(data stored in ACNUC8465 zone)

EMBL: AP009510

ID   AP009510; SV 1; circular; genomic DNA; STD; PRO; 1125857 BP.
XX
AC   AP009510;
XX
PR   Project:PRJDA20871;
XX
DT   19-MAR-2008 (Rel. 95, Created)
DT   20-JUL-2020 (Rel. 144, Last updated, Version 7)
XX
DE   Candidatus Endomicrobium trichonymphae Rs-D17 genomovar Ri2008 DNA,
DE   complete genome.
XX
KW   .
XX
OS   Candidatus Endomicrobium trichonymphae
OC   Bacteria; Elusimicrobia; Endomicrobia; Endomicrobiales; Endomicrobiaceae;
OC   Endomicrobium.
XX
RN   [1]
RP   1-1125857
RA   Toyoda A., Hongoh Y., Sharma V.K., Hattori M., Ohkuma M., Sakaki Y.,
RA   Izawa K., Yoshioka T.;
RT   ;
RL   Submitted (01-OCT-2007) to the INSDC.
RL   Contact:Yuichi Hongoh Tokyo Institute of Technology, Department of Life
RL   Science and Technology; 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8550, Japan
XX
RN   [2]
RA   Hongoh Y., Yoshioka T., Izawa K.;
RT   "Revised annotation of the genome of 'Ca. Endomicrobium trichonymphae'
RT   phylotype Rs-D17";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1073/pnas.0801389105.
RX   PUBMED; 18391199.
RA   Hongoh Y., Sharma V.K., Prakash T., Noda S., Taylor T.D., Kudo T.,
RA   Sakaki Y., Toyoda A., Hattori M., Ohkuma M.;
RT   "Complete genome of the uncultured Termite Group 1 bacteria in a single
RT   host protist cell";
RL   Proc. Natl. Acad. Sci. U.S.A. 105(14):5555-5560(2008).
XX
DR   MD5; f40af556ca3528cd845570fdfb2f0cd5.
DR   EMBL-TPA; HG526709.
DR   EMBL-TPA; HG788570.
DR   BioSample; SAMD00232923.
DR   EMBL-TPA; HG526709.
DR   EMBL-TPA; HG788570.
DR   EnsemblGenomes-Gn; EBG00001231117.
DR   EnsemblGenomes-Gn; EBG00001231118.
DR   EnsemblGenomes-Gn; EBG00001231119.
DR   EnsemblGenomes-Gn; EBG00001231120.
DR   EnsemblGenomes-Gn; EBG00001231121.
DR   EnsemblGenomes-Gn; EBG00001231122.
DR   EnsemblGenomes-Gn; EBG00001231123.
DR   EnsemblGenomes-Gn; EBG00001231124.
DR   EnsemblGenomes-Gn; EBG00001231125.
DR   EnsemblGenomes-Gn; EBG00001231126.
DR   EnsemblGenomes-Gn; EBG00001231127.
DR   EnsemblGenomes-Gn; EBG00001231128.
DR   EnsemblGenomes-Gn; EBG00001231129.
DR   EnsemblGenomes-Gn; EBG00001231130.
DR   EnsemblGenomes-Gn; EBG00001231131.
DR   EnsemblGenomes-Gn; EBG00001231132.
DR   EnsemblGenomes-Gn; EBG00001231133.
DR   EnsemblGenomes-Gn; EBG00001231134.
DR   EnsemblGenomes-Gn; EBG00001231135.
DR   EnsemblGenomes-Gn; EBG00001231136.
DR   EnsemblGenomes-Gn; EBG00001231137.
DR   EnsemblGenomes-Gn; EBG00001231138.
DR   EnsemblGenomes-Gn; EBG00001231139.
DR   EnsemblGenomes-Gn; EBG00001231140.
DR   EnsemblGenomes-Gn; EBG00001231141.
DR   EnsemblGenomes-Gn; EBG00001231142.
DR   EnsemblGenomes-Gn; EBG00001231143.
DR   EnsemblGenomes-Gn; EBG00001231144.
DR   EnsemblGenomes-Gn; EBG00001231145.
DR   EnsemblGenomes-Gn; EBG00001231146.
DR   EnsemblGenomes-Gn; EBG00001231147.
DR   EnsemblGenomes-Gn; EBG00001231148.
DR   EnsemblGenomes-Gn; EBG00001231149.
DR   EnsemblGenomes-Gn; EBG00001231150.
DR   EnsemblGenomes-Gn; EBG00001231151.
DR   EnsemblGenomes-Gn; EBG00001231152.
DR   EnsemblGenomes-Gn; EBG00001231153.
DR   EnsemblGenomes-Gn; EBG00001231154.
DR   EnsemblGenomes-Gn; EBG00001231155.
DR   EnsemblGenomes-Gn; EBG00001231156.
DR   EnsemblGenomes-Gn; EBG00001231157.
DR   EnsemblGenomes-Gn; EBG00001231158.
DR   EnsemblGenomes-Gn; EBG00001231159.
DR   EnsemblGenomes-Gn; EBG00001231160.
DR   EnsemblGenomes-Gn; EBG00001231161.
DR   EnsemblGenomes-Gn; EBG00001231162.
DR   EnsemblGenomes-Gn; EBG00001231163.
DR   EnsemblGenomes-Gn; EBG00001231164.
DR   EnsemblGenomes-Gn; EBG00001231165.
DR   EnsemblGenomes-Gn; EBG00001231166.
DR   EnsemblGenomes-Gn; EBG00001231167.
DR   EnsemblGenomes-Gn; TGRD_16SrRNA01.
DR   EnsemblGenomes-Gn; TGRD_23SrRNA01.
DR   EnsemblGenomes-Gn; TGRD_5SrRNA01.
DR   EnsemblGenomes-Gn; TGRD_tRNA01.
DR   EnsemblGenomes-Gn; TGRD_tRNA02.
DR   EnsemblGenomes-Gn; TGRD_tRNA03.
DR   EnsemblGenomes-Gn; TGRD_tRNA04.
DR   EnsemblGenomes-Gn; TGRD_tRNA05.
DR   EnsemblGenomes-Gn; TGRD_tRNA06.
DR   EnsemblGenomes-Gn; TGRD_tRNA07.
DR   EnsemblGenomes-Gn; TGRD_tRNA08.
DR   EnsemblGenomes-Gn; TGRD_tRNA09.
DR   EnsemblGenomes-Gn; TGRD_tRNA10.
DR   EnsemblGenomes-Gn; TGRD_tRNA11.
DR   EnsemblGenomes-Gn; TGRD_tRNA12.
DR   EnsemblGenomes-Gn; TGRD_tRNA13.
DR   EnsemblGenomes-Gn; TGRD_tRNA14.
DR   EnsemblGenomes-Gn; TGRD_tRNA15.
DR   EnsemblGenomes-Gn; TGRD_tRNA16.
DR   EnsemblGenomes-Gn; TGRD_tRNA17.
DR   EnsemblGenomes-Gn; TGRD_tRNA18.
DR   EnsemblGenomes-Gn; TGRD_tRNA19.
DR   EnsemblGenomes-Gn; TGRD_tRNA20.
DR   EnsemblGenomes-Gn; TGRD_tRNA21.
DR   EnsemblGenomes-Gn; TGRD_tRNA22.
DR   EnsemblGenomes-Gn; TGRD_tRNA23.
DR   EnsemblGenomes-Gn; TGRD_tRNA24.
DR   EnsemblGenomes-Gn; TGRD_tRNA25.
DR   EnsemblGenomes-Gn; TGRD_tRNA26.
DR   EnsemblGenomes-Gn; TGRD_tRNA27.
DR   EnsemblGenomes-Gn; TGRD_tRNA28.
DR   EnsemblGenomes-Gn; TGRD_tRNA29.
DR   EnsemblGenomes-Gn; TGRD_tRNA30.
DR   EnsemblGenomes-Gn; TGRD_tRNA31.
DR   EnsemblGenomes-Gn; TGRD_tRNA32.
DR   EnsemblGenomes-Gn; TGRD_tRNA33.
DR   EnsemblGenomes-Gn; TGRD_tRNA34.
DR   EnsemblGenomes-Gn; TGRD_tRNA35.
DR   EnsemblGenomes-Gn; TGRD_tRNA36.
DR   EnsemblGenomes-Gn; TGRD_tRNA37.
DR   EnsemblGenomes-Gn; TGRD_tRNA38.
DR   EnsemblGenomes-Gn; TGRD_tRNA39.
DR   EnsemblGenomes-Gn; TGRD_tRNA40.
DR   EnsemblGenomes-Gn; TGRD_tRNA41.
DR   EnsemblGenomes-Gn; TGRD_tRNA42.
DR   EnsemblGenomes-Gn; TGRD_tRNA43.
DR   EnsemblGenomes-Gn; TGRD_tRNA44.
DR   EnsemblGenomes-Gn; TGRD_tRNA45.
DR   EnsemblGenomes-Tr; EBT00001576625.
DR   EnsemblGenomes-Tr; EBT00001576626.
DR   EnsemblGenomes-Tr; EBT00001576627.
DR   EnsemblGenomes-Tr; EBT00001576628.
DR   EnsemblGenomes-Tr; EBT00001576629.
DR   EnsemblGenomes-Tr; EBT00001576630.
DR   EnsemblGenomes-Tr; EBT00001576631.
DR   EnsemblGenomes-Tr; EBT00001576632.
DR   EnsemblGenomes-Tr; EBT00001576633.
DR   EnsemblGenomes-Tr; EBT00001576634.
DR   EnsemblGenomes-Tr; EBT00001576635.
DR   EnsemblGenomes-Tr; EBT00001576636.
DR   EnsemblGenomes-Tr; EBT00001576637.
DR   EnsemblGenomes-Tr; EBT00001576638.
DR   EnsemblGenomes-Tr; EBT00001576639.
DR   EnsemblGenomes-Tr; EBT00001576640.
DR   EnsemblGenomes-Tr; EBT00001576641.
DR   EnsemblGenomes-Tr; EBT00001576642.
DR   EnsemblGenomes-Tr; EBT00001576643.
DR   EnsemblGenomes-Tr; EBT00001576644.
DR   EnsemblGenomes-Tr; EBT00001576645.
DR   EnsemblGenomes-Tr; EBT00001576646.
DR   EnsemblGenomes-Tr; EBT00001576647.
DR   EnsemblGenomes-Tr; EBT00001576648.
DR   EnsemblGenomes-Tr; EBT00001576649.
DR   EnsemblGenomes-Tr; EBT00001576650.
DR   EnsemblGenomes-Tr; EBT00001576651.
DR   EnsemblGenomes-Tr; EBT00001576652.
DR   EnsemblGenomes-Tr; EBT00001576653.
DR   EnsemblGenomes-Tr; EBT00001576654.
DR   EnsemblGenomes-Tr; EBT00001576655.
DR   EnsemblGenomes-Tr; EBT00001576656.
DR   EnsemblGenomes-Tr; EBT00001576657.
DR   EnsemblGenomes-Tr; EBT00001576658.
DR   EnsemblGenomes-Tr; EBT00001576659.
DR   EnsemblGenomes-Tr; EBT00001576660.
DR   EnsemblGenomes-Tr; EBT00001576661.
DR   EnsemblGenomes-Tr; EBT00001576662.
DR   EnsemblGenomes-Tr; EBT00001576663.
DR   EnsemblGenomes-Tr; EBT00001576664.
DR   EnsemblGenomes-Tr; EBT00001576665.
DR   EnsemblGenomes-Tr; EBT00001576666.
DR   EnsemblGenomes-Tr; EBT00001576667.
DR   EnsemblGenomes-Tr; EBT00001576668.
DR   EnsemblGenomes-Tr; EBT00001576669.
DR   EnsemblGenomes-Tr; EBT00001576670.
DR   EnsemblGenomes-Tr; EBT00001576671.
DR   EnsemblGenomes-Tr; EBT00001576672.
DR   EnsemblGenomes-Tr; EBT00001576673.
DR   EnsemblGenomes-Tr; EBT00001576674.
DR   EnsemblGenomes-Tr; EBT00001576675.
DR   EnsemblGenomes-Tr; TGRD_16SrRNA01-1.
DR   EnsemblGenomes-Tr; TGRD_23SrRNA01-1.
DR   EnsemblGenomes-Tr; TGRD_5SrRNA01-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA01-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA02-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA03-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA04-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA05-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA06-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA07-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA08-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA09-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA10-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA11-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA12-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA13-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA14-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA15-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA16-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA17-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA18-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA19-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA20-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA21-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA22-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA23-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA24-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA25-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA26-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA27-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA28-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA29-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA30-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA31-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA32-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA33-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA34-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA35-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA36-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA37-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA38-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA39-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA40-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA41-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA42-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA43-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA44-1.
DR   EnsemblGenomes-Tr; TGRD_tRNA45-1.
DR   EuropePMC; PMC2291132; 18391199.
DR   EuropePMC; PMC5561302; 28646115.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP009510.
DR   SILVA-SSU; AP009510.
XX
CC   The wood-feeding termite Reticulitermes speratus (Isoptera;
CC   Rhinotermitidae) was collected in Saitama, Japan. The entire gut
CC   was removed from a worker termite, and a single cell of the
CC   cellulolytic protist Trichonympha agilis (Parabasalia;
CC   Trichonymphida) in the gut was physically isolated by using a
CC   micromanipulator. In order to collect the intracellular symbionts
CC   of T. agilis, as-yet-uncultivated bacteria designated phylotype
CC   Rs-D17 belonging to the candidate division Termite Group 1, the
CC   host T. agilis cell was ruptured in buffer and bacterial cells
CC   which leaked out were collected with a glass capillary. These
CC   collected cells were directly subjected to isothermal whole genome
CC   amplification. After checking their purity by clone analysis of
CC   16S rRNA gene and its adjacent ITS, the complete genome sequence
CC   was determined using ABI 3730 capillary sequencers and a GS20
CC   system.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1125857
FT                   /organism="Candidatus Endomicrobium trichonymphae"
FT                   /host="Trichonympha agilis"
FT                   /strain="Rs-D17 genomovar Ri2008"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="a single cell of termite (Reticulitermes
FT                   speratus) gut protist"
FT                   /db_xref="taxon:1408204"
FT   CDS_pept        1..620
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_1-1"
FT                   /note="pseudogene of chromosomal replication initiator
FT                   protein DnaA"
FT                   /pseudogene="unitary"
FT   CDS_pept        982..2259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_001"
FT                   /product="DnaA-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_001"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13484"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ02"
FT                   /protein_id="BAG13484.1"
FT                   /translation="MWNEIIEELTKEIPTIWLEGVKEKSYKDNILTLDVPNSTYAERYG
FT                   TKYKELIQNVIKAKTGKDIGLQCQIELLLEPVMKDEKPKATMTKTPLIKSKEFNDKPYY
FT                   KNYKEIALVAEETKQIKIKKDNIKKTELTSMPTKYGIENVATFNLFNSKMFTYPNDKRK
FT                   KAKVSMKIRFNDGTSKEYELYRGQIARHNDTGTGQLTTTHAKIFLAITHIWQEQKSRFA
FT                   NDSYCVVVDTSLTEIAKKLGYKKVSGSDRSRILQKIKEMVYFYMMVSDGVRDCGFSLLN
FT                   NIIVLDKEDRKENNYKSTIRISISPFVSKQLYDRKIIMRKPQCYKIKNPTAIKFLLCYD
FT                   KRIVAGNSLRMNISEVANDLEINISTNKSMIIEVLNNALKELNGYELNDIYNLKAEIAK
FT                   VGKEWIVIAERILKEKTTIIKGELQN"
FT   CDS_pept        3878..5134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_002"
FT                   /product="DnaA-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_002"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13485"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ03"
FT                   /protein_id="BAG13485.1"
FT                   /translation="MWNEIITELKEKIPTEWLEPIKEESFKDDILTLAVPDTYYAQKYE
FT                   TDYKSLIQNILKAKTGKAVGLQFQIVASKLLAEPVIKDEKPKTQLMKKTKFNGKPYFKN
FT                   SAELALVARDAIQVKNIDTQNAELTSMPSKYGIKDVVSFCLFNSKMFTYPNDKRKKVKV
FT                   SMDVRFSNGTLKTFDLYRGQITFNDVGRGQLTTTHAKIFLAIIHIWQEQGCKFADNKGF
FT                   YAVVDISMRELAKRLGYQKLSGADVKRLTVLTNDLVDFPMILSDGYTAYTFTFLFDVVT
FT                   RTFKKSRSNRTMLRLTINPFISKQFYDRKVFLRNPQCYKIKNPTAIKFLLCYDKRIVKG
FT                   NGLKLNISEVANDLEILTEQKSIVAEHLGNAFQELNGYELNDRYRLYVELVKEEREWIV
FT                   VAERILKEKTTIIKSELQN"
FT   CDS_pept        6071..6520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_003"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13486"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ04"
FT                   /protein_id="BAG13486.1"
FT                   /translation="MKLKKAVCVYLTLVLFLTGCGNLKSQIRGNQNTDASADQPTGNII
FT                   KSDNNEIIEKEETKKLDDKVIGLVVVGDEKEKTSSKEPELMWQDKTKKYAGDAGHFLYE
FT                   HKGKIAFAVVVATSVYWFGIRPINGLPAQPEVLQLRQRQALQQYQ"
FT   CDS_pept        7264..7985
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_1-2"
FT                   /note="pseudogene of chromosomal replication initiator
FT                   protein DnaA"
FT                   /pseudogene="unitary"
FT   CDS_pept        8206..9327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_004"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_004"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13487"
FT                   /db_xref="GOA:B1GZ05"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ05"
FT                   /protein_id="BAG13487.1"
FT                   /translation="MKVICEKEELMRGIQMVSPVTPSKNTLPALSNILFEAERDKIKLS
FT                   STDLEIAVQCYIKGEITEDGGITIPSKRFANIIKELSTDDEIEIKADETNQINIKSGKS
FT                   KFNLMGISKTEYPVIPEPPKNNNFTIKRGIFASMLKKIVFAASRDSQRYVLNGIYFILG
FT                   DSKLTMVATDGRRLAYAKTNITQAEVKGKAIVPTKAVNDILRLLYSDINSEDMRIGISD
FT                   NRISAEIDDITLLSTLIEGVFPNYEQVIPKKSDLKIKLNVKNTLTAVKQMALLTDNHLS
FT                   SDRSSAVKFYFSQDLLKISASSAGIGSGETDLEIEYKNDPAEINFNPDFIKEIFQSIDE
FT                   YSAIFEFTNSLNPAVIYPETDENYLCVVMPMRV"
FT   CDS_pept        9654..12146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_005"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13488"
FT                   /db_xref="GOA:B1GZ06"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ06"
FT                   /protein_id="BAG13488.1"
FT                   /translation="MANKEVKNESSEKDGYSASNIQILEGLEAVRKRPAMYIGSTGSQG
FT                   LHHLVYEVVDNSIDEVLAGYCKNIDVTVHSDNSITVLDDGRGIPVDPHPDPKFKGVSAL
FT                   EIVLTKLHAGGKFDKNSYKVSGGLHGVGVSCVNALSDLLKAEVYRNGKVYVQNYSKGKP
FT                   LCPVKESGVTEERGTKVTFHPDPEIFSVMKYSFDTLANRLRELAFLNAGTRIRISDERD
FT                   DDKEHIFDYNGGIKTFVQYLNTNKNVINKDPIYFVKEKDDVYVEIAMQYNDSYNELIFT
FT                   FVNNINTVEGGTHLSGFRSALTRSVNEYIKKNEVSKIKDLKLSGEDVREGLTAIISIKV
FT                   QDPQFEGQTKTRLGNSEVEGIMQSVVGDALTTFLEENPGIASQILDKAINAAEAREAAR
FT                   KARELTRRKGALDSASLPGKLADCSERDPQKTELFIVEGDSAGGSAKQGRDRSFQAILP
FT                   LKGKILNVEKSRLTKILANDEIRTLITAIGAGIGKEEQDFNINKVRYHKIIIMTDADVD
FT                   GAHIRTLLLTFFYRQMPQLLDRGYIYIAQPPLYKVRRNKREMYLDSEEELDKFLFQQAL
FT                   DGLSMSLIRDGVEVKEIDYKSLHKIVANISELDILLKKLWKKGVSWKEYLRFKKEGKLP
FT                   LYRAMKDGSVKYIYSDKEWKEFKDPLLEKRRELLASQGELDEITENLKTDEVMPEYKDL
FT                   WELPRVDNLAEQLEEEGLHPEHYSETHAKPVYRLQDTEKKVQGEIYELYSTTELIETIR
FT                   ELGNKGATIQRYKGLGEMNPEQLWETTMDIKNRKLLQITLEDAIETDRVFTTLMGDQVE
FT                   PRRLFIQTHALDVRNLDI"
FT   CDS_pept        12928..15435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_006"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13489"
FT                   /db_xref="GOA:B1GZ07"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ07"
FT                   /protein_id="BAG13489.1"
FT                   /translation="MPKEKNIKDEQEILPVSIVPRNIEDEMKNSYIDYAMSVIVGRALP
FT                   DVRDGLKPVHRRILYAMKEMGLKHNTAYKKSARIVGDVLGKYHPHGDSAVYGAMVRMVQ
FT                   DFSLRYPMIDGQGNFGSIDGDFAAAMRYTEVRMDTITDEMLVDLDKNTVDFIPNYDGSL
FT                   KEPVILPTKLPSLLINGSAGIAVGMATNIPAHNIVEVSDALVTLIDDKEISVSEIVKYI
FT                   KGPDFPTGAIILGKSGIKDYMEKGRGSVKIRAKTEIEEVKSGREAIIVNEIPYQVNKAN
FT                   LITSIADLVKDKKIDGIADLRDESDRDGIRIVIEIKRDANVQVVLNQLYKHTQMQLSFG
FT                   VIMLALVNNRPKVMNVKEILIHHIEHRKVIIIRRTKFDLQKAEARFHILEGLKIAIDNI
FT                   DAVIKIIKESADEDNARVSLMSKLRLTKIQTEAILEMKIRQLTGLKRKEIDDEYLELIR
FT                   LIEKLRSVLADPKKVLDIIKNEALDIKRKYGDKRRTQIQAAEADFNIEDLIQEEEVAVT
FT                   MSHAGYIKRIPLDTYKAQHRGGRGIAAMNTREEDFVENLFITSSHSYMLFFTTRGRLYW
FT                   MRIYEIPEGARTSKGKAIVNLLQLQGTEEKITAAIPIRSFNPEYTKDEYLLMCTRNGII
FT                   KKIALDKFINPRKRGIIAIKLEDGDILTEVKAINKNPEVVIATKKGSSIRFKESDIRVI
FT                   GRAGRGVKGIELKKGDEVIGMEVFSPDDVFLSISENGYGKRTKVGKYRLQKRAGHGVIN
FT                   MQMSERNGNMIGIKKANDGEEVMIITQNGITIRLRVNSISVIGRNTQGVRLVRLDAGDK
FT                   VAAIACVVKDENSEEPQCYCKES"
FT   CDS_pept        complement(15723..17126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_007"
FT                   /product="aromatic amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_007"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13490"
FT                   /db_xref="GOA:B1GZ08"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ08"
FT                   /protein_id="BAG13490.1"
FT                   /translation="MKQPQEGNLKRKLKNRHIQFIVIGGAIGTGLFLGTGEAIFKAGPA
FT                   VILGYLIAGISIFLTMRQLGEMETEEPMTGSFSYFAYKYWGKFPGFLSGWNYWIQYVLV
FT                   GIAELTAVAAYAQYWFPTLATWKTALLFFILINAINLTAVKAYAEIEFWFSIIKVTAIC
FT                   AMILAGGYILIINPGLVDGATIKNLWMAATIGEHTGDPALSGFFPHGIIGLLAAIPMIT
FT                   FAFGGLELIGITAAETADPQKTIPKAVNQVVFRILFFYIGSIIVLLALYHWSNLHTTDS
FT                   PFVMIFDKTGFKHAAWALNFVILSAALSVYNSCIYSNSRTLYGLALQNNAPQIFAKTTK
FT                   KGVPVAAQMLSGVLTFLVVPLNYFMPNWVDAFQTVISFVVVCILINWGLIAMSHIKFKK
FT                   QKNLENHKTLFPSPLYPYTNYLIFAFILFILIVMAKFCGCTRQTIAVPLWILIVYALYK
FT                   VQNIRNEKS"
FT   CDS_pept        17928..18346
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_2"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(18880..23094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_008"
FT                   /product="CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_008"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13491"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ09"
FT                   /protein_id="BAG13491.1"
FT                   /translation="MGSAGIDIGSTTVKLSILNKNNEPIYCNYKRHQSDLLNTIISLID
FT                   ETPEKLKTTNLTICTTGSGAIDLSRKANIYFEQEVIACTKAIKTFLPKVDVAIELGGED
FT                   AKITFFDNASTDQRMNETCAGGTGAFIDQMAQTLKTDAAGINKLSKNHKTVYPIAARCG
FT                   VFAKTDIMPLLNDGVSKEDIAASILQAVVNQTIGGLARGHTIRGNVCFLGGPLFFLSEL
FT                   RNFFIKSLKLKPENVFSPDNAHFFVSFGAALLGKGDKITLKSLKEKFKSLKYKPLRSAS
FT                   EVLPPLFVNEKDYEMFIRRHNETPAVKVKDVEGDLFLGVDAGSTTTKSVLINKDKAIAY
FT                   SYYGSNDGTPLQSAINVLKNIYEELPRKAHIAGACITGYGEALIKAALNFDHGEVETIA
FT                   HYKAAYYFNPKVSFILDIGGQDMKCIYVKNGLIDKIALNEACSSGCGSFVQSCAKSMNY
FT                   ELQDFAQLALFAKKPADLGSRCTVFMNSKIKQVQKEGTSAGNISAGLDYSIIKNALYKV
FT                   IKINNPEELGGHIVVQGGTFFNNGVLRATEILLKTEVIRPNIAGLMGAFGSAIIAMQNK
FT                   KYSTSLISKEKLAGFVCKMRNTRCKGCENKCLLNITVFPNGKTFISGNRCENVLQNKKE
FT                   QSFAFNMFDYKYKRLFSYYKPLPLEKAPRGEIGIPRVLNMYENYPFWFAFFTKLGFRVV
FT                   LSDQSSNVLFNSGLDTISSQTVCFPAKMVHGHIENLVEKGIKIIFYPCIPYEVEEFKDV
FT                   ANHYNCPIVGSYPEVIRLNMSALEEKGIKFLQPFLPFDNIKRLIYRLAEELKDFNITKK
FT                   NLVFAILRARAALNLFKKDIRKRGTVLIREIKETKKPAVILAGRPYHIDPAINHGIADL
FT                   IASYKVIVLSEDSVANLSGPLPKISFVDQWMYHSRLYRAANLATKIDSLELIQLNSFGC
FT                   GLDAITMEQTEEILSKSGKIYTVLKIDEGSNLGAAKIRIRSLLAAIKERKGLKFKDTIF
FT                   EGTKVSKFSEFTKDMKDSHTILCPQMSPVHFRLAGSVMRNYGIKLEVLPEVNKADIEEG
FT                   LRYVNNDACYPTIVVVGQLINALKSGRYDINKTAMIISQTGGGCRATNYASFLRKAAEK
FT                   AGFKNVPVISLSTTDSSLNKSLGISFSMLKDTLLILLYGDLLMRLSNRMRPYEVHSGQT
FT                   DALVETWLMRLSDRIGKTLYFDFKNTVKKIVKDFDGIVAQKVKKPRVGIVGEILVKFHP
FT                   YANNNLVSVLEKEEAEIVVPDMTDFINYCILDDIYKHKYLAGSFKNKVMSLIASSYIER
FT                   LRSGIRKTLKKSKHFHSYQTTKDLAHKASDIISVCNQTGEGWLLTAEMLELIEDGVKNI
FT                   VCVQPFGCLPNHITGKGVMKELKRRYNDINIISVDYDPGVSEVNQINRIKLLMSVARQN
FT                   IN"
FT   tRNA            23299..23374
FT                   /locus_tag="TGRD_tRNA01"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   CDS_pept        24367..24873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_009"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_009"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13492"
FT                   /db_xref="GOA:B1GZ10"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ10"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13492.1"
FT                   /translation="MAKLKIKKYGDPALRKRAEAVSEINEIIKELASDMLETMYSASGV
FT                   GLAAPQVGILLRFCVIDVDPNKKSPIVMINPEIISGENKITAEEGCLSFPGFYGNVNRF
FT                   ENIIAGYTDLNGNRQEIKAQNFLAKALQHEIDHLDAKLFIDYLPDWKRESIEKKIKRKK
FT                   KAGDW"
FT   CDS_pept        24870..25808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_010"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13493"
FT                   /db_xref="GOA:B1GZ11"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ11"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13493.1"
FT                   /translation="MRILFFGTAFISETYLKELHKKCHEIFVVTTPDKPALRGQKLIYP
FT                   AVKVYAVKNNISFIQPEKFTLDVIETIKNFAADTGVAVAYGKLIPKVVFDIPKYKTFNI
FT                   HFSLLPKYKGAAPVQHALCRGETETGISSFYIEEGLDTGGIIIQEKLNISIKDNAETLL
FT                   NKLILLGIDVMNKTLELFRCGKCDAASQTGDPSFAPSLKKIDGLVNWNKRAGEIYNQFR
FT                   GLYLWPGIYSTISQGKLVGKRIKFREIEVFDSDSINKDSGIVYSAEKNRGFTVSCAVGR
FT                   ILVVKMQSENKPVVSAWDFIQGRQISAGDRF"
FT   CDS_pept        26002..26334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_011"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_011"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13494"
FT                   /db_xref="GOA:B1GZ12"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ12"
FT                   /protein_id="BAG13494.1"
FT                   /translation="MAVEINKNNFAQEVLSSDKPVLVDFWAPWCNPCKMLSPIIEELAA
FT                   EYEDSVKVGKVNTDENMSLSAKFQIVSIPCLILFKNGKTLHKTVGFRSKNDIKKIIDSA
FT                   LMVGDE"
FT   CDS_pept        26336..26870
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_3"
FT                   /note="pseudogene of DUF4065-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        27703..28611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_012"
FT                   /product="thioredoxin reductase"
FT                   /note="NADPH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_012"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13495"
FT                   /db_xref="GOA:B1GZ13"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ13"
FT                   /protein_id="BAG13495.1"
FT                   /translation="MIYDVIIIGGGPAGLSAAIYASRARLKTLIIEKTGCGGQMTTTDL
FT                   LENYPGFNGGINGFELAVKLEKQARDFGAEIIYDEVGAIEQGLSKKVITANSAYETKTV
FT                   IIAAGTYAKKMNIPGESEFMGRGVSFCAVCDAPFYRDKNVLVVGGGDSAIEEAAYISKF
FT                   AKNVTVVHRRDKLRAAKILQERMKLHPNISVIYDSVPKEIFGSDSVEKVTITNVKTNES
FT                   KGLIIDGVFVFTGLIPNTLFLSGVALDKTGYIITDEDMNTSSTGIFACGDIRKKQLRQV
FT                   VTAASDGAQAAVSAQRCIENL"
FT   CDS_pept        28608..31334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_013"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_013"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13496"
FT                   /db_xref="GOA:B1GZ14"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ14"
FT                   /protein_id="BAG13496.1"
FT                   /translation="MKKFFIIDGNAYIHRAYHALPPLSTSNNRQVNAVYGFVKLLLKIK
FT                   NSFKPDYMAVCFDYPSKNFRHEIFKDYKANRKPLDKALISQMPIAREAVKALNVVGIEI
FT                   KGYEADDLIATVTGNNKGSGVQTVIVTGDKDILQLAEDETVLIWNYSKDIMYDTKKVEE
FT                   KYGVAPKQLSDIFALMGDASDNIPGIKGIGEKTAVKLIEKFGNLENVLQNADSVKGNMG
FT                   KLLSHGKEQALLSRKLIELNRRVPLDYKLGEFESKDIDAGKAVSFFEKYEFKSLLAKYS
FT                   VKEHELQFPVILNETHRNEEAGSGSFVTDKPVFEVVNSQERAAEVAEKIEQAGIFALKT
FT                   VRSTLDSLKTRIVGISLCVENKAFYFPIGHNDLTARQVIFEDFKDIFAPLFFSDKIKKI
FT                   GHDLKQERNIYSMSGVGLNNIYFDIMLASYCLNPAKSHCITDMSKEYLDFTAGVGSYAW
FT                   KGSKKSSFANSSIEAGAKYANSISAAVFAIYKIFDFQIKEKKLSLLFFDTEMSLVEILS
FT                   EMEISGIKVDLPFLRNFNEKIVYELKIIENNIYKIAGIEFNINSQKQLSSVMFEKLNLP
FT                   VIKKTKTGYSTDEEVLVELSSHEFPAEILKYRELQKLKSTYIDPLTDYCVYYGSRIHTI
FT                   FNQAVTTTGRLSSTEPNLQNIPVKSAYGKEFRKAFVPERNKIFISADYSQIDLRVLAHI
FT                   SQDTKFIEAFKAGTDIHSATAREIFNIPEGYPLTDSLRSAAKSINFGIIYGMSPFGLSK
FT                   QLNIPFGKAKEYIDGYFERYDKVKFWMEQIVKQASEDGYVRTITGRIRYIPELRSTNAQ
FT                   VRKAGERMALNTPVQGSSADIIKIAMISVYNEIKLKGYKSLMLLQVHDDLLFEVPDGES
FT                   ENMISIIKNKMENPLHLSIPIVVDIKAGRNWGEMKKI"
FT   CDS_pept        31331..31930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_014"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_014"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13497"
FT                   /db_xref="GOA:B1GZ15"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ15"
FT                   /protein_id="BAG13497.1"
FT                   /translation="MIIGLTGGIAAGKSESAKYFESLGACAIDADVIAHELTAKGMPAL
FT                   DELSKSFGGSILLSSGDLNRKKLADIIFSDEKAKLRIEKIIHSHIISRINEIISQNIMR
FT                   SNIVIDAPLLFEVGLDRICDKSAVVRVSYNIQVERLVLRDKLNADQAKRRISSQMPMEK
FT                   KVELADFVIDNSGSKENLKKRVKDLYKLLTSEVKII"
FT   CDS_pept        32096..33388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_015"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_015"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13498"
FT                   /db_xref="GOA:B1GZ16"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ16"
FT                   /protein_id="BAG13498.1"
FT                   /translation="MEKGKSSMDVSVLSKRTMAELIEIAKSFKVDSVAGLRKQELIAKI
FT                   FEAQTKENKSVYDEGVLEILPDGFGFLRSPDYNYLPGPDDIYISPSQIKKFALRKGDTV
FT                   AGYVRPPQSQQERYFALLQVRSINGQENLENIRDRDLFDNLTPLYPDEKMVLETKKEEI
FT                   SMRIIDMLVPIGKGQRVLINAAPRTGKTVLLQKIANAVTKNNPDIVLMVLLIDERPEEV
FT                   TDMQRSVKGEVISSTFDEPSDRHIQVAEMVIEKAKRIVENGKHVVVLLDSITRLARAYN
FT                   TAMPSSGRILSGGLDSNALQRPKRFFGAARNIEEGGSLTIIGTALVETGSRMDDVIFEE
FT                   FKGTGNCEIYLDRKLADRRIFPSIDLLRSGTRKEELLLSEDEKNKMWILRKWMNSMNSI
FT                   EVMEELSKRLLNSKSNKDFLKQMELSSMERL"
FT   CDS_pept        33481..34038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_016"
FT                   /product="DUF4065-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_016"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13499"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ17"
FT                   /protein_id="BAG13499.1"
FT                   /translation="MNLEKIIQIVNYVLQKYDFSLNYTKLLKLLYIADRECLDRWNFTI
FT                   SEDNYAAMKQGMVLSGLYDFIRGNADKLSQVKWDSYFYRDNYDLRSRHRENCSYDELSE
FT                   AEKEMLDEVDKKYHFKSWDYLVNEVVHKFPEWKEVEAEIGNSSLKIEKEKILSVLDRDE
FT                   REIKEIISSENAYEKCKNDLKG"
FT   CDS_pept        34044..34434
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_4"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   tRNA            34638..34727
FT                   /locus_tag="TGRD_tRNA02"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   CDS_pept        complement(34837..37409)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_5"
FT                   /note="pseuogene of type III restriction-modification
FT                   system, restriction subunit"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(37424..39068)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_6"
FT                   /note="pseuogene of RloC-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(39111..41005)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_7"
FT                   /note="pseuogene of type III restriction-modification
FT                   system, methylase subunit"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(41391..41544)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_8"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(41683..41866)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_9"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(42292..42475)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_10"
FT                   /note="pseudogene of endonuclease-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(42522..43154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_017"
FT                   /product="ribonuclease HII"
FT                   /note="RNase HII"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_017"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13500"
FT                   /db_xref="GOA:B1GZ18"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ18"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13500.1"
FT                   /translation="MFSNIFSFDRNFYNKGFYPVAGIDEAGRGPLAGPVVAAVVILPKD
FT                   SAIPYLNDSKQLSEKKREILFEIIKETALDYAVELVNNEIIDEINILQATFLAMSRAVL
FT                   KLKTQPDLYLIDGNRKVHGLSFNQETIVGGDAKSACIAAASILAKVSRDKMMLEYAKQY
FT                   PVYEFEKHKGYGTKKHIEALKKHGICPIHRLTFSPVNDIISQTKLNI"
FT   CDS_pept        complement(43643..44041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_018"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_018"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13501"
FT                   /db_xref="GOA:B1GZ19"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ19"
FT                   /protein_id="BAG13501.1"
FT                   /translation="MSLSLLAQVQIAQKRDLGVSFKSGDQIKVHFKIIEGGNERIQIFE
FT                   GIVIRIKGSGLSKTFTVRKISFGIGVERIFPIHSPRIDKIEVVRRGKVRRAKLYYLRNL
FT                   SGKAARISEYSSRRNLKKETVNQVPAAN"
FT   CDS_pept        complement(44187..44888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_019"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_019"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13502"
FT                   /db_xref="GOA:B1GZ20"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ20"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13502.1"
FT                   /translation="MKIDVLTIFPGMFKGPLTESLIGKAIEKEILKINIIDIRSFSKDK
FT                   HKKVDDKSFGGGCGMVMKLEPLYDAIKSTGVKKKNSTYKNPYTKPYVIYMSPQGRILSD
FT                   SIVKNLAKFKQLVIICGHYEGVDERTMNYVDEEISIGDYILTGGEIPAMVLIDSTARML
FT                   TGVVKEKSSVKNDSFYNNLLDYPHYTRPAVFKGYKIPEVLLSGDHKKISEWRVQESYKR
FT                   TKERRPDLLKK"
FT   CDS_pept        complement(44878..45189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_020"
FT                   /product="RimM-like PRC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13503"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ21"
FT                   /protein_id="BAG13503.1"
FT                   /translation="MDSKKRDLKWKVSDILGFEVFNQNGKRLGILSDIILTGSNDVWVV
FT                   KYYNEEVLIPALKNIVKEVNVIRKKIFVILPKEYEYIYSQVKLADDVLEYNGYFVYED"
FT   CDS_pept        complement(45194..45424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_021"
FT                   /product="KH-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_021"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13504"
FT                   /db_xref="GOA:B1GZ22"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ22"
FT                   /protein_id="BAG13504.1"
FT                   /translation="MKDLVLFIAKALVDNPDQVEVREVTGEKATVLELKVAEGDRGKII
FT                   GKEGRIIKAIRVIINSASAKLDKRATVEVVE"
FT   CDS_pept        complement(45460..45714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_022"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_022"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13505"
FT                   /db_xref="GOA:B1GZ23"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ23"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13505.1"
FT                   /translation="MAVRLRLQRRGKPKRPYYRVVAIDQRAKRDGEPIEILGQYDPIAE
FT                   DNKFKVNIERINYWLGIGAKASETVAALIKKNQTVEIKQ"
FT   tRNA            complement(45896..45987)
FT                   /locus_tag="TGRD_tRNA03"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   CDS_pept        46149..47039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_023"
FT                   /product="bifunctional 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/5,10-methylene-tetrahydrofolate FolD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_023"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13506"
FT                   /db_xref="GOA:B1GZ24"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ24"
FT                   /protein_id="BAG13506.1"
FT                   /translation="MKLIDGKKISSDKRAEIKEEVAKIKQQTEKIPGLATVLVGGDPAS
FT                   RVYIKSKIKACEDAGIKSFHHNLDANSSKEEIIALIKKLNENSEIDGILLQLPLPQNKD
FT                   AQECLNAVSPLKDVDGLHPFNAGLLNLSKSWNEIIEKNILVSCTPLGVVHILHKSGIII
FT                   EGKTAVVIGRSNLVGKPLSMLLLANNATVIMAHSKTRNLKEICKSADIVVAAVGKSKFV
FT                   NKDFIKTGAVVIDVGINRTSEGLCGDVDFDAVKDMDIKITPVPGGVGPMTITMLLENTL
FT                   KAFNNRKRYLSNRMP"
FT   CDS_pept        47298..47771
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_11"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(47904..49175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_024"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_024"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13507"
FT                   /db_xref="GOA:B1GZ25"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ25"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13507.1"
FT                   /translation="MLDIKVIRENVKEVKQAMLNRNLDISFDQLLNWDSERKTIIGKIE
FT                   QLRLKRNKESEEIGRLKKESKEPPAELLAEINKVRDIIQEQEKQLLTIEKHIEDFLLRI
FT                   PNIPDKSVPVGKDEKDNKIIRFVGKPEKFSFKPKYHWEIGEKLGIIDFAAASKISGPHF
FT                   AVLKNEGSALERAIISFFLDKHKEKGYKEITTPYLVNRASMTGTGQLPNLEEDSFKCAI
FT                   DDLYLIPTAEVPVTNIYRDDVLEESALPQKYVSYSACFRRESGSYGKDTKGLIRNHQFD
FT                   KVELVKFAKPETSSEELESLVLDAGNVLELLGLPYRVVLLSTGDIGFSSSKTYDLEVWF
FT                   AGYGIYREISSCSNLKDFQARRMNIKVKYSQNKKRELLHTLNGSGVAVGRTFAAILENY
FT                   QQEDGSVVIPNSLREYTGFDIIKP"
FT   CDS_pept        complement(49565..53089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_025"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_025"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13508"
FT                   /db_xref="GOA:B1GZ26"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ26"
FT                   /protein_id="BAG13508.1"
FT                   /translation="MAAEFVHLHNHTEYSLLDGACRLIDDKGKPGELFNLIAKEYKMPA
FT                   LAITDHGNMYGAMEFYLAAKQSGIKPIIGCEIYVAPKSRFDKKNINRITEDNVNYHHLT
FT                   LLAKDFEGYQNLMRIVSAGFTEGFYYKPRVDKEVLKKYRCGLIALSGCLAGEVASALVK
FT                   GNKKKAQNAAIEYRDIFDKDNFYIEIMDNGLETQKKIIPSLIELSKSAAIPLVATNDCH
FT                   FLKKEDAEVHDILLCIGTGKMLNETKRLHFDSDLFYYRSAEDMIKTFSSVPEAIKNTLE
FT                   IAEKTNLEINTDKLLLPQFPIPKEYKSDSEYLETLCRRGLAARYDTIKPEHEERLKHEL
FT                   SVINKMGFASYFLIVSDFIKYAKDHRIPVGPGRGSGSGAMVAYTLGITDICPLKYGLLF
FT                   ERFLNPDRRSMPDLDIDFADYGRDEVIQYVRRKYGEEKCAQIITFGSMQSRLVIKDVAR
FT                   VMGFTPAESNNIAKLIPQNASIAEALQASTDLSKLVKADEKIAKLIAASQKLEGLKRHT
FT                   GVHAAGMVIANKEITSYSPLAKGSKDIVTTQYDGGVLPQLGLLKIDFLGLKTLTIIDDC
FT                   VKFIREKNPSFNLDNIPLDDKKTYELLGEAKTMGIFQLESIGMRDLIKKLKPSNIDDII
FT                   ALIALYRPGPMGSGMLDNFVNRKHGRTKIVYDHPLQESILKDTYGVILYQEQVMKMSVA
FT                   LAGFTPGEADSLRKAMSKKIPEVIEKQREKFVRGTKEKGVNKKISEKIFNNIVAFGGYG
FT                   FNKSHSAAYGIISYKTAYLKANYPLEYITALCNNEIGRPATKNNEESKLVAYLGDALAF
FT                   DIKVLPPDVQYSDGKFKTEDKNIRFGMLAVKNVGKGVTDSIEQSRIENGQLKSFKDWVD
FT                   FLQRIDLKSINKKALESLIKAGVFDSFGKDKFTIRGRLIQNIDSYADKAAKVKQYRESL
FT                   QGFLFDNVKTITDDILSLQEVKPLEPLEALNFEKEVLGFYISGHPLTHRKKDIIAYSNY
FT                   RLDKLPQLKENADRKTVRIAGMIVSVKKLTSTTRKEPYARFKIEDLHGNVNALLFPKNF
FT                   EKFGGYLTLNNIVVIKGWLTNMQGQLEMITEDIMTIDEAKKKSPSKCDEIRIKFSAASF
FT                   NVALEEELKKIFKIHTGKTKVYLILEDSLHGNFSIETEYLSDCSDNFINDVETIIGVKD
FT                   SVELHYTN"
FT   CDS_pept        53699..54268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_026"
FT                   /product="conserved membrane protein LemA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_026"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13509"
FT                   /db_xref="GOA:B1GZ27"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ27"
FT                   /protein_id="BAG13509.1"
FT                   /translation="MLTTAMTTFIVLIVLAGLYILLTYNRFVMLKNRVKEAWSDIEVQM
FT                   KRRYDLIPNLVETVKGYASHEKNTLDAVIKARNAAMQSTGNIADKAQSENALSGTLKSL
FT                   FALSESYPKLKANENFLELQRELTDTENKIQSSRRFYNSNVLAVNTKLELFPSNIIGGA
FT                   FGFTKQDFFKLDDTEQDAKKNVKVSF"
FT   CDS_pept        54382..55386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_027"
FT                   /product="M48 family protease"
FT                   /note="protease (peptidase M48 family)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_027"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13510"
FT                   /db_xref="GOA:B1GZ28"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ28"
FT                   /protein_id="BAG13510.1"
FT                   /translation="MTNITTYDFISSNSRKTVWLMILFPISLAVIVYLIILLASAVVAV
FT                   DNSQIYNRVSVLAVANQTAAHVLPVVSVIAILWVLISYYAGQNFVLSVVGAVELTKKNA
FT                   PEVIRTVENVAVAAGLPVPKIYAINDEALNAFATGRDPTHSYIVLTKGIINKLEKPELE
FT                   GVIAHEMSHIGNRDIRLMLIMIVCISFATVVAELLLRFVLTAKINKSKNNNSSAAVQIF
FT                   LFALATAFYMYGYLIAPLIKFAVSRTREFQADATAALITRNPQGLIDALKKISGNSRVE
FT                   KLSDKQTISSVCIANPLTKDKQNSFFSKISGLFATHPPIEDRIKVLQAMDGYR"
FT   CDS_pept        55431..55791
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_12"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(56673..57428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_028"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_028"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13511"
FT                   /db_xref="GOA:B1GZ29"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ29"
FT                   /protein_id="BAG13511.1"
FT                   /translation="MKIVSWNVNGIRAIYKKDFTAWFKDENADIVCVQETKAGETQFPK
FT                   DIKEINGYNFYCSSAEKKGYSGVAVWSKIKPDFVIASIENKVFDNEGRIIRLDFKDFII
FT                   FNVYFPNGGASQERLKYKMEFYDYLIKYLKQFKDKTVIICGDYNTAHFSIDLARPKENE
FT                   KVSGFMPEEREKLDNLVSSGFIDTFRYFNKEPGNYTWWDYKTAARSRNIGWRIDHFFMS
FT                   QHSVKRLKSADIKKSVSGSDHCPVSITVF"
FT   CDS_pept        complement(57519..57980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_029"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13512"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ30"
FT                   /protein_id="BAG13512.1"
FT                   /translation="MNRLLSALCAIAVFTNISFATTPLKLSIWEKTAIPQDDSVNGLEI
FT                   GIGTYTPEVKGILCNLIYAKTDDCSGWQHACLITFTELFKGLQTGIINLNSGEISGIQK
FT                   GFFNKAVSVKGIQVGFINVAENMEGIQLGFINFIKKGPIPIMIIANARF"
FT   CDS_pept        complement(58069..58650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_030"
FT                   /product="putative GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13513"
FT                   /db_xref="GOA:B1GZ31"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ31"
FT                   /protein_id="BAG13513.1"
FT                   /translation="MLEKTVFFRATAEADSLPKSVAEIIFSGRSNVGKSSVINALCSQK
FT                   NLARISKTPGRTRSINVYSVSLRKWIVDLPGYGFARVSLQEKKLWNKMMEECIIKRNSN
FT                   KTVYIVIDAFVGPTELDFDMTKWLKEYNISFKIIANKCDKVPQTISEDEIQSKAAECFG
FT                   TDKPNVFTVSAKKRNGFNKLKTDILKFFNS"
FT   CDS_pept        complement(58881..59597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_031"
FT                   /product="YccA family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_031"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13514"
FT                   /db_xref="GOA:B1GZ32"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ32"
FT                   /protein_id="BAG13514.1"
FT                   /translation="MSNPLLKDSVFQSTESYSEVMTMSGTINKSIILWILLVGSAFYSW
FT                   THPGVIAPLLFPISIGAFVLAFVSIFKKTATPFLSPLYAMCEGFVLGTVSLYFEKSYPG
FT                   IVVNAILSTICVLFCMLASYKAGILKATPRFQKTVIFSTLAIAFVYIADLLLNSFGAGK
FT                   LPYIHDSSTFGVIISIVIVAVASFNLIIDFDLIEKGAYNRAPKYMEWYSALSLMITLVW
FT                   LYLEMLKLLSKLNRKD"
FT   CDS_pept        complement(59572..60039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_032"
FT                   /product="bis(5'-nucleosidyl)-tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_032"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13515"
FT                   /db_xref="GOA:B1GZ33"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ33"
FT                   /protein_id="BAG13515.1"
FT                   /translation="MLKEFSCGAVLYKMKNDNPLFLLVNSKRSRIWGFPKGHIENCESE
FT                   IETARREIFEETGIKNISFIKNFRQEDVYIIDDTASRTDERQVEKHSIYFLASALEDAS
FT                   DFDKNEILELKWANINQARDMLSFANQKKIVNLAAYNLIIGGQHEQSAFKR"
FT   CDS_pept        complement(60335..61621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_033"
FT                   /product="nicotinamide-nucleotide amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_033"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13516"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ34"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13516.1"
FT                   /translation="MKIELICTGSELLTGKVNTNAAYIGSRLSAIGFEISLVTDVGDKK
FT                   QDLLREFKRAFKRSNIVITTGGLGPTFDDITVETAAECLNLKIYPDEKVLNSIKEYFLK
FT                   RSVAASIPKINEKQANIIRGAKVLENRVGTAPGQMLHFKFKDSEKKYRKTLFLLPGPPE
FT                   EMKPIFEENVEPFLKSYSVGIKKNGVLHVFGIAESAVEEMIKPVMEEAVSGDSKFVEFG
FT                   ILASKSVIDIKFSVSGTDELFVDETISKLKLGFGNVLKDNIFGFDNDTLASVAGRLLLE
FT                   NKKTVSFAESCTGGNIAAAITDIPGSSLYFKSSVVTYSNESKMKLLGVKEETLTNFGAV
FT                   SKETVKEMAEGVLKLSDSDYAFSVTGIAGPIGGTKKKPVGLVYIGSADKKKTESFKFNF
FT                   SGTRKDIRKRTVNTALDLLRRKLIAKHSY"
FT   CDS_pept        complement(61800..62864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_034"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_034"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13517"
FT                   /db_xref="GOA:B1GZ35"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ35"
FT                   /protein_id="BAG13517.1"
FT                   /translation="MGYRGLIEKYRKNLPVSDKTPVISLHEGNTPLLPARNLPDKLGFN
FT                   GKIYLKFEGMNPTGSFKDRGMTMAVSKAVEDGSKIVICASTGNTSASAAAYAARAGIKC
FT                   VVLIPEGKIALGKLSQAVMHGAEVLEIDGNFDEALNLVKELSSKYPLTLVNSINPFRIE
FT                   GQKTAAYEICESLEQSPDYQFMPVGNAGNITAYWKGYKEYNKAAPEKYTLPKMMGFQAA
FT                   GSAPIVEGHPITNPETIATAIRIGNPASWKTAEEARDESGGVIDKVTDEEILEAYRIVA
FT                   VTEGVFCEPASASSIAGLIKYIKQGYFKSADPAKIVCILTGHGLKDPDTAVTNAVKPQK
FT                   VKADIKDIINTIGF"
FT   CDS_pept        complement(63069..63851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_035"
FT                   /product="DUF4328-doamin protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_035"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13518"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ36"
FT                   /protein_id="BAG13518.1"
FT                   /translation="MPKTKNNHYIPQFYSSKWKFNDTQVYCLQKENSNIFKPNPRNIFA
FT                   DRIWDNEVENMFAQIENNVWFPTINKILKDKTMDKLSETEFGNFYSFIVALKVRKKHIV
FT                   AEAYETAESDLAKFDDELIRHGKATKEEIEELQKYNKPLSNYSFLSVFNPGGAIFGQFK
FT                   RFTFGNKIIEEKDMQYGQFLTSNHPLLMLGEKGKVDLIMIALTPKLLIFGTRGPEIFKT
FT                   VHNKPINIIIKEFNKEIYNDTESEYIISNKRFLLKQFL"
FT   CDS_pept        64675..66889
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_13"
FT                   /note="pseudogene of predicted P-loop ATPase (COG4928)"
FT                   /pseudogene="unitary"
FT   CDS_pept        67198..71394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_036"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13519"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ37"
FT                   /protein_id="BAG13519.1"
FT                   /translation="MNENSSQDYIELDRKYVKFQDSLSFLKPVNIEIVLKENDAVVILG
FT                   DKGSGKTIEVKQFQSKHRDNSKYFELKDIYSGLQDVKSKIEVLIKSLDLKNDDSYLYLL
FT                   FDAIDECRLQGIRKQDAFEITLRKIRNDLENLPIHIISKLKFIFTSREADWKKDADNNL
FT                   IQKYLSIDTLKQNSGTANSDSVILKDPTNCTTDTGKHDIKISIYTLEELNNEQKRLIAK
FT                   YLKENEDFFEKDIIAQGYSNTPLDCLEFLKFKTRRRNTAYKMEDFLRYKLQRRYRELNE
FT                   SRNDGQFPMIKIERLSKRLAAATLFCKTVSIQKRESYSDFSTSPRSNDVSLTELFPNED
FT                   SSCLNAFTNSALFSANGENSVKFWDELSRDNVAHFWLKDRIEKGKYNEIKNLIFQKCDS
FT                   IISPKKSFIISAVFLANTEPEFRKYLIEFHPEFLVIYSYCCESLTEFDKKEILSKLLNK
FT                   YSYRIQNIISVFSNNKKAFSFFVKDFDVEYIVAEFKRMKHNNFLAKIFLMQLLYYSDVK
FT                   NLDRKLKGKVNSLLFSKKDMTIGINFYTSAVEILLRQEHPKINQKLKAFLLSNISKLSD
FT                   VTIGTLLEDYLCPEYISFKEVTVLLKKYINEGCDNGGMAYLKIVYPKLIQKLSDASEIK
FT                   SILDGISFDFSNENEVFIYVSLLIRFIDCGVKSDEISNHLLKLHKYNYDKFYPNSKNEE
FT                   ELEHLKEKITPEINLAFVKKLLEEYKAFKESNHDWFPYDKLYKINDDIMKIFLKETNNK
FT                   SLSQNSIFYLFNFCLRNLKKTYSDSGTMMQIIKPYLNTKQKRQSWKEFLNPPNIAVKNK
FT                   ISEYKVQKEKNQQFLNEHIEDIRRAAKEYQHIIVGLSLKNKADISSIENEWGVDIAGAY
FT                   KEGIKKYWQICELDFNQYVNEIVGTKNESLKQTVAGLSGLHLFFQDSPDCLNKLNEEQA
FT                   KRAIYWGVQKLNLLPDWISKCIKIYPKIAKEIILPIIDKTIELKADNYLLFNLSQIDSD
FT                   ALSVFYEDLWGRIQNQPDSKSICDVVKIITNMNLIDDKKRSDLVVYIMGKISDIENKNT
FT                   IIWLRLLYNTDKKKFAETIQNLEKKYSNESEKMQRFFISLFNELYLCQFCEVKNKTADN
FT                   SGLIDLLPLLFKYIDPNNDVQRKNGAVFWTGARDNAESFRDQIFNFISSVNNFRKDDRS
FT                   RLLDLAKKINHKKYKEYSERIQCVADELLLIDEENLAEDDVIKIEESDYLAPKSADDLF
FT                   RIVCDKLDEIKTDIETSDYSLKELYQDNIKKEKYFQKYILMGLRKLSRNLYSSVREPEV
FT                   AANNKPDLQIWDGNWCVNIECKVADNWSGNDMCDTIDSQLIEKYLKYKKYRHGILLLSR
FT                   IKKDSWEIKKQSVYFSELIKMLQEHADEARKKYIHIKDIRVIGIDYSIQSKNCKK"
FT   CDS_pept        complement(71601..72453)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_14"
FT                   /note="pseudogene of conserved Fic family protein
FT                   (COG3177)"
FT                   /pseudogene="unitary"
FT   CDS_pept        72603..74315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_037"
FT                   /product="type I restriction-modification system, methylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_037"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13520"
FT                   /db_xref="GOA:B1GZ38"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ38"
FT                   /protein_id="BAG13520.1"
FT                   /translation="MSSFSDKANFIWSVADLLRGDFKQSEYGRVILPFTVLRRFDCVLA
FT                   PHKDRILEINKTLTVTNKAPVFKRCTGYDYYNISKFSFEKLRDDSNAVETNLRDYISGF
FT                   SDDIRAILDNFEIGITIKRLKKANLLYLIVQKFAELDLDEKSIDNLTMGYMFEDLIRKF
FT                   SEKSNETAGEHFTPREVIELMVDLLLEEDGDILNTEGKVIKVYDPACGTGGMLTAAQKK
FT                   LQEYNGKIKVIPFGQELNPETYAICKSDMSIKGNSQAGIVLGNSFSEDGFKDEKFDYML
FT                   SNPPFGVEWKKVQSFILDEAEKQGFNGRFGAGTPRISDGSLLFLQNMISKMIPQKDGGS
FT                   RIAIVFNGSPLFTGDAGSGESEIRKWIIENDFLEAVIGLPDQLFYNTGIATYIWILSNR
FT                   KSDRRKGKIRLVNGVSFFEKMRKSLGNKRNEISDKSRNALVNLYSMHEPDENYIDFDNS
FT                   DFGYKKITIDRPLYDKDGKPELDKKGNKKPNAELRDIETVPLKEDVNEYFKREVLPYVP
FT                   GAWIDESKTKTGYEIPFTRHFYKFVPLRSSQEIMKEIECLKKDIDEAFQELIK"
FT   CDS_pept        74315..75619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_038"
FT                   /product="type I restriction-modification system
FT                   substrate-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_038"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13521"
FT                   /db_xref="GOA:B1GZ39"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ39"
FT                   /protein_id="BAG13521.1"
FT                   /translation="MEEYSKYKPSGIEWIGDIPKNWNFVSCRLIVSERNERNKGMKNNN
FT                   YLSLMANIGVIPYEEKGDIGNKKPENLEKCKIVYEGDLIINSMNYFIGSYGISKYDGIC
FT                   SPVYIVLYANTKVIEPRFAFRVFENPKFQGVAQSFGNGILEHRRAINWDILKNIKIPVP
FT                   LLEEQRNILSFLDKKTEKIDALISDKEKLIKLLREYRQSIISETVTKGLDKKVQMKHSG
FT                   IEWIGDIPYDWKVNKFNRIIIRVSTGLNPRNNFKLGDGDCYYVTIKNFKKGKLFLDEKC
FT                   DRMTKEALNIINERSDLKIDDILFSSIGEEAEAYLISEHPTNWNINESVFTIRVNKDLV
FT                   LPNFFYYLIANKSFFNDLLKDATGSTFKSIKINSLIEKKVPVPSLKTQKEIANLLDDKT
FT                   EKIDNLIENITKQIKKLQEYRKSIIGEAVTGKAAI"
FT   CDS_pept        75619..78621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_039"
FT                   /product="type I restriction-modification system
FT                   restriction subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_039"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13522"
FT                   /db_xref="GOA:B1GZ40"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ40"
FT                   /protein_id="BAG13522.1"
FT                   /translation="MPIKTKEETFENEIENILLKNGYIKGNPADYDKKYALDTALLFKF
FT                   LQNSQSKEWGKLVNKYGDGAEKSFLRRLGRELESKGMLYLLRNGIIDTPAKFELCFFEP
FT                   ASNMNETDIENYKKNILSITRQVHYSLKNENSIDMVIFINGLPVSTIELKNPVAGQTVE
FT                   NAKRQYKYDRDPSDLLLSFKIRCLVHFAADTDEIYMTTKLCGADTYFLPFNKGSGHGKG
FT                   NPLNSRGYRTSYLWEDVLQKDSLLDIIRRFIHLEVKDKKENIIFPRYHQLDTVRKLIAD
FT                   VKANGLGKNYLIQHSAGSGKSNSIAWLAHHLQNLHNADDKIIFNSIVVVTDRKVLDRQL
FT                   QDTIYQFEHIDGVVAKIDVNSKQLAEALSAGRKIIITTLQKFPFVLEEVENLRELKGKR
FT                   FAVIIDEAHSSQTGEASSKLKAVLGDDTAGLSECEKLQKTADEEAKEEKNIPDSEDIII
FT                   KEMKTHGRLKNLSFFAFTATPKPATIEMFGNKGDDGKPKAFHLYSMRQAVEEGFILDVL
FT                   KNYMTYTTYFRLGKAIANDPRYDKSRANKALGKFLSLHPHNLAQKTQIIVEHFRSVTKN
FT                   KICGKAKAMVVTSSRLHAVRYYFEFKKYIKKMGYQKELRVLVAFSGTVSDEGKECTEQK
FT                   LNNIKETELKEKFKGTDYQILLVAEKYQTGYDEPLLHTMFIDKKLGGVKAVQTLSRLNR
FT                   ICPGKEDTFILDFVNSEEDIKKSFEPYYKAADIEETTDANIVYDIKSKLDEFRIYWDTE
FT                   IENFANVFFKPSKKQENLDFSILNSYIDPAVERYKGKNEEEQEEFKSNLTKFVRAYSFI
FT                   SNIIKLDDVKMHKFFAYSKYLLRKLPKDKRDEVNLNDEITLQYYRVQKIFEGSIILEEE
FT                   NNPLKNYKYVSKVDTKYETASLSELIEKLNERFGTDFTGMDKMLQQFIADMGKDENLHK
FT                   QAMNNSKEHFKFPFNDAFMTIVVDRMVQNKEFCERILDDEKFGKTVKELLSGYMYDRLR
FT                   KTDSVKIELDK"
FT   CDS_pept        complement(79077..80129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_040"
FT                   /product="Sir2-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13523"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ41"
FT                   /protein_id="BAG13523.1"
FT                   /translation="MSNPDSTKKVFFLGAGFSKAINHKYPLLSELNEEIKPNIIKGELF
FT                   KCYRNICSKIGENIEELLAYLSLDLPWKTEYTKTLDKALYIDITKNISATINSLNTMPD
FT                   KYDYDQEQEQVRLLADFIKENLSLCLTLNYDTLLEKIIFSKKDENYQRSNGYEGFYKVP
FT                   IQSVADRWKISTSAKWGFGSEDPKGKKLPTILKLHGSINWMWAGISPSDPIYCSDKNDS
FT                   IQEINNSVLELQPFIVPPALDKNSFYNNNILKSIWSLAYKGLMKSKEIYIIGFSLPDSD
FT                   ISIKYFFKEVMSKNKDRNTSSTIYVINTDESDELKKRYKNVFPEESLNFDYCCQYAFDR
FT                   FVKEKLSANL"
FT   CDS_pept        complement(80317..81086)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_15"
FT                   /note="pseudogene of type II restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(81087..82673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_041"
FT                   /product="type II DNA modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_041"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13524"
FT                   /db_xref="GOA:B1GZ42"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ42"
FT                   /protein_id="BAG13524.1"
FT                   /translation="MEENIEYLTIKEASLWATNYLGKEITASNISYLIQYGRIHKIGHN
FT                   GSTQILKSELIKYYHSLNQSRENAWKNKLGQDLNWKLSFDNLKESDTTKHIHRLHPYKG
FT                   KFIPQLAEYFLDDHIDEFKKEKYFNKNDIILDPFCGSGTTLAQADELGMHAIGVDVSYF
FT                   NSFITNCKINTYDVVSLEKNINIITERLFENHKFSKDIEFEQVLIEKLKKFNDKYFPAP
FT                   KFKHKIKQNLIDENKCGRKKENLFLPVYKDLLMKYKIELLKQNPKTFMDKWYFKNVTNE
FT                   INFVFEEIKKIKNSINKNISALILSRTMRSCRATTHSDLATLTEPVSEIYYCSKHGKIC
FT                   KPVFSIMKWWKTYSKDTIKRIKEFEKLKAGTLHYCLPGDARTIDIISALSKKQKSFADI
FT                   LNRQKNSGIFSSPPYVGLIDYHEQHAYAYDLLDFERKDELEIGSLFKGQGREAQKSYAE
FT                   GISDVLNNCKKYLKENYNVFLVANDKYNLYSEIAQKAGMKIANTFKRPVLNRTEKDKGA
FT                   YSEIIFHLKEK"
FT   CDS_pept        82852..83439
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_16"
FT                   /note="pseudogene of putative transcriptional regulator"
FT                   /pseudogene="unitary"
FT   CDS_pept        83501..83893
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_17"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(84148..86781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_042"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_042"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13525"
FT                   /db_xref="GOA:B1GZ43"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ43"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13525.1"
FT                   /translation="MDKLSSKIRAEFLGFFKNSGCAVVPSDSLIPAGDKTLLFTSAGMV
FT                   QFKQHFLGQSKDSFTRATSCQKCFRTSDIDQVGTTARHLTFFEMLGNFSFGDYFKKEAA
FT                   AWAWEFLTKNMSLPKDKLYITIYKDDDEVAGIWKNIAPANKIIKMDEKTNFWNMGETGP
FT                   CGPCSEILIDLGQETGCGSPACCPECNCDRYLEIWNLVFTQFDKQPDGSLKNLPRKNID
FT                   TGMGLERLSATVNGRKNVFDTDLFMPVMENAAEILKIKNEGSNISKLRMIADHSRAITF
FT                   LISDGILPSNEGRGYVLRRILRRALRQGKFYGYNKPYINELVSDVLKIMEGAYPELSSK
FT                   LSNIRSIVKTEEEKFLETLESGSEILSSLINSYKSKDINIISGKDVFKLYDTYGFPHDL
FT                   TKEMAFENGLEIDEDKFKFEQKKAQEKSRVAWCGSGERDITFYSILRKKTGDTVFTGYD
FT                   NYASESRVLALIKDGSEISELKTGDNGEIILSHSSFYAQSGGQSDDKGKIANNSFESIV
FT                   EYIFKPAGNLFVHKVKVLKGLIKINDAVSTIIDIERRKQIARHHTAAHLLHKALREAFG
FT                   GHITQAGSLVARDYFRFDFTHFSALKKDDLIKIEKRVNSIIRLNSEVCIETMAIAKARN
FT                   AGAMALFGEKYGDEVRTVLIKNESGDGNYSMELCGGTHVSRTGDIGIFKIISESSAAAG
FT                   VRRIEAVAGIAAENYILDEEAVIIKTSKILNASKEELVNKAHKYTSDYKKLENEFKSLK
FT                   SSLISGEIDSYAKEVKKINGINFLSVIADKADIKALRTISDQLKEKLKSAVLLIVSKNE
FT                   DRASFILSATADCVQKGINAGKIAKAFAASINGSAGGKPDFAQGGSKDLSNLNDAVKNA
FT                   HKYILL"
FT   CDS_pept        86991..87055
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_18"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(88019..89971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_043"
FT                   /product="ABC-type macrolide exporter"
FT                   /note="ATP-binding/permease component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_043"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13526"
FT                   /db_xref="GOA:B1GZ44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ44"
FT                   /protein_id="BAG13526.1"
FT                   /translation="MKAIEIKNLKKTYHLEKLDVPVLHGINLEIMQGEFVAIMGQSGSG
FT                   KSTLLNILGLLDKPSEGSYKLAGIETLNYSNNELATLRNRYLGFIFQQFNLLPKLTLSE
FT                   NVSLPAIYTDSKDKEEFEDSLKLLDMVGLSERIKHRPSEVSGGQQQRAAIARSLINKPL
FT                   IIFADEPTGNLDTKSAKEIIKILKDLNNTGITIVMVTHEAELADCATKIVKIQDGLIIS
FT                   DKKISEKSSSNPVFQKKTFKHNTFSLVKKFRDYFKEALRSLLGNKMRSILSVLGITMGV
FT                   ASLIAMFAIVNGAKRNITKYIENLGKPDILMVIPSLSQNDKYLKLNINDIDDLKRNVSG
FT                   VRTVSGGCGREQLTIVANGKNCGTTLIGVSADYADLKNYYISDGRFFTEEENREKKKVA
FT                   VLGKTVIKKLYGDENFNPTGKYVKINKTDFQVIGVLPSKSSNEWRDEDDKVIIPLNTAL
FT                   YRMFGIKELGFMDVQVKKDADMSEVSESIIKRLLFIHRLPADEKDAVRVINMEEIKKTL
FT                   SSVTRTFTYLFGSIAFISLLIGGIGIMNIMFVSVSERTKEIGLRKAIGANNADILFQFI
FT                   IESVFVCCVGGIIGILFGSGLSVIMGKFAGWTIYITPFSIGFAFCFSGLIGLIFGVWPA
FT                   RKASILNPIDALRHD"
FT   CDS_pept        complement(90128..91033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_044"
FT                   /product="ABC-type macrolide exporter"
FT                   /note="membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_044"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13527"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ45"
FT                   /protein_id="BAG13527.1"
FT                   /translation="MKKFILITILLAVAATAVFLIFKFKPSKQVIDKETTLTPRNLYLE
FT                   LRENGVVNPRNRLEVKSSFNGRIEKILVNEGDKIKKGQIIILMSSSERASMVDAARTIS
FT                   EQEYEKYQNIYKPTPIIAYMDGFIILRQKEPGHDVSSNEVILAMADDLIVKAYIDETDL
FT                   RYIKKGIRTKMYLDAYPDENFEGIVEHISYESKLLNNVNVYEIRIKPLKKPKAFKSGMT
FT                   VTVMIIAEFKKNAPAIANTFISEIGDTKTVTVKTGNINKPTLEKREIKTGISDGIFTEI
FT                   LSGLNQDETVVTFKPVKEKN"
FT   CDS_pept        complement(91035..92255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_045"
FT                   /product="outer membrane efflux protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_045"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13528"
FT                   /db_xref="GOA:B1GZ46"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ46"
FT                   /protein_id="BAG13528.1"
FT                   /translation="MKKIFVVLLSLFIVTFYVYAEEINKKTVKIQTLKNNPSIAAAKLA
FT                   LDNAKQEYNSSLGSFLPKIIGNFQCNDDYPYTLEIAIPLFERFETYSDLKAKASEFKSA
FT                   QASYARIVSNELYKADAAYINLICLYEKIELLKNAKEKRIENKNMIEFKYNSGEVNIAS
FT                   LRKVEADFAIVEYDLKVMQRYIETASAQLLKAIGRNDYTTILETNERLAISEKLPQKPD
FT                   YDSLITVIPEFIIAQNKLESCKIQTLKAKSQWLPSLTGNIQLKSRSLRSLLFSQWLPSL
FT                   KISYTIFNGGKRYAYMQTASNNLKIASEELKNIANNLKAEAIEHYNNLTNAYELVALKT
FT                   QYLSVTKLLSEISAKEYVNGIVNYEKWYSIEKDYFSSQIELLEAKKEAVLKRAEWNTFT
FT                   GKSLKGK"
FT   CDS_pept        92798..92932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_046"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_046"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13529"
FT                   /db_xref="GOA:B1GZ47"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ47"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13529.1"
FT                   /translation="MKRTFQPNRARRKKKIGFRARMDTSGGRRILSARRRKGRKTISA"
FT   CDS_pept        92942..93361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_047"
FT                   /product="RNase P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_047"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13530"
FT                   /db_xref="GOA:B1GZ48"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ48"
FT                   /protein_id="BAG13530.1"
FT                   /translation="MRAENKKNLSGSLFPENSAGKKFSFTYFERLHIQKDFDKIFKNGL
FT                   RLENKNIKILVYKRNDGHIIRRLGLITTKRVGAAVIRNRTKRRLREIFRTNKHFLESGL
FT                   DLIFISKPGTALLDYDSLKKNILGLLKSAELYNPE"
FT   CDS_pept        93365..93589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_048"
FT                   /product="membrane protein insertion efficiency factor
FT                   YidD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_048"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13531"
FT                   /db_xref="GOA:B1GZ49"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ49"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13531.1"
FT                   /translation="MKQIALFLIKCYKFISQFLPSICRFQPSCSTYAYQAIETYGFFKG
FT                   SLLTFKRIIRCRPFCAGGFDPVPLPKKKI"
FT   CDS_pept        93609..95168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_049"
FT                   /product="protein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_049"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13532"
FT                   /db_xref="GOA:B1GZ50"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ50"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13532.1"
FT                   /translation="MQKNSILFVTLSAFTVFIWYFFFAQPSEQSYRQMMQLQNTVAVSE
FT                   SGVNKFKNADLNEFQIDDIYAKEEHINIETEQYKAVLTNKGGGVLSWSVKEKNGQWVDL
FT                   VFPESAPVMANFPNLTYKVVSKSAEKIVFEYASKEGWKITKIYNLSDLYMHNLNISVEK
FT                   NAKTPFPQIDLKWGPGLGTDSKELKENISLTRALVYTAVKPNKLKKLKDNFEPASLCKW
FT                   TAVDNRYFLVAFIPKNSMDFDKILFSRLEKKHPCSVILKAAEPKDVDKKDYSVNFYLGP
FT                   KDYKYLKTYDLGLEKTVDFGFFGFLGKIAFSILVFFYKLTHNYGWAIIMLTTIIQILVL
FT                   PLTLKSFKSSAAMKRVQPVIKDIQTKYKDNPQRLKAEMLNIYQSQKVNPLGGCLPMLLQ
FT                   LPIFWAFFTMLRNAYELRNEGWILWVKDLSAADQFMQFGSFNLNLLPLMMGIGMFFQQR
FT                   MTTVTSDPTQRKIMYIMPVIFTFMFWSFPSGLVLYWLTNSLISMIEQYFIMKKDAITVK
FT                   HI"
FT   CDS_pept        95225..95443
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_19"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        95586..95954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_050"
FT                   /product="conserved CoA-binding domain protein"
FT                   /note="COG1832"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13533"
FT                   /db_xref="GOA:B1GZ51"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ51"
FT                   /protein_id="BAG13533.1"
FT                   /translation="MDRNKLIAIVGVSENPDKTGFKIFTDLLRAGFKVAAVGIRGGAIA
FT                   GKRVYKSLKDLPAKPDMILTVVPPAGTDKTVDDAIDLGIKEIWMQPGSQSETAVQRAKA
FT                   VGMKVTESGCFMLVHGIW"
FT   CDS_pept        96120..96836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_051"
FT                   /product="putative phosphatase/phosphohexomutase"
FT                   /note="COG0637"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_051"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13534"
FT                   /db_xref="GOA:B1GZ52"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ52"
FT                   /protein_id="BAG13534.1"
FT                   /translation="MYKVVSSFSKKSKQMNKKSKKFKTKSFKAVLFDMDGVIADSMPYH
FT                   FISWFEVLKQHNVRINPMIIFEMEGAKWDKVIKLAFKQSGIPLFQQATQKIRKKREQIF
FT                   NQYFKRYIFTGIPEFIKSLKNKGVLVGLVTGSSLKEAQKMLPEYIYKLFDTIIAGDGVK
FT                   RGKPYPDPYLAAAKNLKVLSKECMVIENAPYGIKSAKAAKMYCCAIATSLSEDLLSEAD
FT                   IIFDTHRDLYEYFEGD"
FT   CDS_pept        97506..98270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_052"
FT                   /product="ParA-like chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_052"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13535"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ53"
FT                   /protein_id="BAG13535.1"
FT                   /translation="MSKVIAIANQKGGVGKTTTAINFTASLAYMGHESLLIDMDPQSNT
FT                   TSGFGINKNNLEKNIYNVLINDVALEDILQDTIMDRLDIVPATTSLSGAEVDLVNMSDR
FT                   GKRLKFALEKFHKIYKYIIIDCPPSLGLLTINSLVAADTVLIPMQCEFFSLEGLGQLSE
FT                   TISALMQSYDLELEGVLFTMFDSRTNLADQVVEEVKKFFKEKVYETKIPRTIKLAEAPS
FT                   FGKPVLLYDPSGKGSQAYIDFAKEFLLKQNME"
FT   CDS_pept        98308..99168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_053"
FT                   /product="ParB-like chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_053"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13536"
FT                   /db_xref="GOA:B1GZ54"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ54"
FT                   /protein_id="BAG13536.1"
FT                   /translation="MQKKALGRGLESLIPALAANKASTDEIIIIIPLDKIKSNRFQPRN
FT                   KFDEVKLQELARSIEKHGLAQPILVAASIVPGEYEIIAGERRYRASKLAGNKDIKAIVK
FT                   QSADDKQRFDLALVENIQRENLDPIEEARAFKRLIEEFGHTHEQISDIVGKERSVISNA
FT                   LRLLSLPEDVQLLITEDKISPGHGKILAGIEDKNRIRAIVDRILNENLSVRAVEKIISE
FT                   LKPEKESDGQKKQEIELINLKEEIQRKLGTKVNISGTGKKGRIEIYYYSLEDLERITKE
FT                   LKFSC"
FT   CDS_pept        99507..100787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_054"
FT                   /product="exodeoxyribonuclease V alpha chain (RecD)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_054"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13537"
FT                   /db_xref="GOA:B1GZ55"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ55"
FT                   /protein_id="BAG13537.1"
FT                   /translation="MKSNIDIEINDEFKQAYDLIDKSGNCVFITGSAGSGKTTFLRYYT
FT                   MRASKKTVILAPTGVAALNCGGETVHSFFYFKPDITVSKIKKKKLSEKSIYKKVETIII
FT                   DEASMLRCDILDCIDKFLRLNREKRQEPFGGVQMVFIGDLKQLPPVVKREEYHIFNSVY
FT                   KSPYFLSAYSLNKCILHTVELKKIYRQRDSNFVALLNAVRDGTANDDEIAELNKKVSSQ
FT                   IFNRPMTVYLTTTNKKAAFINHKYLSEIEYKQVVFTAETKNIEENSKVFPAEYELVIKK
FT                   NAQVMMLNNDAKNRWVNGSIGIVENIKSGSDFGKLSICIRFPNGRVENVEPYKWELFKY
FT                   GWNEEKKQIETYRAGFFKQYPLRLSWAITIHKSQGKTFDNVIIDMEYGAFAPGQLYVAL
FT                   SRCTSFDGITLSRPLTKRDILAPAVWD"
FT   tRNA            101025..101111
FT                   /locus_tag="TGRD_tRNA04"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   CDS_pept        101786..102286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_055"
FT                   /product="CRISPR-associated protein Csn1 N-terminal
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_055"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13538"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ56"
FT                   /protein_id="BAG13538.1"
FT                   /translation="MNKVQEIEYKKIREKLADREYRIGLDLGVGSIGYVVVSLKECNDL
FT                   SYLPEDIILSGSRIFKSSIGAVERREFRLQRNSHRHHRERMRFLWQLLAEKQLALQSSK
FT                   DLEKKENSADCETSQKRFPINILKEDPYILRYKALEEKLSLFQLGYVLYHIANHSNTAY
FT                   ENT"
FT   CDS_pept        102302..105400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_056"
FT                   /product="CRISPR-associated protein Csn1 C-terminal
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_056"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13539"
FT                   /db_xref="GOA:B1GZ57"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ57"
FT                   /protein_id="BAG13539.1"
FT                   /translation="MLYHIANHRGTDSVRSFLEYDDDKIKENTLTAKIAKETKKVIDAK
FT                   KYRTFGEYLYKGKIEKFQQNIRKKVSNRKTPANKNKEFAVTRDVIIKETEKILASQKQY
FT                   YTYILTDEYIKKIKDAISYQTEKLIPESGYCPYFKDEKRLPRSHKLNEYRRMYEALNNA
FT                   KYFDPVLDENTGEILSYQEKEFSREEKKILFDEVLLKGMELTESGAKKLLYHLPDGCEV
FT                   QLQGRDKTTQKIKGYALVDLEASPFWLRLSQQQQDEFLYDWNSLPLEKLKPKLTNYYSL
FT                   TESEVDETFQEIKLPSNYASVGKKAMEILLTYIKDGCSYTEALEKAVSEGKLKVDKQTM
FT                   IYDSLPYYGKILKESTQKLIGKAFSKQFADRNYKEPDTNKNEREFGKIANPVVHQTLNE
FT                   LRKLINEIITVFGKKPLEIGLETTRELKKSKKNREYLSKQQNKNEYARNRIYKEYIEPH
FT                   LSQIKSRQENPSKYISKFELLEEQNFICPFCSEKITPDDIINSKVDVEHIFPIEESEDI
FT                   TKNNLVIAHNECNADKGKKSPFDAFGDKTSGKYRWNCILHNAQKNLPHKVWRFYQGSLE
FT                   KFLENKPMSRRFGTDNSYISKIAARYLACLFNDPYHSEIFCIKSSLIAQLRIAWDLNSI
FT                   MVPLVKNILSEKELEEFKISKNKKIRIDNRHHALDAIVIAYANRGYHNFLNRIHAKEYK
FT                   INYREKSWLSKILLPPLNRDLEDFKISVKDSIEKANVSIKHDHNTNGSLVKATAYKVYY
FT                   SGAGEYIITTSKNVEEISFKEKEDPKDTLYRALCKFECRDIDIKDEKLIKKLKYNSTLY
FT                   KKVQNNLSKAKQELEQDNKKTEEEGKKSQKITEVRIYKKACSLVKGQYIQCGSRLKDKF
FT                   FAVKEPTEIKTGLGYDTGDNLFLDLYYDKTGKLCGEIIRKVNFNRNKPNYQKEGYTLFE
FT                   RIYQSDILEVDTSEDRISLKNKTGSAPSDRTFIKVNTFTEVNAYFDGKRDKIQIFFGNL
FT                   LKSSFKNDSFFISSMQKYNVRKVILTSLGIIKYRSQILKNKEV"
FT   CDS_pept        105401..106312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_057"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_057"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13540"
FT                   /db_xref="GOA:B1GZ58"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ58"
FT                   /protein_id="BAG13540.1"
FT                   /translation="MWRIIDISGDGYHICVKNNNFSVLKSNEEKLHANFSDINCIILHG
FT                   NGITYTNSAIQKCLKNEIPIVFCDETHTPAGMLLPYFNIAEYGKRLEIQLSASQPIRKQ
FT                   AWKQIITEKLINQSACLASFPKSNSKHLQLLDFAREVKTGDNTFREGIGAKIYFGELFD
FT                   NFYRSNKNEDIINSSLNYGYAVLRSGIARAVVSCGLNPAIGVFHSKNKNPFCLVDDLIE
FT                   PLRPMVDYIVKSQYDDFIKEKILTPALKRFLVSITEKKLLVENAAYSFVAGLQKYIQSY
FT                   LAYISKQEKQIIFPKLFYDIKI"
FT   CDS_pept        106296..106622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_058"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_058"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13541"
FT                   /db_xref="GOA:B1GZ59"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ59"
FT                   /protein_id="BAG13541.1"
FT                   /translation="MISKYKAMWVLIAFDLPVLTQKQRRIASSFREYLKNIGFIMLQKS
FT                   IYCYYACTKERSDSVEKDIKKHIPDNGHISVLFLTDRMFSMTKNYYGKLKVDISQPELF
FT                   DNLL"
FT   CDS_pept        complement(107149..107973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_059"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_059"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13542"
FT                   /db_xref="GOA:B1GZ60"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ60"
FT                   /protein_id="BAG13542.1"
FT                   /translation="MNSIIRKSLLHKTNVEYGDYTINHAEGCSHGCLYPCYAMLMAKRF
FT                   GKIKIYDDWIKPKIVKNALEILESEIPKYKDKIRFVQLSFTTDPFMCGYNEISEMSYKI
FT                   IKRLNRENIKCIAITKGILPDKLATLSSNNEFGITLITIKDNFRKKLEPFASPMKKRIK
FT                   SLYNLHKNGIKTWVSIEPYPTPNIIKQDFDEILKALEFVDKIIFGKLNYNSQVSAYKGC
FT                   KEFFNETAEKVISFAEKNNKKHYIKKGTITDLNVSKQFSHNFSLYSNPISIF"
FT   CDS_pept        complement(107990..109036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_060"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13543"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ61"
FT                   /protein_id="BAG13543.1"
FT                   /translation="MDTKGNIENHSKIKLSIYEKYLKAYLSIMMRLYFTDIFIVEPFAG
FT                   KGISNNGEEGSAIIAKNVITSISNSSNKNIHLVLNDIKKESYVDLIKNLKPDGNRVLCF
FT                   NKDANEFINDVLSKADHKTKTNHLFFIDPWGYTQLRGDTYQNIFKAKRLDILIFIPINH
FT                   IYRFLIKEENSEQLKPIAGFLNDMGIAEEDARKCQDEMSFVNEIKKAFTKKADTDYVYY
FT                   KELKNTKSNNKYALFFLTKHILGAEKFLEALVKIKEKDLFENTISDEDLPFIENIHKNK
FT                   SLTNCELYEYGILHGLLPKKVTAILNSYEKDNKITVMPMPEVSNRKKGNFYISYKNKEK
FT                   PKIKIVFK"
FT   CDS_pept        109198..110598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_061"
FT                   /product="dupulicated ATPase component protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_061"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13544"
FT                   /db_xref="GOA:B1GZ62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ62"
FT                   /protein_id="BAG13544.1"
FT                   /translation="MHPPIFLSHISLYFPGKICFEYFSAQIQAGNRIAIIGNNGTGKSS
FT                   LLKIIKGDLPASEGEIQNKNVSFGYVPQLIYEYENLSGGEKFNRALSVAFSNHPDILLL
FT                   DEPTNHLDLKNRRSLIKMLNFYKGTLVVVSHDTELLRSSIDILWRIDNGKVSVFNGKYD
FT                   DYRQTIMQERQNIENELEFLAKEKKENHKALMKEQQRAKKNKERGRKFVERKKWLPALG
FT                   DLNQSYAQKTTGKNKGSISNKRKILNERLSSLRLPEIIKPSFSLTAKNIASKTIVSISS
FT                   GQTAYGHKIISKDINLSVTGSEHLAVTGGNGSGKTTLFRAILNYPQIKKTGVWDLPRSE
FT                   DIGYLDQCYSSLNDIKTVLETLADLSPEKTHAEIRDFLNDFLFRKNEEVNKQVSVLSGG
FT                   EKARLSLAKIALQTPRLLLIDEITNNIDLETKEHVTQALKEYPGAMIIISHDSAFLENI
FT                   GITHYYKL"
FT   CDS_pept        complement(110619..111863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_062"
FT                   /product="U32 family peptidase"
FT                   /note="protease (peptidase U32 family)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_062"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13545"
FT                   /db_xref="GOA:B1GZ63"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ63"
FT                   /protein_id="BAG13545.1"
FT                   /translation="MKKPELLLPAGSLSKLKTAFLYGADAVYAGIPEMSLRVKSEFLLE
FT                   EMEEGISFAHNIEKKVYLTLNLFSHNKDVERLEKFAKTLKTLNPDGIIISDPGIFQYVK
FT                   KEIPQIPIHISTQANICSWLTADFWKNLGAELCVLGREISFSEIREIREKCREIKLEIF
FT                   IHGSMCVSYSGRCLMSAFMASRSANQGACAHSCRWKYKSRLLLEEELRPGEYLEMEEDD
FT                   KGSYVLNSKDLCLMPKLDKIISIGIDSLKIEGRNKSEYYAAQTARVYRKAIDDYFDNPG
FT                   SWHPDEYMKELITLQNRGYTIGFFDGMPGIEAQDYIDTSSKSNYRNAGVIKSSANGFLT
FT                   IELRNKLKKGAEIEILSPFKFKPVKIILNEIYNKDNNNLIEELAPGKASQSVKIPVDGD
FT                   LSVFPENTIIRIKTV"
FT   CDS_pept        complement(111897..112256)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_20"
FT                   /note="pseudogene of conserved hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        113053..113575
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_21"
FT                   /note="pseudogene of DUF488-domain protein"
FT                   /pseudogene="unitary"
FT   tRNA            complement(113883..113953)
FT                   /locus_tag="TGRD_tRNA05"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGG"
FT   CDS_pept        complement(114009..115454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_063"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="CCA-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_063"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13546"
FT                   /db_xref="GOA:B1GZ64"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ64"
FT                   /protein_id="BAG13546.1"
FT                   /translation="MNKLIKKINNLSKDFDIYATGGFSRDLLLKRSPIDIDLAVSRNAL
FT                   KYSKKIADVFNSKLITLNDTRKTYRIILKDDVITNIDISLFNGKTIKQDLQNRDFTINA
FT                   TAFNLKNFKNFKKHIILSDRNTLRDLKSKIVNTVSAESFKTDPLRMLRAFRFAAELNFK
FT                   ISKKTFKQIIKNAKLIRQSAPERIKNEFFRVLSVKNSAALIKDMDDCGLLSEIFAEIKK
FT                   MKKTCRKYYYHPGGLFQHSFETVESAENILNNLKKYFPENYADMQKHFDNNATFSENIT
FT                   RESLLKFAALFHDSAKPETAKFENGKMHFLGHEELGAGKVKEIMLSLKSSKNDIETAVF
FT                   LVSNHMRPSTLTRNNIVTKKAALKFFRDIGDNTPDLLVLSMSDWHSYKKLKVFSSKGLK
FT                   LQEKSVRELLKYYYELKNAEPLSKIIDGNIIMKKFNLKPGPWIGELLNFATETQLEGTI
FT                   FNTDEALKIVFSKLTHIKKKYKL"
FT   CDS_pept        complement(115482..116705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_064"
FT                   /product="peptidase M16 family zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_064"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13547"
FT                   /db_xref="GOA:B1GZ65"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ65"
FT                   /protein_id="BAG13547.1"
FT                   /translation="MESFRLSNNIKVVFNKTSGINVVSMRIFTPVSVINETSDNAGISY
FT                   LTAKLMTQSTKNRSNEILANETESIGADLSGDADYDTALLSMTFLSEYFDKAADILADA
FT                   VLNPAFDEKELSFEKQNVIAALSCRRDNIGNIAYDEFAKLFYHNTSYAMPVLGAKETVS
FT                   KISCKDLADWHRYSYNTSNILISVAGNIGKNIVKESLEKYFASVPDGKKVEKPVFNIKQ
FT                   HESIKKEIKGKFNQAYIYTGFPAPAISSKDFVSIKVANAILGGKMTSRLFVELRENLGL
FT                   AYEVGAVYTPRKAESYLAVYIGLDKKNIELTLKKTDKILKDFCTLKVDEEELKNTKTYI
FT                   KGLYIMSRQTVSKQSYYYGWREIVGQGCEYDNEYLKQMEKITAQNILDAINKVFLSHSV
FT                   SVIVNPAA"
FT   CDS_pept        complement(116810..118033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_065"
FT                   /product="peptidase M16 family zinc protease"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_065"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13548"
FT                   /db_xref="GOA:B1GZ66"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ66"
FT                   /protein_id="BAG13548.1"
FT                   /translation="MKYENGLTSILINNKNTLTATAIVFVRVGSVDEKPFQSGLSHFLE
FT                   HLMFKGSKNYRGDLMGRNVENMGGYINAATAKEFTMYYINIQKDGLGESIKMLADAMQN
FT                   PLFPQDEIDRERKVVIEEIQRHSDNPAAVIYEKFYETVYEASALKNSIIGTPQVVANVS
FT                   REEIYGYYKTHYIPAKMIVVVSGNFDETAVEKLIGETFGKFEEQSASPDPMLFEKVHDG
FT                   KDIIEYGKVETGYMLTGFLGPAINEEDIYTADTAVNILGSGKSSRLYKALYEKKHLVYS
FT                   TDSYFMTEKGTGNICIISVFDSKNLKKIKDEIKKQIEYIIDGGIAEEELNRATLSIKTN
FT                   WNFSLETPFGTADNIGYWHLMDNPKFVTEHMKKIESMTVSDIINFFKKYYSPATVSNIA
FT                   LLPSAATV"
FT   CDS_pept        complement(119220..120638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_066"
FT                   /product="hexuronate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_066"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13549"
FT                   /db_xref="GOA:B1GZ67"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ67"
FT                   /protein_id="BAG13549.1"
FT                   /translation="MAQNETLSDAGTTNQKMTNYRWTICALLFFATTINYVDRQVLSLL
FT                   QPYLSEKFHWTYSDYANITSAFQFCYAIALLFAGRFIDRLGTKKGYAWALILWSIGSMI
FT                   HAFANGIGNALSPLLSVFGIVMMPVSVVGFIFARFVLGVGESGNFPSAIKTTAEWFPKK
FT                   ERSFATGIFNSGANIGAVVAPLSVPLIAEYFGWEYAFIIVGATGFLWIVFWKYYYDSPE
FT                   KLLKKRKINKAEYNYIHSDTKEQPVENDVKEKSSKNKVRWFRLLSYRQTWSFVIGKFFT
FT                   DCVWWFFLFWLPVFLKSYYGMAGTQLMMPLAVLYTMTMMGSIGGGWLPAYFVNKGMNMY
FT                   PARMAAMIVIAIFPLVVLLAQPLSSISYWWPILLIGIGTSAHQAWSANLFTTVSDMFPK
FT                   KVVASVTGIGGMAGSISGVIISKVGGWLFDHYSTLGHIETGYTIMFAFCAIAYLLAWCI
FT                   MKLLVPKFKPITDI"
FT   CDS_pept        complement(120700..122106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_067"
FT                   /product="glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_067"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13550"
FT                   /db_xref="GOA:B1GZ68"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ68"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13550.1"
FT                   /translation="MKKFLDKDFLLSTEAAKELFHKYAEKKPILDYHCHINPEEIAKDR
FT                   QFENISQLWLGSDHYKWRQMRSCGVEEKYITGNASDSEKFQKWAETLEKAIGNPLYHWS
FT                   HLELRRYFGYEGVLNGETAKEVWTICNEKLREKSMSARSMIKQSSVTLICTTDDPVDNL
FT                   EWHKKIKEEESFDVQVLPTWRPDRALNIEKPGFKDYIARFSEVSGVNITSFKTMKEAFR
FT                   KRLGFFISSGCRTTDHAPEYIMYVPSSDKEVETIFDKRLSGVALSKEEELKYKTAFMLF
FT                   AGGEYSKNDLVMELHYGCKRNNNTLVFDKLGPDTGHDCIDNFAPGAQLSNFLDALDSAG
FT                   QLPRTIIYSLNPNDNAVIGTILGCFQDSSALSKIQQGAAWWFNDHKPGITEQLTSLANL
FT                   GILSNFVGMLTDSRSFLSYTRHEYFRRILCDLIGSWVENGEYPYDVKILSKIVSDISYD
FT                   NAVRYFKFKL"
FT   CDS_pept        complement(122128..122961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_068"
FT                   /product="putative mannonate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_068"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13551"
FT                   /db_xref="GOA:B1GZ69"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ69"
FT                   /protein_id="BAG13551.1"
FT                   /translation="MEWNKKVAVITGAGGVLLSAYAKELASKGVKTAVLSRNLKNAQCT
FT                   AEEITSTGGIAKAYACDVLDKENLIKTEEQIYKDFGQYHILINGAGGNMPNANTTNEIF
FT                   NPKDLNNPNVCSFFDLDSKEIEKVFSLNFMGTFLVSQIFTKRMLGTKGAVIINFSSMAA
FT                   QSPMTKVLGYAAAKAAIDNFTKWLAVHFAEQGLRVNAVAPGFFLTNQNKSLLTNTDGSL
FT                   TSRSHKIITHTPMRRFGEARDLFGALSWLCDEEASGFVTGSIIAVDGGFQAYSGV"
FT   CDS_pept        complement(122948..124042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_069"
FT                   /product="mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_069"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13552"
FT                   /db_xref="GOA:B1GZ70"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ70"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13552.1"
FT                   /translation="MKMTFRWYGENVDPIPLRYIRQIPGVEGIVWALHDIPAGECWTVE
FT                   RIEEVKAQAAKYNFNTDVVESVNVHEDIKLGLPSRKKYIENYKNTLKNLGRAGVKVVCY
FT                   NFMPVFDWTRTDLYKPQSDGSTALFYEKAKVDNINPVKFLEQMSKQEGLLTMPGWEPER
FT                   LSKIKELFEAYKEIKDDDLWENLKYFLQEIIPVAQESGIKMAIHPDDPPWSIFGLSRII
FT                   TCRDNIKKFLSLVDNPSNGLTLCSGSLGSCTKNNIAAIVREFGDRIYFAHIRNIRHFKN
FT                   GDFTETSHKTSDGSLDITEIVKAYHDINYKYYVRPDHGRHIWDEKCRPGYGLYDRSLGI
FT                   MYIFGLWDAFEKISASKRGQYGVE"
FT   CDS_pept        complement(124050..125075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_070"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /note="KDG kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13553"
FT                   /db_xref="GOA:B1GZ71"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ71"
FT                   /protein_id="BAG13553.1"
FT                   /translation="MSKKIVIFGELMLRLAPEGYYRFSQANRYGATYGGGEANVAVSLA
FT                   NFGLKAAFISKMPKHEIGQAGINSLRKYGVDTSFIARGGDRVGIYFLEKGASQRPSKVI
FT                   YDRAGSSISAASKEDFDWDKIFEDVQWFHFTGITPALGDNVAEICLEACKYAKEKKITV
FT                   SCDLNYRNKLWSKEKAGRIMGELCKYVNVCIANEEDAGDVFGIKAKHTDITTGKINHEG
FT                   YKEVAQELKTRFNFSKVAITLRSSISASDNRWAAMLYDGKEFFFSREYLIHIIDRVGGG
FT                   DSFGAGLIYSSINDYAGQKTIEFAVAASCLKHSIEGDYNQVSVDEVKKLAGGNASGRVE
FT                   R"
FT   CDS_pept        complement(125094..126059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_071"
FT                   /product="4-hydroxy-2-oxoglutarate
FT                   aldolase/2-dehydro-3-deoxyphosphogluconate aldolase"
FT                   /note="KHG/KDPG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_071"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13554"
FT                   /db_xref="GOA:B1GZ72"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ72"
FT                   /protein_id="BAG13554.1"
FT                   /translation="MNKLLNEISNIGIVPVVVLDESSHALSLAKALYAGGLGCAEVTFR
FT                   TAAAEESIKIISKKMPEMLVGAGTVLTVEQVDRAIAAGAKFIVSPGLNREIVKYCVDKN
FT                   ITIIPGCTTPSDIETALSLGLEVVKFFPAEAAGGINMIKAISAPYTSIKFMPTGGINIK
FT                   NLNTYLSFNKVIACGGSWMVSKELLKSNNYEAVTKLAKEALCAMLGFEVQHVGINMPDA
FT                   AGANKAASAFESLFGFTKHERSGSFFAGSDIEIMKQQFLGKNGHIAVSTNNAARAVYYL
FT                   RRAGVVFNEGTASYDEAGNLRIIYIKEEIGNFAVHLLQKK"
FT   tRNA            126339..126410
FT                   /locus_tag="TGRD_tRNA06"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGG"
FT   CDS_pept        126571..127455
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_22"
FT                   /note="pseudogene of conserved Fe-S protein (COG1313)"
FT                   /pseudogene="unitary"
FT   rRNA            128213..129792
FT                   /locus_tag="TGRD_16SrRNA01"
FT                   /product="16S ribosomal RNA"
FT   tRNA            129959..130035
FT                   /locus_tag="TGRD_tRNA07"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   tRNA            130090..130162
FT                   /locus_tag="TGRD_tRNA08"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   rRNA            130478..133369
FT                   /locus_tag="TGRD_23SrRNA01"
FT                   /product="23S ribosomal RNA"
FT   rRNA            133615..133736
FT                   /locus_tag="TGRD_5SrRNA01"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        134011..134526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_072"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_072"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13555"
FT                   /db_xref="GOA:B1GZ73"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ73"
FT                   /protein_id="BAG13555.1"
FT                   /translation="MPNVKNQEIVKSLTEKFKDMEGLILTEYRGLTVEEISDLRLKLRP
FT                   FGSEYVVVKNTLSKIAFNGTGIEACENFSGSTALVIESGDIVSPAKVVVEFAKTHAKLK
FT                   IKSGFLEGKFVNVAVIEQLSALPSKEVLIARMLGSMNATVTGFVNVLAANIRGLVTVLD
FT                   AVAKKQAV"
FT   CDS_pept        134853..135230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_073"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_073"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13556"
FT                   /db_xref="GOA:B1GZ74"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ74"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13556.1"
FT                   /translation="MAGLSKDQLIESISSMSVIELSELVKALEEKFGVSAAAPAPAVVA
FT                   GTSPAVATEEKTEFNVILGSVGTSKINVIKVVREVTGLGLKEAKDLVDGAPKTVKENVA
FT                   KAEAEEIKKKFTEVGATVELK"
FT   CDS_pept        135342..139115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_074"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_074"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13557"
FT                   /db_xref="GOA:B1GZ75"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ75"
FT                   /protein_id="BAG13557.1"
FT                   /translation="MNKVNFGRIRIPIDPPSLLKMQKDSFSEFLQQNVAPEKRKLQGLE
FT                   SAFRDIFPLTNSDGNLVLEYVSYAFGEPKYSVEESITRDATYALPLKVKLRLIYKKEDD
FT                   IEKELSEQEVYFGDIPLMTDTATFIINGAERVVVSQIHRSPGVIFEEDEEKRVTVLGKP
FT                   LYFARMIPYRGAWVEFEFDQNGILYVRIDRKRKIFVTTFLRSLGFRTDEEILNLFKEVK
FT                   EVSLDAALTSLTGEYIAEDISDENTGEIIADTGRELQEDLIKKLWAKGFTKVTVFKDVS
FT                   ILLTLKKDTIKNQKEAINYIYKVLKTQEFVVQERAQVFLEELLFKSVRRYDLTKIGRYK
FT                   ILKKLAPIFKYYEKNFNLNIPPETKRTLTKEDVVVTLKYLLMLYSGETEFTENGQTTKI
FT                   VLDDIDHLGNRRVRSVGELLENQIRIGLVQMARTVKEHMNNQDKFNVTPRSLINITQFI
FT                   AQIRKFFGTSQLSQFMDQINPLAELTHKRRLSALGPGGLNRKRAGFEVRDVHHTHYGRV
FT                   CPIETPEGPNIGLITSLSAFASVNPYGLIETPYKKVKNGRATDKIEYLTADKEDEFFVA
FT                   QANTPLDDKGNILSDLVQGRKWDDFLFQSPAKVDYMDVSPMQVISISAALIPFLEHDDA
FT                   NRALMGCNMQRQAVPLLLAEVPLVSTGIEKKVAEDSGVVVVSDSDGEVVSVSSDEIMIY
FT                   SQSKKIEVYELKKYLRSNQDTCINQKPLITLGDIVKKGQIIADGPATSDGQLSLGQNIL
FT                   VAYMPWDGYNFEDAMLLSEKLIQDDKFTSIHIREFKTEARETKEHPEEITKDIPNVGAE
FT                   DLLDLDEYGIVKVGSMVQRGDILVGKTAPKGEQQMTPEERLLRVLFGKKAEDVQDVSLR
FT                   VPPGISGKVIGVRVFIRLEKITDQEKKKKQKEMYSVYEAAKAKLCKDKKEQLEIAKKSE
FT                   TAKIEAIYATKEEILRQNYESEKEKLKKGDDLPVSVNKTVKVYIAAKLKVQVGDKLAGR
FT                   HGNKGVVARILPVEDMPHLPDGTPVDCVLSPLAIPSRMNVGQLLEIMLGWSGKELGVQM
FT                   ITPVFDGASEEQIKDYVEKAKAKILDKKKKLLIAHGLEGVELEESLSKFADESLPTSDC
FT                   KIKLYDGRTGEPFMEKVTIGVMYVMKLNHLVEDKMHARSTGPYSLITRQPLGGKAQFGG
FT                   QRFGEMEVWAIEGYGAAHILQEFLTVKSDDVEGRVKMYDSIIKGESISKPGVPESFKVL
FT                   VSELKSLALNVELFNGKRQKDNHEKMKGVDKK"
FT   CDS_pept        139115..143896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_075"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_075"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13558"
FT                   /db_xref="GOA:B1GZ76"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ76"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13558.1"
FT                   /translation="MVKINFQIKKKKSNGPNFIGFDAVRVSVASPDQIKTWSYGEVKKP
FT                   ETINYRTFKPERDGLFCNRIFGPTKDWECHCGKYKYIKYKGTICDRCGVEVTESKVRRE
FT                   RFGHINLAVPVAHLWFLKKPPSRVGILLNMKISDLEKVIYYAKYIVMGDLKDRSGISFF
FT                   ARKGMLMGGEDFNLFKYGINNPIVKEEFKNIFDGIVCEEIKLDSNLTKALKQLKVLVKG
FT                   QADSAGISTEEAAKKILENVKKGDIYYKVYFKPHSVYYYIDLDPSSHGEIKKILSEKFE
FT                   KSSTVSITETDKKIRIEFFDIEKDKIYNDLRKDSFALKKYEGCLRIEILKNKIPFIENF
FT                   SRSDSFVLLEESDINNIQNGFGDSLKVNIGAEAVRSLLEEINLDDEMKNIYAEIKKTKS
FT                   DAERARLLRKLRVVEGFLNSQTRPEWMILTVLPVIPPDLRPLVALDGGRFATSDLNDLY
FT                   RRIINRNNRLRHIEQLKAPIVMINNEKRLLQEAVDALIDNDSRMRPVTGAGNRILKSLS
FT                   DTLKGKRGRFRQNLLGKRVDYSGRSVIVVGPNLRLNQCGIPKEMALELFKPFIVKELIK
FT                   QENITLRSAKRMLERGDLKVWNILEKVTQSHPVLLNRAPTLHRLGIQAFEPVLVEGKSI
FT                   QLHPLTCSAFNADFDGDQMAVHLPISLEAQLEARVLMMATRNILSPASGRPIAVPSQDM
FT                   VLGNCYLTKEKYGVVGEGKVFSSVSEAISAYQAEKVDLQARIKVAGITSIRDKNLNNDD
FT                   EQPDVTKWKNCKSEDDTEIINYTTVGRIIFNEQLPKNDDGSYALEYQNKSMTKKELVAL
FT                   VDRCYKELGQFKTTVLLDEIKRIGYKYATLAGISISIDEMKVPTEKEKMVREAKTKISE
FT                   IEKQAKLGLITESERYNRIIDIWTRVTDEISDIMFDEMRKEETKAYKPGQNRFNSIFMM
FT                   ADSGSRGSRQQVRQLAGMRGLMAKPQKKLTGGIGEIIETPIISNFREGLTVLEYFISTH
FT                   GGRKGLADTALKTAEAGYLTRRLVDVAHDVVVREEDCGTVNGVFIGTLRCGDEIIEKID
FT                   ERVVGRTALDNVVDIVHDDLIIKRGELITPKKAEKLVEAGIDKIGIRSVLTCESGHGVC
FT                   AKCYGVNPATGEQVEMGEAVGILAAQSIGEPGTQLTLRTFHIGGAASRVVQRSEVYAEN
FT                   NGTVNYYNLKTIQNKDGETIVLSRNAELVYTEYPVYRKQIYQIPYGAVIKIYDGQTVEI
FT                   RVNPITGMKKDILIAKWDPHSKPIISEFDGTVNFVDVKDGVTLQREKSKITGQIERVII
FT                   EHSSDRRSPRIVVKKDDGSVVEYPLPVDTTLVVRDKDRVKSGDILAKIPQEISRTKDIT
FT                   GGLPRVAELFEGRRPRNVAVVSEIDGIVHLVGPTVKGNVKVEVENPETKMKKSYLVRAG
FT                   RHLVVYEGDRVKEGEALSDGAINPHDILKVKGPKEVQEYLVNEIQQVYRLQGVSINDKH
FT                   IEIIVRQMLSNVRITDSGDSHYLNGEIVSRYKYEIDRKAIKGKKGKAPIAHSILLGITK
FT                   ASLSSDSFISAASFQETTRILTEAAVSGQVDYLKGLKENVSIGRLIPAGTGLAAVDIDD
FT                   NNKFYSREQNDAND"
FT   CDS_pept        143883..144278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_076"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_076"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13559"
FT                   /db_xref="GOA:B1GZ77"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ77"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13559.1"
FT                   /translation="MPTINQLITNGRKGIIKKTKSPALKNCPQRRGVCTRVYTVTPRKP
FT                   NSALRKVARVRLTSGYEISSYIPGEGHNLQEHSLVLIRGGRIRDLPGVRYHIIRGTLDT
FT                   AGVDGRKQGRSKYGAKKAKVAKTASAK"
FT   CDS_pept        complement(144302..144619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_077"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13560"
FT                   /db_xref="GOA:B1GZ78"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ78"
FT                   /protein_id="BAG13560.1"
FT                   /translation="MSSYYLIYFYIFILFIMPNPIKYTIFLYLSHYNSYLVIFERISIH
FT                   TLNYHRHKHMKHPKQSATLPQTFSAIIILASFLGHFQLSPATNLHLSATSTPSLPINKN
FT                   Q"
FT   CDS_pept        144621..145100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_078"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_078"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13561"
FT                   /db_xref="GOA:B1GZ79"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ79"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13561.1"
FT                   /translation="MPRKALKPKEKRGLPEPDSKFGSVQIARFISKLNFEGKKSIAESI
FT                   MYGSFDIIKERTGEDPVSVFNRALENIRPLLEVRPRRVGGATYQVPMEVPVIRSTTLAI
FT                   NWLIGIARSKTGKPMREKLAQEIIDASKKEGAAVKKREDTHKMAEANKAFAHYRW"
FT   CDS_pept        145467..147548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_079"
FT                   /product="elongation factor G"
FT                   /note="EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_079"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13562"
FT                   /db_xref="GOA:B1GZ80"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ80"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13562.1"
FT                   /translation="MAREYPLNKVRNFGIAAHIDAGKTTTTERILYYTGRTHKIGEVHE
FT                   GAATMDWMEQEKERGITITSAATYCRWQDMQFNIIDTPGHVDFTAEVERSLRVLDGAVV
FT                   VFDSGNGVEPQSETVWRQADKYGVPRIVFSNKMDKVGADFFMVVNDIEEKLGAKPIPVQ
FT                   IPIGAESSFQGIVDLVTMKAHIWSGEELGAKFDITDVPKELEEKAHAARSEMIELIADY
FT                   SDDIMNNFMEGKESTAVQIKQAIRNATLQIKLIPVLCGTAFKNKGVQPMLDAVCDYLPS
FT                   PLDRKAFKGINPVTSETDSREVDDKAPFSALAFKIQADPYIGKLTYLRVYSGTLESGSY
FT                   VYNPIKDAKERISRIVRMHSNNREEVKSVNTGDIAAAVGLKNTGTGDTLCDEEKPILLE
FT                   SMDFPVPVIDVAIEPKSKADEEKLGIALNRLSEEDPTFRVRTNEETNQTIIAGMGELHL
FT                   EILVDRMKREFNVQANVGRPQVAYRETIRKVQEAESKYIRQTGGRGQYGHVVLTVEPQD
FT                   PGKGYEFVNKIVGGVIPREYIPAIDKGIKEAMTSGTLAGYPVADVKVVVIDGSFHEVDS
FT                   SEMAFKIAGSMAFKDACRKASPVILEPIMKTEVIVPEEYMGDVIGDLNSRRGKIVSMES
FT                   KNKVQHIKANVPLAEMFGYSTTLRSLTQGRGNYSMEPSHYEEVPSQIADKILERTTRG"
FT   CDS_pept        147563..148762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_080"
FT                   /product="elongation factor Tu"
FT                   /note="EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13563"
FT                   /db_xref="GOA:B1GZ81"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ81"
FT                   /protein_id="BAG13563.1"
FT                   /translation="MGKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKVLGDKGLAKYI
FT                   SYDEVARASESQGRRDASKIVTIAVSHVEYSTVNRHYAHIDCPGHADYVKNMITGAAQM
FT                   DGAILVVSALDGPMPQTREHILLARQVNVPAVVVFLNKCDAVEDKELLDLVEMEVRDLL
FT                   TKYNFPGESTPIIRGSALGALEGKQDGVDSIMSLMEAVDNTIPLPARDVDKPFLMSVED
FT                   VFSITGRGTVATGRVEKGRVRVGENVDIVGIQETRKSVVTGIEMFRKLLDEAQAGDNIG
FT                   MLLRGIEKNQVERGQVIAYPGSIKPHKKFRGQVYVLTKEEGGRHTPFFNGYRPQFYFRT
FT                   TDVTGIAHLPEGVEMVIPGDNVTMDIELIMPVAMETQLRFAIREGGKTVGSGVVTEIVE"
FT   CDS_pept        148931..149257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_081"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_081"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13564"
FT                   /db_xref="GOA:B1GZ82"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ82"
FT                   /protein_id="BAG13564.1"
FT                   /translation="MVNEKTVPTQRLRIKLRSYDHKILDDSLAKIVETARRTGAAITGP
FT                   VLLPTNIKKYTVNRSVHTDKKSREQFEMRIHKRLVDICEPSSKTVDELMKLDLPAGVDI
FT                   EIKV"
FT   CDS_pept        149290..149973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_082"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_082"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13565"
FT                   /db_xref="GOA:B1GZ83"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ83"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13565.1"
FT                   /translation="MLKFIIGKKIGMTQVFDVKGNLMPVTVVEVGHCVVTDVRTVEKNG
FT                   YSAVQLGFGEIKEKGLNKAQAVFFKRNNLSYKRTLKEFRVSEVAGFSVGHEIKADAFKA
FT                   GDYVDVSAVTKGKGYAGVIKRHNFGMQPVSHGQSDRTRSRGSSGAQGPQKVLKGLKMSG
FT                   HMGNEYVTVQKLLIVNVDAEKNVLLIKGSVPSANRGTLFISSTLKKIPKVLVAVVHKGT
FT                   KVKKK"
FT   CDS_pept        150375..150995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_083"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_083"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13566"
FT                   /db_xref="GOA:B1GZ84"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ84"
FT                   /protein_id="BAG13566.1"
FT                   /translation="METTVYDAKGEEKGKIELPDFFGKKVSVALLHEVTMAYLNNLRAG
FT                   THKTKTRGEVSFSGAKPWKQKGTGNARAGQKNSPLWRKGGIIFGPQPRNYYTKISKRKK
FT                   KLSLDMAFSAQLKNGNIIVVDSVKVSEVKTKKVAELIKNLKVGGKKIVFAIPSDTDFKV
FT                   AARNIKNVIVENIKNINAYQVLWADKLVITPEAVDLIKERQSA"
FT   CDS_pept        151034..151324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_084"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_084"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13567"
FT                   /db_xref="GOA:B1GZ85"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ85"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13567.1"
FT                   /translation="MDIRNIIKRPIVTEKAVLMKEKSNKYTFVVDKSANKFQIKYAVET
FT                   LFNVKVKSVHTSNCVGKSLKVGRYAAGYRSDWKKAIVKLGKGQEIQLADKV"
FT   CDS_pept        151529..152356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_085"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_085"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13568"
FT                   /db_xref="GOA:B1GZ86"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ86"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13568.1"
FT                   /translation="MPIKTFKPYTQSRRHMSVSSFSNITKTSPEKSLTKIIKKKGGRNN
FT                   TGQIMVRFRGGGHKRFYRIIDFKRDKFNIPAEVMSIEYDPNRSSSIALLQYLDGEKRYI
FT                   LYPLGVNVGDLLVSGPDAGIKPGNSLPISNIPVGTFVHNLELVEGKGGQFVRSAGVAAQ
FT                   ILAKEGDYAHVRMPSGEIRLIRVKCYATIGQVGNLDHENITLGSAGRNRHMGRKPHVRG
FT                   TAMNAVDHPHGGGRGRSKGNNQPRSPWNQPAKGFKTRPKKIWDWVIISRRNKS"
FT   CDS_pept        152384..152668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_086"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_086"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13569"
FT                   /db_xref="GOA:B1GZ87"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ87"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13569.1"
FT                   /translation="MSRSTKKGPYVDEKLFEKMQKLNKTGDRKVVKTWARASVITPEFV
FT                   GHTIAIHNGKKFFPIFISEQMVGHKLGEFAPTRTFKGHGGMTKQETSLV"
FT   CDS_pept        152778..153125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_087"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_087"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13570"
FT                   /db_xref="GOA:B1GZ88"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ88"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13570.1"
FT                   /translation="MEAKATAKFVRYTPRKVNQVLALIRNKKVEKTLEILSFLPKSTAV
FT                   LVKKVLKSATANAGKFEDYSGLKVKEAWVGNGPILKRIRAGSKGRSMPIKKRTVHLTII
FT                   VTDASTYLRKK"
FT   CDS_pept        153204..153899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_088"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_088"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13571"
FT                   /db_xref="GOA:B1GZ89"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ89"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13571.1"
FT                   /translation="MGHKIHPKSIRLGYIKDWESKWFNLKEMPNFIEEDYRIRVYLKNR
FT                   LKLASVSKIVIERPGKYLRVSIYTARPGIVIGKGGQGIESLRKEIETMTAKKTFVNIME
FT                   IKRPEIDAQLASENIAFQLEKQIAFRRVMKRTIEKAMMSGVQGIKVMVSGRLGGAEIAR
FT                   TEWLKEGRIPLQTFRADIDYGFSEACTPMGHIGVKVWIFKKEFFKKTAKELAEDAKVVV
FT                   DLDTAAKQG"
FT   CDS_pept        153976..154389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_089"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_089"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13572"
FT                   /db_xref="GOA:B1GZ90"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ90"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13572.1"
FT                   /translation="MLMPKRVKYRKMHRGRMKGKAKGGVSLAFGKYGLQALEPVWINSN
FT                   QIEAARIALARSIKKGGKVWIRIFPDKPVTKKPAETRMGKGKGDPQFWVAVVKPGRVMF
FT                   EMEGIPETEAKKALRLASNKLPIHTKILVRADI"
FT   CDS_pept        154397..154600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_090"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13573"
FT                   /db_xref="GOA:B1GZ91"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ91"
FT                   /protein_id="BAG13573.1"
FT                   /translation="MKSKNWNEMKNMSRVELNEKLSELQDKIFRLRFRHLTVPVKNPLE
FT                   IREIRKDIARIKTLIAQKKKTK"
FT   CDS_pept        154636..154899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_091"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_091"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13574"
FT                   /db_xref="GOA:B1GZ92"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ92"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13574.1"
FT                   /translation="MAERGKRKFRTGIVVSDKSNKTRQVSVERTYRHSLYDRVLRSKSK
FT                   FIVHDEKNISHVGDTVKIMESRPLSKMKRWVLVEVVNKTSEI"
FT   CDS_pept        154925..155293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_092"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_092"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13575"
FT                   /db_xref="GOA:B1GZ93"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ93"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13575.1"
FT                   /translation="MIQERTILNVADNSGARKIRCFRVTKGLKRRYASIGDVIHASVQD
FT                   ALPHANVKKGDVVKAVVVRTVKEIRRADGTYIKFDDNATVIINDEGEPKGTRIFGPVAK
FT                   ELRENNYLKIISLAPEVI"
FT   CDS_pept        155499..155810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_093"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_093"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13576"
FT                   /db_xref="GOA:B1GZ94"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ94"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13576.1"
FT                   /translation="MLNIKKKDKVLILSGKDRGKKGEVIYVSPDKGKVIVTKINVVKRH
FT                   TNPTRKDLGGIHKKEAPIAISKIMLICPKCSRGSRAKFDKLSDGKKIRVCRRCGEVIV"
FT   CDS_pept        155968..156531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_094"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_094"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13577"
FT                   /db_xref="GOA:B1GZ95"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ95"
FT                   /protein_id="BAG13577.1"
FT                   /translation="MNQPRLKEFYHKSVTAELKKQFSFKNVHQIPRLTKIVVNIGLGEA
FT                   KENIKVLDIATEELAAITGQKPLICRAKKSLSNFKIRQGMPIGIKVTLRSAMMYEFLDR
FT                   LINVAIPRIRDFRGIESSSFDGKGNFNLGLAEQYIFPEINVEKTDKARGMNVTIVTTAE
FT                   KDDHAKVLLESFGMPFKKGLINNK"
FT   CDS_pept        156550..156735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_095"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_095"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13578"
FT                   /db_xref="GOA:B1GZ96"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ96"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13578.1"
FT                   /translation="MATTSAEAKMRKPQKFATRYRNRCRLCGRPRGYYRDFGICRICLR
FT                   KLAYNGEIPGVTKSSW"
FT   CDS_pept        156766..157167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_096"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_096"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13579"
FT                   /db_xref="GOA:B1GZ97"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ97"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13579.1"
FT                   /translation="MIIDPISDMFTRIRNANLKLHEKVDVPSSKLKLGIAKILKEEGYI
FT                   SNYEIKGIENQTQSVLRIHLRYTSKGKVVLQGIKRISKSSLRIYKGHSDVPRTIGGLGV
FT                   TIISTSKGLMTDGQARKDKIGGEVIGCVW"
FT   CDS_pept        157269..157835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_097"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_097"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13580"
FT                   /db_xref="GOA:B1GZ98"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ98"
FT                   /protein_id="BAG13580.1"
FT                   /translation="MSRLGKKPVYMPEKVKAEFKKGILEVTGPGGKLSQVIDKKMNVKV
FT                   DKSTILVEALGDSRRHNMLHGLTRGLVVNMVEGVTKGFKKELEIIGLGYKANVESGKNL
FT                   IMAVGFSHLVTIPIPCTVKASVLLTPDKNTLITVTGIDKYEVGAFAARIRAVKPAEPYK
FT                   GFGIKYSGENIIRKAGKAAAGAGKK"
FT   CDS_pept        157844..158203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_098"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_098"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13581"
FT                   /db_xref="GOA:B1GZ99"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZ99"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13581.1"
FT                   /translation="MKDSNKRFDYRVKRVRSKINGTHDKPRLSVYRGHKHIYAQIIDDS
FT                   RGVTLASASTLSPELKGKLEINDTVEAAKSVGGLIAKKAVEKGVKKVVFDRRGYEYTGK
FT                   IKALADTARESGLEF"
FT   CDS_pept        158586..159086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_099"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_099"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13582"
FT                   /db_xref="GOA:B1GZA0"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZA0"
FT                   /protein_id="BAG13582.1"
FT                   /translation="MAEQSAIQQQSDSSLKETVITVNRVAKVVKGGKRFSFNALVVVGN
FT                   GSGKVGCGLGKANEVQSAIQKGSMYASKHMISVRLKGNTIPHEIIGVSGSGKVLLKPAA
FT                   PGTGVIAGGMVRAVLEAVGIKDILTKSMRSSNPFNVVYATVEALKKLRSKEDVAKIRMK
FT                   EVV"
FT   CDS_pept        159083..159532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_100"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13583"
FT                   /db_xref="GOA:B1GZA1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZA1"
FT                   /protein_id="BAG13583.1"
FT                   /translation="MIGLNNLKPAKGSKHRKKIVGRGVGSGHGRTSTRGCKGQKSRSGD
FT                   GSKKIGFEGGQTPIFRRIPKRGFRNNHFRGEYEIVNVDKLDKFEMGAEITPTSLKEAGF
FT                   VAKTRLVKILGGGNVKKPFTVKVAAFSKSALDKIKAAGGKAEIVK"
FT   CDS_pept        159577..160923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_101"
FT                   /product="protein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_101"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13584"
FT                   /db_xref="GOA:B1GZA2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZA2"
FT                   /protein_id="BAG13584.1"
FT                   /translation="MLNNFADIFKVPELRKKVLFTLFIIIAYRIGAMVPIPGINVEALK
FT                   SFFATQNNGLLGFLDMFSGGALNRMSIFSMGIIPYINSSIIMSLLQGAHMIPYLDRLGR
FT                   DGEQGRKKLTQITRYGMVLLGMFQSFGWMMMIIRIHSPSRMPVVVDPSWPWIILAGSTL
FT                   VAGSVLIMWLGEQVTERGVGNGISLIIFSGIVERLPHTVLSIVKLIQMEELSVIFALML
FT                   AVVVIIVLVLVVWIETAQRKIPIHYAKRVIGRKMYGGQASFLPIKVDQSGVIAVIFAVS
FT                   VLSAPLILVQFTTEWTVWNFPIVRKITEWLSGTNSVIYSLVYASIIIFFCYFYNSISFN
FT                   PKDLADSMKKSGSFIPGIRPGESTSIYIQKVLERVTLVGALFIACIAVLPDYLRSAIGS
FT                   PFFFGGTSLLIVVGVSLDTVGQIESHLIMCHYEGFIKDGRVKGRWFKVK"
FT   CDS_pept        160927..161565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_102"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_102"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13585"
FT                   /db_xref="GOA:B1GZA3"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="InterPro:IPR036193"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZA3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13585.1"
FT                   /translation="MNYIILGPPGAGKGTQAKKIAVKFGILHLSTGDMFREAKKSDESI
FT                   SKLLSSGQLVPDEIVVNMVRKRLEKNNIKKGFLLDGFPRTVKQTGELDRMLMSENIKID
FT                   SVFLISVPFEEAAKRIAGRIVCACGASYHTMLLPPKEFGKCDCCGGVLFHRSDDKEEDI
FT                   IRDRFSVYEKQTKPLIEYYKESGLLIYIDGLKSESDVFEQISGCIINGE"
FT   CDS_pept        161567..162346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_103"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_103"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13586"
FT                   /db_xref="GOA:B1GZA4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZA4"
FT                   /protein_id="BAG13586.2"
FT                   /translation="MFFEKRNIELKTMKEIERMRTASSVVGEILQKLSEIIKPGITTKD
FT                   IDIFSEKYIRSLNMVPAFLGVKGISCPFPASACVSVNDEVVHGIPNTSRVLKSGDIVSV
FT                   DMGVIYEGYYGDAAMTYAVGDISTSAAKLLEITELSLQKGIEQALSGKRLGDISYAIQK
FT                   TAEDAGFSVVRDFVGHGIGRSLHEEPQIPNFGRACVGIKLLPGMVLAIEPMVNAGSYEV
FT                   CMLDDSWTVVTKDGGLSAHFEHTVAITENGCEILTKV"
FT   CDS_pept        162348..162566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_104"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_104"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13587"
FT                   /db_xref="GOA:B1GZA5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZA5"
FT                   /protein_id="BAG13587.1"
FT                   /translation="MGKEEKIIVDGKILESLSNALFKVEIEGKHIVLAHICGKMRMHYI
FT                   KILPGDKVKVELSPYDLKRGRITYREK"
FT   CDS_pept        162810..162959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_105"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_105"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13588"
FT                   /db_xref="GOA:B1GZA6"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZA6"
FT                   /func_characterised="similar sequence"
FT                   /protein_id="BAG13588.1"
FT                   /translation="MDTRYRNKAEYKMKVKASVKPICQKCKVVKRKGVVRVICQDPRHK
FT                   QRQG"
FT   CDS_pept        163105..163497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_106"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_106"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13589"
FT                   /db_xref="GOA:B1GZA7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZA7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13589.1"
FT                   /translation="MARVAGIDLPNNKRLDIALRYIYGIGPAISDEIIKELSLNPAKRV
FT                   KDLTEEEVGRINNLITKNLKVEGDLRREVQSNIKRLIEIRSYRGLRHRRNLPVRGQRTK
FT                   TNARTRRGKRKTVGAGKSTSSIKRVK"
FT   CDS_pept        163811..164206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_107"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_107"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13590"
FT                   /db_xref="GOA:B1GZA8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZA8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13590.1"
FT                   /translation="MAGEKNAVGSSKKKKYTGGVAKAYILSTFNNTIVNITDEKGNTLA
FT                   WASAGVSGFKGTKKGTPFAAQMTAASVGRKVMGIGVKQIAIFIKGPGPGRETAIRGLQS
FT                   SGLGITTIKDITPVPHDGCRPPKLRRV"
FT   CDS_pept        164290..164916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_108"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_108"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13591"
FT                   /db_xref="GOA:B1GZA9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZA9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13591.1"
FT                   /translation="MSRYLGSVCKLCRREKEKLFLKGERCSSNCALNRKRGKNSPGQHG
FT                   ASKVKMSDYAKHLREKQKARRMYGLTEEQFSNYYKTAEKMKGSAGDNLLKLLELRLDNV
FT                   VYRLGLASSKKMARQIVNHGNILVNEKKIDVPRYRLKIGDVITFPEKYKSNVIIKKLIE
FT                   KMVSSIPAWLSFDKSRIAGTVVSEPLAGETSHPINSQLIVEYYSK"
FT   CDS_pept        164957..165928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_109"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_109"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13592"
FT                   /db_xref="GOA:B1GZB0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB0"
FT                   /protein_id="BAG13592.1"
FT                   /translation="MKALDLEKLRKLILDEKTATKFYGHFSAGPFERGYGHTIGNSLRR
FT                   ILLSSLEGAAITSVKIAGAFHEFAVLKGVKEDVAQIVLNLKRIKVKLHSEGPEKLYLKV
FT                   KKAGTVTAKDIEANASVEIMNPEQEIANIDNGTTLEMELEASLGKGYVLAEEMKSNGYS
FT                   SGTIILDSLFSPIIKVNYEVENTRVEQTLNYDKLIIEIWTDGSVSPKDALMRSAEILRK
FT                   ILVIFTDNAFKTEEVSADKEEQDGILGKPVSIMDISVKTLKSLKSAGIETVEDLVKIKE
FT                   EDLLNFNNLSKRSCEEIKNRVKELGLSLGMKIEDGEVNDKNL"
FT   CDS_pept        165912..166265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_110"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13593"
FT                   /db_xref="GOA:B1GZB1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZB1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13593.1"
FT                   /translation="MIKTYNGSKLGIASSHRKALLRNLAAALFLYEKITTTLSKAKELV
FT                   SYSEKLVTKAKKADLSAMRAINGEINSKAAVKKIFDILVPRYKERSGGYTQILKVGTRR
FT                   GDSADVAIVKLVT"
FT   CDS_pept        166519..167547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_111"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_111"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13594"
FT                   /db_xref="GOA:B1GZB2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB2"
FT                   /protein_id="BAG13594.1"
FT                   /translation="MFNYIFGLFSNDMGIDLGTASVLVFIKGQNIVLREPSVVAMERDT
FT                   KRVLAIGMEAKKMLGKTPANIIAVRPLRNGVIADFEATEKMIRYFIRKVHKKRTLLHPR
FT                   IVIGVPSGITEVERRAVRESAEQAGAREVYLIDEPMAAAIGAGIQIQEPEGSMIVDIGG
FT                   GTTEVAIISLGGMVIAKSLDIAGDKMDEAIVQYFRRKYNLTIGENTAEVVKMKIGSVFP
FT                   LEEELSVDVKGRDLLTGLPKTVNISSEEVRVALSEPIKKITEIVKNVLEETPAELSADL
FT                   IDRGIILSGGGSLVKGLPDLLSKETELPVNRADDPLGCVAKGTGSYLDELDNIKNSRKR
FT                   RM"
FT   CDS_pept        167603..168436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_112"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_112"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13595"
FT                   /db_xref="GOA:B1GZB3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB3"
FT                   /protein_id="BAG13595.1"
FT                   /translation="MCQHQKSKYENIIFVFLLLIGFFFIAGRLTSPVKLIKNLVYYISY
FT                   PTLRTADCIFRSMETFADNVKAIVYTHRENIVFKQKNQELTDKLRSYDAISEEYNNLSR
FT                   LLKLTKIKNIICVFAGISFGALDERYQWYILDKGGADGLYNELPVAMLNKENDILCVSG
FT                   KIIETYKTSSKVVLITNSISILPVEIKDKGINCLAEGSNSSLLKITYIPFDADVKPGDE
FT                   IVVSGLSAVFQKGMPVGVITAVSEGVSADFKTAAAKVFYENNILNKAVVLVPQKE"
FT   CDS_pept        168433..168939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_113"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_113"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13596"
FT                   /db_xref="GOA:B1GZB4"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB4"
FT                   /protein_id="BAG13596.1"
FT                   /translation="MKKLIFYFFLYFIFCMLQFFFGRYINIYGIFPNFILIFVVYLGLS
FT                   KGIINTQLMGFLFGLTWDVFSTDIFGIRTVMFTVIGYLAGRFCKDFDREKIFTQIVIMF
FT                   FAGAIYWLGFGLIYFIFLDNGNCAFSFSILSVSSKILVTATFAPLVFYILEKMDIIWHH
FT                   DTTER"
FT   CDS_pept        170099..171880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_114"
FT                   /product="rod shape-determining protein MrdA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_114"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13597"
FT                   /db_xref="GOA:B1GZB5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB5"
FT                   /protein_id="BAG13597.1"
FT                   /translation="MVWQKEDISAYEAFLKKHKMILVFFIFLFICLSMRLFYLQIVKGS
FT                   SYRKVSEQQRIHNTYERAPRGVIYSADNAILAENEFSYVALFYPFEQQWTLSDESIKEL
FT                   NKILGRNIKFTADKNWRYGTFIKLADNITIEEMFKIKEKKLILKDISVIKKPHRIYYYP
FT                   EVASHIIGYIGEIRADEIEELSEQGYKVGDYIGRGGVEQSYDKYLQGRDGDWQTEVNAK
FT                   GYKVKSFKYVPPEIGASVYLTVDLKLQKVAYDALKNSSTGRGAAVVLDTRTGAVKALVS
FT                   CPGFDTNRVGTKDFGIYLKDKKLPLFNRSLQALYPPGSLFKIITFVAAVELLNVDAEKT
FT                   MHCDGSFELGDRHYSCWYKPGHGEMNLISATVQSCNIYFYQLGLKLGIKNLEKYAKNFH
FT                   LGQKTEIDLPNEKRGFVPSPEWKKLKSKVSWLQGDTVIFAIGQGALWATPLQMAYIIAA
FT                   VANKGVYYKPYIVDRVIDFNGNEVYKHTLECAGRTDVSDRTWDLLYKALLEVVESGTGR
FT                   RSRLSGIKIAGKTGTAQNPHGKDHAWFISYAPADSPEIAIAVIVENGGGGGLNAVPVGR
FT                   KIYEAYFNVESEKEEQQ"
FT   CDS_pept        170467..173798
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_23"
FT                   /note="pseudogene of carbohydrate-selective porin OprB"
FT                   /pseudogene="unitary"
FT   CDS_pept        171877..173223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_115"
FT                   /product="rod shape-determining protein MrdB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_115"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13598"
FT                   /db_xref="GOA:B1GZB6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB6"
FT                   /protein_id="BAG13598.1"
FT                   /translation="MIDKKQFFQHLISDIDWRLISVLLILMLISFIAIYSAGVNYRISF
FT                   KYLSVQILAFGIGFIWIFLFASFNYQHYRRFDKFIYISSLALLVSVLIFGSVKRGTRGW
FT                   FDFGFISFQPVEIAKVMFILALASFLDKRAEESRKISFLIYAFTILAGHLVLIVMQPDF
FT                   SSTLSYFPVTLVLLFMAGVNPFYLLCSTVLGSLAAGIPLLETFLDMPLKSLGSETFLTS
FT                   LGVSLKTGWTGIYIIAAVLFLIAGGWYLLWKFRVKIPIIYPAVLCGAILIGCAASIPVE
FT                   KSLKDYQRKRLVVFLNPKVDPRGAGYNIIQSKIAIGSGRFTGKGFKRGTQTQLGFLPEQ
FT                   HTDFIFSVIGEEGGWIISQLTLFLYIFFIWRALVIAKEARDRYGSLVAVGFAAMFTFYA
FT                   VINIGMVMGIMPVTGMPLLLLSYGGSSIFSSLCAVGILCSIHIRRHIYY"
FT   CDS_pept        174060..174145
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_24"
FT                   /note="pseudogene of RloB-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        174608..176083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_116"
FT                   /product="anthranilate synthase"
FT                   /note="anthranilate synthase component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_116"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13599"
FT                   /db_xref="GOA:B1GZB7"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB7"
FT                   /protein_id="BAG13599.1"
FT                   /translation="MIRPSFEEAKKFFEDCTIVPVCTEIFADIRTSVEILKIFTSANKK
FT                   CYLLESVESFAFGETWGRYSFLGCDPKFTVRCNNNKIFIDNGAKKEITTDNPVKILRDI
FT                   ISEYKSPKIEYMPPFTGGLAGYFSYDFVKYGKKSLNLSNLNDENFDDFYLMLFDTIIAF
FT                   DHLKQKIFIVVNVPVRDFEKNFIKAEEKLKKMEYLIRNGVAKKEQKSELKSDFKMLHDK
FT                   KEFINMVEKVKGHIREGDIFQAVISNRAEADFSGSLIQTYRVLRTTNPSPYMFYFNFGD
FT                   IEIAGASPETLVTLKNKKITNYALAGTCRRGANAAEDEFLISQLLNDEKELSEHNMLVD
FT                   LGRNDLGKVSEFGSVKVTEYMKILKFSHVSHIASVLSSTIEDGYDHLDALSAVLPAGTL
FT                   SGAPKKRACEIINDLEKHKRGTYGGAIGYIDFTGNMDMCIAIRMVKLQNGKVYVQSGAG
FT                   VVADSDPEKEYNECSQKARAVINALQIAQEEKI"
FT   CDS_pept        176080..176658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_117"
FT                   /product="anthranilate synthase"
FT                   /note="glutamine amidotransferase component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_117"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13600"
FT                   /db_xref="GOA:B1GZB8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZB8"
FT                   /protein_id="BAG13600.1"
FT                   /translation="MILIIDNYDSFSYNLYQYVGTINKDVKVIKNDEMTVKEIEELNAT
FT                   NLIISPGPGRPDAAGVCEETIKYFKGKIPILGVCLGHQAICEVFGAKITYAKTLKHGKT
FT                   SDIHIANGSPVFKGLSPVLRAARYHSLIADRATIPDELLVIAEDEESQVMGVKHQDCDL
FT                   YGLQFHPESVLTKNGMTIIENFLSLRGTR"
FT   CDS_pept        176655..177665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_118"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_118"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13601"
FT                   /db_xref="GOA:B1GZB9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZB9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13601.1"
FT                   /translation="MIREAIYEIVNRNNLTIDKTKEVMNRIMDGGATDAQIASFLTSLR
FT                   LKGETIEEITACAMVMREKCQKLNPEFDVLDIVGTGGDELATFNISTISSFIIAAAGVP
FT                   VAKHGNRSVSSKCGSADLLEVLGVNIMLTPQQCEAILKKVGMCFLMAQTFHSSMKYVAK
FT                   VRKELGIRTIFNILGPLANPAKASYELIGVYDENLVEPIASVLVNLGVKRAMVVHGHDG
FT                   LDEITLSDTTTICEVNRGRLNSFFITPEQFGLKRCSLSELIGGTPQENREIALNILNGE
FT                   QGAKRDTVVLNSAVCLYMFYDNMTLKQCLRMAQDMIDSKKALNKLDEFIKASHET"
FT   CDS_pept        177997..178773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_119"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /note="IGPS"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_119"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13602"
FT                   /db_xref="GOA:B1GZC0"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZC0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13602.1"
FT                   /translation="MILDKIVAATKVRVEKAKLQKSFKTAKREALLNKKKNFVSFKKAL
FT                   SKAGINFICEVKKASPSKGLISTDFKYKEIALEYEKTGAAAISVLTEPNFFLGSIRYLQ
FT                   EIKSIVKIPVLRKDFIIDSYQIYESRVIGADAVLLICAVLSYDVLKEFLETAQGLGMSC
FT                   LVEAHNEEEIETALKAGAEIIGVNNRNLRTFEVDFGNSMKLRRLVPVDKIFVSESGIKT
FT                   KKHIDILKANDVNAVLIGEELMKSGNIAERLRELKD"
FT   CDS_pept        178987..179589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_120"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13603"
FT                   /db_xref="GOA:B1GZC1"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZC1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13603.1"
FT                   /translation="MPKIKICGLKREEDVSFVNIAKPDYAGFVFAGVKRKIDFNTAVRF
FT                   RSLLDDTIQSVGVFVNDKIDNIVNLCEDKTIDLVQLHGGEDESYIGRLKERIKKPVVKA
FT                   VRVKDKIYSAATKADFMLFDTYSSFEYGGSGKIFDWDLLKEFRNPFFLAGGLNRDNIAE
FT                   AVKKLNPYCVDLSSGVETNGVKDLNKIIETVKILRSL"
FT   CDS_pept        179748..180932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_121"
FT                   /product="tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_121"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13604"
FT                   /db_xref="GOA:B1GZC2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZC2"
FT                   /protein_id="BAG13604.1"
FT                   /translation="MSKGKFGIHGGQYITETLMSAVNELESAYNSFKNDGHFNEELTAL
FT                   LNGYAGRPSELYYAENVTEKLGGAKIYLKREDLNHTGSHKINNVLGQTLLAKKMGKKRV
FT                   IAETGAGQHGVATATAAALLGMECEIFMGEEDTERQALNVFRMQLLGAEVHPVKSGTKT
FT                   LKDAVSETMREWSKRVDDTFYVLGSVMGPHPYPQIVRDFQSVISKEIKEQLMKRESVLP
FT                   SAVIACVGGGSNSIGAFYNFINDNEVRLIGCEAAGKGVDTFETAATIAKGRLGIFHGMK
FT                   SYFCQTEKGQIAPVYSISAGLDYPGIGPEHAYLHDTKRAQYVPVTDDEAVGAFEFLSKT
FT                   EGIIPAIESAHAMHYAIKIAPEMKKDEIIVVCISGRGDKDVAMIAKYKGVNINE"
FT   CDS_pept        180925..181737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_122"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_122"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13605"
FT                   /db_xref="GOA:B1GZC3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZC3"
FT                   /protein_id="BAG13605.1"
FT                   /translation="MNNIRSSTAASKSRWLITEIFKNGKALITYLTAGDPSLDKTEDYI
FT                   LTMAENGSDLIEIGIPFSDPVAEGETIQNAMTRALSKNIDLDDIFNVVENVRKKSNVPL
FT                   VFMTYLNPLFSYGYEKFFKKCASTGINGIIVPDMPFEEQEEIKSFTDKYDITIITLIAP
FT                   TSKERISVLAKQAEGFIYLVSSLGVTGVRSRITTNIDAIVSEIKKVTDTPVAVGFGIST
FT                   PEQAKKVTKSADGVIIGSAVVKIIAEYKESAASKLAEYVSEIKRVMQD"
FT   CDS_pept        complement(182181..185705)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_25"
FT                   /old_locus_tag="TGRD_123"
FT                   /note="pseudogene of conserved hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        186168..188768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_123"
FT                   /old_locus_tag="TGRD_126"
FT                   /product="type III restriction-modification system
FT                   methylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_126"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13609"
FT                   /db_xref="GOA:B1GZC7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZC7"
FT                   /protein_id="BAG13609.1"
FT                   /translation="MQNINEAKFYQALENIFTGAKIEGDGGYINLLKIKSSYYKLILER
FT                   FKKDVSAESGIIKDSFKEEFFDKLYSFFEKYFSESGSVYFVKTANWQRVYEQVYTDNKD
FT                   VILFWKTHMLYYVKSDILFKDISAEISDEQNGWAYNFHFDVGTLKNKQNNEKKNLFFDF
FT                   SKKEISEKDGKKTYYFNVNYSEGGKKTKTSEISGKLKIKEGILEKAFAVFKKQSEVDFF
FT                   INKNADAFLNEQLDLYLHQILLNTENKFDQERLDQLKTIKVFAEKIISFIAQFENELVR
FT                   IWNKPKFVLNSNYVITLDKLTDEIINKLSKHSNLKEQIKEWQELGMVDNNFSFSERSEA
FT                   HKYLSIDTKRFKDLELDILALFDNLDEALDGRLIHSENYQALNTLQERYKEKIQCIYID
FT                   PPYNTNSSPIIYINNYKDSSWLTIIHNRMELSRKLLKDNGINITAIDDIELRYLTVLQD
FT                   NVFGKNNYITTIITKCNPQGRVADKISKTTEFHILHSKNLATIGKLFIKKNDEKKPFPL
FT                   KRGGTNSKRVERPNRYYPILVKDNKIYMITDEEYSKIYNREKQLFNDNFVESLKNKYES
FT                   QGFSFILPINQRDEKVVWQRKFERVKEEKETYIVKNNIIYTSSSDVEIPKTLWQDAKFS
FT                   NPQYGSSYLKDILGHNKFETPKSINTIKQFLSMFESTGIYLDYFGGSGTTAEAIISANK
FT                   EDDGDRKYIIIELGAHIDTIIIPRIKKIIFSDCWKNGISQNGKGVSQFFKYYSLEQYEN
FT                   TLRNMKYSENIPSTLWDTKNPFETYIFKADQKFADVLSIESEILEVDFNKLYKDIDFAE
FT                   TISNLKGLPIKRITKTGVLLDGENKEMKTNYKDMANSEKIEFIRLLKPLLWWGE"
FT   CDS_pept        188793..189675
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_26"
FT                   /note="pseudogene of RloC-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        189675..192458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_124"
FT                   /old_locus_tag="TGRD_127"
FT                   /product="type III restriction-modification system
FT                   restriction subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_127"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13610"
FT                   /db_xref="GOA:B1GZC8"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZC8"
FT                   /protein_id="BAG13610.1"
FT                   /translation="MKIILEKILEQIDYDQLNNWQLPSISCFSENKNLEGFPYQKQALK
FT                   NITKALYLSFKTFQNGNASPDKQTLHTKYKEYGLKDKAFAVRKFTNNKDKSIGNTSGRF
FT                   KFFQNYSKDYKVLGGGTEEYVADAAFLNRACFWMSTGSGKSIVLIKTIELLDYLQKQKL
FT                   IPRKEIMLLLPREDLIKQFKREIEEFNKSRERKIELINLINYEDDKQGFNYDHSIKVYY
FT                   YRSDLLRDERKESILDYRNYDNEGNWYIFLDEAHRGEKENSSAQNYVSVLSRNGFLFNF
FT                   SATFTENIDYSTTCFNFNLEKFISEGYGKNLYLSHACFTFAAEKNELSEIEKQQQVLKS
FT                   LLAFTLIKKSKKQGYYHEPLLITLVNSINTADSDLLLFFKKIEEIATDSIAYQIFDKAK
FT                   DEFEQELSDNKKYIFGQEKFSFDKELFDKIILKDLLENIFNTKKPGKIELLEGEKEKEI
FT                   VLKLETTDKPFALIKIGDAKKFQREKLGGNYQYVTSPEKKTVFQGINDNEDINLLLGSR
FT                   SFYEGWDSNRPNVINMINIGGKEAKKFVLQSIGRGVRIEPVKGKRKRLPENDTNKNRLL
FT                   ETLFIFATDKNSIASIFETIEEQKTKDEELKGIFKNTPHFELYIPKYEEEAPRNNFAKF
FT                   NLSEQTKENIREYIKEFNKNLLLLKHDISLENLNLLLEKIDDDNFFQIKEDNVYNDMDF
FT                   LFNKLISHTAVKNKKFSGLKELEDEIIHFKHIKISNLETENVELLNSEIEDVKTGKKKE
FT                   AEFRELKIKNIAKHYYLPLIYSRKEKIDYINHIIVNESEVKFIQALEKYISRENISSEW
FT                   MFSKIDETLDEKIGIPYFYRKDNRYRKFSPDFIFWIKKGNNYKIIFIDPKGTSHADYEN
FT                   KVDDFEKLFLSLNTPYPYKGLNIEFDLRLYTDDTNNPIGGKYKKYWHTNGDFSFLK"
FT   CDS_pept        complement(192804..195338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_125"
FT                   /old_locus_tag="TGRD_128"
FT                   /product="B12-binding radical SAM protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_128"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13611"
FT                   /db_xref="GOA:B1GZC9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZC9"
FT                   /protein_id="BAG13611.1"
FT                   /translation="MKENTTMENCWKVREKSSCYTQLMKKLSKINEILNIVKKPARYIN
FT                   SELNSHPADMSADFSVVLCFPDIYEVGASNLGIEILYHLINEKKLARCERAFAPDIDLE
FT                   LLLKEKKLSLFSLESGSDLKSFDILGFTIQCELVATNIVNILDLSGISIFSKDRKDDEP
FT                   LIIAGGPALTNPEPFCDFFDMFVLGDGEEAIENIISVCKESKKAGLSRLETLKNLSKID
FT                   GVYAPSFYNVKYNDDNTVKSVIPVSEDIKPVVKKRILNLENAYFPGKKIIPFVKTVHDR
FT                   LNIEVARGCPGQCRFCQASKYYHPWRQRPPEKLLDLIKKGIQSTGFEEISFSSLSCSDY
FT                   KNLDELLIETNNLCGKSNLSISLPSLRCNKHSLKVARYVNTSKRPTLTFAPEAGTERMR
FT                   NVIGKYLSEKQIVETLLTASAMGWKVIKLYFMIGLPTEADEDIAGIERLVKLVRKKAKD
FT                   LNFNITVSPFVPKAQTAFQWAPMAGADEIKRKINLLNKLLPANVKTHNRRAGILEALIA
FT                   KGDRRLSSVIYKAWQKGARFDQWTDKFVSDIWDEALAESGIDLNFYVYRNIKYDEILPW
FT                   EHLNFGMSKEALYKEYTKGINETVDIAAIQSYEAQCILPENYAEIKIPADAPVMRLRLR
FT                   FSKKGAVRFVSHLEQVEVFRRTARRSGLPVAFTAGFSPQVKSSYGPPLSVGQESSSEYM
FT                   ELYFTQKVNIENVKLEFSKALPDGFRLLDVKKVPLNFPAINILSNISEYKIKNADIAQE
FT                   KIDKFLSQGLIIVEKTKKGKTVEIDAKPLIKSFKNENSVLKLQLRFSSGKSVRPEAVLK
FT                   KLLGNQDNSGKIYAVERTNLYIETKNGEIYEP"
FT   CDS_pept        195812..197587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_126"
FT                   /old_locus_tag="TGRD_129"
FT                   /product="putative kef-type K+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_129"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13612"
FT                   /db_xref="GOA:B1GZD0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD0"
FT                   /protein_id="BAG13612.1"
FT                   /translation="MHEYHLLEIMAVGFTLALAFGFITQKLGLSSIVGYLLAGFFIGPA
FT                   SPGFVANYGLASQLSEAGVILLMFGVGLHFKTEDLVAVKGVAIPGAIIQSAIATVCGIL
FT                   TGTALGLDLKSALILGFGLAVASTVVLLRVLNDNDIVGTVHGHVAIGWLIVEDILTVLI
FT                   LVALPSLIIILSNTRNVVGSIEILKAIGIALARLVLLWILVMKVGGRFVPWLLSKIVKV
FT                   RSEELFTLTVLVIAFLTAVLAAVVFQASFALGAFLGGMVVGKSKLSHQAGADILPLRDA
FT                   FAVLFFLAVGMLFDFKFVVEYPQLICVCLVIVLLVKPLTAVFAVSVLGYSVKTALTVAS
FT                   GLAQVGEFSFILAQEAKRLNLAGDIVYNTIVVCSIVSITLNPLLFKKVPPIEKFLHSRK
FT                   KLWNILNFVADRRINKSNRSKEIAKNLLPTEEYLAQKTSIIVGYGPTGKKVTDALIEYG
FT                   VKPIVVEINIDTVNSLSSQGQTVIYGDSAKKDILLAAGIKSADYLIITVPSLQVTLETA
FT                   LLASALNSKTRILVRAHFLDSKETLKQAGISGIVFEEEEVSNALTSLLLDDLEKQSLLA
FT                   TASELINQSVNEERK"
FT   CDS_pept        complement(197676..197987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_127"
FT                   /old_locus_tag="TGRD_130"
FT                   /product="phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13613"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD1"
FT                   /protein_id="BAG13613.1"
FT                   /translation="MADLKRVFYTGIGLALKGKKKVEEAAKKFVENNKREADEGKKFVD
FT                   KTIKHAETTKNELSKKINKTVKTTVNKIGFITRKETDNLKNEIEKLKSQLHKSEKKKK"
FT   CDS_pept        complement(198231..199715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_128"
FT                   /old_locus_tag="TGRD_131"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_131"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13614"
FT                   /db_xref="GOA:B1GZD2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZD2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13614.1"
FT                   /translation="MADYETVVGLEVHMQINTKSKVFCECSTRFGAEPNSNTCIICTSQ
FT                   PGAIPILNKKAVEAVVKTGLALNFSINKRCTFARKQYFYPDVPKNYQITQSEPPLCSRG
FT                   KLAITIDGKEKIINITRIHLEEDAGKLVHEIGNKKLDYSLLDLNRAGVGLMELVTEPEI
FT                   ISQHEALEFLKELKNIVEYLGTSECNMEEGKMRCDVNVSIRPVGQKELGTRVEIKNMNS
FT                   ISGVRDAIAYEVERQKEVLNSGGKLTQETRLWKAEEGITKSMRSKESALDYRYFPEPDL
FT                   LPFNLPDSFIEELQKQILELPRARKARFIKDYGISEYDADYLTSTRMIADYYEEALNAL
FT                   KNQKSDSLSGNFVVAAKLLANWISTELNAKLNASKTCIAETHISSQNLAKLVSLILNGT
FT                   ISGKIAKTVFEEMYEKSIEPEKIVKEKGLVQISDESAILRICEEAISESPKAVAEFKSG
FT                   KERAIGAIVGLVMKKSKGKANPQLVNKILLEKLKAY"
FT   CDS_pept        complement(200484..201941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_129"
FT                   /old_locus_tag="TGRD_132"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_132"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13615"
FT                   /db_xref="GOA:B1GZD3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZD3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13615.1"
FT                   /translation="MDEILKTRVKDLCEKIRSGQIKSIEIVKACFKRIKETDPKVKAFL
FT                   KLNEERSLKQAAQSDDKIKTGAECGSLEGVPIGIKDNIMIKGESMTSASKYLENYISPY
FT                   DAAVIEKLKEAGVIFVGRTNMDEFAMGGSTETSVYQKTANPWNIDYIPGGSSGGSAAAV
FT                   SSGMVPFALGSDTGGSIRQPAGFCGIVGYKPSYGLISRYGACALASSFDQIGVFSKTVK
FT                   DASLLTSFIAVGDYRDPVCETGEQTNYAHGIYNPDILKTVRIGIPKQLSNYKADEEITK
FT                   YFGDAVNKLKLEGAATVEIDVPAYKYVPALYEVIMCAEVSANIATFDGIRYGYRSSNGR
FT                   NLNDEYAKSRAESLGYEVKKRILFGTYVLGAKNYYRCYHQAQRVRTLLINQITDAYKKC
FT                   DFIFSPATLQMPVKFGEKLSEECDIFLTAANLAGLPGITVPCTFTSSGMPMGVHFMGSR
FT                   FSDAKLFQIADAFERISGFDINKYPNL"
FT   CDS_pept        complement(201944..202936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_130"
FT                   /old_locus_tag="TGRD_133"
FT                   /product="putative Mg2+/Co2+ transport protein CorA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_133"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13616"
FT                   /db_xref="GOA:B1GZD4"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD4"
FT                   /protein_id="BAG13616.1"
FT                   /translation="MIKAIYSINGTVTTKYKALKISEDYKNKKPNLIWIDIYLENHELE
FT                   QEETLILSESFKFHEMSIEDCLFPQYPKIEEFGNYIFTAVHGIQLKPHYFQEFEDSIYE
FT                   LDIFIGKDFVVTVHAEELFFLETIFEKAKTRPQIEMKSLENLLYNIFNKVVSSYEFTLE
FT                   KIDDKMENLEDDILEEPETVNMEEILNIKKVIFAMRKIAESQQTPYIYFTRPNNNLISK
FT                   EHFVYFRDIYTQCAKMNQSITMRSQAVVSLLEVYMSSVTLRLTEAMKFLTVIATVLMPV
FT                   LIISGYYGMNIKFPEYSIFGERELWIFAVCLMFVGIIAMLIYFKKKKWF"
FT   CDS_pept        complement(202966..203262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_131"
FT                   /old_locus_tag="TGRD_134"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_134"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13617"
FT                   /db_xref="GOA:B1GZD5"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD5"
FT                   /protein_id="BAG13617.1"
FT                   /translation="MLKEELETTAFLARIHIKEDEKEKYLADLSMMFDYIEILHEPDIA
FT                   DLEPTTHVTKIRNVWREDVVKPCPKEIIEQMLDSAPAKEGTFYKIKKVISGAS"
FT   CDS_pept        complement(205501..208302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_132"
FT                   /old_locus_tag="TGRD_135"
FT                   /product="PD-(D/E)XK nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_135"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13618"
FT                   /db_xref="GOA:B1GZD6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD6"
FT                   /protein_id="BAG13618.1"
FT                   /translation="MSGKILNIDVHESIIDFTADYISKSDKKTALISGGRRPFLFIKKK
FT                   LAEKQKKAFFSPEFFTNDGFIEEIIFDNTELIKISDIEATFMIFETVKNESPQLLKDKT
FT                   SFASFMEWSFEILSFIEQLDLENVSEDKLKAVKANAEIGYDVPENINSLLKNIFKIRKS
FT                   FYNSMEKSSKTTKGHSFLKAAEIESNLLAGNFDEIILMSPFYLHKVEIEIFKKIYNAGK
FT                   LTVFIHGNPKKYEALMQIYSVFGEPLPDIENKKDEYKLNIYSAFDDQSQGALLKNLISG
FT                   YSENDLDKTAVIVPDSKMLQSVISEISIVTDRYNVSAGYPAEKTPVFSLLNAIIEAQLS
FT                   RKGEYYYSKDVMKVLTNPLVKNMEFLGESSISRTAVYKIEEALNQYSGNCLSGRMFVAF
FT                   KEIIGEKQIIDEISLAVNEVWEYTAPEEIMKMLKEIFDVFFTSWEKIETLNNLSYILSE
FT                   LLEKIYSLSVAANYSLNAEATELLLSLAKELKFGEVSQAKFQNEDVLNTFKKLIKNKRI
FT                   VLPGSPLKGLQILGLLESRNLSFENVFIVGMIDSAIPAVKKEYSLIPKDIMYALGIEIA
FT                   KKELEIQQYHFDRLISGAKNLNLIYPDNDKDERSRFIESLIWNKQFENKDINIVKINKF
FT                   VLPKFLAKQPAKRKYAKTKKIREYLKNMSYTHSKIDAYLSCKLKFYFMHVLILDERTKV
FT                   GQEFSAVDIGNFVHSFLKDTLCEKLDSKKLQTLEFEKEYFKKFENSFDNSPHFKFREDA
FT                   FMIKEVLLYRMKNILHYERLRSYKNIYGCEKKYYSNIKTASGETYKFNCRIDRIDTDGE
FT                   NYMIFDYKTGAAPGSIVSNKYFDLMSNNFDRQNIKKAVSSMQLPLYKNIFEKETDFAVL
FT                   ECGIYDIKKAEIIKFPERKEIYDKCIDAVRSLLDEINTGESFEFDEEDKVNCKTCKYFY
FT                   ICT"
FT   CDS_pept        complement(208666..211740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_133"
FT                   /old_locus_tag="TGRD_136"
FT                   /product="exodeoxyribonuclease V beta chain (RecB)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_136"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13619"
FT                   /db_xref="GOA:B1GZD7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD7"
FT                   /protein_id="BAG13619.1"
FT                   /translation="MNKSQIISVLASAGTGKTYNLAKRYLYLLLSSNDNTSIKNIIAVT
FT                   FTNKAAVEMKYRVIDYLKKAALSLDTGDFFDELELTKDKIAQRSAAVLKDIFKFYDNFN
FT                   ISTIDSFKNRILKSCAMSIDISPNFVIEQDYSDNLLFSLEIFLQKARTSENLRNIILQY
FT                   LSQYLMKDSGWFPKNNIYNEIEKVFKESGNTGKDIMPYEGVPFRNEIASRSAAIIRKIK
FT                   KFAVLLPNIQAKKYYSEAVEKVLSTGGKIFFSMDIPVRFAYETIKYIKDAKINAEADEL
FT                   WSEINKDIKSLCDFYMENYYSVYSYIYSKVAFEFDLRSKKDGIVFLNEINKKTVGFFEK
FT                   DNTVMPEVYYRLSEKYKHFLIDEFQDTSLVQWVGIKRFLEESLAEGGTFFYVGDIKQAI
FT                   YAFRGGEPEIFDAPSRDFFSADVNIKTLNQNFRSGRTIVDFNNDIFSKENIERFLNEFY
FT                   KKKNIECGFSKFIKTYSFLRQETPAEHNYGYIEIDVIDKTCENVKEKIKQRFINCVAQV
FT                   SERFNPKDITTLCRANDEVLTVSSWLLENDFDVESSQTLNIRNNSVIKQIISLLMFINS
FT                   PIDALSFSSFILGDIFSKISGIENVEFEKFIFACNKRNRAGTFYKTFQDRYENLWDKYF
FT                   KDFFVKDGFAPVYELTLAALEKFKVTDNFSDSRAFIMRFLELVKDFETQGSGIKNFLEY
FT                   FDDLKDNEESLYIKSALGNGIKVMTVHKAKGLQFPVVIIPFLKLSVKPDRKPYFDSSGN
FT                   KIKLFNISKNITKFSHKAKEIYDREKISSLLSELNVTYVSMTRAEYELYAIVPPKSGIS
FT                   NNEIPVLLGNKALTSGVKQTYAQDNNGKDNIVKDSFDSGYKDIQKYLKNVDKTTLDINN
FT                   SSKKNSIICYALSKITSLKNKNINDCISYALRITKRKFFFEDVKFCREKLNRLFATKKI
FT                   LDLFMHDEKYICNEKKIVNSAGETFRIDKLIVLDDEVITADFQISNDKEEKNKKQVEYR
FT                   NTLIAEIYPGKKISAYIADIDTADCLLLKRQTLLL"
FT   CDS_pept        complement(211772..212233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_134"
FT                   /old_locus_tag="TGRD_137"
FT                   /product="SsrA-binding protein SmpB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_137"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13620"
FT                   /db_xref="GOA:B1GZD8"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD8"
FT                   /protein_id="BAG13620.1"
FT                   /translation="MYNLMKKKTLSSNRKAYYNYEILEKLETGIVLSGYEVKSARQSNI
FT                   SLVDSVVRFSDCEAFAENMFIASYEQISTHIADYDAKRKRKLLMHKSEINKMRTKVKEK
FT                   GLTVIPLEVYIGNRGKIKLLIGLAKGKKTYNKKEALKKKDIEREVAREY"
FT   tRNA            complement(212424..212499)
FT                   /locus_tag="TGRD_tRNA09"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   CDS_pept        212770..214062
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_27"
FT                   /note="pseudogene of M23 family peptidase"
FT                   /pseudogene="unitary"
FT   CDS_pept        214031..214262
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_28"
FT                   /note="pseudogene of bactofilin-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        214262..214900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_135"
FT                   /product="rotamase-like protein SurA"
FT                   /protein_id="BCI50711.1"
FT                   /translation="MNFLRKHIRIIFIVTIVAFIGSSFAGVGYYFFSSKNDFKTFVVVN
FT                   GIKVPEKLFNSVYTDFRQMINDQQLSDADLKELKTKVIYSLVQDEILYQQSKLYGIVVT
FT                   DEELRNDLRNSAKFEDNNIFNIRKYHAFLDSIQMTAKEYETMRRKQIAAIKVKMFIASC
FT                   VKLWNYELENAFKQEPSITENTLIQAKVNFILNEWYLDIVRNSKIAVPK"
FT   CDS_pept        complement(214859..215506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_136"
FT                   /old_locus_tag="TGRD_138"
FT                   /product="maf-like protein"
FT                   /note="COG0424"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_138"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13621"
FT                   /db_xref="GOA:B1GZD9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZD9"
FT                   /protein_id="BAG13621.1"
FT                   /translation="MRVNKQIILASSSVRRISLLKQWGLFFKIIPSGADEKINLIKPSY
FT                   IVKELAYRKGRHVAQRYPDALTLSADTVVVLNGKIIGKPKSKKESEKIIRELNGSIHKV
FT                   YTGVAVIQKDKCSVFYDTVCIKMRKLPENMLKQLFGKHMDKAGAYAVQDTGDNFVEKIY
FT                   GDYYTAIGLPYKKLATELKKFKIRLKSSHDLSKNHSHQRLFRDCYFRISDNV"
FT   CDS_pept        complement(215497..216459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_137"
FT                   /old_locus_tag="TGRD_139"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="OTCase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_139"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13622"
FT                   /db_xref="GOA:B1GZE0"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE0"
FT                   /protein_id="BAG13622.1"
FT                   /translation="MAKKDLLSIYDLSTKEIKEILNKAFKLKNDRKHLDVFKGKILGLI
FT                   FEKPSTRTMVSFTAAMLQLGGTPVFLNTENLQRKRGESIHDTAIVLSRYLDGLMIRSFK
FT                   HSDLEEFAKYSTAPVINGLTDHEHPCQILADIMTVMEIHKIKTVEALKKIKIVYTGDSN
FT                   NIANSLLAISAVLGFDFTLISPKEYSPKKRILNKALEYTSSTGAEIKITSDVNDAKNAD
FT                   VIYTDVWTSMGFEAEEKKRKKIFAPYQVNSELLKKASSKCIVLHCLPAIRGEEITEEIM
FT                   YKYESSIFTQAENRLYVQKAVLLYLLNTSLISPPQKPCA"
FT   tRNA            complement(217054..217127)
FT                   /locus_tag="TGRD_tRNA10"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCC"
FT   CDS_pept        complement(217184..217558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_138"
FT                   /old_locus_tag="TGRD_140"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13623"
FT                   /db_xref="GOA:B1GZE1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE1"
FT                   /protein_id="BAG13623.1"
FT                   /translation="MFQIPPIPDKEYFTIGEVSQITLVPKHTLRYWESEFKLLRPIRKS
FT                   SGQRSYRKEEVEFVFKIKNLLYNQRYTIEGVKKYLIGDKRKRLTNLQTNLNLDLEYMPD
FT                   SKLLKDIKEELKHILKLLKK"
FT   CDS_pept        complement(217573..217833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_139"
FT                   /old_locus_tag="TGRD_141"
FT                   /product="integration host factor subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_141"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13624"
FT                   /db_xref="GOA:B1GZE2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE2"
FT                   /protein_id="BAG13624.1"
FT                   /translation="MTKNDIAIALSRILSSKKEAEEAVNKVFEEMSNSLKNGDKVIITG
FT                   FGSFNMFETKTKRVRNPRTCEKLLIAPMKKIRFKQSKKFFK"
FT   CDS_pept        complement(217908..218900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_140"
FT                   /old_locus_tag="TGRD_142"
FT                   /product="NAD-dependent glycerol-3-phosphate dehydrogenase"
FT                   /note="GPDH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_142"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13625"
FT                   /db_xref="GOA:B1GZE3"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE3"
FT                   /protein_id="BAG13625.1"
FT                   /translation="MKITVLGAGSWGATLAALLFENGHDVTLWEFDAKRAKDLQDRKIK
FT                   PFNAGTNLPSALVVTNSIKSLKNSEAVLFVIPSQYMRSLCLHLKNNGILLDGKLIISAT
FT                   KGIENKTLLRMSEVIDEIFKGVYRNIAVLSGPSHAEEVCRKIPTAVTSTALNLETAERC
FT                   RMIFMNEYFRIYNQNDIIGVETGSALKNVFAVASGIVDGLKYGDNTKAAIISRGLKELS
FT                   RVGIALGGKEQTFYGLSGVGDLMVTCFSKHSRNRAIGQAIGEGKTLDEAEKNLGMVAEG
FT                   VKNTISAYEIGKKLNIELPIINEVYAVLFEGKNPLKAVSDLMTRCPCHE"
FT   CDS_pept        complement(219146..219745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_141"
FT                   /old_locus_tag="TGRD_143"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_143"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13626"
FT                   /db_xref="GOA:B1GZE4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZE4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13626.1"
FT                   /translation="MLIKILYIIITYLCGSIPSAYIVAKANGKVDIRTVGSGNSGATNV
FT                   FREIGKCAGVITLIADILKGFIPVYFATFIDNSFSYSVAVAAAAMVGHVFTIFLKFKGG
FT                   KGVATGLGVFFALMRWPSLIALAIFGLAFVFSRYVSLGSICAVISLPLTSYFLGYSTEV
FT                   VIFTFAITLLIIYRHRTNIKRLIERSENKLRIFKKK"
FT   CDS_pept        complement(219759..221084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_142"
FT                   /old_locus_tag="TGRD_144"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_144"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13627"
FT                   /db_xref="GOA:B1GZE5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE5"
FT                   /protein_id="BAG13627.1"
FT                   /translation="MLMLTKVAIVGRPNVGKSALFNRLIGRKKAIIHETPGTTRDRNDH
FT                   EVSWRDKNFIATDTAGWSTDISAFSKDMSRQLDIAVEKSDIVLFVVDGKTGAHPTDVQI
FT                   AQQIRLKRKKTILVVNKIDTQAEEIKGYEFYELGFDDVIFVSANHGRSVHDLLDKIWEN
FT                   IKYDRKEKNTWKTLKIILVGKPNVGKSSFINTVAKEERSIVHDTPGTTRDSLTARIQSD
FT                   GKEYILTDTAGLHRGNKTKDGMEYLSNLSTGHAIEDADVAVLIADASQGIGETEVKIAR
FT                   LLLEKKKPVIVTVNKWDLIEEKEEAAKYFTGQLRERIKFMNWADIIFISAKTGQRLGRI
FT                   FQEAKLVFEQYSKQLTKEELNDVIRDALAKKPYTNKGRTLKIKEYVQATSKPPVFIFSV
FT                   NDTDLVHFSYERFLENCLRAKFDFHGTPIVLKFRNYYKKKMD"
FT   tRNA            complement(221176..221247)
FT                   /locus_tag="TGRD_tRNA11"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   tRNA            complement(221286..221367)
FT                   /locus_tag="TGRD_tRNA12"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUC"
FT   CDS_pept        complement(221392..221673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_143"
FT                   /old_locus_tag="TGRD_145"
FT                   /product="protein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_145"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13628"
FT                   /db_xref="GOA:B1GZE6"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE6"
FT                   /protein_id="BAG13628.1"
FT                   /translation="MRYNKIMSIAFSAFKFIHYTICAGLVLVILLQTAKSGDMAGIFSG
FT                   GGSDQIFNAPSRMAFIKKVTILMACIFLFTSLMLTKLSPAISVVKLAL"
FT   CDS_pept        complement(221821..223071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_144"
FT                   /old_locus_tag="TGRD_146"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_146"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13629"
FT                   /db_xref="GOA:B1GZE7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE7"
FT                   /protein_id="BAG13629.1"
FT                   /translation="MKNTLKDIDVKGKKVLVRVDYNVPLDANLKITNDKRIAATIPTIQ
FT                   YLLEKNSAIILMAHLGRPKGKIVPGMSLKPVPPRLSEFLGKPVKFVGGDCIDSQSKKAA
FT                   ADLKPGEILLLENLRFHPEEEGKNASGEKDKAAMDVFAKELASMGEVFVQDAFGTVHRA
FT                   HASTTAIVKYAKDVVAGFLVEKELKFLGEALENPVRPFLAILGGAKVSDKINVIKNLLN
FT                   KADTIIIGGAMAYTFLKSQEVITGTSLVEDDKLDLAIELIKKSKERKVALLLPIDHIIT
FT                   DKVDFVNKQMPGDAIVKNTADEAIPEGFMGVDIGLKSIEKFSKIIKSAKTIVWNGPLGI
FT                   FEIDEFSKGTIKIANLVAKSTDNGAISIVGGGDSIAAVKKAGVDKRINHISTGGGASLE
FT                   FLEDKELPGIAALPDKK"
FT   CDS_pept        complement(223160..224167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_145"
FT                   /old_locus_tag="TGRD_147"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /note="GAPDH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_147"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13630"
FT                   /db_xref="GOA:B1GZE8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE8"
FT                   /protein_id="BAG13630.1"
FT                   /translation="MAIKVGINGFGRIGRLVFRAAQNISDIKVVAVNDLIDVEYMAYML
FT                   KYDSVHGTFKGTVEVKNGNLIVNGNTIRVTAEKNPADLKWSDAEAEYVVESTGLFLSKD
FT                   KALAHINAGAKYVVMSAPSKDDTPMFVCGVNLDSYKKGTQFVSNASCTTNCLAPIAKVL
FT                   NDKFSILDGLMTTVHATTATQKTVDGPSAKDWRGGRATSGNIIPSSTGAAKAVGKVIPQ
FT                   LNGKLTGMSFRIPTLDVSVVDLTVNLAKPASYDEIKAAMKSASENELKGILGYTEDEVV
FT                   SSDFVGDARTSIFDAKAGIALTNKFVKVVSWYDNEWGYSNKILDLISYMKKVNG"
FT   CDS_pept        226125..226424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_146"
FT                   /old_locus_tag="TGRD_148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_148"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13631"
FT                   /db_xref="GOA:B1GZE9"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZE9"
FT                   /protein_id="BAG13631.1"
FT                   /translation="MISNPTPTAGTNVVLKGEVKAVDPALPTIPSEGDNLPSEGNYTRA
FT                   DGEFLDKGNYWLWGVTVCSTIVVFLLIYHRKTIMDFLMLRTRIKRKGFNWISKR"
FT   CDS_pept        227099..228066
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_29"
FT                   /note="pseudogene of cobalamin-independent methionine
FT                   synthase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(228180..228389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_147"
FT                   /old_locus_tag="TGRD_149"
FT                   /product="YtxH family uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_149"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13632"
FT                   /db_xref="GOA:B1GZF0"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF0"
FT                   /protein_id="BAG13632.1"
FT                   /translation="MSDNRDTLLAFVLGGLIGATLGILYAPKSGRETRSNIKKFGEEIV
FT                   DTVSNLSDDFKDDESQFKVSSKIK"
FT   CDS_pept        complement(228391..228681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_148"
FT                   /product="hypothetical protein"
FT                   /protein_id="BCI50712.1"
FT                   /translation="MNSIGLVFIIIGVILITLSVVAVTVFLILMLIGIKKSAIEFRRFI
FT                   KKINSELDGVNKVSGVASMRRKLSSLVIKGISFLFYAFLSVSERKNRTHGE"
FT   CDS_pept        229177..229845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_149"
FT                   /old_locus_tag="TGRD_150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13633"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF1"
FT                   /protein_id="BAG13633.1"
FT                   /translation="MLQKIWKYGEVRKLCDCTSKGCFNYAAKYMLKQARINYRKTLVEA
FT                   KGRVATAKKDKILIMCDKNGRLAPFRQYSKALGLGFNREFPASVVASADVFTNAATAGS
FT                   VGLVDGWSTTFERPIFGILSALTNFAKIGICRVGTEIGRVSIPNYYLRVLHSSKAGQKI
FT                   LGELRRFYNLKDWFKKNPDVKGKEAVEKVRFNEALERNAEIVQKLNEDLMRKNNYDIND"
FT   CDS_pept        229987..230295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_150"
FT                   /old_locus_tag="TGRD_151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_151"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13634"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF2"
FT                   /protein_id="BAG13634.1"
FT                   /translation="MFKFCFSLFVLVLVSGCNSKSMLKLAGAVESLNKDLVEANKVLAK
FT                   SNVDLSNSVTRSTNAIRKLVDVQEKEAERKAKKEAEKKAKEEAKKNRSWYEKLVDLD"
FT   CDS_pept        230672..231763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_151"
FT                   /old_locus_tag="TGRD_152"
FT                   /product="GTP-dependent nucleic acid-binding protein EngD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_152"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13635"
FT                   /db_xref="GOA:B1GZF3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF3"
FT                   /protein_id="BAG13635.1"
FT                   /translation="MKLGIIGLPNVGKSTLFNAITEARSETANYPFCTIDPNVGVVNVP
FT                   DKRLDFLEKLYNSKKKVHATAEFLDIAGLVKGASQGEGLGNQFLSHIRETAAVIHTVRC
FT                   FESKDITHVMGGVDPFRDIEIIDTELILADIESVSKRLEKLEKTVRLNDKKILAERELA
FT                   IKVKAHLDVGNPARTLKLSDNEKIIVKDFFLITAKPVLYVCNVAESDLPVMENKYIKIV
FT                   KEKSEKENALVIPVCAKIEAELSELSEDDQKTFLKDLGLGYPGLNRLIRAGYDLLGLAT
FT                   FLTAGEDEVKAWTIKKGIPAPQAAGAIHSDFERGFIRAKVMSFDDLLRLGSEKAVKEAG
FT                   LLRSEGKEYLVKDGDIIEFRFNV"
FT   CDS_pept        232522..233577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_152"
FT                   /old_locus_tag="TGRD_153"
FT                   /product="rotamase SurA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_153"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13636"
FT                   /db_xref="GOA:B1GZF4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF4"
FT                   /protein_id="BAG13636.1"
FT                   /translation="MKKFFSVLAVTFFIVGVGSIFAAPKKVDQTLAIVNGKPIFESEVN
FT                   KVFNNLKSDMLASEQWSEQKINELKNRILERQIDSILLKNEIKKQKILVSRKEVLEYIK
FT                   ELKKNHAIDEELSKQNLTYKDLEKSVSEIIRFMKLLGKILDVNAEKITEAEIKSFYDKV
FT                   IIKMKGGNPGLSHDKDCLAASVADELKKVFSENVRIKQIFIKNPKGTQDAETQVVQSKV
FT                   ETVKKELQVKSFAEVARKYSEDLISKSRNGDLGIFVVKGDLPLVLEKAVFSMKVGDYTK
FT                   EPIKTDIGYYFIKLEEKLPNRKIVFDGKVKDYINSRLLQFNNEQACIRYISTLRTKANI
FT                   KINKVWQNNND"
FT   CDS_pept        233570..234526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_153"
FT                   /old_locus_tag="TGRD_154"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_154"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13637"
FT                   /db_xref="GOA:B1GZF5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF5"
FT                   /protein_id="BAG13637.1"
FT                   /translation="MTKPRLAITLGDPAGVGCEIVCRAVSSSAVKRVCSPVIFGDKQSL
FT                   KRSLLKYLKNRMPFEFVESSNIGDSVKMGAPSKKAGIIAASAIYKAVKYCANGKALALV
FT                   TAPVSKESLKMSGIKYPGHTELLASLTNSKKVAMMMTCGNIHGVMVTRHIPVSKISENI
FT                   KTKTIVEAVNLSVNFLRKAGKKNIKVVLCGLNPHAGDNSILGFEEKKFILPAYKIIKKS
FT                   GIDITKPLSADSAWLKTKNGQYDLICAMYHDQIMIALKCINAAKIVNVTIGLPFVRTSP
FT                   GHGTAFNIAGKNEADASAMIEAILYAARWGKKSRMQS"
FT   CDS_pept        complement(234600..234869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_154"
FT                   /old_locus_tag="TGRD_155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_155"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13638"
FT                   /db_xref="GOA:B1GZF6"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF6"
FT                   /protein_id="BAG13638.1"
FT                   /translation="MSIFEALMMIFWGTLYPFSIYKSYKSKSNDGKSLWFLLIALSGYM
FT                   FCIIHKIFYNYDSVIFLYIFNFIIIFADSCLYLRNRIISNKKSY"
FT   CDS_pept        complement(234964..235518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_155"
FT                   /old_locus_tag="TGRD_156"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_156"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13639"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF7"
FT                   /protein_id="BAG13639.1"
FT                   /translation="MIIGLTGACCSGKDTIAEYISKKHGYKHYSLSEILRGIMKEKGIK
FT                   LTRENLAVFGTELREENGNEILAKKALEKIDLGGRFCITSIRHTGEVEKLRERKDFILV
FT                   NITAPQNIRFERMRNRKRYGDPQTFEKFTELEEKESQTKGHGQQLKKTADMADINFINY
FT                   SNYMASLEITVEKLLKDIKNK"
FT   CDS_pept        complement(235515..236170)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_30"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(236375..236816)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_31"
FT                   /note="pseudogene of DUF386-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        236919..237136
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_32"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        237184..238569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_156"
FT                   /old_locus_tag="TGRD_157"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /note="CCA-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_157"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13640"
FT                   /db_xref="GOA:B1GZF8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032810"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF8"
FT                   /protein_id="BAG13640.1"
FT                   /translation="MEDIVIPQRYKSIIDKISITAVENSFDVYIVGGFVRDLFIKREPK
FT                   DLDIMVCGRGSNLSMQSAGINFSKILAKKYKLDKPVIFERFGTSKLFMDSEEVEFVMPR
FT                   REYYNANSRNPDTQIASVEQDALRRDFTINALFLRLNDMKILDFTSQGVVDIKNKIIRV
FT                   TDPSNIEIIFKQDPLRILRAVRQSVQLDFKIETETYNAMKISSPSIEIVSPERIRDEIN
FT                   KILIEKIPSKAFKIMDEINLSVKILPEVARLKNLEQLEKYHTDDVFVHTLKVLDRTKND
FT                   IILRMAALLHDTGKYATCKKNGGRICFYGHDAESAKEAEAVLKRLKYSKEFIQKTVSVI
FT                   KNHMYPKMYSDDWTDGAVRRFVKRCSGELDLIMEISRADYGKDSNDVKLVKLKKRIEDL
FT                   KLKNMLYPKPELLTGREMMRIFNRLSGKWIRKAKSKIEEMRFENPGITKEEAIEIIREM
FT                   FRK"
FT   CDS_pept        239643..240734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_157"
FT                   /old_locus_tag="TGRD_158"
FT                   /product="glutamate synthase large subunit GltB"
FT                   /note="glutamine amidotransferase domain (domain 1)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_158"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13641"
FT                   /db_xref="GOA:B1GZF9"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF9"
FT                   /protein_id="BAG13641.1"
FT                   /translation="MLKEGELRIPSGCAISGIIDKEGKRFNGDEIIKSIALMHDRSNGL
FT                   GGGFAAYGIYPQYKDFYALHIFYDNLSIKMQTEDFISKYFDIESAGNIPTKSVLGVRNK
FT                   PLIWRYFVHPRNYMVKDGFVDEAEFTSRYVIKINKEYKGAYVFSSGKNMGTFKGVGYPE
FT                   DIGKFFMLDTYEGYMWMAHGRFPTNTPGWWGGAHPFTMLDWSVIHNGEISSYDANRRFV
FT                   EMYGYKCTLQTDTEVITYLFDMLVRKHNIPMEKAIKVVAAPFWEDIERENKEVQNELKS
FT                   IRSVYASALINGPFSIILGFEKGMIVLNDRIKLRSLVAAEKGSRTYVASEESAIRIICD
FT                   NPHKIWSPQGGEPIIALLKGEQK"
FT   CDS_pept        240731..242236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_158"
FT                   /old_locus_tag="TGRD_159"
FT                   /product="glutamate synthase large subunit GltB"
FT                   /note="FMN-binding domain (domain 2)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_159"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13642"
FT                   /db_xref="GOA:B1GZG0"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG0"
FT                   /protein_id="BAG13642.1"
FT                   /translation="MSLDFNSPVFEVIRDEKKCIQCQVCARQCSNKVHLYDEEDNVVRA
FT                   DDIKCVNCHRCVVLCPTKALVIKKYPLEFKENVNWTDAALKEIYKQSQTGGVLLSSMGN
FT                   PKSFPIYWDRMLLNASQVTNPSIDPLREPMETKVMIGRKPEKLEFDAKGKLVTNVPPQI
FT                   ELSIPIMFSAMSYGSISRNAHESLARAATELGICYNTGEGGLNRDFYKYGKNTIVQVAS
FT                   GRFGVHKEYLNAGAAIEIKIGQGAKPGIGGHLPGKKVGEDVSATRMIPVGSDAISPAPH
FT                   HDIYSIEDLRQLIFSLKEVTAYKKPVFVKIAAVHNSAAIASGIVRAGADAIVVDGFRGG
FT                   TGAAPTRVRDNVGIPIELALAAIDQRLREEEIRNEVSLIIAGSIRNSADVVKAVALGAD
FT                   AVYIGSAAVIALGCHLCRSCSTGKCNWGIATQEPELVKRLNPDIMYKRLVNLASAWNHE
FT                   IQELLGGMGINAIDSLRGNRLMLRGIDLNEKELEILGIKYAGE"
FT   CDS_pept        242369..242836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_159"
FT                   /old_locus_tag="TGRD_160"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13643"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG1"
FT                   /protein_id="BAG13643.1"
FT                   /translation="MKKIYAFERECLGCRLCEVYCKTAHSKSKDIIKAHKQENITSAII
FT                   IEEILQPKAVSYFALQCRHCASPKCVKACISGAMYRDEKGIVHNDKKRCVSCMSCVLVC
FT                   PFGAVKKSNDGKAVSKCDLCVDYGNGKSLCVENCPNNAIKLLNEDEAEALK"
FT   CDS_pept        242833..244104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_160"
FT                   /old_locus_tag="TGRD_161"
FT                   /product="putative NAD(P)H/FAD-binding nitrite reductase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_161"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13644"
FT                   /db_xref="GOA:B1GZG2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG2"
FT                   /protein_id="BAG13644.1"
FT                   /translation="MKYLIIGNSAAGVNAADGIRANDKKGSITIISNEEFGAYGRPLIS
FT                   YYLSGKVRSESMYYRSEDFYKSRNIEVLLNTEAEEIDVKKKEVFTAGGKKLSYDKLLIA
FT                   TGSSPFIPLVKNLDLSKQENVFTFLTYKDSIKLKKQIIGKSKVVIAGAGLIGLKAAEGL
FT                   FGQVSSITVIDLADRVMASVLDKTSADIIQGHIEQNDIDFKFQTSICEVHGGERNVNKV
FT                   VLSNGETLDCDILIIAVGVRPNINLAKKAGIKTAKGIIVDEYMRTSVKDIYAAGDCVES
FT                   VDMLSNESKILALWTNASSQGETAGFNMTGTEIKAPAAFAMNAISFFGLQLISAGVIGT
FT                   SKSNEIVTDSAENKLRRLNISNDKLVGFVLINYNQRAGIYTALISDRTKLSTLEYDITS
FT                   KDIGLDVYPKEERTKKIWNHKGGC"
FT   CDS_pept        244160..244897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_161"
FT                   /old_locus_tag="TGRD_162"
FT                   /product="glutamate synthase large subunit GltB"
FT                   /note="uncharacterized domain (domain 3)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_162"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13645"
FT                   /db_xref="GOA:B1GZG3"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG3"
FT                   /protein_id="BAG13645.1"
FT                   /translation="MKTINALNVYYRDLNASIDETVKVDKSITLRNVFGQRYIGRGLPE
FT                   KVKLKIYGTPGNDMAAYMDGAELEIFGNGQDAVGNTMNYGRIIVHGSCGDTLGYAMRGG
FT                   EIYIEGNVGYRVGIHMKEYKEMKPIIVAGGKAGEFLGEYMAGGAIILLGLNLSKDEYIT
FT                   GKFCGTGMHGGVIYLNGSGGKCKFGKEAVKVDINGEDILFLKKHISFYAKTFKKDLSRL
FT                   KLESFSKYAAINKNPYSNMYCTY"
FT   CDS_pept        245146..246288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_162"
FT                   /old_locus_tag="TGRD_163"
FT                   /product="carbamoyl-phosphate synthase arginine-specific
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_163"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13646"
FT                   /db_xref="GOA:B1GZG4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG4"
FT                   /protein_id="BAG13646.1"
FT                   /translation="MEQTKKILGKKYKKACLELSNGVKLKGNAIGADVIVSGEMVFNTG
FT                   MLGYSEAMTDPSYLGQILVFSFCLIGNYGIPDLKIGDFFMSKGHESSSIKTQGIIVSGI
FT                   YDGCHHHDGGVSLEDWMKSQGVPGISGIDTRYLVQMIRESRNLSGRIIPEGAKLQDKNK
FT                   FEFLKNFRDDEYVDPSKYNLMPSVSTKEKVIMNKASKKVAVVDCGAKWNIMRMLVGRNC
FT                   GVELLPWDSDFSKVKCDGWIISNGPGDPKNTGDLVERIKKDVLSSDKPILGICLGHQLL
FT                   SLASGAKTKRLNHGHRSHNQPVFSFPEKNAYMSSQNHRYAVEKNSIQPDWMLWFENAND
FT                   GSVEGLKHETKPFMSVQFHPEASSGPNDTSWIMDKFVGLL"
FT   CDS_pept        246492..247547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_163"
FT                   /old_locus_tag="TGRD_164"
FT                   /product="rotamase SurA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_164"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13647"
FT                   /db_xref="GOA:B1GZF4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF4"
FT                   /protein_id="BAG13647.1"
FT                   /translation="MKKFFSVLAVTFFIVGVGSIFAAPKKVDQTLAIVNGKPIFESEVN
FT                   KVFNNLKSDMLASEQWSEQKINELKNRILERQIDSILLKNEIKKQKILVSRKEVLEYIK
FT                   ELKKNHAIDEELSKQNLTYKDLEKSVSEIIRFMKLLGKILDVNAEKITEAEIKSFYDKV
FT                   IIKMKGGNPGLSHDKDCLAASVADELKKVFSENVRIKQIFIKNPKGTQDAETQVVQSKV
FT                   ETVKKELQVKSFAEVARKYSEDLISKSRNGDLGIFVVKGDLPLVLEKAVFSMKVGDYTK
FT                   EPIKTDIGYYFIKLEEKLPNRKIVFDGKVKDYINSRLLQFNNEQACIRYISTLRTKANI
FT                   KINKVWQNNND"
FT   CDS_pept        248058..249247
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_33"
FT                   /note="pseudogene of predicted ATP-binding protein
FT                   (COG3950)"
FT                   /pseudogene="unitary"
FT   CDS_pept        249250..249957
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_34"
FT                   /note="pseudogene of reverse transcriptase-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        250000..253311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_164"
FT                   /old_locus_tag="TGRD_165"
FT                   /product="carbamoyl-phosphate synthase arginine-specific
FT                   large chain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_165"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13648"
FT                   /db_xref="GOA:B1GZG6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG6"
FT                   /protein_id="BAG13648.1"
FT                   /translation="MPILDFLLPKNEKKQKVILLGSGALSIGQAGEFDYSGSQAVEALE
FT                   EEGLEVIVINPNIASVQTNKAANKRVYLYPVTPFWVEKIIKIEKPAAIISSFGGQTSLN
FT                   CVIELEKSGILKKYNVKVLGTQVNALEMSEDRELFAQKMKSIDAPVAKSHAVSTVKEAL
FT                   ETAEQIGYPVITRSAFALGGLGSGLAATDAELKKLTQSALMSSPQVLIEKSLHGWKEIE
FT                   YEVMRDKTGNTITICNMENFDPMGIHTGDSIVIAPCQTINNIENNMLRDMAIKIAQNVG
FT                   IVGECNVQYALNPKDYGFYVIEINARLSRSSALASKATGYPIAYIAAKIVIGFDLLELK
FT                   NPVTGTTSAFYEPSLDYVTLKVPRWDLSKFSGVSKNLGTQMKSVGEVMAIGRNFCEVIQ
FT                   KALRMVNENEDGITVNFFKDASDEDIEKELLSPTNLRVFAIYETFKRGKSLEYVYEKTK
FT                   IDYWFLSHILYLAKIEKELLNFFKPNVKKDSVTVQELYDAYKQIPKDFLQHLKSRGFSD
FT                   FQLVKIYLLACLNSKIKLSIKEIRNLSFAVRKLRKKLGILPVVKQIDTTSSEYPTKSNY
FT                   LYLTYDGIHSDVSSKKNEKSIITLGSGSYRIGSSLEFDWCSVMTSSYFKNKKNDSVIIN
FT                   CNPETVSTDYNASDRLYFEELSFERVLDIIDIEDPKGVIACMGGQNPNNLIQPLSEAKV
FT                   NILGHSQKSVAAAEDREKFSATLDKLGIDQPEWISAVSIADIDKFIKKIGFPVLIRPSF
FT                   VLSGTLMNVATDKKSLDYYLSLTRDISFDFPVVISKFILDAKEIECDGVAKNGDVILSI
FT                   VSEHIENAGVHSGDATMVFPARKIYVRTVNIIKDIVRKIAKGLNLNGPFNIQFIAKDND
FT                   VKVIECNARASRSFPFISKVSGVNLAEISCKVMNNERVKKILIDESEIPYVGVKASMFS
FT                   FQRLDGADPVVGVEMSSTGEVGCLGEKFNHAMLLSMEATRIIKPQKGVLLSTGREKDKV
FT                   KFMEVVDNLYKLGIPVYATKGSARYLEGRGYSVNTVHWNRSSRAVDVIIDGKVDFVINI
FT                   NKNLSVDEINNNSEIRKTAVKFGCSILTNLEKAIAYLRAYDSYDELQNIENCIGL"
FT   CDS_pept        253496..253756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_165"
FT                   /old_locus_tag="TGRD_166"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_166"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13649"
FT                   /db_xref="GOA:B1GZG7"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZG7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13649.1"
FT                   /translation="MTFEKKTVVDQFKVHATDTGSSEVQIAILTTRIKYLSDHFKKFPK
FT                   DFASRVGFLKMIGQRRQLLDYLKKYNKDSYSSLIKRLYLRK"
FT   CDS_pept        253871..255940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_166"
FT                   /old_locus_tag="TGRD_167"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_167"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13650"
FT                   /db_xref="GOA:B1GZG8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZG8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13650.1"
FT                   /translation="MEYFKKEVDVAGKKFIVESGKVAKQAGGSCTVRIGETVVLVTVVS
FT                   LKEPKVGIDFMPLTVDYRERTYAAGKIPGGFFKRETRPRDGEVLVSRLIDRSIRPLFPE
FT                   YYRNDTQISAVVLSHDGENDSEMAAILGASIALYTSDLPFTTPIASVRIGKINGQLIIN
FT                   PLIAEQKLSDLDLVVSGTEEALTMVEAGARELSEAEMLEALNLAGKTLKGICLFQKTLP
FT                   AKTKIVVEQPQHNSLLKADIEAEAVSKAEMSVVIKEKCEREFFWDSFKKDISSRLLEKY
FT                   PEELPSTIDAILEDIFYQKARDLVLNKKIRTDGRGFEEIRPITCETGVLPRVHGSSLFT
FT                   RGQTQALVTVTLGSPCDMQVIDELIVEYKERFMLHYNFPGFATGEPKRDRAVSRREIGH
FT                   GNLAKKALKHIMPDGEDFGYAVRIVSDILESNGSSSMASVCGGSLALFNAGVPVKSSCA
FT                   GVSMGLMKEGGSYVILTDITGMEDHLGDMDFKVAGTRKGITALQMDIKILGLTTEIVAQ
FT                   ALEQAKRGRFFILDQMDAVVSAPKNDLSNYAPRMITLTIPQNKIGELIGPGGKNIRKIQ
FT                   EDNNVKIDIEETGRVFISGVESDGVKSAKEYVECLTVEAEVGKIYKSRVTKIMAFGAFA
FT                   EILPGKEGLIHISQLSNRHTKRVEDVVKEGDEVKVKVIEIDKQGRINLSIKAAL"
FT   CDS_pept        256050..256472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_167"
FT                   /old_locus_tag="TGRD_168"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_168"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13651"
FT                   /db_xref="GOA:B1GZG9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZG9"
FT                   /protein_id="BAG13651.1"
FT                   /translation="MVNDIKDEVRSLYEIMKEEKVQELEINSRNYSICIKRKDHDENNQ
FT                   TVQKKQIIVQEEPMVSGETIKTPIAGVFYRSPSPSSPVFVNEGDIVNIGKTVCIIEAMK
FT                   VMNEIKATFKAKILKMLAENGKPVNSGQDLFEVEKV"
FT   CDS_pept        256681..258852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_168"
FT                   /old_locus_tag="TGRD_169"
FT                   /product="cell division protein FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_169"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13652"
FT                   /db_xref="GOA:B1GZH0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH0"
FT                   /protein_id="BAG13652.1"
FT                   /translation="MRKNKKTKNKKQDSLKRNREAAALFFALASFLSAYVFIVRSRSGI
FT                   LGRAFFAVMFVVFGQAIYILPLIFLRYFIIHIMQSVELRKKLDFIWSVICIVSCSVLFK
FT                   AVCLTFVPTTEIFSGGWIGDNLYPFFKELFGVWLGFAVIIAIFLFSVAKLFRISINNSL
FT                   KNPEASITKVEEEKVQDIAQAKKQEYLILQKSDRAIPKPNILSRQEKEEKKKAESLICP
FT                   TVKQTKVDSKIFDYKLPVAGLLKNDSAADFETSKDELLKRAELLRTTLADFDIDAKVKD
FT                   IIPGPVVTRYDLILSPGIRIQTVSGIIDNISLAMRTASIRVVPIPEKAVVGIEVPNSSG
FT                   IIVGLRGILESATFENSKSLLTLALGKTTDGSGYVTDLASMPHLLIAGATGSGKSVSIH
FT                   TIILSILYKARPDEVKFMLIDPKRVEMPIYRDIPHIYNPCTCATNADIITGYREAAVAL
FT                   KKLVNVMDERYTKFAKAMARNIEDYNSKMVETGGEKEFYIVVIIDELADLMTAVQKEIE
FT                   DSVQRLAQMARAVGIHLILATQRPSVNVVTGIIKANFPARLSFQTTSKIDSRVILDMLG
FT                   AECLMGKGDMLFLPPGEARPARLQGAYVSLKEAEKVISFINEQNFPRLYEPVVAEVERT
FT                   VGFNADKEKRTRDLIPALKLINERKRISQDLLKANFGGSARATNILSILETRGFITKPE
FT                   GTNKWQIDYDKIRQYLEETERGACAERQS"
FT   CDS_pept        258871..259493
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_35"
FT                   /note="pseudogene of outer-membrane lipoprotein carrier
FT                   protein LolA"
FT                   /pseudogene="unitary"
FT   CDS_pept        259502..259843
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_36"
FT                   /note="pseudogene of conserved hypothetical protein
FT                   (COG1426)"
FT                   /pseudogene="unitary"
FT   CDS_pept        260247..261566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_169"
FT                   /old_locus_tag="TGRD_170"
FT                   /product="ribosomal protein S12 methylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13653"
FT                   /db_xref="GOA:B1GZH1"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZH1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13653.1"
FT                   /translation="MTDNIMQTIAVIALGCPKNTVEAEYLLGIFQEKGFKISSNLDKAD
FT                   IVVIHTCSFIKAAKAESEKCIRTILDIKKKKSLRVYVSGCLPQLLKEKMSVLFPDIDGF
FT                   AGTGTLQYLPDLVFGKNFGRFILPPGGLNDSNYRVLSSTIPSAYLKIAEGCGHVCSFCI
FT                   IPALRGRYESRTMESLVDEVAALAESGIKELILIAQDTTGYGKDIYGAFVLDKLLVKLS
FT                   KINGLKWIRLLYAYPSSITDGLIEVFKEHKKICSYMDIPIQHASKNVLSAMKRPLNTPG
FT                   IIEKIKRKLPDIVLRTSIIAGFPGETKKDVNELINFLNRGYFQYAGVFEYSDLKEAVSS
FT                   KLKRHVRAAAAKERKIMIENAQYNIFQAKIDKIKNNTIEFLVESCLKKGNVYSIKGRSS
FT                   FQSPEIDGNIILENDKPLTVGGFCKAKVRSVDGYNIKVYI"
FT   CDS_pept        261624..262247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_170"
FT                   /old_locus_tag="TGRD_171"
FT                   /product="CDP-diacylglycerol-glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_171"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13654"
FT                   /db_xref="GOA:B1GZH2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH2"
FT                   /protein_id="BAG13654.1"
FT                   /translation="MNLANRLTIARICMLPFFILFMELGGFYNSVLALAVFCTASITDM
FT                   LDGQIARRSKTITSLGIFLDPIADKMLISAAFIYFVNIPMLGIAAWMVIIIIAREFIIT
FT                   GLRSIAAARNIMIPADKSGKCKTVSQIVVIIVIMVILIAREALFEFTGLTPDTLRLYDF
FT                   GSYTALSLIMEKMPFWTTFVAIMLTVYSGVKYILRYRKLFSENG"
FT   CDS_pept        262240..262689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_171"
FT                   /old_locus_tag="TGRD_172"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_172"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13655"
FT                   /db_xref="GOA:B1GZH3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH3"
FT                   /protein_id="BAG13655.1"
FT                   /translation="MDKIVIFFSSVFGLGYIKSASGTFSSLAGILFWALFVPDIYIFQI
FT                   FVLAAMFSISVLFSSLAEDIYNKKDDLRIVIDEVTGVWVSVAFLPKTFMFLFLGFLLFR
FT                   IFDIGKPLFIREVQKVKGGLGITIDDVIAGIFTNIILQVLRFVAY"
FT   CDS_pept        complement(262721..263980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_172"
FT                   /old_locus_tag="TGRD_173"
FT                   /product="M23B family peptidase"
FT                   /note="protease (peptidase M23B family)"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_173"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13656"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH4"
FT                   /protein_id="BAG13656.1"
FT                   /translation="MLLCIFCFIVVVAMLIAKKNTSSTEYTAATDNHNPNIETVIIQHG
FT                   DSFSLTLNNTRLPPKDSSDIIRELKKVLNINRCLPGDFYEIFYDSRTGEWTDFLYYPTG
FT                   TSYCLITKSSDGVIKTEKKKFSTTITEHKAQGIINSSLWAAMKSQNIPLEIITSFTDIF
FT                   SWHIDFLRKAKKDDVFKIVYEVENISKKNKKLSSRIIAAQYKTPLKTYNAFYFKPKNAR
FT                   SGYFDENGKSIKSAFLKAPLQFKRISSNFTTKRIHPILKCVKSHLATDYAAPFGTPVST
FT                   VGDGIVKKVKSNKQFGNLVVIKHPNNYETYYAHLSKYAKGIKEGVRVNQGEVIGYVGMT
FT                   GFTTGAHLDFRIKHNNNFFDFCKIEQPTITLTSEDKKEFKEKIQNLLDIFDDRLQTTKH
FT                   RMRLIIPLTTQSDTNQQQRN"
FT   CDS_pept        264116..265336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_173"
FT                   /old_locus_tag="TGRD_174"
FT                   /product="DUF1015-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_174"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13657"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH5"
FT                   /protein_id="BAG13657.1"
FT                   /translation="MAEIKAFQAIRYSKKFITDFICPPYDVIGSEEKKRLQELSPFNIV
FT                   NIELSDPGDKNDKYKNAASLFNAWQNNGVLVRDKEPSLYFYEQIFEVCGIEMTRKGFFA
FT                   ALKLDEPYSEKGLVKPHEKTLARSNADRLRLLKATKANISPVFCLFEDEKLVVTDICRK
FT                   IAKRVPSATVRDKKRTFHKLWVVSDEDIIKTVEEYLSDKKIFIADGHRRYETAWDYSQE
FT                   IKEKNENYSPTKGYNYVLVYLCPIEDPGISIWPVHRVIKAPADLESKIEKYFDVHPAKN
FT                   FHRLSKKEIQPMIIFKDGRYRVLTIKKEAFLKKAMPGKSKAYRDLAVNTLHYILMPKTD
FT                   ASEFAYVENDKEAVLLAQKTGRIAVIVPATTIKSLKTVSLNNEMLPQKSTYFYPKLASG
FT                   IVIASLA"
FT   CDS_pept        265358..265813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_174"
FT                   /old_locus_tag="TGRD_175"
FT                   /product="CvpA-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_175"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13658"
FT                   /db_xref="GOA:B1GZH6"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH6"
FT                   /protein_id="BAG13658.1"
FT                   /translation="MAIDIFLTLTVVLAVWLGWFAGFTRTFFAFLAGFLAVFAASKYPH
FT                   QKGLNFYLVFVITALLVIMSGGVTLRLISFFYLNILDRIGGAALGACIWLVVSVNIIIP
FT                   AVFCGTYMSCGQSHIYKTVSHVMQFEVTVFKDYISQSLGRIMIECRK"
FT   CDS_pept        265836..266708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_175"
FT                   /old_locus_tag="TGRD_176"
FT                   /product="ATP phosphoribosyltransferase HisG"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_176"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13659"
FT                   /db_xref="GOA:B1GZH7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH7"
FT                   /protein_id="BAG13659.1"
FT                   /translation="MKKLKLGFPKGSLQNATVELFKKAGTKISISSRSYYLISDDDELE
FT                   IMLVRSQEMAKYVQDGFFDAGLTGFDWICESGAKVEEVCELNYAKSGFRSVRWVLAVTE
FT                   DSKIKSIKDLEGKRVATELINYTKKYFAKNKIKADIEFSWGATEAKAGKLVDAIVELTE
FT                   TGSSLRANKLRVIDEMFSSTTRFIANDKALNDNWKKEKIENMAMLLKGALATEGMVGLK
FT                   MNVPLKFLEKVIVVLPAHKKPTISQLSDREWIALDIIIEERTVKKIIPALKRSGAADII
FT                   EYPLNKIIY"
FT   CDS_pept        266842..267717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_176"
FT                   /old_locus_tag="TGRD_177"
FT                   /product="16S rRNA cytosine-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_177"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13660"
FT                   /db_xref="GOA:B1GZH8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZH8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13660.1"
FT                   /translation="MFHIPVMPLETSRYLIGKPGGLYVDCTFGGGGHALYLLDKFKDIK
FT                   IVAFDWDEDSSKRFIEREKEFSGRVTFIRDNFKNVKKALSALNISKVDGILADIGVSSK
FT                   QFGDLDRGFSFNSGTLDMRMDKRNGFEAKEVVNSYSYEDLADIFYKYGEERKSRQIASA
FT                   ILLRRKRGIINTASELQTVICSVKRPEGRINPATKVFQALRIFVNSELENLAVLLSDAP
FT                   ELLNAGGRTVIISFHSLEDRIVKQNFKRNSECGIYKILTKKVVTALKEEVKINPGSRSA
FT                   RIRAAEKTSV"
FT   CDS_pept        267974..269755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_177"
FT                   /old_locus_tag="TGRD_178"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_178"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13661"
FT                   /db_xref="GOA:B1GZH9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZH9"
FT                   /protein_id="BAG13661.1"
FT                   /translation="MVRRNKKRISRKTVLVLIILAVFFLLFAKLVYVQIFLHGKINEAV
FT                   KRMVSRKNIKISKRGDILDSRGKILASSIEKYTVFLDPKIIEDFDKVKSILSENGIKVK
FT                   EKSLNEFRKTSYVPVVFNIDADTVDRIKNEKLKGIGFESRYLRQYPEGRLLAHILGIIG
FT                   SDGNGLEGIEKTCNESLSGDSIMTRAIRDGRGCIIQDEFIDKTRICGRNVKLNIDRTLQ
FT                   FIAEQELRRAFEKYKAKKAICIIQNPKTGKILAMVSLPDFNSSDKIKDLGILRNSAISD
FT                   IYEPGSTFKIVAVAAALELGKVKFTDSFYLEDGKYKIAGHTIKDDHKIKGNASLSGIME
FT                   QSSNIGMIKIAQKLGSGNFYGYIRKFGFYSLTGVDLPGEARGLLKDVKNWNALSLPAIS
FT                   FGQGIGVTGLQMINAFSAIANDGVLMKPLVIENIGKADAATKAASTESAIAMHAMGTKE
FT                   KPGNGMAEGVFEPKEIRRVVSIETARRVKKLLKSVVEFGTGRSAKISGYTVGGKTGTAQ
FT                   KVDPVLKTYSAKYYTVSFCGMVPAMEPEIVILVIIDEPKGSSYYAASVASPVFANIAKR
FT                   VAEYLGIKKDDKNESSF"
FT   CDS_pept        269775..270637
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_37"
FT                   /note="pseudogene of site-specific recombinase XerD"
FT                   /pseudogene="unitary"
FT   CDS_pept        271892..273424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_178"
FT                   /old_locus_tag="TGRD_179"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_179"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13662"
FT                   /db_xref="GOA:B1GZI0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI0"
FT                   /protein_id="BAG13662.1"
FT                   /translation="MKLRELLSDESAFVIGDEDTEVSGVSYDSRKIEKDYAFFSLPGHN
FT                   TDGRKYIAEAIANGASVIITDSKYDTNDVAQVVIKDIFRFMSLFGAKFYNYPDRELNIM
FT                   GITGTNGKTTVTYMIESILANSGIECGVIGTVNYRYKGKVIEANNTTPQSLDIYRIMRD
FT                   ISNNGIKYLVMEVSSHALSLGRVYGIEFDTAVFTNLTREHLDFHKNMDRYFEAKSALFK
FT                   ELGAGKKNNKKCAIINVDDEYGRKLLKVGISAEIKLYSAIEKNAADFKASNIKVTNKGA
FT                   VFNLVFCNKRARIRIKHIGVHNVYNALAALAAAVCSEISFENAVEGLNNSSRVPGRLEK
FT                   VNTIGLGFEIVVDYAHTDDALESVLRALKDLNPKRIIIVFGCGGDRDRAKRPLMGKIAV
FT                   EMSDFVFVTSDNPRTEDPYQIILDIEVGIKRAGKKNYKVVVDREAAIKEVIMMAADKGD
FT                   IILLAGKGHETYQITSGGKVHFNDVKIAEKYIDLKKKQKIAAKQAGQREFIF"
FT   CDS_pept        273424..274824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_179"
FT                   /old_locus_tag="TGRD_180"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13663"
FT                   /db_xref="GOA:B1GZI1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI1"
FT                   /protein_id="BAG13663.1"
FT                   /translation="METFYLKDLMRVVGGKFVKGNPGFSANGVSIDSRTIKKGEVYFAM
FT                   QGARYDGHDFIKEAINKGAAAVVCSKDKIDFVKSFPDSVSIIKTNDTLISLGEFAKSYR
FT                   TKFKSIKIAGITGSNGKTTTKEILVSIFNRKGRTLSNKGNFNNRIGIPLSIFNLTSDIE
FT                   YAVFEMGTSLRGEIKILSDILNPDAGIITNVGFSHLETFISPKGVFEEKKVLFDNVKET
FT                   GFIVINNDDEFLMTAPQYVSRKIIAFALDVAADVCAKNIKLYSNKMDFEIFYKGTSVKI
FT                   AMPAKGRFNVSNALAAVACAIGFGFSLDEIKCGIENFMPPKMRMETLVTGTDVVLINDA
FT                   YNANPSSMKKAIQAVLQSYSGKKINLVLGDMLELGDKSADYHSELGKFINAHDVSSVHL
FT                   LGEMSFYTKEALNTKNVFHSRNSDSLLTQLKQIPAEDDCVFLFKASRGMKLEKICAEFY
FT                   NILEQRNK"
FT   CDS_pept        274824..275909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_180"
FT                   /old_locus_tag="TGRD_181"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_181"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13664"
FT                   /db_xref="GOA:B1GZI2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZI2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13664.1"
FT                   /translation="MLYHVFYCLSSIFTPFNIFQYITFRAGGAILTSLLICFVAGPCII
FT                   EKLENFKIKQIVRTDGPETHLSKNGTPTMGGLLILLSVVASTFLWARLDNRFILWLLTG
FT                   TLWLGFLGFCDDYLKLKKRDSNGLSAKSKIFGQTVFAAVLAAYLNFFPSNPEFATLVNV
FT                   PFLKGFFINFSFLYALFVIIVIVGSSNAVNLTDGLDGLAIGNITIVAFSLTLFAYFAGH
FT                   FQIANYLKIINVSGAGEISIFLFAVVGSSLGFLWYNSHPAEIFMGDTGSLFLGGVLGMV
FT                   SLFIKQELVLVLLGGVFVIEALSVLIQIFYYRRTGKKVFKMSPLHHHYEMLGLSEMKVT
FT                   VRFWIAGVILAILSFASLKVR"
FT   CDS_pept        275917..277242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_181"
FT                   /old_locus_tag="TGRD_182"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_182"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13665"
FT                   /db_xref="GOA:B1GZI3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI3"
FT                   /protein_id="BAG13665.1"
FT                   /translation="MKKNIGILGLGKSGVAAANLAVKLGYNVFASDSKEKKIKNLNKKV
FT                   IKEFGGHSDKVLNSDVIIKSPGVYSNIPILKKARKQKIKIMSELAFSLENSKYKKIMAV
FT                   SGTNGKTTVTDLISKIIKAAHKDSIVSGNIGCPLADKALKTTETTFITMELSSYQLGDT
FT                   PDFRPAISVLLNITPDHLEYHKTMKAYLRAKENIFINQRDGDFTVINYDDKICRKIFEK
FT                   TKAAVIFFSKTPLKKGVFYDSGSIVINVKEKHYVIKPKINIVGTHNIENILAAVAASYA
FT                   AGVKPAVIEKIVSKYKGVEHRIEFVKTLNGVDYYNDSKSTNIDSTRVALESFDKNILII
FT                   MGGRDKGVPYTPLKELVKQRVKLIFLIGEASDKIKKDLNGASFVDCGNMENAVKQIFRT
FT                   AVRADIALLSPACASFDQFENFEERGKVFKKMVLSLGSGAIS"
FT   CDS_pept        277402..277737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_182"
FT                   /old_locus_tag="TGRD_183"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_183"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13666"
FT                   /db_xref="GOA:B1GZI4"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI4"
FT                   /protein_id="BAG13666.1"
FT                   /translation="MREAIHPKYEESTVSCVCGYTFKTRSIKPLIKLEICSNCHPFFTG
FT                   RQKLIDTAGRVEKFQKRFAKTMGKTIVKKKTEKKVPVSRKTSGKIFTISPKNAKMDPKK
FT                   KKETKGK"
FT   CDS_pept        277815..278885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_183"
FT                   /old_locus_tag="TGRD_184"
FT                   /product="peptide chain release factor 1"
FT                   /note="RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_184"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13667"
FT                   /db_xref="GOA:B1GZI5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZI5"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13667.1"
FT                   /translation="MFLEKLKLLNSIFEEVESKLSDLSVISNQEEYRELTKQHFYLRPL
FT                   AEKYIRYSKLLNEIKDAEELQKSKDAEMKEIAFAEYNNLIEKRNQMENEIKVLLIPTDP
FT                   NEDKNIIVEIRAGTGGNEAALFVGDLYGMYTRFAERNGWKYEVLGSNPTGLGGYKEVVF
FT                   EINGGKVWRCFKFERGAHRVQRVPETEASGRVHTSAATVAVLPEAEEVDVEIKMEDLRI
FT                   DTYRASGAGGQHINKTDSAIRITHLPTGLVVACQDERSQIKNRAKAFKVLRAKIYEQRI
FT                   LEHEMRLSSERKQQIGSGDRSEKIRTYNFPQNRITDHRIGYSVYNITEVMDGNLSELVN
FT                   KLIKADIESKLKENNI"
FT   CDS_pept        278886..279752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_184"
FT                   /old_locus_tag="TGRD_185"
FT                   /product="peptide chain release factor glutamine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_185"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13668"
FT                   /db_xref="GOA:B1GZI6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI6"
FT                   /protein_id="BAG13668.1"
FT                   /translation="MFGDGNVYSLLKRAKRFLESKGLSEPESDVEVLLSFVLQTKRSKL
FT                   PLMRSQKLTDIQVLQYERYILRRSKREPVAYIMGLAGFMDFEFKVNKNVLIPRPETEIL
FT                   VETALKIAKKENKNSVLDLCTGSGCIAVSLAKLGKFKDIMASDVSGSALEIARENARSN
FT                   NVLDINFVKSNVFSGISGKNFDIIISNPPYVSHEEYDALEPELKYEPEIALAADDSGLF
FT                   FYKKIAGKAGRYLNDNGFILIELNAYKAGEIKQIFSTCSYKNIEIVKDYAGLPRMLKAE
FT                   SNSLMGN"
FT   CDS_pept        280108..280621
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_38"
FT                   /note="pseudogene of outer membrane lipid-exporting
FT                   ABC-type transport system, ATPase component MlaF"
FT                   /pseudogene="unitary"
FT   CDS_pept        280618..281937
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_39"
FT                   /note="pseudogene of outer membrane lipid-exporting
FT                   ABC-type transport system, periplasmic component MlaD"
FT                   /pseudogene="unitary"
FT   CDS_pept        282006..283373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_185"
FT                   /old_locus_tag="TGRD_186"
FT                   /product="DNA repair protein RadA-homolog Sms"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_186"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13669"
FT                   /db_xref="GOA:B1GZI7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI7"
FT                   /protein_id="BAG13669.1"
FT                   /translation="MKKQKTRFLCQHCGYESVQWLGKCPSCGAWNSFAEEKFSLPVRTG
FT                   SLSRQLTGFSSEVLKLKDISVKDFSRYQTAIKEFDNMIGGGIVPGSLILLGGAPGIGKS
FT                   TLMLHISDSLSDRGTVLYISGEESLSQVKARAERLKVKKDNIFLASETNLKNIIDAVNK
FT                   IDPKFLVIDSIQTTYHPDLSSAPGTVGQVRETAAELLRVAKSKSIAVFLLGHVTKEGDL
FT                   AGPRVLEHIVDTVLYFENERRQTYRILRAYKNRFGPTSEIGIFEMDSSGLSEVSNPSLI
FT                   FLGERVAEAAGNTVTVAMEGTRPILLEVQALTARTTFGIPRRMVSGYDANRITILIAVL
FT                   EKRLNLPLEMQDVFINIAGGVKIKETSADLAVACAIMSANSGFICPKDIIVFGEVGLAG
FT                   EVRSVTFTAERLSEAEKLGFKKAIIPKSNLKNLSYKGKIDVLGTETLRSAVKFLRN"
FT   CDS_pept        complement(283937..284479)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_40"
FT                   /note="pseudogene of D-sedoheptulose 7-phosphate isomerase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(284508..285857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_186"
FT                   /old_locus_tag="TGRD_187"
FT                   /product="biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_187"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13670"
FT                   /db_xref="GOA:B1GZI8"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI8"
FT                   /protein_id="BAG13670.1"
FT                   /translation="MFKKVLIANRGEIACRVIRACRELGIKTIAIHSEVDRESMHVKFA
FT                   DQSICVGDASVSESYLNIPSIIAAAEISGADAIHPGYGFLAENTYFAEVCEACRLNFIG
FT                   PSKESIEQMGNKITAIKLMKKSGIPVIPGSDGPVNVDDPKIFDTAQKIGYPVIIKATAG
FT                   GGGKGMRIVTSKENLKNSIVMAQTEAKAAFGNPEIYMEKYIEEPHHIEFQILGDKYGKT
FT                   AYLPERDCSIQRRHQKLIEESPSPLISDTLRKKMGRVARNAAEAVKYVTVGTVEFLVDK
FT                   KGYFYFIEMNTRIQVEHPVTELVTGIDLVKEQIKLAAGEKLLIVPEKINILGHAIECRI
FT                   NAEDPDRDFIPSPGTIGKLFLPGGPGIRLDTHVYSGYTIPPFYDSLIAKIIALGESRDE
FT                   AIARMSRALREVEIEGIKNTSALHSKIMANEKFRKGSVSTNFLPKYILGR"
FT   CDS_pept        complement(285933..286412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_187"
FT                   /old_locus_tag="TGRD_188"
FT                   /product="biotin carboxyl carrier protein of acetyl-CoA
FT                   carboxylase"
FT                   /note="BCCP"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_188"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13671"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZI9"
FT                   /protein_id="BAG13671.1"
FT                   /translation="MNSQEVKELLKSIKDTDIEEIQYQSGDNSLYLKKTDVKAIAPDVK
FT                   EAIETEVKVKNKKEEDKKIVLTAIKSTMVGTFASAQSNDKPPFVREGDNIVVGQKIGQI
FT                   EAMKIIKDILSNIKGRISKILVSNGQSVEYGQELFLVDTSKQCERSERKDRVKFE"
FT   CDS_pept        complement(286521..287078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_188"
FT                   /old_locus_tag="TGRD_189"
FT                   /product="elongation factor P"
FT                   /note="EF-P"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_189"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13672"
FT                   /db_xref="GOA:B1GZJ0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZJ0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13672.1"
FT                   /translation="MISTSDFKNGTNILVDGEPYQIAWFQNHKPGKGGAVMRVKLRHLK
FT                   KGGIIERTFKSGEKFKALTITRQKKRFLYKESNNFNFMDMDTYEQITVHPELLGKMVNF
FT                   LKENLEVEAIYLENELIGIDLPVIIEMTIAEAEHGIKGDSVSNTTKTAKLETGADIHVP
FT                   LFIKEGDRIKVDTRTGEYVERA"
FT   CDS_pept        complement(287095..288147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_189"
FT                   /old_locus_tag="TGRD_190"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /note="aminoacylproline aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13673"
FT                   /db_xref="GOA:B1GZJ1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZJ1"
FT                   /protein_id="BAG13673.1"
FT                   /translation="MKEKILKKILGKYQTESILFTNVKETSYLTGAEFDGFWLLNAKDN
FT                   THIICSKMIENQIMEYFGKQNIRMHAESPLYKTVVKILKQDKINSLLINPKYMNAADFI
FT                   LINENLSHEKINLIKKTGVLDSLRIIKGTVEVENLKKACQIVSEVCNTVKEELKPGLSE
FT                   IDIHYRVIELFAKNRVTESFIPIIASGANSANPHHRSSNRKIIENDIVMMDIGCMYNGY
FT                   CSDLTRTYFLDKINDKQKKIWNIVKSSQNAVLKEIKAGLPLSWADKTARNIIEAAGYKD
FT                   KFIHTTGHGVGIEIHEMPLLAPNAEGVFLTHMAVTVEPGIYIEGEFGVRIEDTILIKEN
FT                   GCEMLTSAVY"
FT   CDS_pept        288290..288493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_190"
FT                   /old_locus_tag="TGRD_191"
FT                   /product="cold shock RNA chaperon protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_191"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13674"
FT                   /db_xref="GOA:B1GZJ2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZJ2"
FT                   /protein_id="BAG13674.1"
FT                   /translation="MAQGKVKWFNDQKGYGFISNDDGSGDVFAHYSAIQSDGFKSLAEG
FT                   DSVEFEIVNSDKGPKAANIKKI"
FT   CDS_pept        complement(288567..288998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_191"
FT                   /old_locus_tag="TGRD_192"
FT                   /product="3-dehydroquinate synthetase II"
FT                   /note="DHQase II"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_192"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13675"
FT                   /db_xref="GOA:B1GZJ3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZJ3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13675.1"
FT                   /translation="MKKILVLNGPNINMLGIREPAVYGNITLAEIEKSLSSLAKELKVE
FT                   VEFFQSNHEGKIVDKIQDSINKIFGIIINPAALTHTSITIRDALSSISVPTIEVHISNI
FT                   YAREEFRHKSYIAAEAIGQIAGLGIDGYLFALRKMVSLM"
FT   CDS_pept        complement(288995..290080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_192"
FT                   /old_locus_tag="TGRD_193"
FT                   /product="3-dehydroquinate synthetase"
FT                   /note="DHQase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_193"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13676"
FT                   /db_xref="GOA:B1GZJ4"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZJ4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13676.1"
FT                   /translation="MKQIIVNLKTKKYDIVISQSENDFFTALAKAAKTNMFFVITDKNV
FT                   EKLHLKYFTVLLKRKGFNVKTAVISAGEIGKNIKSLSFLYDKALEAGIDRKSCAIALGG
FT                   GVIGDVAGFFAATYMRGINYIQVPTTLLAMTDSSVGGKTAVNIKGGKNIAGVFYQPDLV
FT                   WINSAFLSTLTERHIKNGLAEIIKYAFTFDKKFYSYLSDTLENGTVPPKDFEYIIYQSC
FT                   SYKARVVEKDEKEITGLRAVLNFGHTFAHALETATKYKKFLHGEAVAVGMLFAVKLSLK
FT                   LRICKPETYKEVENLLQKADFTLSTKNNARQMLSLMKKDKKSIDGNIKFILIKDIGKAV
FT                   STYVKDNVVLNVLKNFTGENK"
FT   tRNA            complement(290367..290438)
FT                   /locus_tag="TGRD_tRNA13"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   CDS_pept        290938..292399
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_41"
FT                   /note="pseudogene of type I restriction-modification
FT                   system, methylase subunit (M protein)"
FT                   /pseudogene="unitary"
FT   CDS_pept        292400..293047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_193"
FT                   /old_locus_tag="TGRD_194"
FT                   /product="DUF3800-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_194"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13677"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZJ5"
FT                   /protein_id="BAG13677.1"
FT                   /translation="MAYIFMDESGCLGFDFTKAKTSRYFVIAFLMAKNDNVINKAVSKI
FT                   FKSIPKNELRVHCGTLHCYKENDRTRIKLLTELKGLEDKDVSVMSIILNKKKVVDYLQS
FT                   EKTRLYNYITKILLDRIINKRLLLSDESIDFIASRREKNRFLNENFRNYLKTKAFPNHK
FT                   LKIEVSITPPHSVKGLQAVDFVSWAVFKKYEHAKSHYYNIIENLVVEESPLF"
FT   CDS_pept        293239..294486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_194"
FT                   /old_locus_tag="TGRD_195"
FT                   /product="type I restriction-modification system,
FT                   substrate-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_195"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13678"
FT                   /db_xref="GOA:B1GZJ6"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZJ6"
FT                   /protein_id="BAG13678.1"
FT                   /translation="MRINSKREVKKLGEICEIVNGGTPKTNVREYWNGTNLWITPAEMG
FT                   KREIPFVEKTVRQLSDSGLKNSSAKLLPPYSVILSSRAPIGHLVINTKPMATNQGCKGL
FT                   IPSGKLFYLFLYYYLYFSVDYLDKLGTGTTFKELPTWKLKEVEIPFPLLSEQKRIVTKL
FT                   DKFSENIKRLEDAARKNIQNVKDLFNSVLNETFKNKSAVVNDNRQVYKKAHWEVKKLGE
FT                   ICTFINGLWAGKKCPFINVYVIRNTNFTKDGKLDLSNVVNLSLEKKQYEKKRLEYDDII
FT                   LEKSGGGPKQPVGRVVLFDIKKGNFSFSNFTSVIRIINKRYVYPKYLYNYLFYCYISGM
FT                   TEVMQSHSTGIRNLNFDEYKKINIVFPSISEQKKIVARLDKLSTKTKKLEIVYQEKIDG
FT                   LAELKKSVLKQTFDCG"
FT   CDS_pept        294614..296919
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_42"
FT                   /note="pseudogene of type I restriction-modification
FT                   system, restriction subunit (R protein)"
FT                   /pseudogene="unitary"
FT   CDS_pept        296932..297456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_195"
FT                   /old_locus_tag="TGRD_196"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_196"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13679"
FT                   /db_xref="GOA:B1GZJ7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZJ7"
FT                   /protein_id="BAG13679.1"
FT                   /translation="MKNAVYLSLGSNVGDRAENIVSALSFLQSSLFADIKKISSFYETA
FT                   PIGPKQRSFYNIVIEAQTDLKPDDLLLFIKQAEHILGRRKTIRWGPRVIDIDILLFCRK
FT                   IINQTGLTVPHKEIQNRLFVLIPLSEIAGDFVHPVLKQKISGILYDKSLTLKCQKVKII
FT                   QTNIANRSLKN"
FT   CDS_pept        297502..298302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_196"
FT                   /old_locus_tag="TGRD_197"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_197"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13680"
FT                   /db_xref="GOA:B1GZJ8"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZJ8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13680.1"
FT                   /translation="MKKKTVLTILKKKQSGEKITMLTCYDYVTAKLISSQDIDVLLVGD
FT                   SLGNVKLGYENTLSVTVDDMIYHTKSVKRGNDGALLITDMPFMSYEITVEDAVKNAARI
FT                   VKEGGAEAVKVEGGIEIVDRVKAISDAKVPIVGHLGLTPQSINKFGGFKVQGRTEEERG
FT                   RLIADAEALEKTGAFAVVLEAVPEQLAKEVTERLKIPTIGIGSGRYCDGQVLVVDDMLG
FT                   MFTDFTPKFVKKYAEIGEMVRTAVKNYIDEVKKGQFPREENTYK"
FT   CDS_pept        298299..299150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_197"
FT                   /old_locus_tag="TGRD_198"
FT                   /product="panthothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_198"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13681"
FT                   /db_xref="GOA:B1GZJ9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZJ9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13681.1"
FT                   /translation="MKIIKNASQMQKIALRHIKNGDEIGLVPTMGALHEGHISLIAKSV
FT                   KNDDITIVSIFVNPIQFGPNEDYLKYPRPVKKDKEICKKNHVDYVFMPSVNDMFPADHK
FT                   TFIEVKTLQDILCGAFRINHFKGVATVIAKLFNISCADRAYFGMKDFQQLKIIEKMGKD
FT                   LNFRTKIIPCSIVRERNGLALSSRNSYLSAEGKKRSLNISKSLKEAAEDFKRRDLNFVK
FT                   KTVINKLKKIPGSEIDYAEIVNFDDLLPADKNTKKAVFAVAVWIGKTRLIDNIMMIKDK
FT                   DS"
FT   CDS_pept        299151..300713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_198"
FT                   /old_locus_tag="TGRD_199"
FT                   /product="L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_199"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13682"
FT                   /db_xref="GOA:B1GZK0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK0"
FT                   /protein_id="BAG13682.1"
FT                   /translation="MISSDYLVIGSGIAGLSLALKASKNGSVSLITKKKLFDSATGKAQ
FT                   GGIACVMDESDSFEAHVRDTIVSGAGLCNEKMVEKMVVEGPERIRELIVLGVEFTKKKD
FT                   SDSKFELALEGGHGKRRILHAGDITGNEIERVLIRNIEKHKNITVYEYHTAIDLILNKD
FT                   RICRGVYVFDSENNNTEIFEAKVTALTCGGAGKTYLYTSNPDVATGDAVAMAYRAGADI
FT                   ANMEFVQFHPTCLHSSDARSFLISEAVRGEGAVLKLKDGGSFVEKYNPQKELASRDVVA
FT                   RAIDCELKSSGEKFVYLDITAKSKDFLMKRFPNIYAKCLEYGIDISRDMIPVVPAAHFF
FT                   CGGVVIDENGRSSIKNLYAAGETACSGVHGANRLASNSLLEGVVYADRIYKDSLQFLRK
FT                   EYSKIDGKPIGNIKSSLNKSAVFVQKKEEVRRLTWDYLGISRSNEGLLKAQEKIDVLKV
FT                   EIEQCFKKAPFTIDGIEVRNMMFIAEMIARSAIQRKESRGLHFNTDYLFLLPDVKDTVI
FT                   NIR"
FT   CDS_pept        300741..303551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_199"
FT                   /old_locus_tag="TGRD_200"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13683"
FT                   /db_xref="GOA:B1GZK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK1"
FT                   /protein_id="BAG13683.1"
FT                   /translation="MDIIKIRGARQHNLKNIDLDIPRNKLIVITGLSGSGKSSLAFDTI
FT                   YAEGQRRYVESLSAYARQFLELMEKPDVDIIEGLSPAISIEQRNPLHNPRSTVGTVTEV
FT                   YDYLRLLFAKVGVPHCPKCGKIIRPQSAQQIIDEIMKMPAATVIHILSPLIKGRTGTYE
FT                   ELFSRLAKSGYSRVRVDNEVYLLDEKIELNRYKKHTIDIVIDRITLNENLRSRVAASIE
FT                   TALKESKGTVSVAVIKDGKSIAETVYSEQYACTDCGINLSDIEPRLFSFNLPFGACPEC
FT                   GGLGNKIEIDENLVVPDKNRSVRHGAIIAWSEPITTKTNRWKNSWGGYYRELLTEVARK
FT                   NKISLIVPWEELIREHQKILLYGQDDFEGVITNMQRRYNETESAFVREEIYNKYMTRKI
FT                   CPLCGGQRLKREALSVLVGGKSISDVTKMSVEKSFDFFDKIRFGGKDKIISKAVLKEIH
FT                   ERLRFLNNVGLGYLSLERESGTLSGGEAQRIHLATQIGSGLTGVLYVLDEPSIGLHQKD
FT                   NYKLLETLIKLRDLGNTLIVVEHDEDTMRRADRIIDLGPGAGVYGGHIVAEGNAKEIVK
FT                   FKNSLTGQYLKGVLQIPVPKKRKQLSDKCLTVEGASQFNLKNIDVHIPIGLFICVTGVS
FT                   GSGKSTLVHEIVYKSIAHKLYGSKEKPGKFKNMDGLENIDKVVIVDQSPIGRTPRSNPV
FT                   TYTGAFSIIRDLFAWVPEAKARGYQPGRFSFNVKGGRCENCQGDGTLKTEMQFLPDIYV
FT                   RCDVCGGRRFNEETLQIKYKGRNIDEVLNMTVEESVKFFENIPVLKRILSTIEDVGLGY
FT                   IRIGHQATMLSGGEAQRVKLATELSKKATGRTMYILDEPTTGLHFADVSKLLEVLQRFS
FT                   YAGNTVLVIEHNLDVIKTADWLIDLGPEGGERGGRLVAEGTPEDVMKNPKSFTGYYLRN
FT                   HINRHK"
FT   CDS_pept        303858..304571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_200"
FT                   /old_locus_tag="TGRD_201"
FT                   /product="putative DNA alkylation repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_201"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13684"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK2"
FT                   /protein_id="BAG13684.1"
FT                   /translation="MKINFKENLLKDLKKYKNEIFANRYAKYFQTHKGGYGEGDFFWGL
FT                   KVPQQRITARKYWKDINLKDVEKLLQHRIHEVRLTALMILIEKYKKADDAKSVIVKIYL
FT                   RNSECINNWDLVDLSAPYIPGHYWHDNSLKDFWEYAESGSLWKERIAMISTLYFIRQGR
FT                   FVETLALSKLFLAHNHDLIHKASGWMLREVGKRDTRTLISFLDKYSNVMPRTMLRYSIE
FT                   KLSQEKREYYMEKDI"
FT   CDS_pept        304861..306036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_201"
FT                   /old_locus_tag="TGRD_202"
FT                   /product="HD superfamily cytoplasmic hydrolase"
FT                   /note="COG1896"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_202"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13685"
FT                   /db_xref="GOA:B1GZK3"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK3"
FT                   /protein_id="BAG13685.1"
FT                   /translation="MITKDLILRIFSAANILRWNDHIRPFDFFELDKQAHKMIIAYIVA
FT                   KFEEEDDKPVDWVKLIECGIFEFFQRIMLTDLKPEVFREIMSKKEKELNRWVIENLNND
FT                   LSVLKGEFSKRCSEYLLESDYALHEKRILSASHCLSTKWEFNIIYPWNSMIYGIEKTKN
FT                   EIEESIAAFDDLSGIKKLVINKKYYGFLDLCGQLRFQQRWAQAFRIPKTTVLGHMLTVA
FT                   IFAYLLSMEINASDRRKYNNFYSSLFHDLPEILTKDIIKPVKSSIVGLENIIKHYEKKQ
FT                   VVEKILPLIPPEWHFEMQYFIEDEFLDKIIENGKVKKVDNAADFNDNKYNAVDGTLTEM
FT                   CDKLCAYIEASMALEYGIKSSTLIKSKQTLYDKYSNVRKNNLDFRRLFDHF"
FT   tRNA            complement(306693..306776)
FT                   /locus_tag="TGRD_tRNA14"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUG"
FT   CDS_pept        307006..307791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_202"
FT                   /old_locus_tag="TGRD_203"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_203"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13686"
FT                   /db_xref="GOA:B1GZK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK4"
FT                   /protein_id="BAG13686.1"
FT                   /translation="MDSFIELKKISVLRGDRKILDDINFDISSGENVAVIGPNGSGKST
FT                   FIKLITGKIYPSYTGNGTVCKLFGHSRWNIHNLRSMLGIVTNELQHDFYNEITGFEAVL
FT                   SGFFSSVGISNNHIVTKDMTKKADDMIDFLEVSSLRNKKLETMSSGEARRFLIARALVN
FT                   NPKVLVLDEPSNSLDISSSLKLHNTMRKISYSGTKIILVTHLVSDIIPEMNRFVFFKGG
FT                   KIFADGKRSEVFTCDKLSSLFDMKVKLAENNGLCCITIV"
FT   CDS_pept        308004..310574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_203"
FT                   /old_locus_tag="TGRD_204"
FT                   /product="phosphatidylglycerol lysyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_204"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13687"
FT                   /db_xref="GOA:B1GZK5"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK5"
FT                   /protein_id="BAG13687.1"
FT                   /translation="MRKWIKFIIVPLGFLIFIGALMLLHDQLKDLNYVDIINALKAIPA
FT                   LRITIALFLSLSYYLIFGGYDVIAFKYIGLKVPLSLKDILFTCFISNVLGSNTGYSMLF
FT                   GGSIRYRLYSVYNVPIVDVTKIIIFSSITIWLGFLTVGGLIFTFAPVSLERMFSFNFTT
FT                   RTIGLFFIAVLVLYIFLSILRSRPIKIFKWNVAFPNIKIVSSQILLATYDWLIASLILY
FT                   ILMPSGEISYFVLLKAFLVSQLLGIISQVPGGIGVFETAISKLLPNSASNPGVIGGLLA
FT                   YRAIFYFFPFLIALALLGIFEIMMFIKKFNGKAKIFGKTISSVIIRVIALSSFFAGMIV
FT                   MFSTSTPFDVVQLKFVINILPAWFANLSHFLLSITAIGLLFVSKTLQLRVKSAWSTACI
FT                   LISFMIVLVLVVGEPPLVLLYLIALLISLLFSKKYFYRDMSILNTAFNAWWFSAIAVGG
FT                   ILSVWIGFFVNRQDTFSWVHLGVFFKNILSTTDAARFLRASLGMGIIIFIAVLEQISRN
FT                   LFKKPVSFTKRDIKNIVDSSDYTYSFNALASDKSYIVNDEKDAFIMYAKSKGSLIALGD
FT                   PIGKSERRNELLWQFKEIADNALAKPAFIGVDHKYMQIYDDIGLDTFNIGQEARVPLIT
FT                   FDKRDNRFEYFCSLEKDIEDSGFKYQIMNAGQFGQYKEIFAKINEEWEKNTNYLERNFI
FT                   PGKYDESYMNDMDFGILEKAGKIYAFSIIIKTKNKCELSSEVVRYIKCDHNVFAYVVFK
FT                   NILWAKQNEYDWFNLGFAYSPAVNSDGGVIRHFAKMFMFAEHFDYNLVFLRKFKDKFYP
FT                   VWRNKYIAVSPDKYIVTFIKNFTTLISPLRMVDEKHLFRRFFKR"
FT   CDS_pept        310571..311536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_204"
FT                   /old_locus_tag="TGRD_205"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_205"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13688"
FT                   /db_xref="GOA:B1GZK6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK6"
FT                   /protein_id="BAG13688.1"
FT                   /translation="MKTWNIFYQNVSQNGFVIPGDKIILSVSGGMDSMCMLHLFWRLAK
FT                   KMDIVFLAVNFNHNLRKESVKEAETVKNLSAEFGIDCLLEEIGVKEYSKKYSLSVETAG
FT                   RNLRYLTLERISKKYKCNKIATAHNANDNAETVLMRLLRGSGNFAGIPQKRKINRNIVV
FT                   IRPLLPVKRKFIEEYVRNHKLPFCTDKSNFSDIYTRNKIRLSLMPVFEKINPMAVEHIF
FT                   ALSCIQSRENAYLEEVSAKFLKKCVKKQKNQILLDLKTFLRYNKTIQFRILKNLLPQKK
FT                   YNSHINLIMRKIVLSDTSVYRLSAGWIFKIKSDKACFIRN"
FT   CDS_pept        311809..313704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_205"
FT                   /old_locus_tag="TGRD_206"
FT                   /product="cell division protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_206"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13689"
FT                   /db_xref="GOA:B1GZK7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZK7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13689.1"
FT                   /translation="MKKSNPWFVFFWITLLVIVLMFINFARQGGNEVELEYSQFKQHIK
FT                   AGSVFKVLVAPGLIRGQFRDGDGVFKRFKTVPMDDPNLVKDMEDNKVLEFSATEKSGWL
FT                   GSLLLNWGPVVLLILFCFWMMRGMSMGNKQAMSFGKTKAKLAVGASKKITFKDVAGCDE
FT                   AKEELQELIEFLKDPARFQKLGGKIPKGVLLFGSPGTGKTLLAKAVAGEANVPFFSSSG
FT                   SEFVEMFVGVGASRVRDLFDHGRKSAPCLLFIDEIDAVGRHRFAGIGGGHDEREQTLNQ
FT                   LLVEMDGFDSKEGVILIAATNRPDVLDPALLRPGRFDRQVIILSPDLKDREEILGVHSK
FT                   KIRLDNDVNLNVIARRTPGFVGADLANLVNEAALLAARNSQNAVNMKNMEEAIDRILAG
FT                   PQRKSRLMSDKEKNIIAYHEAGHTLVAKFLPSADPVHKVSIIPRGPALGYTLQLPEEDK
FT                   YLTSKSELLDKLSILFGGRVAEELVFSEITTGAQNDISKATGIAMRMVTEFGMSDKIGP
FT                   MALQRPNEEVFLGRDISRDARHSGKTSELIDEEVKNIIYSSKSRASKIIKDNVSILNKI
FT                   VSYLLERENLSGEDIDKIIKGEELAPLSESSSVDEETKKKSTVEKKVINEKVIIS"
FT   CDS_pept        313764..314336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_206"
FT                   /old_locus_tag="TGRD_207"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_207"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13690"
FT                   /db_xref="GOA:B1GZK8"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK8"
FT                   /protein_id="BAG13690.1"
FT                   /translation="MQIFNFDEKKAQRAVKLLLESFGEDLNREGIKRTPERVAEFYKEV
FT                   LSGNKIDPLKFIPVHYATEDHEEIVLVKDITFYSLCEHHLLPFFGKMHIAYIPKKDRII
FT                   GVSKLIKLVEIFANRLQLQERLTKQLADIVMKFVKPHGVMVVVEAEHLCMTMRGVKKTG
FT                   SKIITSAMRGIFLKDVRTRSEAMSLLR"
FT   CDS_pept        314748..315914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_207"
FT                   /old_locus_tag="TGRD_208"
FT                   /product="dihydropteroate synthase"
FT                   /note="DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_208"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13691"
FT                   /db_xref="GOA:B1GZK9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZK9"
FT                   /protein_id="BAG13691.1"
FT                   /translation="MIIRKAIVSNFNDALRLVKNTGSSSIVNELLAKKGVFNAIVIEKI
FT                   DNRAANILKQETISVGASVALNENVSRFKKGISNTVLFATVNQIEKLIKKLRLQPFRLK
FT                   EIALKLENIVNKKKVFKYRERYMDLSNPVVMGIVNVDPNSFSGDGLTDPNEALKQAVEF
FT                   ERFGAGIIDIGAESSRPGTKLIDAKTEIKRLIPALKRIRKNVKIPVSVDTYKYETVKAA
FT                   LDEGADIINDIFALRKGRERSAKLIADAKAGVILMHMKGIPKNMQTSPEYKNCTSEVYG
FT                   FLAQQKEYAVGFDIEEERIAVDPGPGFGKTVEHSVELIKNIGVFSTLGAVVGAVSRKRF
FT                   IKALAGEDRTSFIAANFLAGFCGADIIRAHDVKETVNVLKMAETFRRM"
FT   CDS_pept        315914..316777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_208"
FT                   /old_locus_tag="TGRD_209"
FT                   /product="diadenylate cyclase N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_209"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13692"
FT                   /db_xref="GOA:B1GZL0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL0"
FT                   /protein_id="BAG13692.1"
FT                   /translation="METMLNIYNTYIVNILDIFILAIVFYRVVLIIKGTMAIQIIVGIL
FT                   FILGFTIVAEYVLYLRVLSWLLSRLWVTAVVIFAVIFQTEIRSVLARLGGQLWGLKAKV
FT                   KDSYIIEIVEAVEDLSVSMSGGLIAIEKEIGLKNFAETGIPLNADISKELLLSIFKNKS
FT                   APLHDGAIIIFKDKISAAGCLLPLNNDTGVEILGTRHRSALGLSEVTDAVIIVVSEETG
FT                   RISVAYKGELSFNISSAELRKIISINGEAEVKMKRLYIKMRENWQLKLLALCLAIFVWL
FT                   YVVGYK"
FT   CDS_pept        316779..318119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_209"
FT                   /old_locus_tag="TGRD_210"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13693"
FT                   /db_xref="GOA:B1GZL1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL1"
FT                   /protein_id="BAG13693.1"
FT                   /translation="MKLFGTDGIRGDSFKFPFDNITLGIIGKSIAETLVSKKDILVIRD
FT                   TRESGKRIQKELAKGILSAGVTPVFGGIMPTPAASFLMQSGKYSAAVVISASHNPYMDN
FT                   GIKIFNSKGLKIGDFVETEIEKKVNKYLGLKAVVSIKKIKVVENSELLKFYKEFIVRNF
FT                   TGSDLKGKTIVIDCANGASYKCAPYVLRKLGARVIALNVKPNGKNINLNCGALQPEYAV
FT                   KIVKELKAFCGFAFDGDADRLVCIDENGIVRDGDYFLASMACWLKSKKNLKNNILVATV
FT                   MTNIGFLQAMKREKIKIVSAKVGDRYVISDMKKYKAVLGGEQSGHFIFKDILATGDGLL
FT                   SAVMLLTALSDKNKTMLEFMNVIEKFPQVFINKKVSVRIPVEKLSESYKLIKSYERSLG
FT                   TDGRILVRYSGTENLLRVMVEGKEIKEIKTIAKNIADSIEKEIKYYE"
FT   CDS_pept        318624..319358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_210"
FT                   /old_locus_tag="TGRD_211"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /note="PNP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_211"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13694"
FT                   /db_xref="GOA:B1GZL2"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL2"
FT                   /protein_id="BAG13694.1"
FT                   /translation="MVKLGVNIDHIATIRQARKEDFPSVIKAAAICEKSGADGITVHLR
FT                   EDRRHIQDEDVYDLRKSLKIKLNLEMAASEEIVKIALDVKPDFVCMVPEKRQELTTEGG
FT                   LDVKAHKSKLASIVARLQKAGIIVSVFIDANTEQVLACSEIKADSIELHTGKYAKFFKE
FT                   NGTDSSEFKEEMERLSEASRKAVKKGLILNAGHGLDYDNVERICNIPGMNEFNIGFSII
FT                   AESVFAGLETAVRNMKELISKD"
FT   CDS_pept        319362..321197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_211"
FT                   /old_locus_tag="TGRD_212"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_212"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13695"
FT                   /db_xref="GOA:B1GZL3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL3"
FT                   /protein_id="BAG13695.1"
FT                   /translation="MCGIFGYIGKKNAVDIIFKGLEKLEYRGYDSAGIAVVIDKELCIR
FT                   RSVGKLCNLGLSLKENPISANIGIGHTRWATHGSPSKENAHPHTDTAKTVVIVHNGIIE
FT                   NYVELKAELQKDGYEFKSETDTEVIAHLIKKYCKGNLFCAVQKTLSRVKGSYALGIVSK
FT                   DEYDKIICARKDASLIIGVGVGENFMASDIPALLPYTRDMIFLENGDIAEITAEKVVVK
FT                   NIKGDIINREIKNIRWDTVQAEKDGYKHFMLKEIFEQPRTIEDTFRGRIYPDEGRVYIE
FT                   EVKLKLKEEYIKNISNIYIVACGTSYHSGLVSKFLFESFAKIPTEVDIASEFRYRDVIL
FT                   DEKTLVVVISQSGETADTLAALRLAKSKGCQTLAVCNVVGSSISREAMYVIYTHCGPEI
FT                   GVASTKAFTGQVTALYVLALDWAYKREALTIKELKKYLKELWEIPLKINEFLKNAESVH
FT                   DIAKVFANKRDFLYLGRHINYPVALEGALKIKEISYIHAEGYAAGEMKHGPIALIDKSM
FT                   PIVAIVIKGRIYEKIISNIEEAKARGGTIIAVADQSDKEIGNKSNYVIYVPETDEFVSP
FT                   LMTVIPLQLLAYYISLILGCDVDQPRNLAKSVTVE"
FT   CDS_pept        321542..321877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_212"
FT                   /old_locus_tag="TGRD_213"
FT                   /product="holo-[acyl-carrier protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_213"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13696"
FT                   /db_xref="GOA:B1GZL4"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL4"
FT                   /protein_id="BAG13696.1"
FT                   /translation="MNVGIDIEEVERFVKYVRDKKFLERIFAKEEISYSIPRKNVAQYL
FT                   AARFAAKEAVWKALSTRNKKFTIADISVRNTKDGKPQVYIKNKKYKRIDISLSHTDKYV
FT                   AAVAIAF"
FT   CDS_pept        321885..322739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_213"
FT                   /old_locus_tag="TGRD_214"
FT                   /product="putative hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_214"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13697"
FT                   /db_xref="GOA:B1GZL5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL5"
FT                   /protein_id="BAG13697.1"
FT                   /translation="MKEKEIRSFASKLKRKPDSYKYNYGHVLVIAGSNTMPGSGILCCL
FT                   GALRSGSGLVTYAVRDNFLDQACAISKPEVMFFVYRTATDILDFIKSRKVTSIVIGPGL
FT                   KADNSVLCKFIKEIIYAVNIPVILDASGLACFNGIAGELKTTNAKLIITPHLGEFSKLL
FT                   NIQSAVIENDRKKIVADFAEVNSLICVLKGSNTFVSCGKKNYKNNTGTPAMATAGSGDV
FT                   LSGIISSFVNVTDDVFEAVTFAVFIHGLAGEIAEKDKGMTGVIASDIAENICYAIKQIM
FT                   MKR"
FT   CDS_pept        322870..322925
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_43"
FT                   /note="pseudogene of M20 family peptidase"
FT                   /pseudogene="unitary"
FT   CDS_pept        323150..325594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_214"
FT                   /old_locus_tag="TGRD_215"
FT                   /product="CRISPR-associated protein Cas3"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13698"
FT                   /db_xref="GOA:B1GZL6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL6"
FT                   /protein_id="BAG13698.1"
FT                   /translation="MISENQPLLFYAHLSKSKDDKNKRQELNTHLTEVAEMSQKNASKI
FT                   GMRNIGYCLGLLHDLGKYSELYQDYLLGERGDISRGDIDHSTAGAQYFNEFIKASMQDD
FT                   NKLKNFLSEQIELCCVSHHSGLIDMIDIRGKNNFDKRLNKKYYYKETVSIEDIKKNIEK
FT                   DVVDKINNIANNNLLYEIEQIKSKIDKNSKNEIYRTFSYGMLARFLLSCLIDADHTNSA
FT                   DFERGKKIKNKLVDWNIISEKLEKAIDELNDKNKSSENIKEIRKQISDDCAIAGQTYQK
FT                   GCYKLEVPTGGGKTLASFRFAVEMAKKCNAGIDRIIYCIPFTTIIEQNANTIRKIVEAD
FT                   KSDKGNIVLEHHSNISQTSYDKGKEEEFNPTELYMQSWDIPIIFTTNVQILEVLFGRRT
FT                   SDTRKLHQLANSIIIFDEVQSLPIKCVHLFNNAINYLVDFCNTTVVLCTATQPLLDNVD
FT                   PERGCLKLSEKPDIIQNRNCVFDSLKRVEVKPEIKDVDYTSEEIASKAAEFVNDNENCL
FT                   VICNTTKSAKEIFEIIKGRVDYEVYHLSARMMPIHRKIVLRAIKRKLNKRKKIAVVSTQ
FT                   VIEAGIDIDFNCGIRALAGLDSIIQAAGRINRNGTLKTNDGNNKKGKLYVYNFNENLGI
FT                   LDDIKRGKDTAKIILRRHPNADLLDNKIIKDYYDDFFYQKEQRKDMQFLICNENTELDL
FT                   LSENRKYNGKYNLTLNQSFKEASNNFKVIDNIASPVCIEIKRVRKIIDKINSSFDSKER
FT                   YKLIKKLHKYRVNIYPSQFKNSTAIKPINNDLDIYSISDCYYDKNFGITEEAALDKGGA
FT                   CV"
FT   CDS_pept        325587..326330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_215"
FT                   /old_locus_tag="TGRD_216"
FT                   /product="CRISPR-associated protein Cas5"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_216"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13699"
FT                   /db_xref="GOA:B1GZL7"
FT                   /db_xref="InterPro:IPR010155"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL7"
FT                   /protein_id="BAG13699.1"
FT                   /translation="MFNIPKNAIEFKVYGKYALFTDPITKLGGEKCSYQIPTYEAIKGI
FT                   TESIYWKPTFIWIIDKVRVMKSIEMEAKGVRTLKYHGGVGLYYYTYLRDVEYQVQAHFE
FT                   WNVNESNLIQDRIDGKHFAIANRSLENGGRRDIFIGTRECQGYVEPCKFGEGDSDYDNN
FT                   NLLSFGSMFYNFGYPNETGKKELITRIWLDANMKKGTVDFNDKKNNIKERIVKPMQQEN
FT                   QYVLDKNILKVNTEYENIFGNMEVK"
FT   CDS_pept        326330..328327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_216"
FT                   /old_locus_tag="TGRD_217"
FT                   /product="CRISPR-associated protein Csd1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_217"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13700"
FT                   /db_xref="InterPro:IPR010144"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL8"
FT                   /protein_id="BAG13700.1"
FT                   /translation="MSWFQRLYETYGNCVAAQGKFEIAPVAHTNKVCNIEIKLNEKAEF
FT                   IEAEFIEAITPIPTTDDNNCLWPLAVDIKTYQKEKDKQGKELKVTYKKLLKEWSDTADI
FT                   KIQIVNKYIQKNTLIQDLVEKKRILWLSEDGKFIEKPKNKKDITDKYKIFQYVKKQEDV
FT                   FIRWIVDTDKCRKTWEDKAIIESWINFRKQKENKKYKSEIEKTYRKIDKENNIVSRLTD
FT                   DKICYISGEITDCITTNHPFANGTSKLIAVGDDLVFKGIFEEYYEALSVSFDVSQKAHN
FT                   TLKWLISKERKQAYRNYPQIIVAFTINGKSGNVGLIFGEDFVKSAKGYRIDFEKFEEDE
FT                   KIVKTSLQSRKHKIDFEKFEEDEKIVLLEMNAASPGRACITYYKELLGSQYLKNIKNWH
FT                   KKYCWQFLKRKNKNSQKKEYQYFCGTPSINTIANSYFYKKDKYSAEKSEQNIKRKLIRD
FT                   LMPSVLENKNIPEYIEKHFIEKASNPVVLNNIQWKTILSIACSIYKGNHLYYDENKKEE
FT                   DCLMSVDENCKDRNYLYGRLLAVIDDAEKSALLKQNKENSNAKEAIRSTNAQRLMRQFS
FT                   IKPFETWKFLYEKFNDAYKKRLSGDWIDKRIADIKDKFTSIEEFENNLKLTGLYLLGYF
FT                   HQLKTIENERGAAIQNKNKKEKEFSNDTAK"
FT   CDS_pept        328311..329162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_217"
FT                   /old_locus_tag="TGRD_218"
FT                   /product="CRISPR-associated protein Csd2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_218"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13701"
FT                   /db_xref="GOA:B1GZL9"
FT                   /db_xref="InterPro:IPR006482"
FT                   /db_xref="InterPro:IPR013418"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZL9"
FT                   /protein_id="BAG13701.1"
FT                   /translation="MTLLSKKIDFVVIFKVKSANPNGDPLNENMPRTLADGIGEVTDVC
FT                   IKRKIRNRLLDMNKDIFVQSDDYKKDKYSSLQERANEEIGKISETSDFSTKACEKWMDV
FT                   RAFGQVFAYEKGSSIGIRGPVTIRTAFSKEPIIVISDQITKSVNSKSNKKGNDSDDEGM
FT                   ASDRMGMKHWIREAIYVFYGAMNPQLAEKTAFTDEDAKDIKDVLPKLFEKDASSARPEG
FT                   SMEILKVIWFEHNSPAGQYSSAKVHSSIKIDNSGNIENEKDLENGTVESIKGLKAEIIQ
FT                   GW"
FT   CDS_pept        329166..329804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_218"
FT                   /old_locus_tag="TGRD_219"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_219"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13702"
FT                   /db_xref="GOA:B1GZM0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM0"
FT                   /protein_id="BAG13702.1"
FT                   /translation="MYCEDDLLHIRGVQQLSYCKRRCALLFIEQQWSDNFFTAKGIVMH
FT                   DKAHAEKIEHKKGVVIERDIYLKSYELGLIGKSDVVEFHRSGNKLIPFPVEYKSGKAKS
FT                   DNVDKVQLCAQALCLEEMMNVTIESGAIFYGKTRNRLNVEFNKSLREETFALAQEFHSL
FT                   VDSRETPKPEYSKKCYNCSFKELCLPEIFDKQKSVKKYLKEIVNNEKTI"
FT   CDS_pept        329788..330822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_219"
FT                   /old_locus_tag="TGRD_220"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13703"
FT                   /db_xref="GOA:B1GZM1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019856"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM1"
FT                   /protein_id="BAG13703.1"
FT                   /translation="MKKLFSTLYVSTQGTYISKERENIVVSLQSKELFRAPIHLINSVV
FT                   CFGNIMCSPFLLGLCAENNASVSYFTEYGRFIAKVQSPVSGNVLLRKQQYKYSDDGKFC
FT                   LETAQSVLLGKLNNSRTVINRALRDHEDKISDSDKLKQVSDGLRRAIANIFNAENVDVL
FT                   RGMEGDAAVAYFSVFNKLILNHKEEFFMPGRNRRPPKDRVNCLLSFVYTLLVHDVSSAL
FT                   EGVGLDPQVGFLHKDRPGRPSLALDIMEEFRSVIADRLVLTLINLSQVNANGFSESPSG
FT                   GVIMDDENRKIVIDAYRKRKEEEIFHPFFKENIHIGLLYHAQALLFARYIRGDIDAYPP
FT                   FIWK"
FT   CDS_pept        330832..331122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_220"
FT                   /old_locus_tag="TGRD_221"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_221"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13704"
FT                   /db_xref="GOA:B1GZM2"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM2"
FT                   /protein_id="BAG13704.1"
FT                   /translation="MLVLISYDISTIDAGGQKRLRRVSKECLDYGQRVQYSVFECEVDP
FT                   TQWIFLKDKLLNTVNLKKDSIRFYMLGSDWKRKIEHYGCKKPVDLHETLII"
FT   CDS_pept        339128..342226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_221"
FT                   /old_locus_tag="TGRD_222"
FT                   /product="CRISPR-associated protein Csn1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_222"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13705"
FT                   /db_xref="GOA:B1GZM3"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR028629"
FT                   /db_xref="InterPro:IPR033114"
FT                   /db_xref="InterPro:IPR041383"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM3"
FT                   /protein_id="BAG13705.1"
FT                   /translation="MKKRILGLDIGIASVGWALVEFDDEFQDNKKKGTIIKSGVRIFTR
FT                   AETPKERESLAKPRREARSQRRRIRRRVERLNSIRELFVKNGVVEEWSVSKKNPNNIYI
FT                   TLNQIKTPWQLRMESLDRKLTNEQFAVVLTHLAKHRGYKSLRKDDKAGKVLEAISQNKK
FT                   RLNDSDYRTLGEMFCKNESYKEHKRNKGGEYINSVARELIEEEVEKIFVKQREKGNNFA
FT                   DVNTEREYLKIAFSQKPAGSISKMVGFCTFENGEKRAPRDSYSAELFKVLCTINNTTFT
FT                   DMKTGEIRSFSKEEIGKTLETVKNVKDVKYAKIRKDLGLEDSVKFSGVDYRENAKSKGE
FT                   GEIFVSMKTYHEIKSKIEKLSKEKWDNLKGNTELLDSIVNIIANLKDDESIKKEFQKLK
FT                   IDEDIIDVLLNFEFKKFINLSFKALRKIIPFQFQGQKYITASTSAGYSLKQEGIKNKLV
FT                   PPAKENINVAVVARAFAQTRKVINAVIRKYGQFDQINIELATELKNSKFDRSKIEEGQK
FT                   KFQSQKDKIFKEVQELRGGMTPSSSLLLKYRLWREQDERCVYSGRKISFEDLLDTGFLD
FT                   IDHIIPYSKSMDDSFNNKVLCLAEENRNKKNDIPFNYYQRIDRDWNLLISIITSMKNMK
FT                   IAKKSRLLKQELSDIEGFIERNINDTRYATRYIKDFLENNLEFKENEFIKVKVQARSGG
FT                   LTSVLSYNWGMSKDREESYFHHAKDAIIVACSTQGMVQYISKISQQYENDKDKMKKIKD
FT                   KTENCIPKPWDSFRADVEESIEGIFVSFAPRHKVTGSAHKETIYSKKHLEKERYVTVKK
FT                   SLDKIKLSDLENIPCNENCGIIRVLKERLEKFKNDSLKAFADPVHMPTKCPNKKGPVIR
FT                   SVKIKESNKTGIEVRKGLAERGEMVRVDVFIKDKKYYLVPIYVSDFKNKDLPNKAIAAL
FT                   KLENEWIMIDKTYSFKFSLFKDDLIKIKKKKEEIFGYFGGVHRSTGTIKIKSRHKPKEI
FT                   DEGIGSRCLLDFRKFQVDVLGNYTEVKHEKRMPAYITRKDKKH"
FT   CDS_pept        342223..343119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_222"
FT                   /old_locus_tag="TGRD_223"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_223"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13706"
FT                   /db_xref="GOA:B1GZM4"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019855"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM4"
FT                   /protein_id="BAG13706.1"
FT                   /translation="MSWRTVFFSKPCSLSVKNSQLYCRFQDSTVHDIPIEDISVIVLES
FT                   NRINLTSALISECSQSNIVIFSCDSSHIPCGIYVPFNQHSRFTQTANSQVKWDTAFKNR
FT                   IWQKIVKQKICNQAEIIKKYSFANYVGLKGTCDRVQSGDKTNCEAFAAKIYWESIFENF
FT                   QRNKNSDIRNSALNYGYAIVRGVVARSLASSGFITCFGVHHSNDLNAFNLADDIIEPFR
FT                   PFVDDIAIDIFKNSETSKELLKEHKQQLLSVLSTDCIFNDKNSNILTAASQTTESFMIA
FT                   SRELNPDKLLLPEFKTA"
FT   CDS_pept        343116..343445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_223"
FT                   /old_locus_tag="TGRD_224"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_224"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13707"
FT                   /db_xref="GOA:B1GZM5"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM5"
FT                   /protein_id="BAG13707.1"
FT                   /translation="MKKEGTRFMRILVFFDLPTETAENRHNAAKFRNNLIKDGYYMLQY
FT                   SVYCRICRGMDSSEKHIRRLMMRTPMEGNIRVLEITEKQYERMKIILGKKQLAEQIDSR
FT                   QLVFF"
FT   CDS_pept        complement(345048..346265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_224"
FT                   /old_locus_tag="TGRD_225"
FT                   /product="threonylcarbamoyladenosine tRNA
FT                   methylthiotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_225"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13708"
FT                   /db_xref="GOA:B1GZM6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZM6"
FT                   /protein_id="BAG13708.1"
FT                   /translation="MKKYYIHTFGCKVNQYESQLISEKFRKDNFECTQKPEEADIIIFN
FT                   SCTVTADADKKLEYFLRRATKLPNRPKIMLTGCIVKNKNIDIKNLFPDIEIITDKTKLF
FT                   IEPQKQKVSGFDRHSRAFLKIQDGCKSFCSYCIVPYVRSTLWSKPENEVLSEIKNLVKS
FT                   GYSEIVLTGIHTGKYDGGLSDLLEKIIKIPLAFRVRISSVELSEIDDKFIELIETNTEK
FT                   ICRHLHVPLQSGSDEILKQMNRNYSTKEFEKKVSKIMRILPDLALTTDIITGFPGETEK
FT                   HHKETCDFVKQILFARFHIFRYSYRQETKASTFGNKVPTSEIKNRAKDIFEIDSIKRKD
FT                   FLNKNIGTKRKAVKTGKNKLLTDNYITVKRQTEAWNVECGTMKASGNKKKQSGIFEVEI
FT                   TDTSEI"
FT   CDS_pept        complement(346262..346797)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_44"
FT                   /old_locus_tag="TGRD_226"
FT                   /note="pseudogene of ribosomal RNA small subunit
FT                   methyltransferase E"
FT                   /pseudogene="unitary"
FT   tRNA            347455..347537
FT                   /locus_tag="TGRD_tRNA15"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   tRNA            347553..347623
FT                   /locus_tag="TGRD_tRNA16"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGA"
FT   tRNA            347651..347722
FT                   /locus_tag="TGRD_tRNA17"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   CDS_pept        347787..348986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_225"
FT                   /old_locus_tag="TGRD_227"
FT                   /product="elongation factor Tu"
FT                   /note="EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_227"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13710"
FT                   /db_xref="GOA:B1GZ81"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZ81"
FT                   /protein_id="BAG13710.1"
FT                   /translation="MGKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKVLGDKGLAKYI
FT                   SYDEVARASESQGRRDASKIVTIAVSHVEYSTVNRHYAHIDCPGHADYVKNMITGAAQM
FT                   DGAILVVSALDGPMPQTREHILLARQVNVPAVVVFLNKCDAVEDKELLDLVEMEVRDLL
FT                   TKYNFPGESTPIIRGSALGALEGKQDGVDSIMSLMEAVDNTIPLPARDVDKPFLMSVED
FT                   VFSITGRGTVATGRVEKGRVRVGENVDIVGIQETRKSVVTGIEMFRKLLDEAQAGDNIG
FT                   MLLRGIEKNQVERGQVIAYPGSIKPHKKFRGQVYVLTKEEGGRHTPFFNGYRPQFYFRT
FT                   TDVTGIAHLPEGVEMVIPGDNVTMDIELIMPVAMETQLRFAIREGGKTVGSGVVTEIVE"
FT   CDS_pept        349489..349641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_226"
FT                   /old_locus_tag="TGRD_228"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_228"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13711"
FT                   /db_xref="GOA:B1GZM9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZM9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13711.1"
FT                   /translation="MAERVIITLACSVCKNRNYYFDRAKNHEGKLALKKFCKNCGKRTD
FT                   HKETK"
FT   tRNA            349656..349726
FT                   /locus_tag="TGRD_tRNA18"
FT                   /product="tRNA-Trp"
FT                   /note="codon recognized: UGG"
FT   CDS_pept        349756..349944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_227"
FT                   /old_locus_tag="TGRD_229"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_229"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13712"
FT                   /db_xref="GOA:B1GZN0"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN0"
FT                   /protein_id="BAG13712.1"
FT                   /translation="MNLIRTSIQFFKESYYELTKVTWLGKKEVVGTTIIVIIFVIIMSI
FT                   FVSVVDLFLGTVVGIIL"
FT   CDS_pept        349957..350487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_228"
FT                   /old_locus_tag="TGRD_230"
FT                   /product="transcription antitermination factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13713"
FT                   /db_xref="GOA:B1GZN1"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN1"
FT                   /protein_id="BAG13713.1"
FT                   /translation="MANQWYVVHVYSGHEYKVKKGLEMTVANLNMQDTISQILVPTEEV
FT                   IEVKQNKKKIKKRKFYPGYIFVEMTINNSTYWLIRNTAGVTGFLGGVKPIPISQFEVEN
FT                   ILNTVANPDTSKPRPAVSFEKEENIRIIEGPFKHFIGIVEEVNHERGKLRVMVTIFGRH
FT                   TPVELGFLQVEKM"
FT   CDS_pept        350559..350993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_229"
FT                   /old_locus_tag="TGRD_231"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_231"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13714"
FT                   /db_xref="GOA:B1GZN2"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN2"
FT                   /protein_id="BAG13714.1"
FT                   /translation="MPPKKIKAMIKLQIPAGGANPSPPVGPALGQQGVNIMDFCKQFNE
FT                   RTKSMEQGMTIPAVITVFEDRSFTFITKIPPVPVLIKKAAGVAKASGVPNRNKAGKITA
FT                   TQVEEIAKQKMPDLNANGDLNAAKLMIEGTARSMGIDIVK"
FT   CDS_pept        351096..351779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_230"
FT                   /old_locus_tag="TGRD_232"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_232"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13715"
FT                   /db_xref="GOA:B1GZN3"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN3"
FT                   /protein_id="BAG13715.1"
FT                   /translation="MGKRLSEASKLVDKNMVYKLTEAVILVKETAKAKFDETIEIHIKL
FT                   GIDPKRSDQMVRGTISIPHGIGRTRKIAVLAKGEKQKEAEAAGADIIGSDDLIEDISKG
FT                   KLGSGFDVLVATPDVMKDLSRVAKILGPKGLMPNPKSGTVTFEIGKTVEELKKGRVEYK
FT                   NDSFGIIHVPVGKASFEKEKLENNIKTLLEAVAKAKPLSSKGQYIKSISISSTMGPGIF
FT                   VEQKI"
FT   CDS_pept        351858..352313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_231"
FT                   /old_locus_tag="TGRD_233"
FT                   /product="ribosome maturation factor RimP"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_233"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13716"
FT                   /db_xref="GOA:B1GZN4"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZN4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13716.1"
FT                   /translation="MRKVQEIEDLLAPVAAREKIEIVDVQYSKKAGDWVARIFIDKDSG
FT                   VTISDCENISCIFGAFLDESDILKDSYVLEISSPGFKRVLKSEKSFRRFIGSKTRIRTF
FT                   KPINNQRNFLGTLLNFDDGRIKINDVTNGVVEIEFSDIRKANIEADI"
FT   CDS_pept        352324..353580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_232"
FT                   /old_locus_tag="TGRD_234"
FT                   /product="transcription antitermination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_234"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13717"
FT                   /db_xref="GOA:B1GZN5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN5"
FT                   /protein_id="BAG13717.1"
FT                   /translation="MAEKGELLIALEQIEKDKKIKKEDILVVIENALVSAYKKHVGKNV
FT                   NVEAKVNPELGEMTASVVKVVVKDVVNPLLEICVQDAKKFDQSVEIGTEVRIPLDTRDF
FT                   SRIAAQTAKQVIVQKIRESERDSLFDEMKEKIGQIANGAIYRITNRNLIVDLGKTEAIL
FT                   PSSEQVFKEKFSVGQYIKAVIIKVEKSVKGSGVVLSRTSIELVKRLFELEVPEIYEKIV
FT                   EIVNVVREPGVRTKITVLSHNPKVDPVGACVGVKGARVKPIIDELRGERIDLVSYSVDP
FT                   AKYIASAMSPAKIVSVTTISEEEKKAEVLVTDDMLFLAIGKNGHNVRLAAKLTGWHIDV
FT                   KSEGQKKQEGNERIEKQAEVFEKLEGFSERIIKMLVKAGITDVEKLSLLTTEYLITLPG
FT                   IGHKTAEKIIEVAKNSIRK"
FT   CDS_pept        353595..355874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_233"
FT                   /old_locus_tag="TGRD_235"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_235"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13718"
FT                   /db_xref="GOA:B1GZN6"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN6"
FT                   /protein_id="BAG13718.1"
FT                   /translation="MPSKQGDKVEVSEEKSAKKNTVSSGKTKKVLARKAVKKAAIGVAQ
FT                   KVVKTKVVSKKTELGAKTKFVRTKVGKANSVRKKIIKDVFSEKNDHEEKSEIEKKYDLE
FT                   TVVKEEKATPKKESAIIKGQETVILHSPMSSDATAGYQESKQKPIEPESSVPKTENPKT
FT                   AIKSTEAKPGTVKDNYKGIILINELITVRELADKMKLMFGDVLKKLLSMGSLATINQRL
FT                   DTDTAILLAKEFDYDARFTSIYSEEEINSKEDSSKLKQRPPVVTIMGHVDHGKTSLLDA
FT                   IRSSDVIAGEHGRITQHIGAYKVKVSSGDYIAFLDTPGHEVFTAMRSRGAQATDIVVLV
FT                   ISAADGVMPQTVEAINHAKAANVPIIVAVNKIDLPSSDTQKVRQELSNYGLVPEEWGGD
FT                   TIMIDISAKQKTNINSLLEMILLKAEMMELKANPDKKAEGVVIEAKLDSRRGPVATLLV
FT                   QGGTLRVVDNLVIGTTYGKVRAMIDDRGKRFNEAPPSTPVEILGMNEPPHVGDKFIVVD
FT                   NESQAREITRSRKGKIKEASLKPRHHLSLADINMRQVKDLRIVLKADVQGSLGALSDAL
FT                   ERLSTSEISLKIIHMGAGAITESDIALAVASNALVVGFNLRPDTVVEKLAEAEGVSINV
FT                   YRIIYDLIADVKAAMEGLLDPDVKEKVLGRAVVKQVFRLSSYGIISGCSVTDGQIQRGI
FT                   KIRLLRNNIIVFEGNISSLKRFKDDVKEVEKGYECGIGLENFSDVKPGDIIENFSIEKI
FT                   VRKLDN"
FT   CDS_pept        355932..356297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_234"
FT                   /old_locus_tag="TGRD_236"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_236"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13719"
FT                   /db_xref="GOA:B1GZN7"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN7"
FT                   /protein_id="BAG13719.1"
FT                   /translation="MPLSYKRSVRVSELIQQTISSIVREMKDLDAGLVTVMGANLTDDL
FT                   LSCKIYYSVLGSEEYKKKVAGILKRSTKQVRHKLALRLNLRCTPTISFVYDDSNERATK
FT                   VFDMLQRIEEEKDKCIF"
FT   CDS_pept        356425..357441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_235"
FT                   /old_locus_tag="TGRD_237"
FT                   /product="bifunctional oligoribonuclease/pAp phosphatase
FT                   NrnA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_237"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13720"
FT                   /db_xref="GOA:B1GZN8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZN8"
FT                   /protein_id="BAG13720.1"
FT                   /translation="MNLAKNDLKKISEISRIIKQSKIFFIAGHIKPDGDSIGSALALAS
FT                   VLNRLGKEACVYCIDEVPDFLKFLKGSDEIKKSAKKTDVFDCAIILEAINFSRMGDIIT
FT                   PCQSKKVINIDHHLTYTNFGTINYIVPSSSSTAELVLNILDYMKIKLTRGEAENLYAGI
FT                   LTDTGCFQQINTTPNSHIACAKLMKYGIDINEIYKKVYENGSINALKLRGIALCGIKTI
FT                   LDDSVSYIVLTKDMFKKSGAKDNDDSGIINYTLRIEGVKVGCLFKEIDEKTIKVSCRSV
FT                   RSFNVLEVVGRFGGGGHKNAAGCTIKKGINASIKMISSVLKEKLAADKLLFCSAVFL"
FT   CDS_pept        357533..358225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_236"
FT                   /old_locus_tag="TGRD_238"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_238"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13721"
FT                   /db_xref="GOA:B1GZN9"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZN9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13721.1"
FT                   /translation="MSQSYNNIDGLLLLDKPFGITSFDAVYKIKKVLNVEKTGHCGTLD
FT                   PASTGLLLVLMGKATKLQAKFMKKDKVYLSSFLLGMVTDSGDLDGKVISENSVLNINIE
FT                   KIKKMVEMFEGEIFQIPPMYSALKYNGKKLCELARQGIEVERKPRKVTIKKFEVLSYDG
FT                   DIVKVRIECSSGTYIRTLAQDLGNVLKCGATVKTLRREKIDIFDIKDALRFKDTDSADK
FT                   IIKKLIPL"
FT   CDS_pept        358272..359189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_237"
FT                   /old_locus_tag="TGRD_239"
FT                   /product="bifunctional riboflavin kinase / FMN
FT                   adenylyltransferase RibF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_239"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13722"
FT                   /db_xref="GOA:B1GZP0"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP0"
FT                   /protein_id="BAG13722.1"
FT                   /translation="MLKGKDFGIKFNRCEMTKKSVVAIGTFDGMHKGHRLLIDKILSSA
FT                   RKNNLRSVIIVLEKPVKKVRGLLTTYEEKIEKIKFSGADEIFVIGVPSEILSCCPEEFF
FT                   DEFLHKMLNVSEIMCGIDFAFGKDGKGNIEWLKKKAKEKNIKINIVKPLKNISSSYIRI
FT                   LIEKDDVKNAASLLGRNYSFTGIPFKEKGEGKKLGFPTVNLHVNSDKLLPKGVYISLIS
FT                   QGERIYPSLTNIGIRSTFDRGNKIVPETYILDFKGEWKKLQTKVMFLKKIRNEKKFASV
FT                   DALKIQISKDLLAALRFFNYHKTK"
FT   CDS_pept        359485..359832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_238"
FT                   /old_locus_tag="TGRD_240"
FT                   /product="histidine triad (HIT) family nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13723"
FT                   /db_xref="GOA:B1GZP1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP1"
FT                   /protein_id="BAG13723.1"
FT                   /translation="MSENCLFCKITKGEIPSYKVYEDEKVFAFRDINPQAPVHILIIPK
FT                   KHIGGLNTASEEDERILGNIQIIVSKIAKQFSEMGNGFRLVNNCGADGGQTVFHIHYHL
FT                   LGGRVFGWPPG"
FT   CDS_pept        359874..360080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_239"
FT                   /old_locus_tag="TGRD_241"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_241"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13724"
FT                   /db_xref="GOA:B1GZP2"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZP2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13724.1"
FT                   /translation="MVSVKVREGESIEEAIRRFKRECERNGVMQEIKKREFYKTPSILK
FT                   KEKLAETKRKIRRKMFKDSKWSK"
FT   CDS_pept        360154..361113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_240"
FT                   /old_locus_tag="TGRD_242"
FT                   /product="conserved NIF3-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_242"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13725"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP3"
FT                   /protein_id="BAG13725.1"
FT                   /translation="MKLKDIHDLFIKEGIKADPRGLNIVELDLLKRKEEYDDLSDKKKE
FT                   NYDIESLTNPYYDSRILYGDENTEVKTVMVGIDIESQEILLAKQLINSGTKIDLIIAHH
FT                   PEGYAYSTFYGVLEMQTDILNKQGVPINITEKIVSQRIKEVQRSVLPQNSERVYDAAKL
FT                   LNIPLMTAHSVADNHVATFLQNEINVLSPTYLKTIIELLNKYPEYKHASKIGHKPFILN
FT                   GSDYSHCGKVFVDMTGGTEGPLESFEKLEAAGVGTIISMHLSRKAVKEAEKHHLNIILA
FT                   GHISSDNLGLNLLFDKLKKKALEKFEFIECSGFRRFGR"
FT   CDS_pept        361116..362882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_241"
FT                   /old_locus_tag="TGRD_243"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_243"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13726"
FT                   /db_xref="GOA:B1GZP4"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP4"
FT                   /protein_id="BAG13726.1"
FT                   /translation="MVISEDTIEKIRLSNSIDSVIREYLPDLKRAGRNWKVCCPFHNEK
FT                   TPSFIVSPEKGIFKCFSCNVAGDVFKFVMFLDNISWIEAVKKLAKKTNIEIQEAKQGII
FT                   KLSENTKLFDILESSANFYNKCLLERASAQKAREYIKKRGINREAVNKFKIGFAPKGQF
FT                   LQWALEKDYKDDDLLKAGLITRTGRGIFFECMSERVVFPIFDVQGRIVAFGGRTIADHK
FT                   IKYLNTPETAVYSKSSNLYGLFQTLPELRKERKIIVLEGYIDAVILQQFGITGAVATLG
FT                   TAFTQNHAKLVSRYSDSVTLLFDSDNAGRTAAQRSLEILVGDSIECRVSALPEHVDADE
FT                   YLNQYGKESFLKFLEDSSKSAIDFMIERVLGGLSSDGRKSSPEIKAKAVSALLDFVARS
FT                   TNSIIQREWIRDIAQHVDVNEEAVWREFEKKQQLRLRGYLQYDKNSVEQTVKVKKDKKF
FT                   SMSLEENLLNLILNNRDYIKKTDSNCFEDARCRKIFELTVSGLNTVGILNTLSEEDKNW
FT                   FAELILNTIEYSDIGEAFGIILRDIDAGRLERERRRLEKEILLVSEGKKEKDKKVFDEY
FT                   KKLTALLKGSGK"
FT   CDS_pept        362884..364605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_242"
FT                   /old_locus_tag="TGRD_244"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="Sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_244"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13727"
FT                   /db_xref="GOA:B1GZP5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP5"
FT                   /protein_id="BAG13727.1"
FT                   /translation="MGKKDLFKGLIDTGKEQGYLTYEAISKNLPQRSMIAEEIDGFFVT
FT                   LDNLGIKVLDNREYRSDKVKKSRGEVVERSMKTVNEEDINPVRMYLSEMAKVPLLERNM
FT                   ELKLVKSIRENEDRLKSIVLESPLIIKEIRNWETLISQQEMTTKELMPRGRKSKAQLIG
FT                   MGLKIKIVVKKINRIEKNINTYEKKLKLKSISCKDKEQYKEKVKEFRSEIVSLIVELNL
FT                   NQDKIRRLINKIKTIAQKLNEIKEGLRRFERKYKNSFSKVQVLFKSCNLGKISSAEFKK
FT                   STGLSMKDVAEDIANVKTLLVKQTNLKDGFVITPEEMIETDRRIRELEYVIHRDKMKLI
FT                   EANFRLVVSIAKKHVGISNLELSDLIQEGNLGLSKAVEKFEWKRGFKFSTYATWWIRQS
FT                   INRAIADQARTIRIPVHMKELISKLTKSKKECQQNMGREPTIQEYSKILKLSCDRIRRI
FT                   LKMMQEPVSLAMPVGEEEDSRLEDFIEDQNSPNPVVKTQQYRLQLELEKVLATLAPREA
FT                   EIIRLRYGIGIGYPSTLEEVGKKFGITRERVRQIEAKAIRKLKYPRRNKSLREYLD"
FT   CDS_pept        complement(364687..365436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_243"
FT                   /old_locus_tag="TGRD_245"
FT                   /product="2-oxoglutarate synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_245"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13728"
FT                   /db_xref="GOA:B1GZP6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP6"
FT                   /protein_id="BAG13728.1"
FT                   /translation="MKKILSKPESLKDAVLSYCSGCGHGIIHRLVAECIDELVVREKTI
FT                   AVAPVGCAVFAYDYFNFDVTEAPHGRPPAVATGIKRTNPDKFVFTYQGDGDIAAIGMAE
FT                   TIHAANRGENITILFVNNANYGMTGGQMAPTTLIGQVTETTPFGRNPEREGYPIKLCEL
FT                   LSTLEGTTYLERVAIYNPRNIIKAKKAIKKAFQCQIDGKGFSLVEVISNCPVDWGMTPL
FT                   DSIKWVEETFIKSFPLRTVKDKINSDI"
FT   CDS_pept        complement(365582..366643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_244"
FT                   /old_locus_tag="TGRD_246"
FT                   /product="2-oxoglutarate synthase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_246"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13729"
FT                   /db_xref="GOA:B1GZP7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP7"
FT                   /protein_id="BAG13729.1"
FT                   /translation="MTKKLVKGNIALCEGAITAGLKSYFGYPITPQNEIPSYFSRKMVE
FT                   LGRVFIQAESEIAAANMVLGAAATGTRAMTSSSSPGISLKQETISYMAGMQVPALIVNV
FT                   QRGGPGLGNISSSQSDYFQAVKGGGHGDYKIIVIAPNSAQEMYETAYDAFDLAEKYRTP
FT                   VMILADGIIGQMMEPIEFNRPEKKEFKEKEWILNGCKGREPRSIKSLLMKDGVLEKHNV
FT                   KLQEKYKLISENEVKYELYMIEDAEIIITAYGISSRIVKSAVKLARKNGIKAGLLRPKT
FT                   LWPFPSKIISSFAKPNIKFLSVELSYGQMVEDVKLAVNGKSNVEFLGKAGGGLVTEQEI
FT                   IKKIQSKVCSIFL"
FT   CDS_pept        complement(366640..366852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_245"
FT                   /old_locus_tag="TGRD_247"
FT                   /product="2-oxoglutarate synthase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_247"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13730"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP8"
FT                   /protein_id="BAG13730.1"
FT                   /translation="MISTIKINSEKCKGCSLCIKACPKQCISLSKQFNKAGYHWAVLEK
FT                   ENSCIGCGFCYMVCPDVCIEVYKDL"
FT   CDS_pept        367018..367656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_246"
FT                   /product="Mug-like G:T/U mismatch-specific DNA glycosylase"
FT                   /protein_id="BCI50713.1"
FT                   /translation="MLAIHPFKPFVPQGATTLIIGTFPPLAQYQDFKFYYPNNTGSRFW
FT                   IIMEYVFNHKFQYWKDDPAAEERKALFEREHIAITDMIEKCIRTNGNSSDKNLSEIEFR
FT                   NVYKLLKDRPAIQKVILTSRTDGDSERIHKKHLGKSRNNSALELLNEHLMGNEITIRNL
FT                   HKEDNGLIKGEFELNNKIIRIFVPYTPSARWYNSHKGKVNDMYKDSFDA"
FT   tRNA            367929..368004
FT                   /locus_tag="TGRD_tRNA19"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAG"
FT   CDS_pept        368507..369003
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_45"
FT                   /note="pseudogene of phosphoglycolate phosphatase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(369213..369704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_247"
FT                   /old_locus_tag="TGRD_248"
FT                   /product="deoxycytidylate deaminase"
FT                   /note="dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_248"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13731"
FT                   /db_xref="GOA:B1GZP9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZP9"
FT                   /protein_id="BAG13731.1"
FT                   /translation="MEKTTVRSRPSWDEYFMKLAWLVSERSTCVRHHVGAVIVRDKRIL
FT                   TTGYNGAATDMQDCISLGCLRNTLNILSGQRHEICRAIHAEQNAIIQGGYHGINIKDST
FT                   LYCTHSPCVLCAKITVNAGIKRVIANIEYPDNTFKELFSVTGIEFSTLQLDNFSINRLL"
FT   CDS_pept        369813..370658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_248"
FT                   /old_locus_tag="TGRD_249"
FT                   /product="glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_249"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13732"
FT                   /db_xref="GOA:B1GZQ0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ0"
FT                   /protein_id="BAG13732.1"
FT                   /translation="MNFQGIIMALQKFWAKKGCLICQSYDLEKGAGTFNPATFLRSLGP
FT                   RPWNAAYVEPSRRPADGRYGENPNRLQHYYQFQVIMKPAPQNIQRIYLESLKTVGLDPK
FT                   KHDIRFIEDDWESPTLGAWGLGWEVWIDGMEATQFTYFQQVGGINLNPVSVEITYGTER
FT                   LAMYVQKKNSVYDLQWNDEVTYGDVHLEDERQWSFYNFEKVDVDMLKKHFDEWEREAER
FT                   LAGTHLPVPAYDAVMKCSHLFNLLDARGAISVSERMDYVLRVRTIAGIVAEEYLNSNSV"
FT   CDS_pept        370729..372843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_249"
FT                   /old_locus_tag="TGRD_250"
FT                   /product="glycyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13733"
FT                   /db_xref="GOA:B1GZQ1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ1"
FT                   /protein_id="BAG13733.1"
FT                   /translation="MVDGNIKNALLEIGAEEIPSSYIEPALKQIEDYALKAFNTSGLKH
FT                   GVLKTYATPRRLVLIVENLEEKSDDKTEEVLGPSLNAAKDAHGKYTRAAVGFALKNGVI
FT                   PEKLAVKTTEKGDYLFFVKKIKGEKTEKLLVAIFPEIIKNISFPKIMIWEESGFKFARP
FT                   VRNIVALYGKKVIKFKIADVNSSNWTVGLHTYDNSRIKIDLPEKYLLAMKNKSVIVDQN
FT                   ERREEIKRSIKYAAENIGSVIPDEELVDKVNYLVEYPSAVLCAFNRKYLDLPQEILTVC
FT                   MRKSQKSFAINDENGKFSNYFISVKNGVSKYQETAKEGYEKVVAARLADAEFFYSNDLK
FT                   KGLGINIEKLKGIVFHKEIGTVYEKIERIKQIATLFNEEFDMRIDGSALERAVMLSKVD
FT                   LTSEMVFEYPELQGVMGRIYALKSGENADVASSVEQHYWPLVTSGKLPLHPMASLLSLA
FT                   DKIDTLTAFFSIGLEPSGSADPYGVKRAGTGFVKVAMNELPKCDLTGVVGRVFEFLPEN
FT                   VKNNPKSKDACERLIKFFWQRIENIFESEGYNSDEVKAVINAVGINKLKYIGSLRTKLE
FT                   ALRNADREGDFSFVVAIFKRINNIISQAKKQNIGISGVVNEDLLAENAEKALYTAAKKA
FT                   KAEIENCVSANEYGRVFGKVSEIKPAIDSFFEKVMVMAEDETIKLNRVSLLSYIKNMFA
FT                   GFVDFSVLRR"
FT   CDS_pept        372918..374714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_250"
FT                   /old_locus_tag="TGRD_251"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_251"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13734"
FT                   /db_xref="GOA:B1GZQ2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ2"
FT                   /protein_id="BAG13734.1"
FT                   /translation="MLTQRKKKDFEYKKYCIIEQMEKQKSLDILRHSTAHIMAAAVMEL
FT                   FPGTKVAIGPSIEDGFYYDFDREQAFTPGDLIRIEEKMAEIIKADYPFICSYVPKGEAV
FT                   KEFREKGEKYKAEIASQIEDDKVSMYRSGNFTDLCRGPHINSTGELKYFKLLSIAGAYW
FT                   RGDSSREQLQRIYGTAFLTKKDIDDYLTGIEEAHKRDHRKLGEDLDLFSIDETVGGGLV
FT                   LWHPKGALLKDIIENYWKKFHLENGYDLLSTPHIASEELFKVSGHLQTYSENMYASMEI
FT                   EGKPYRIKPMNCPMHLMIYKTKLHSYRELPVRYAELGTVYRFEKSGVLHGLLRVRGFTQ
FT                   DDGHIIVAPEQLEEEMLGVFNMAVNCLKTFGFNEYKIYFATRPEKKYVGEIEYWEKAQN
FT                   SIENALKKTGCVYEIDEGGGAFYGPKIDIKIKDVIGRLWQCSTLQFDFNLPERFDIFYV
FT                   NSSGKKARPYMIHRALLGSLERFIGVLLEHYAGALPLWLSPIQVAVANINEEQRGFCEG
FT                   LSQELKKNNIRVIFDGRNEKIGRKIRENAMQKIPYIAVIGNKEKDACAVAVRARGNRDL
FT                   GVMSVDNFISFVKEESVCTSGL"
FT   CDS_pept        374739..376008
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_46"
FT                   /note="pseudogene of [FeFe] hydrogenase H-cluster
FT                   maturation radical SAM protein HydG"
FT                   /pseudogene="unitary"
FT   tRNA            377566..377638
FT                   /locus_tag="TGRD_tRNA20"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAG"
FT   tRNA            377646..377727
FT                   /locus_tag="TGRD_tRNA21"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CUA"
FT   CDS_pept        378059..379399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_251"
FT                   /old_locus_tag="TGRD_252"
FT                   /product="trigger factor"
FT                   /note="TF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_252"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13735"
FT                   /db_xref="GOA:B1GZQ3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ3"
FT                   /protein_id="BAG13735.1"
FT                   /translation="MSLENKTIDFKSAVVGEKLCSVTMDVEVSENIAADEIESAFSRIR
FT                   RQAKIDGFRHGKVPMNIIRQKFAGEAKDRAVESIIKKTVLDALKKEEFVSIGFPVIEEF
FT                   DYEVGQTLKYRFTAERHPKIEVKDYKGIPLKKEIFKITDKSLEQNLEVLRKRNAKLVPS
FT                   KSDKVTEKSFVSIDYDAFDAYGKELPEIRAKNYVIDLNSENTVKEFKKALSGLKIGAER
FT                   DIKIEYPSDYSSEILAGKTVTFKIKVIEIKEKEIPDLNDDFAKDMGIENLGNLKTKVKE
FT                   IVETEEKRRQDMDIKRQIIEYLLEKNKFEVPQSLVTENKKSLVEKMKNYMKRQGASEEY
FT                   VKKQVELEQKKLKEEAENKIRLSYILNAIFKDENLAMTDADIEEEKSKMKTSNPGMENA
FT                   VDKYFAEKKENIMLSLKGQKLFGFLLASANVETEEKDMLLKKDENEK"
FT   CDS_pept        379485..380096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_252"
FT                   /old_locus_tag="TGRD_253"
FT                   /product="ATP-dependent Clp protease, protease subunit P"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_253"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13736"
FT                   /db_xref="GOA:B1GZQ4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ4"
FT                   /protein_id="BAG13736.1"
FT                   /translation="MPLLIPTVIERWNQGAAVTYDLYSRLLKDRIIFVGGQDGAVTTDS
FT                   ANVLIAQLLYLDSEDQGKDISLYINSPGGMVSAGLAVYDTMQFIKSPITTICMGMAMSF
FT                   GAVLLAAGTKGKRYALTHSRIMIHQPLIYGGGLSGTVSDIDIEAKELVSTKQKLSGIIA
FT                   EHTGKTSERVLKDTDRNCYMSAQEAKEYGLIDEVIVNLKQ"
FT   CDS_pept        380154..381392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_253"
FT                   /old_locus_tag="TGRD_254"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   X"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_254"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13737"
FT                   /db_xref="GOA:B1GZQ5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ5"
FT                   /protein_id="BAG13737.1"
FT                   /translation="MGIDFSEKCCIFCNKGYPYKLVGTSGVYICEECAKHSLELFENLN
FT                   KKESKETMLRLPKPGELKRFLDAYVIGQEHAKKILSVAVYNHYKRLEAIVSKDDVELQK
FT                   SNVLLIGPTGAGKTLLAQTLAKILDVPFAISDATVLTEAGYVGEDVENILLRLIQNASF
FT                   DIRKAEKGIIYIDEIDKISRKSDTPSITRDVSGEGVQQALLKILEGTIANISPQGGRKH
FT                   PQQEYLKIDTTNILFICGGAFDGLEKIIEKRLSKKTLGFITDGSNNRNDFKNMDYTLSR
FT                   VESEDLIKFGLIPEFIGRVPVISALNHLSTSDLVHILTEPKNALIKQYQKMFQFENVEL
FT                   KFEREALEKIAEEALKRGSGARGLRSIIENILLDAMFDIPDNTSVVKSIVMAETVTRRE
FT                   KPKFVYKGTKETA"
FT   CDS_pept        381389..383797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_254"
FT                   /old_locus_tag="TGRD_255"
FT                   /product="ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_255"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13738"
FT                   /db_xref="GOA:B1GZQ6"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZQ6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13738.1"
FT                   /translation="MSELDRFSNDKNEMPKIPDVLPLLPVRDIILYPAMVLPLAVGREK
FT                   SIKALEESMSTNRLVFIVTQKNIQIEDPTPKDVYNIGTICEVLQMLKMPDGTLKALVEG
FT                   ISRAQWTDFKLSDKGYIEVGLKVFDENTLKMPEVEAIMRQTIALFEQYVKLNPRIPIDI
FT                   SVSVSNIADPARLADTIASHLVIKNNDKQTILELVDPVKRLEKIIQILNAEIEILNIER
FT                   RIQNRVRNQIEKTQKEYYLTEQMKAIQKELKQKDEAQKDLDDLKGKLKKTKMPQAAKSA
FT                   ADKEMSRLEKMMPMSPEATVIRTYLEWILDLPWEKSTIDNLDLNRAKEVLDQDHYGLEK
FT                   VKDRVLEYLAVLSRVQKIKGPILCFIGPPGVGKTSIAKSVARSLGRNFVRISMGGVKDE
FT                   AEIRGHRRTYIGSMPGKIIQSIKKAGSNNPVFILDEIDKIGSDWRGDPSSALLEVLDPE
FT                   QNYTFNDHYLDVDFDLSNVMFITTANTLNNIPVTLFDRLELIRFSSYTDVEKRHIAEDF
FT                   IVPKQLKEHGLKPEEFIFDDGALDIVIKNYTHEAGVRNLTREIANLCRKVVKGLEFNKE
FT                   LKSITIKPENLNKYLGIAYYERERIAENDVGVATGLAWTEVGGETLTIEVNKMGGKNSL
FT                   VLTGKLGDVMKESAQAALTYVRSSSQKLKIDENMFSNTDFHVHVPEGAVPKDGPSAGIA
FT                   LATALASVCMNKPIKKKIAMTGEVTLRGRVLSIGGLKEKVLAAYREGITMILFPESNKK
FT                   DLVDIPEDVIKKLQMIPVSHMDEVISLTIERLPENKNIKMDKRNGENGI"
FT   CDS_pept        383794..384927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_255"
FT                   /old_locus_tag="TGRD_256"
FT                   /product="pyridoxal phosphate-dependent putative
FT                   serine---pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_256"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13739"
FT                   /db_xref="GOA:B1GZQ7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ7"
FT                   /protein_id="BAG13739.2"
FT                   /translation="MMNRYLLTPGPVPIPPEIALKEALPIFHHRTDEFAAVYKNIAEGL
FT                   KYIFQTENEVYVLAASGTGAMEMAVANLLSPGDKIIVASCGDFGDRWAEIAQGYGIRVI
FT                   AASVRWGKTVKPAEIERVLKENSDAKAVYTTFTETSTGVANDIKSVGGIVSKTDAVLVV
FT                   DAISGLAGQEFRTDEWKVDVAISASQKGFMLAPGLAFITLSGKAWKLVETSKIPKFYFD
FT                   IKKYKKFYSAGETPFTPPLTLIAALQESVRLIKERGLENIWNDCKLLARAARAAMKALG
FT                   LELFGEVPCEIVTSASVPVDIGIKIVKTLREKYGVSIASGQGDLKGRIIRFAHLGCIGK
FT                   ADLLAGFTCLEMVLIELGVKIEKGKAAAAVEEILLKT"
FT   CDS_pept        385590..386954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_256"
FT                   /old_locus_tag="TGRD_257"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_257"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13740"
FT                   /db_xref="GOA:B1GZQ8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ8"
FT                   /protein_id="BAG13740.1"
FT                   /translation="MCGIIGVENNENAAVLASAGLLTLQHRGEESAGITISGSEKMRTF
FT                   KAMGLVSRIFNEEILLNKLPGTVAIGHVRYTTSSKSSLINAQPFQISCIHGNISVAHNG
FT                   NITNFSKIKELLLKKGAIFNHTSDTEILLHLIAMSKGSFADIIANSLRKLEGAFSLVIL
FT                   KDRTLIGARDSNGFRPLVLGKIDNSYIISSESAAVEVIGGKYIRDIKPGEIIVIEDGQI
FT                   KKSLIYKKGRRQTSCIFEQVYFSRPDSVMFEQTIKEARVKMGEYLAQQMKNIKADIVMP
FT                   VPDTGYFAALGFSRTSGILFENGFIRNHYVGRSFIKPSQNLRNLTSTLKLRPIGEVVNG
FT                   KEIILIDDSIVRGTTSKRLMNILKKTGAKKIHFALSCPPIIDSCYYGIDTPSREYLIAA
FT                   NNSVEEIKEYLNVDSLNFLSLDNLIKACSADNKKSDVFCAACFTGKYPTKISKST"
FT   CDS_pept        386969..388549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_257"
FT                   /old_locus_tag="TGRD_258"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_258"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13741"
FT                   /db_xref="GOA:B1GZQ9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZQ9"
FT                   /protein_id="BAG13741.1"
FT                   /translation="MAKYIFITGGVVSSLGKGISGASIGRLLQLHGFKVNMIKFDPYIN
FT                   VDPGTMNPYQHGEVFVTIDGTESDLDLGTYERFLDVYTSKANTNTAGDIYQTVINRERR
FT                   GDYDGATVQVIPHVTDEIKKRFAALKDSCDISIIEIGGTVGDIEGLPFMEAARQFQLEN
FT                   KKEDVFSIHVTLVPYIAGAHELKTKPTQHSVNKLREIGISPDMIICRTEHSLDEPLKKK
FT                   ISLFCNVREDCVIEALDSPSIYYIPEAFYKQNTDSLIVGKLNIISKKKFDKTWFTKIKS
FT                   TGEFNERVKIAVVGKYADLKDAYKSIDESLNIASSELNTKAEVCYLGAEDKNLVRKLEN
FT                   YGAVLVPGGFGSRGIDGKIRAITYARENKTPFLGICLGMQCSVIEISRNLAKLENANST
FT                   EFDENTKYPVIKILDEQRNIKYRGNTMRLGNYKSEIKKSTLAYNLYKTTKIEERHRHRY
FT                   EMNPEFIETLEKVGLLVSAYHKKKLPEIVEMKNHPFFIGVQFHPEFGSRPMKAHPLFKG
FT                   LISAALKNK"
FT   CDS_pept        complement(388664..389441)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_47"
FT                   /note="pseudogene of carbohydrate-selective porin OprB"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(389596..390954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_258"
FT                   /old_locus_tag="TGRD_259"
FT                   /product="glucose 6-phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_259"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13742"
FT                   /db_xref="GOA:B1GZR0"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR0"
FT                   /protein_id="BAG13742.1"
FT                   /translation="MKLALSTLAVALAGMKPLPDAKNPLTDEKQIAKQYKRWRIRMFSG
FT                   MYVGYVMYYFTRKNLTYAAPSVMKKFDITMGELGTISSVSYITYAIGKFLSGIVADKCN
FT                   IRTFMALGLIGSSLVNLFFGFLPSLPLLTLFWGINGGLQSMGFPPVAKGLVYWFSPKER
FT                   ATKWTLWSSSHTVGTAIGGIVTGLCIAIGDWHAVFYIPGIIGIITGIGLLFTLTDKPAC
FT                   IGLPPIEVYKKDIIPIKKQNNLFHWQILTKYVFGNPFLWSLAMSYIFIYYIRFATLDWT
FT                   TKFMADRGIGNARAAFLLSSMPLVGTLGGISSGWIADRFFKGRCTPVNLIYLFCLIFSL
FT                   VGMYYFINATTPIWIMITFLSLVGFFIDGPQNLVGGVQTSRLTVQESVSAACGFTGMFG
FT                   YVGAALSGFGVALLVGKYGWHGFFVSCIISCIIAMFFIALTWKKEATDIKLSQ"
FT   CDS_pept        391772..392758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_259"
FT                   /old_locus_tag="TGRD_260"
FT                   /product="MoxR-like AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13743"
FT                   /db_xref="GOA:B1GZR1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR1"
FT                   /protein_id="BAG13743.1"
FT                   /translation="MAVYIDELNKKIMQDSIFVSKLLNEVSKVLVGQKYVLERMLIGLL
FT                   SDGHILLEGFPGLAKTLAVKSLAAVIQAAYKRIQFTPDLLPADVVGTLIYNPQSSDFVV
FT                   KKGPVFANIVLADEINRAPAKVQSALLEAMQERHVTIGDTTYGLPDPFLVMATQNPIEQ
FT                   EGTYPLPEAQVDRFMLKLKVSYPNKSDEKIILERMTRFLPKINPIISLKDVQKAKDSIE
FT                   QIYVDDKVKNYIVDIVFASRNPGEYGLKDLRSLIAYGASPRATISLTLASKAYAFLQGR
FT                   GYVIPEDIKIIGHDVLRHRILITYEAEVDSIDSDDIIEKIFGGVDVP"
FT   CDS_pept        393127..394080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_260"
FT                   /old_locus_tag="TGRD_261"
FT                   /product="DUF58-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_261"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13744"
FT                   /db_xref="GOA:B1GZR2"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR2"
FT                   /protein_id="BAG13744.1"
FT                   /translation="MMDKDILKKQIRQLAIRSHKLVNEIFAGQYQSVFKGQGIEFAEVR
FT                   EYQIGDDFRSIDHNVTARFGKPYIKLFSEERELTVIFLIDVSSSQRFGSTDRLKSEITA
FT                   EVAAILAFASLKNNDSVGMLSFTDKVEKVIAPRKGRNNILKMIYEILDSNFSGTETSIS
FT                   VALKAINGIWRRKAIVFLISDFQDENYEKDLAMVAKRHDLICIKIEDNRESDLPAVGLV
FT                   EMEDLETKETMTIDTSAVYESFKQKNEDFKKETVRIFKKAAVSVINLNTGGSYINPLIR
FT                   FFKERERRIRRECSHFRIPLIFMAIFSFFDMVSKNA"
FT   CDS_pept        394073..394957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_261"
FT                   /old_locus_tag="TGRD_262"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_262"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13745"
FT                   /db_xref="GOA:B1GZR3"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR3"
FT                   /protein_id="BAG13745.1"
FT                   /translation="MRKHFKYIIIAILFVFCICASLYSREKVSASLNKNRVFVGDIIKF
FT                   IVKVRLPHGAQISADQDFSFDDFDIISSDIRRISDAENIYELNFNIAAYKTGIFTVNQL
FT                   TVFYISSDGTNNLFFTPEVRVEVLSIIGSGTAEDIKDIKALKKLRVGPVYVLLIVIMSF
FT                   LFIVCVVSVVKAVAERIKKSKQFEADPKIKALNALNDLYKGIDGVSVRIFYYKMSEILR
FT                   TYASKQYNFNAMEMTTSEFFDKIKPFIPREININEFKNYLKIFNLARYADFTPDKIETE
FT                   DNYIFTKKLLELL"
FT   CDS_pept        394954..395955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_262"
FT                   /old_locus_tag="TGRD_263"
FT                   /product="aerotolerance-related cytoplasmic membrane
FT                   protein BatA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_263"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13746"
FT                   /db_xref="GOA:B1GZR4"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR4"
FT                   /protein_id="BAG13746.1"
FT                   /translation="MRFANPLYLLIFLPLLALAYVYISIIKKNSFKPCISFSRVNLLKS
FT                   NNPEFKKILLNILKVLKCVSLILIIIALAKPQKGKTFEHLSDQGIDIIVALDTSTSMRS
FT                   LDFRSLNRMEAAKKVIRDFMKERKYDRIGLVIFSGLAFTQCPLTTDKDSLAEFINNINI
FT                   GDTGLDGTAIGSAIMTSVNRLKDSRAKSRIIILVTDGNNNMGEIDPLTASKIARSYDIK
FT                   IYAVGVGSLDGAIYEVDDPFLGKREIKYRKDAINESVLKEVAYNTSGGYFRAQDVKSFE
FT                   NIMKQIDKLEKDDIEVMRFTNYRELYKYFLIPSFILLLLIIVLENTYLRKLP"
FT   CDS_pept        396106..397098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_263"
FT                   /old_locus_tag="TGRD_264"
FT                   /product="aerotolerance-related cytoplasmic membrane
FT                   protein BatB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_264"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13747"
FT                   /db_xref="GOA:B1GZR5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR5"
FT                   /protein_id="BAG13747.1"
FT                   /translation="MFADKIYLLLLLLIPVLAVFFYIALKKRKAALDRLISRVNISTLV
FT                   SVNLRAYKIKYILLLAGLFFVIIAMACPQYGDGMRTVIKESSEIIIALDISKSMLAEDS
FT                   KPSRLEKAKMIVSKIVEENPGEKMGIVVFSGTAMWQCPLTFDLHALKMFLQSVETTNLP
FT                   LGGTRISSAIMLASKAASCESAGSRVMILISDGENHDSKIKEAVNAAKKAGLRIISIGI
FT                   GKKEGAPIPVKDETGTVIDYVKDVNGKVVISRANPVLLKNVAEEMGGKYFDALDDDVYP
FT                   SLVKAVRNLDKNNSEVGMKSSKTDRFQIFLLLGLIALFAELLFPLRRKR"
FT   CDS_pept        397095..398093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_264"
FT                   /old_locus_tag="TGRD_265"
FT                   /product="aerotolerance-related cytoplasmic membrane
FT                   protein BatC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_265"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13748"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR6"
FT                   /protein_id="BAG13748.1"
FT                   /translation="MKLKMFMLALSASLLIFLLIFSYKDIRGNNRAVRYFNDGNFEAAS
FT                   ESFNKELEKLPGSYSIFNNAAGAEYKLNKFDEAQTKYNAVLDFSDADQEEKFIALYGLG
FT                   NTEYGKNDFRKAASLYKKALRLKPGDKDAKYNLEVALLKLNEKDSCQNNNDNSSKQNSR
FT                   QKGRNNKQNEQNIGNRQQSKEERDLKRHMEQNDKAQKENEKKRQSLGRQVSVVRDEIQK
FT                   RQNVQKGLEEEKLRLDKQKLGISNKIEALKKTGVTKNKFSKRKNESQGDNPLGDKSEKE
FT                   KLEMQPVGEKEDKKDMPAAIFLNYYDEAERKAYKLRNKNKKSALNQPQEDW"
FT   CDS_pept        398095..399870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_265"
FT                   /old_locus_tag="TGRD_266"
FT                   /product="aerotolerance-related cytoplasmic membrane
FT                   protein BatD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_266"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13749"
FT                   /db_xref="GOA:B1GZR7"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR7"
FT                   /protein_id="BAG13749.1"
FT                   /translation="MLKKILLPVILLLLLFTSVLASAETIYFKASANKKTVTLSESFIY
FT                   SVTVSGDSTNLPEYKMDAMPEFNRFGTTVSRSISVVTGKTSMSVTRDYTLGPKKIGKFT
FT                   IPPAKITFKGKTYLTESVEIEVTPAQSVKSIPVVANRRQLSSQNAAAGKAFVKASINKK
FT                   TAYENEKLVYKFSFYTNVDLVSNPEYYPPDFSGFWNDGSKPKNHFEVIDGSNYRVDEIE
FT                   TTLYPVGTGLKRILPAKLKIDLMNFSLPSGMNDFFSFFADNGCAGDGETKILETESLEI
FT                   KIIPLPKDGKPADFYGATGDFEIKAVVDKKDVRINEPVTLTVTVSGSGNMKSISDINFG
FT                   VYNDFKKYDTIVESTSGNSKKFKTIFIPLVSGEKEIPAASLSFFSPLKKQYETIKTSSQ
FT                   KIIVSGMSLHTEENVEDKLKIDIMHKDINYNKRIKTLKLYRGYLIEKPVFYLIFVPFIM
FT                   LFILSVCYAVYMRRVSRNPFKKLKTLSFAEVQKLVKEAENRISENNFEASLDLLYQALI
FT                   EIINIETGTKSDNLQKNQIIGNLRKKNADDEKIIEIIKMLERFDFYKFASVNLDKDSIN
FT                   ALLINVETLILSFKK"
FT   CDS_pept        399952..400104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_266"
FT                   /old_locus_tag="TGRD_267"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_267"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13750"
FT                   /db_xref="GOA:B1GZR8"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR8"
FT                   /protein_id="BAG13750.1"
FT                   /translation="MKKWKCSACGYVYDPAVGLPEAGIALGTLFEQLPEDWVCPLCGAP
FT                   KSTFE"
FT   CDS_pept        400117..401376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_267"
FT                   /old_locus_tag="TGRD_268"
FT                   /product="NifS-like cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_268"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13751"
FT                   /db_xref="GOA:B1GZR9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZR9"
FT                   /protein_id="BAG13751.1"
FT                   /translation="MKRIYMDNQSNTKADERVFESMKPFFIEYYGNPQSIYSFGSFSKN
FT                   ALETARRQVADLINADAEEIIFTSCGTESNNLAVKGIAGALKAGGRHIIISSIEHFSVL
FT                   NSVKRLEKEGFEVSFIPVDGNGNVDGSELKKALRKDTILVSVQYANPEIGTIQDIKKLV
FT                   SVVKENSNAGKFVAFHTDAVSACGTIPVDVKDLGVDALTFSASVMYGPKGAAALYLKKG
FT                   VRISPQMDGGIQENYIRSGTENIPTIVGFGKACEIAKDEIVKNGKAVQKLRDRLIAELP
FT                   RRIEHIYLNGVRENRLPGNVNFSIEFVEGEALFLLLDAKGIMASSGSACASKNLKLSHI
FT                   LDAIGIDVAVGQGSILFTLSKFNTEEEINYVLEEFPNIVKRLRDISPLYSYFLKTGSRK
FT                   AAGPGTDFDDHCTTTIRRID"
FT   CDS_pept        401421..401798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_268"
FT                   /old_locus_tag="TGRD_269"
FT                   /product="NifU-like Fe-S cluster assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_269"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13752"
FT                   /db_xref="GOA:B1GZS0"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS0"
FT                   /protein_id="BAG13752.1"
FT                   /translation="MAFYSERVMDHFANPRNVGEIKDADGIGEVGNPVCGDMMTFYIKV
FT                   KDNKIEDVKFKTFGCGAAIAVSSMVSEMVLGKTLEEVMNLTNADVAKALGGLPSNKMHC
FT                   SNLGADALHKAVENYNSKQVK"
FT   CDS_pept        401976..403172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_269"
FT                   /old_locus_tag="TGRD_270"
FT                   /product="anaerobic nitric oxide reductase flavorubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13753"
FT                   /db_xref="GOA:B1GZS1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS1"
FT                   /protein_id="BAG13753.1"
FT                   /translation="MTVRLIKDGVYAVGAIDWNERHFHGHTYVTRRGVTYNSYLIVDEK
FT                   ITLIDTVRRGYEKELMENIRTLVDLSKIKIDIIIINHIEPDHSGAFPEILKLCPGAKVY
FT                   GTEKARQGLLKYYGVSGDWTVVKSGQSLSIGKRTLNFIDVPMIHWPDSMFTYSAYDKIL
FT                   FSNDGFGQHYATNKVFDDEVDFAALMDEAQKYYANILWPFNALVAAKLSTIDKLNLNIE
FT                   LIAPSHGLVWRRYVPEIMQKYLYWSSHSCQNRIAVVYETMWNSTEKMAGKIIEGITSEG
FT                   VEAVLFDITKNDRTDIASYMLDAKGWVFGSSTHDGEMLPVITGFLHFLKGSKAKGRRSF
FT                   AFGSYGWSGEAVKDIEDTGSCVSTFESSLMVVFNPTDEELNKCFEAGKTFALKIKTEK"
FT   CDS_pept        403309..403752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_270"
FT                   /old_locus_tag="TGRD_271"
FT                   /product="superoxide reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_271"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13754"
FT                   /db_xref="GOA:B1GZS2"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS2"
FT                   /protein_id="BAG13754.1"
FT                   /translation="MKGLVCKVCGYVALDGNKERCPVCRSKNVFEEKEDAYKMPDFKAA
FT                   SDETEKKHIPSFMLMSECSLIPDTGCVDVHVKIGEILHPTLPEHHITGIAFYIDNKFVE
FT                   NIMLESDINPAAVIHLNGSTKGRVQVIENCNIHGKWFNEVEVK"
FT   CDS_pept        403953..404531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_271"
FT                   /old_locus_tag="TGRD_272"
FT                   /product="rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_272"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13755"
FT                   /db_xref="GOA:B1GZS3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS3"
FT                   /protein_id="BAG13755.1"
FT                   /translation="MVKSIKGTKTEKHLLESFAGESQARMRYTYFASKAKKEGFEQIFA
FT                   VFMEIADNEKEHAKRFFKFLEGGFVEITGTFPAGIISSTIENLRFSATGENEEHSKIYP
FT                   EAARIADEEGFPEVAECFRRVAIAEKHHEARYLTLLNNLENDRVFKKGIVVRWRCRNCG
FT                   YVYESKEAFEKCPACLHSKAYMEELSGSF"
FT   CDS_pept        complement(404827..405594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_272"
FT                   /old_locus_tag="TGRD_273"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_273"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13756"
FT                   /db_xref="GOA:B1GZS4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS4"
FT                   /protein_id="BAG13756.1"
FT                   /translation="MIIKSVQNQIFKDALSLQNKKLRDKNGLFFVEGKKQIYEIPKNRT
FT                   IKQIFISEKYKNDVTNLKNVIMLSNHLFSKLSATKSPQGIMAIVEKKYYAVEDIIKNSG
FT                   LFILLENIQDPGNLGTIIRSADAFGAKAVFVSKGSADIYSDKTIRATMGSIFHLPIIDS
FT                   INIKNTLNLMKNKKISVFAASLKGEKYLNDIKFPNKSAFVIGNEANGLRSETENSADTL
FT                   VKIYMPGNTESLNAATAASIIMYEAAKNRTFIF"
FT   CDS_pept        405764..407491
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_48"
FT                   /note="pseudogene of ABC-type lipid A export system"
FT                   /pseudogene="unitary"
FT   tRNA            408175..408248
FT                   /locus_tag="TGRD_tRNA22"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGA"
FT   tRNA            408261..408334
FT                   /locus_tag="TGRD_tRNA23"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   CDS_pept        408708..409385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_273"
FT                   /old_locus_tag="TGRD_274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_274"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13757"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS5"
FT                   /protein_id="BAG13757.1"
FT                   /translation="MIPEDISKEQAEELFRNLNKIESPYVKSRIADILWHIKKLDKNNI
FT                   EAAKIAIESYYKSVKYFVNNCKISEFFLKFAIGQLERLAIIILFLKDIPKRDHIYNKLL
FT                   EYLDNIANIEFISAAFGIFLRLKLSKEETKVVIEKLENLIKLLGDKIDGFSLRKLYSTG
FT                   AEIAKKSGELDKMRSFKIIEADSFVEEADKINIRGWIIKSGFLKKAILLYQSIPSKKIE
FT                   LKN"
FT   CDS_pept        410907..412442
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_49"
FT                   /note="pseudogene of adenine-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        412651..414730
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_50"
FT                   /note="pseudogene of restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        415739..417334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_274"
FT                   /old_locus_tag="TGRD_275"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_275"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13758"
FT                   /db_xref="GOA:B1GZS6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS6"
FT                   /protein_id="BAG13758.1"
FT                   /translation="MAYLVLARKFRPQNFDEVVGQEHISQTLKNSISEKRIAHAYLFSG
FT                   PRGCGKTTMARILAKALNCKNGPTIKPCGVCENCVEISKSSSVDVLEIDGASNNGIDDI
FT                   RVLRENVKFSTASSKYKIYIIDEAHQITAQAFNALLKTLEEPPAHVIFIMATTEQHKIP
FT                   ITILSRCQRYRFKLISGAEMVCAIKSIGQEEGFEIDDEALNIVTSASGGSMRDALSLLD
FT                   QAVSSNTGRITGDYMRGLLGLLPKDIIVSVTDNIAKGDIHAILKIVKEIYEQGYNILQF
FT                   ARDLREHLRNVMIYSINPAIAEISSEDKKIFDVQKSLFTVSRYVRMNNLLSKALEEMRW
FT                   HDQPRILLEMYLLKMSEPYYDVGELINKITDLERNFRTCGNSQLPFEKQPAVRSESCAA
FT                   GKVFDPADLTVVWNDIVSEIIKKHSLTGQPLKNALIKIESDSSIQLVFSKQFDYDSGLE
FT                   FQEQIAKLFQRMTGLNVAIKIVIEKNISKNKAVYEDAVVKEECPHPNKENAKTTIPARI
FT                   EEIAKRFGSVAKKI"
FT   CDS_pept        417371..418606
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_51"
FT                   /old_locus_tag="TGRD_276"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        418613..419209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_275"
FT                   /old_locus_tag="TGRD_277"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_277"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13760"
FT                   /db_xref="GOA:B1GZS8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZS8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13760.1"
FT                   /translation="MNRPRPVEKMVGIIKKLPGVGHKMAERLSYHILKMPQVEVDRLID
FT                   SIQNARRTMKCCSICCNLSEHDPCPICSDVTREKNIVCVVETPQDLIAVSKVEDYKGLY
FT                   FVLGGALSPLDAVGPDDIRIDKLIKRLKRDSINEVIIATDADSKGEITAVYLADIIKIL
FT                   GIKVTRLGYGLPVGGDIEYADEITISRAIAGRKEM"
FT   CDS_pept        419309..419887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_276"
FT                   /old_locus_tag="TGRD_278"
FT                   /product="pyruvate:ferredoxin oxidoreductase (PFOR) subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_278"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13761"
FT                   /db_xref="GOA:B1GZS9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZS9"
FT                   /protein_id="BAG13761.2"
FT                   /translation="MSAKMIEVRWHGRGGQGAKTAALLFAEAVLATGKYIQAFPEYGPE
FT                   RMGAPVQSFNRISEAPITIHSGITNPDYAVILDPSLIESVPVTDGIGEKGKVIVNTSFS
FT                   SSEIAQKLGIDASQVFVVNASRIALETIGRNIPNTPMLGALVKVIGTLDINGVLEDTKV
FT                   KLTAKFRHKPEVIEGNLASIKCAFGEVKN"
FT   CDS_pept        419992..420303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_277"
FT                   /old_locus_tag="TGRD_279"
FT                   /product="pyruvate:ferredoxin oxidoreductase (PFOR) subunit
FT                   delta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_279"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13762"
FT                   /db_xref="GOA:B1GZT0"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT0"
FT                   /protein_id="BAG13762.1"
FT                   /translation="MKKEERKLTAVEIPIGDIVEAETAVEFNTGSWRSERPVWNKEKCI
FT                   HCLTCWISCPDSSVKIASDEKRITIVTGIDYDHCKGCGICARECPPKIKAITMEHEKK"
FT   CDS_pept        420338..421543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_278"
FT                   /old_locus_tag="TGRD_280"
FT                   /product="pyruvate:ferredoxin oxidoreductase (PFOR) subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13763"
FT                   /db_xref="GOA:B1GZT1"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT1"
FT                   /protein_id="BAG13763.1"
FT                   /translation="MIKTVYSKGKLVAKTGNEVVAEAMRQIEPDVVAAYPITPATEIVQ
FT                   IFSQFVADGIVKSEYVAVESEHSAMSATIGASAAGARAMTGTSSQGLSLMWEMLYIASG
FT                   LRLPIVMAEVNRAISAPINIHGDQSDTMGARDAGWIQIYSENSQEAYDNMIQATRIAEK
FT                   AKLPTLVTTDGFIISHCMEVVETYPDADVKAFIGKYEPERYLLDIKKPYTLGSIDLQDY
FT                   YFEHRYQLAQAMRNAKNIVLDVAKDFEKTFGRKYDLCEKYMLDDAEIAIAVIGSTAGTA
FT                   KVVVNELREKGIKAGLLKIRVYRPFPAEEIAKDLAHVKAVAVMDRADSCSGAFAPVYSD
FT                   IVASLYASGVTNPKVVNYVYGLGGREINTGHIIGIYEMLCKIASGTEKSSNKVEYINVR
FT                   IK"
FT   CDS_pept        421737..422672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_279"
FT                   /old_locus_tag="TGRD_281"
FT                   /product="pyruvate:ferredoxin oxidoreductase (PFOR) subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_281"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13764"
FT                   /db_xref="GOA:B1GZT2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT2"
FT                   /protein_id="BAG13764.1"
FT                   /translation="MANLKELSKNPERLTGGHRLCAGCGAGIVARQTLIAAGSTPVVIT
FT                   NATGCLEVSTTVFPYTAWKDSFFHSAFENSAATCSGIETAYRSLKAQGKIKDDIRFITF
FT                   GGDGGTYDIGLQSLSGAMERGHRMLYICYNNEAYMNTGIQRSGATPKGAHTTTAPAGKV
FT                   RQGKEQNKKDLTQIMIAHDIPYVAQAYVGNWNDFITKVQKALAVDGPSFINILTPCRLG
FT                   WAYKPEDTMLISRLAVETCVWPSFEVENGVYKINVIPKEKKPVIEFLKLQGRFKHLFRS
FT                   DNAHILETIQKGVDEKWDLLQRRSAVGCRA"
FT   CDS_pept        422935..424092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_280"
FT                   /old_locus_tag="TGRD_282"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_282"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13765"
FT                   /db_xref="GOA:B1GZT3"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZT3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13765.1"
FT                   /translation="MIRFTTAGESHGEGLFVIIEGIPAGLTINSEDIDLELARRQKGYG
FT                   RGQRMCIETDTVKVFSGMRHTVSLGSPIAMYIANKDFKNWTKIMSPTSVDSEVTPLLRP
FT                   RPGHADLPGFMKYGVNDFRDILERASARETAARVAAGAVCKALLKEFEISIVSYTSQIG
FT                   DVTADISSVEECKIWHDAEISCVRCPDAKASEKMIQLIKKAGEKGDTLGGKVVVVTKNV
FT                   PAGLGSHTQWDLKLDGRLAQSLISIQAVKAVEFGAGTKLASLLGALSHDEIFYDVTRGF
FT                   YRDTNRAGGIEGGMSNGEPIVVTCTMKAIPSLANPLHSVNLATKETAEAEAIRSDVCAV
FT                   PAVGIVAEAAIAVELAKALKEKFGGDSLKDMKKNVNIYKERIKAL"
FT   CDS_pept        424093..424608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_281"
FT                   /old_locus_tag="TGRD_283"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_283"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13766"
FT                   /db_xref="GOA:B1GZT4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT4"
FT                   /protein_id="BAG13766.1"
FT                   /translation="MNLVFTGFMGTGKSNTGKIISEKLKMSFFDTDDLVEKKSGFSISD
FT                   IFKKFGEANFRKMEAETIKEVSEKDSVVISCGGGAVLNPANIANLRKKGIIINLYALAE
FT                   VIYDRLKDENNRPLLRCEKPLVEIKKLLDFRKSVYADCDFSFDTDGLTAVEVADKVLNN
FT                   DVIKRLLL"
FT   CDS_pept        424662..425178
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_52"
FT                   /old_locus_tag="TGRD_284"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        425189..426172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_282"
FT                   /old_locus_tag="TGRD_285"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_285"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13768"
FT                   /db_xref="GOA:B1GZT6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZT6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13768.1"
FT                   /translation="METSFDFEKPIAEINNRIDDLKESSRVGNIDLLAQIEDLEKTRDE
FT                   LRQKIYGSLTAWQRIQIARHPKRPYSADYVKLIFKDFIELHGDRIFGDDQAILCGIAAF
FT                   NDNPVVVIGHQKGRTLQENMDRNFGMAHPEGYRKAMRIMKLAGKFNRPIITFIDTSGAY
FT                   PGIAAEERGQAEAIARNLRDMSNLKVPIISIVIGEGGSGGALGIGVSNKVLCLENAYYS
FT                   VISPEGCAAILFRDGSKASEAAQAMKITAKDLLNLKVIDGIIKEPLGGAHYDPVATAAN
FT                   IKAVLNEYLCKYETMSCKEIADERYLKFRKMGIYEDVAEEKMNVKK"
FT   CDS_pept        426376..426435
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_53"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        426990..427985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_283"
FT                   /old_locus_tag="TGRD_286"
FT                   /product="class II fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_286"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13769"
FT                   /db_xref="GOA:B1GZT7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT7"
FT                   /protein_id="BAG13769.1"
FT                   /translation="MALVSGKQILEEAKKKGYGVGAYNVNNMEQIQAIMAAAKETQSPV
FT                   IIQASRGALKYSNFTYLGYLMKAAIIENPDIPIVMHLDHGNSLESAIKAIDLGFSSVMI
FT                   DGSLLEDGKTASTYDYNIKVTRSVVEYAHARGVSVEAEIGTLGGIEDGVGSGKIHLTDP
FT                   KEAERFVNETDVDSLAIAIGTSHGAYKFKGAANLAFDVLKEIRALIDIPIVLHGASSVP
FT                   KELTGEVNKYGGKMPGATGVPMSNLQEAIKLGVSKINVDTDGRLALTAAIRKVFTESPE
FT                   KFDPRDYLGPARTALTNLIITKMKDFGTAGHARDYAPKSLEDIKKLYLSK"
FT   CDS_pept        428317..428478
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_54"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        429205..430557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_284"
FT                   /old_locus_tag="TGRD_287"
FT                   /product="oxaloacetate-decarboxylating NAD+-malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_287"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13770"
FT                   /db_xref="GOA:B1GZT8"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT8"
FT                   /protein_id="BAG13770.1"
FT                   /translation="MKKQKKVDVNKLLKAAEEPSKIARKLHPFYRGKIEVVPKCRVKDF
FT                   NDFSIWYSPGVAAVCTDIYKNPELVYEYTNKWNSVAVVSDGTRVLGLGDIGPEAGMPVM
FT                   EGKALLYKYLGGVDAYPICLDTKDEKEIIQTVKILQPSFGGVNLEDIEQPKCFPVLNTL
FT                   RKECRIPVWHDDQQGTALVTLAGFINALKVVGKKIEKVKIAMLGAGAANICISRLLILY
FT                   GANPANIIMVDLCGTLHKKRVDLKMCPEKWTLAVDTNVNAVHGGIKEAMENADAVIALS
FT                   SPGPGVIDKKWIERMAKNPIVFTCANPVPEIWPWEAKEAGAAVVATGRSDFANQVNNSL
FT                   GFPGVFRGALDVRASTITDTMCITAATELASCIADNEIKPDKILPTMDDWEIFPKVAAA
FT                   LGIKAIKEKVAGKKLSYDKIFNDAKSIIKRSRAITEGMMKSGYIKSAKDKI"
FT   CDS_pept        430538..431377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_285"
FT                   /old_locus_tag="TGRD_288"
FT                   /product="fumarate hydratase (fumarase) subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_288"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13771"
FT                   /db_xref="GOA:B1GZT9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZT9"
FT                   /protein_id="BAG13771.1"
FT                   /translation="MRKIKSEIIINAIENLCAETNFKLPADVLKSLEQNIVLEKDTAKD
FT                   ILKEIIENADIARKEQIPLCQDTGTANFFIKLGRDTEIENGDIYAAVNKGVSLGYTNSY
FT                   LRKSVASNPLERKNTKDNTPANIYIDLVSGDKIEITFLPKGGGSENASALKMLVPSVGW
FT                   DGIREFVLSAVDDKGRNACPPLVVGIGIGGDFASVGLMSKKALLREIGSENKNVFYVGK
FT                   EMELLNDINKLNIGPMGMGGKTTALAVFIEAKPVHIASLPVAVNIQCHSCRRKTVMI"
FT   CDS_pept        431374..431895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_286"
FT                   /old_locus_tag="TGRD_289"
FT                   /product="fumarate hydratase (fumarase) subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_289"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13772"
FT                   /db_xref="GOA:B1GZU0"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU0"
FT                   /protein_id="BAG13772.1"
FT                   /translation="MKIDLLDLVLNPKMLKAGQRILLSGTVYTARDAAHKRIIDMLDSG
FT                   SAVPFNLKDAAIYYCGPSPAKPGAVIGACGPTTSSRMDIFTPRILKEGVKFLIGKGTRS
FT                   ESVVNSIEENSVVYLVATGGVAALLSKTVKKAALIAFEDLGPEAIYKLEVEDMPLIVAI
FT                   DSDGGSVFKL"
FT   CDS_pept        433315..433676
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_55"
FT                   /note="pseudogene of adenine-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        433756..434578
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_56"
FT                   /note="pseudogene of restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        435054..435833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_287"
FT                   /old_locus_tag="TGRD_290"
FT                   /product="type III pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13773"
FT                   /db_xref="GOA:B1GZU1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZU1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13773.1"
FT                   /translation="MFLALDIGNTNITVGLFAMKDKKVLPEPLKVWIMSTVKERTFDEY
FT                   ATLLMNMLFYDGFDAKQLSNFAVASVVPSLNAVFEELIKKYFGEKTFFVNSKNCGGLVF
FT                   AAGNSKETGADRIANVVAAYSVYGDSCIVIDFGTATTFDCINSEGIYIGGAIAPGPSIS
FT                   ARLLNLKTEQLPRVEVKKPLKSIGLTTVECMQSGLYFGYTGLVKELIARIKNEMKIKHI
FT                   IATGGLAGLMFDEIEEIEIILPYLTLSGVRIVWEKVI"
FT   CDS_pept        436560..437108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_288"
FT                   /old_locus_tag="TGRD_291"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_291"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13774"
FT                   /db_xref="GOA:B1GZU2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZU2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13774.1"
FT                   /translation="MTSFVRGGFVENRKFRINQFIKVPEVRLVDFDGTMIGVIKTADAL
FT                   AKAQAKDLDLVEISPQANPPVCRIINFSKFKYEMEKKEKEARKKQKIFHIKEVRIRPRI
FT                   SDHDLEVKIKHAREFIDGGDKVQLTALFSGREMQHKDLGIKIMERIKESLADIACPERK
FT                   VYSMGMRVFLTLVPKNKIK"
FT   CDS_pept        437194..437394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_289"
FT                   /old_locus_tag="TGRD_292"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_292"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13775"
FT                   /db_xref="GOA:B1GZU3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU3"
FT                   /protein_id="BAG13775.2"
FT                   /translation="MPKMKQHSGAKKRFKVTGKGKVKYKKPGQRHLLTGDSGNQNRKAR
FT                   KPAIVTKSDMKTMKKIMSYSF"
FT   CDS_pept        437420..437767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_290"
FT                   /old_locus_tag="TGRD_293"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_293"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13776"
FT                   /db_xref="GOA:B1GZU4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU4"
FT                   /protein_id="BAG13776.1"
FT                   /translation="MRAKSVVYTRQRKKKIFRLAKGSYATKKNHWRMVIQQVERSLNYA
FT                   YTGRKDNKANFRTLWIVRLNAAVREEGISYNRFIFGLKKANVAIDRKMLAEIAVNDNTA
FT                   FKQLVEVVKAA"
FT   CDS_pept        437774..439068
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_57"
FT                   /note="pseudogene of K+ transporter membrane component"
FT                   /pseudogene="unitary"
FT   CDS_pept        439629..440206
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_58"
FT                   /note="pseudogene of K+ transporter NAD-binding component"
FT                   /pseudogene="unitary"
FT   CDS_pept        440217..440501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_291"
FT                   /old_locus_tag="TGRD_294"
FT                   /product="TPR-repeats containig protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_294"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13777"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU5"
FT                   /protein_id="BAG13777.1"
FT                   /translation="MSNDIKNMFSNELDHIELGKFYFLNNKYDEAVSEFKKVLEINPAN
FT                   AETYYNIGLIRESSNQMGEAREMYSKALAVKPDYKIVRVRLNKLIGIKS"
FT   CDS_pept        440587..441606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_292"
FT                   /old_locus_tag="TGRD_295"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_295"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13778"
FT                   /db_xref="GOA:B1GZU6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU6"
FT                   /protein_id="BAG13778.1"
FT                   /translation="MDDIKQIIDRALAEIKNADLAVLEDIKTRYLGKNGVLTQILKSLL
FT                   QYSIEDKRIIGLETNGAKDIIVSEIEKRKKSLKKVLLDEKMHKEKLDYSPSFYFPFSKG
FT                   SFHPVVQTIKNISSVFKLLGFSIVEGPEIETDWYNFEALNIPESHPSRDAQDTFYIEGM
FT                   KNLLRTHTSPVQIHVMEKQNPPVKVIVPGRVYRNEASDASHSSTFHQIEGFEVDENISF
FT                   VDLKAVLINFIHQFFGSELGVRFRPSHFQFTEPSAEVDIQCFFCNCGGCRICKNSGWIE
FT                   VLGCGMVHPDVLKTVNYDSEKYTGYAFGMGVERITMLKYGIDDIRLLYENDLRFLKQF"
FT   CDS_pept        441916..444291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_293"
FT                   /old_locus_tag="TGRD_296"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_296"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13779"
FT                   /db_xref="GOA:B1GZU7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU7"
FT                   /protein_id="BAG13779.1"
FT                   /translation="MKLSYKWLKKFIDFELSPQELASMLISVGIETSVVSTGCDWHSVV
FT                   TVKVLEVLKHPGADRLSLCKVNDGSKDYSIVCGAKNIAAGQIVPLAKIGAVLPGNFKIN
FT                   KSKIRGIVSEGMICSEADLGLKKESDGILMLDKNTKIGVALENVLSGLDSILEIEITTN
FT                   RGDCLSHLGVAREIGAKLRKILSFPTMIKTFNIPYLNCVEVKSDLCHRYIGSVISGVKI
FT                   CPSPGWITDALEKSGIRPVNNVVDVTNYVMIELGQPLHTFDITKLSSRKVVVRKAVDYE
FT                   KIIALDGKEYKLDSEMLVIADSEKPVAIAGVMGGEYSAIDEKTETVFLESAIFDAVSIR
FT                   KTSKKLNLSSGSSYRFERGLGWDITELASWRAANLIIEIAGGRMDAREDLQIVKYERAD
FT                   IALRVEKVSKILGCVVKEAEITEILRFLGIDLRSRGTIILCTVPSWRNDIKKEVDLIEE
FT                   IARIKGYDAITSPGKRCTATAEVCVSDNSLLHAVVEEFRVKLNGFSFSEVLNYSFSEIT
FT                   ELEKFDLKYYYKIANPISKENEVLRPSLLPALYKNLLLNIEWGSETVTLFEYGKIFTGL
FT                   GERKAFAVIMYGKVWQEWWKWAEQKNSPKYDFYFGGGIVRNILPSDEFIIAENLNAESY
FT                   YHSGKTASVVYKGKPVGQFGVLKPSITSDIAGDVFYFEVNLESFENVCAGKKSLYKAYS
FT                   KFPEVKRDISITADKTLQFSEIEKVIKNVIKSGGILKEYSLFSVYSDESKVGDGKISYS
FT                   FRLSYKNSEKTLTNEEVNKDMNVLLQKLDADFGVKLRR"
FT   CDS_pept        444888..446393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_294"
FT                   /old_locus_tag="TGRD_297"
FT                   /product="putative FAD-binding glycolate/D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_297"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13780"
FT                   /db_xref="GOA:B1GZU8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZU8"
FT                   /protein_id="BAG13780.1"
FT                   /translation="MIIKRDKDIIQNYFEDNSGVIGSSADFVALTETEDDISGFLVEMS
FT                   KSKTPVTVVGSLTGNTASGLAFGGSVLSLENLNNISEIKEIDDKNALITVQAGAKIHDI
FT                   KLKAFNGGWMYPPDPTEKNASIGGNISTNASGGRGFKFGVTRDYIKALKVIFSDGSQSY
FT                   IERGKYFADKNGGITFDTNKGKKHILLPKYHLPAIKNVTGYYNYPAADLMDVFIGSDGT
FT                   LCVIVKAVLKLIPSFKEVFGGIIFFESRNSAYEFVNKIKIISKNTEKENLKDSISAMSL
FT                   EYFDKNALLMIKNYYPVIPENIEAGIMFEQDIYEDNFDILMEKWVEAISDSGIDLEKVW
FT                   FASNFAQQEEFRVFRHRIPECVNEIVRKNKIPKSGTDFAVPEGKLPEIVDFCDREFKKS
FT                   GIFNLTFGHIGENHLHANIIASNKEEYERCRRICVDIAQKAVELGGTVSAEHGIGKLKH
FT                   ILLEKMLGEKGFKEMAKFKKSIDESGILGQDNIFPKNYIQRIQ"
FT   CDS_pept        446697..447399
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_59"
FT                   /old_locus_tag="TGRD_298"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        447716..448339
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_60"
FT                   /note="pseudogene of M50 family peptidase"
FT                   /pseudogene="unitary"
FT   CDS_pept        448393..449364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_295"
FT                   /old_locus_tag="TGRD_299"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_299"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13782"
FT                   /db_xref="GOA:B1GZV0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV0"
FT                   /protein_id="BAG13782.1"
FT                   /translation="MSKVLSGMRPTGRLHLGHYFGVLMNWVKFQNECECYYMSADWHVL
FT                   TTSYVDTSAVNENTLEMVADWITAGVDPEKSVFFKQSGVLYHSELFLILSMITPLSWLQ
FT                   RCPTYKEQISQIKNKDLSNYGFLGYPILMSADILLYKANIVPIGEDQLSHLELTRKIAR
FT                   RFNNFYGDTFIEPKEELTKAASVPGLDGRKMSKSYGNSILLGESDDILRDKVKSMFTDP
FT                   LKIKTADPGHPCGCVVFAFHEIFGIEYKNREEECKAGAIGCMSCKKQLMEMLSEFMKPL
FT                   TEKRKDLIADKAYLEKIVEAGCRKAAEIAQQTMEEIRKAMKF"
FT   CDS_pept        449492..450196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_296"
FT                   /old_locus_tag="TGRD_300"
FT                   /product="segregation and condensation protein subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13783"
FT                   /db_xref="GOA:B1GZV1"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV1"
FT                   /protein_id="BAG13783.1"
FT                   /translation="MVYDIHLDTFEGPLDILLHLIKKNDLEINEIKIAEITAEYLTYLD
FT                   LMQELNIDIAGEFLVMSSTLIQIKARTLIPSNNEKDILEDDSLSFLKNRLFEYQKYKEL
FT                   GRLLSYKIIENSQIYYRPALPINKQDFVLDATIFDLVGSFRTALTRLPENIKEIMYQEI
FT                   PIETKIREILDVLEGRQYISFNDILRMQETKTALIVCFMAVLELVKNKQIVAKQSELFS
FT                   EIRIYRIYNKEE"
FT   CDS_pept        451176..451847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_297"
FT                   /old_locus_tag="TGRD_301"
FT                   /product="segregation and condensation protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_301"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13784"
FT                   /db_xref="GOA:B1GZV2"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV2"
FT                   /protein_id="BAG13784.1"
FT                   /translation="MEISEVRQILEALLFVSERPLSLRELKELIKTDYTDMDNIENILN
FT                   ELKEKYANLNKPYEIKFVADGWTFATKPQYSLWIKKLFKEKSVLKLSPAALETLAIIAY
FT                   KQPITRAEIDEIRGIESSGVIDTLLDRKLVKVAGRKEALGKPLLYGTTQDFLKHFGLAH
FT                   LSELPLIEDMPKDVQQSDNEPEPELPFDGGNFGGDVSIDVIKKELAGAAENPAGSEREN
FT                   T"
FT   CDS_pept        452166..452903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_298"
FT                   /old_locus_tag="TGRD_302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_302"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13785"
FT                   /db_xref="GOA:B1GZV3"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV3"
FT                   /protein_id="BAG13785.2"
FT                   /translation="MKICKFTIKTASESLKLITVASLCAFCILVSGHYYRIKNYAKTLS
FT                   ETLNIVVFFDKNSVDDTVISREIEATGLVSVKEYVNAVEAYSKAVERNPFLKDISVPDA
FT                   AKSVQAYVLVTPKSIPYENFLSKMKNVLERISGIDEVVFDMTVFKHYTEIENLLSFCRK
FT                   IFFVFAVIIFILFVFKCIFFVLEQELDTRKIVANIFSYLLSSMSGFLILWTICICARYP
FT                   LLIDKVAIFSIVPFIAVLGAVLD"
FT   CDS_pept        452905..454026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_299"
FT                   /old_locus_tag="TGRD_303"
FT                   /product="septal ring factor EnvC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_303"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13786"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV4"
FT                   /protein_id="BAG13786.1"
FT                   /translation="MKKIFILIVLLFCSFVSLSGQSEDIKVQSKKLSEIKKSIKEKERE
FT                   KNKLIRQERIFKEELTSINGSIGKTEKKLAKILVNIKTTQYNLDNFSKVYNASSSRSAV
FT                   WNHVLLDDIKLFNKMTFSYEQNPVEYKIRRKSLEYKKENFEKEKKLAMISAASMKRCER
FT                   SKKDLLNLQLKESKLVERYKNMLKEKKELSDIILNRRFTAEREIRTLSESAKALQRLID
FT                   KINEVNKRKRTAAVRPPAVRSGRKKSLPWPVDGKVVLGFGRNKHPDLDTYVISNGIKIE
FT                   AADFSQVKSVESGIVVFAGQFRSYGKVIIIDHSDLNFSIYGLLGKMFVKLEQKVSKGAV
FT                   IAELGSGEENNVLYFEIRHNNTPVDPILWLQAK"
FT   CDS_pept        454083..455116
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_61"
FT                   /note="pseudogene of periplasmic C-terminal processing
FT                   peptidase"
FT                   /pseudogene="unitary"
FT   CDS_pept        455371..455808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_300"
FT                   /old_locus_tag="TGRD_304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_304"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13787"
FT                   /db_xref="GOA:B1GZV5"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV5"
FT                   /protein_id="BAG13787.2"
FT                   /translation="MSHKVRKESIWVKMYVIVLFFCGVGIWFSIQLAHNRKIYTNATLN
FT                   RKIESVLVKNGIAENDILSQYIRERNKKTAAWNEFYKIIKLKSGKTARTFEKSFRSVAR
FT                   SMKVGLSRADNADGSVTYKFYSSEKNYFNITFMSLKKSSKG"
FT   CDS_pept        455818..456846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_301"
FT                   /old_locus_tag="TGRD_305"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_305"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13788"
FT                   /db_xref="GOA:B1GZV6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZV6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13788.1"
FT                   /translation="MNIFAIETSCDETSASVVLNGLKVKSVVIYSQIKIHAGFFGVVPE
FT                   LASRSHIENINLVIWRALSDAGINFTDFSQKIDALAFTSGPGLAGALLVGAIAAKSLAC
FT                   VYKKPLIPVNHLDGHLYSSLIENRSVKLPFLSLIISGGHTELVVVEDFGKYKVLGSTRD
FT                   DAAGEAFDKAAKMLGLSYPGGPIIDKIAESGNPEAVRFTRPYLKGSWDFSFSGIKTALL
FT                   NYLKTNPVRNEKQLNDICASFRQAVAETLCFKSFEAAKKFNLKRIVLGGGVSANSLIRK
FT                   IFLETGQKNNTKVFIPSLIYSTDNAAMIGCAAYFKQKKCGLKYDNIQLKPNPSLPLENW
FT                   RL"
FT   CDS_pept        456998..457960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_302"
FT                   /old_locus_tag="TGRD_306"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_306"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13789"
FT                   /db_xref="GOA:B1GZV7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV7"
FT                   /protein_id="BAG13789.1"
FT                   /translation="MKKLSLGNIEFDNNIILAPMAGITDLPLRRLAKSGGAGLVYTGML
FT                   SARALVRSDEKTEKLLKTTEDERPVAAQIFGSAAHIMAEAAKIVRNSGADIIDVNLGCP
FT                   VKKVAKAGAGAKLLADEKLVSEILESVVKSVDVPVTVKIRTGLLPEHNAATEIIKVAYN
FT                   CGIKMVAVHARPASQGHSGFPDLKLFAASCAGAKIPVIANGGVVDEKTAADFLRVPNCA
FT                   GIMIGRGALGNYSIFKRLEAFFSSGKKLPLPSKTEKVEWLKKHVQYSVEYYGEKKGFVV
FT                   MKKVFHYYVKDLPNAAKIRDIFNKKIVTLSDFNELIKLF"
FT   CDS_pept        458288..458794
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_62"
FT                   /note="pseudogene of biopolymer transport system protein
FT                   Pal"
FT                   /pseudogene="unitary"
FT   CDS_pept        458795..459495
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_63"
FT                   /old_locus_tag="TGRD_307"
FT                   /note="pseudogene of biopolymer transport system protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        459479..460225
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_64"
FT                   /note="pseudogene of biopolymer transport system protein
FT                   TonB"
FT                   /pseudogene="unitary"
FT   CDS_pept        460235..461527
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_65"
FT                   /note="pseudogene of biopolymer transport system protein
FT                   TolB"
FT                   /pseudogene="unitary"
FT   CDS_pept        461552..461752
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_66"
FT                   /note="pseudogene of biopolymer transport system protein
FT                   ExbB"
FT                   /pseudogene="unitary"
FT   CDS_pept        462003..462965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_303"
FT                   /old_locus_tag="TGRD_308"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_308"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13791"
FT                   /db_xref="GOA:B1GZV9"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZV9"
FT                   /protein_id="BAG13791.1"
FT                   /translation="MAKRVGIITSGGDAPGMNAAIRAVARRGIFWGYQMIGIKRGFKGL
FT                   LDYEFMTLTLRSVSGIINTGGTVLHTGRCPEMKTKIGMGRAVKAIKDLGLSAVIIIGGD
FT                   GSLAAGNSLSKHGIKVINIAASIDNDIYGTDETIGYDTALNTAVEAIDKIRDTAKSHDR
FT                   VFVVEIMGREHGFLTVDVGLAAGCEYIVVPEMKVDMQKLTAELKKGKERGKTSEIIAFA
FT                   EGCGCSAEFAKKVEKLTGLDVRVSNLGYIQRGGRPTARTRILASKFGHAAMDLFHKGKA
FT                   NLFVGITNGNVSAVSICEAIKCEKKFDVKTAKIVKNLSV"
FT   CDS_pept        463035..464201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_304"
FT                   /old_locus_tag="TGRD_309"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_309"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13792"
FT                   /db_xref="GOA:B1GZW0"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW0"
FT                   /protein_id="BAG13792.1"
FT                   /translation="MNEALEKIKRGTNEIISFEELKKKLASGKKLRIKLGIDPTTSDLH
FT                   LGHTVIINKLKTFQDLGHQIVFLIGDFTARIGDPSGRSEMRPVMTDEQIKNNARTYADQ
FT                   IFKILNRDKTEIVYNSKWLSELGVKGLLNLAAKSTVAQMLVRDDFKKRYKEDSPLSIVE
FT                   FLYPLLQAYDSVVLNADVELGGSDQKFNLLLGREIQRDYGIKDVQVVITMPLLEGTDGT
FT                   KKMSKSYKNCIALNDSPEDMFGKIMSISDELMCRYHELLTQIDLNVVKNMHPKEAKSAL
FT                   AKELVERYYGKEEALKAEEEFDKIFSKKNIPNDIGEYRIKDEEIKLSDLLVKSGMISSR
FT                   NEARRIIEQGGVRIDSRKTVRDFVVKSGNTFVLQVGKRKFNRIIREEN"
FT   CDS_pept        464365..465210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_305"
FT                   /old_locus_tag="TGRD_310"
FT                   /product="ferredoxin-NADP+ reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13793"
FT                   /db_xref="GOA:B1GZW1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW1"
FT                   /protein_id="BAG13793.1"
FT                   /translation="MYKIISKKEIGPKVRTYEICAPEIARNAKAGQFVIFRIDDKGERV
FT                   PLTVAGTDPQKGLVRIIFQEVGKSTMQLASLCEGDCIKDFAGPLGRPTEIKKYGTVVAV
FT                   AGGVGTAEVLPVIKELKQAGNRIITVVGARCKDLIILEDELKRESDLLLFATNDGTLGI
FT                   KGFVTAVLKDVISREKIDIAYAIGPVPMMKAVAELTMLKRIKTLVSLSPIMLDGTGMCG
FT                   ACRVSIGGKMKFVCVDGPEFDAHYVNWEELASRLELFKNLEKISVDKFKYSQECKCHKK"
FT   CDS_pept        465195..466565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_306"
FT                   /old_locus_tag="TGRD_311"
FT                   /product="NADPH-dependent glutamate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_311"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13794"
FT                   /db_xref="GOA:B1GZW2"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW2"
FT                   /protein_id="BAG13794.1"
FT                   /translation="MSQKVKMPERDPKIRKKDFKQVNTGYTRDEMLKEAKRCLQCKNPS
FT                   CSRGCPVEVNIPGFIKYLAGDNPSQAVKVLKQKNNLPAVCGRVCPQENQCERLCILGKK
FT                   GESICIGNLERYATDIAFENNDSIAVAEKSGVKVAVVGSGPAGLTCGGDLLKMGYDVTV
FT                   YESLHSAGGVLRYGIPEFRLPKEVLDKEINNLKKLGMKIILNTLIGRTRTVKELFNESY
FT                   KAIFISVGAGLPVFPGIEGENLNHVYCSNEFLVRVNLMRSFDFPNYDTPVYRGKNVVVI
FT                   GGGNTAMDSARTALRLGAESVKLIYRRTEKEMPAREEERLHARKEGIEFIVLTNPVKFI
FT                   GDEKKFVKAVECIKMELGDYDDSGRRHPQEIKESNYAIETDMVILALGLHPNPVLTLLT
FT                   EGLNTDRHGYIIIDDNYMTSVPGVFAGGDIVGGDTVIEAMGMGKKAARSIACYLNQK"
FT   CDS_pept        466810..467617
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_67"
FT                   /note="pseudogene of [FeFe] hydrogenase H-cluster
FT                   maturation GTPase HydF"
FT                   /pseudogene="unitary"
FT   CDS_pept        468968..469720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_307"
FT                   /old_locus_tag="TGRD_312"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_312"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13795"
FT                   /db_xref="GOA:B1GZW3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZW3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13795.1"
FT                   /translation="MRKPLMAGNWKMNKTVSEAVSFVKALKGAVTGVSNVEILVCPAFT
FT                   VLYEVNNEIKGSNINLGAQNLFGEAKGAFTGEISTAMIRDTGCSYVIVGHSERRQYFGE
FT                   TDEAVNKKTKAALAADITPIVCVGETLKERENNVTFSVIEKQVRNGLADLTLQQASLTV
FT                   IAYEPVWAIGTGKTATPDQAQEVHSFIRKIYAQMYEESAEKVRILYGGSVNPGNVSDLM
FT                   KKSDIDGGLVGGASLEAESFTKLVKYSK"
FT   CDS_pept        470097..470546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_308"
FT                   /old_locus_tag="TGRD_313"
FT                   /product="ribose-5-phosphate isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_313"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13796"
FT                   /db_xref="GOA:B1GZW4"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW4"
FT                   /protein_id="BAG13796.1"
FT                   /translation="MKLAFGTDHAAAEVRNKVKEYFQSAGYEIEDFGFCGDGSCDYPDY
FT                   AVKVAEAVISKKADRGILICGTGIGMSIAANKMKGIIAAVCWNEDTAKLAVRHNGANVL
FT                   CLGSRTATLSELCQRIKIFLGTPFEERHLQRIRKIEEIEKQQCQK"
FT   CDS_pept        471056..471880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_309"
FT                   /old_locus_tag="TGRD_314"
FT                   /product="transketolase N-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_314"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13797"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW5"
FT                   /protein_id="BAG13797.1"
FT                   /translation="METSDLKIISADVRKDIIKMLSLAGTGHPGGSLSSVELLVSLYFK
FT                   HMKFNPKDANDQSRDYFILSKGHVCPVLYAVLARLGYFNPDELCTLRKTGSRLQGHPAK
FT                   DKELPGIEISTGSLGYGLSIGAGIAAGMKQSKKNNRIYVLMGDGEQQEGSIWEAAMSAA
FT                   HFKFDNLCAIVDDNGLQIDGATKDVMNVNPLADKYRAFGWNVIEIDGHNLEAVDKAYLQ
FT                   FKTEEGRPTAIIAKTVKGKGVSYMENLVEWHGKIPSKELVEKALAEIDRSLR"
FT   CDS_pept        472000..472947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_310"
FT                   /old_locus_tag="TGRD_315"
FT                   /product="transketolase C-terminal section"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_315"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13798"
FT                   /db_xref="GOA:B1GZW6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW6"
FT                   /protein_id="BAG13798.1"
FT                   /translation="MVEVFGKRATRFGFGEGIIELGKENPKIFVLGADTISSVLIDGFK
FT                   KIFPDRFINVGIAETNLIGMAAGLAVAGFIPFVSTYGVFASGRPWEHIRTTVCYSNLNV
FT                   KIGGSHSGIMVGPDGATHQALEDIAIMRCLPRMKVIVPCDLVETKKAVVASAYSDGPVY
FT                   IRYGRENIPVFTKDDAPFEIGKANILRDGNDVAIVSCGTMVYESLMSAEILEKKGIKAR
FT                   VINIHTIKPIDEKAIINAAKKCGAVVTAEEHQVYGGFGSAVAEVLVKNYPVPVEMVGVA
FT                   DRFGESGEPMNLMSRFGLRDVNIADAVLKVLKRK"
FT   CDS_pept        472949..474144
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_68"
FT                   /note="pseudogene of phosphopentomutase"
FT                   /pseudogene="unitary"
FT   CDS_pept        474186..475031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_311"
FT                   /old_locus_tag="TGRD_316"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_316"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13799"
FT                   /db_xref="GOA:B1GZW7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW7"
FT                   /protein_id="BAG13799.1"
FT                   /translation="MKLNIFKKIQETKKTILSLHDFNPTTAVIAGSGLGEISKQFTIRK
FT                   TIKYSDIPYFLKTAVQGHAGDLLLCSYGSADLLIFNGRFHYYEGHHPQEVVYPVRVMKF
FT                   LGIKTLVITAATGGLNKKYSVGDIIVLKDHIDCTGNNPLIGVHYDEFGERFPNMENVYD
FT                   AVLRKKALSLAKKFKIKACEGIYFGVSGPSYETPASVKAYQILGGDVVGMSVVYEATVA
FT                   AQMKMRVLGLAYVSNMAAGIHNRPLSHAEVIENGEKVSLSMSKIAKNIISFTDNQVKLL"
FT   CDS_pept        475249..476124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_312"
FT                   /old_locus_tag="TGRD_317"
FT                   /product="putative S-methyl-5'-thioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_317"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13800"
FT                   /db_xref="GOA:B1GZW8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW8"
FT                   /protein_id="BAG13800.2"
FT                   /translation="MSDNPIKIAFIGGSGLYQIDGIENIVEKDIDTPFGRPSDKIITGV
FT                   INRINCAFLPRHGRGHILNPSEINQRANIYALKSLGTEQIVSFTACGSLKEEIKPKDFV
FT                   IPDQVFDRTKNRSLTFFEKGIVAHVSMAYPFCNEIRSLIRQTVYEIGIKYHFCGTYVCI
FT                   EGPQFSTKAESQINRQSGFSVVGMTLFPEAKLAREAEICYANISLVTDFDVWKEREEVT
FT                   NDAVVANVAANVANSRRVIKSLILKLSRREIKCSCGSSLKKSLMTSSDRVTVSPHYKNV
FT                   SLLIDKYFKK"
FT   CDS_pept        complement(476264..476770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_313"
FT                   /old_locus_tag="TGRD_318"
FT                   /product="intracellular protease I"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_318"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13801"
FT                   /db_xref="GOA:B1GZW9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZW9"
FT                   /protein_id="BAG13801.1"
FT                   /translation="MNRVVFITAPEIFRDEEYYKPKKVLEDTGIEVITASVKTGELRGR
FT                   FGFKTTSMLLIQEINPNDFDAIVYIGGNGSVIFFDNHYALKLANDFFKQRKPVSSICIA
FT                   GVILANAGILKGKKATVFIDGKEALIKGGAIYTGNPLEIDGNIITAKGPDVAEDFGKAI
FT                   LKSLE"
FT   CDS_pept        complement(477253..478455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_314"
FT                   /old_locus_tag="TGRD_319"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_319"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13802"
FT                   /db_xref="GOA:B1GZX0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZX0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13802.1"
FT                   /translation="MKVLVVNCGSSSVKYTLFEMENEKKIAWGIVECGPSKSYYKRQTA
FT                   VSEEKKNSVKVTSHTEAVELIINDLLDKEIGSIVNIDEIDVIGHRIVHGGDRFSRSVLV
FT                   TKEVKKGLKECFSIAPLHTPAHYAGILAVEKMLPGIPSVLVFDTAFHQTMPDYAYMYAL
FT                   PFEYYEKYHIRKYGFHGTSHNYVSQRAAIMLGKSLNELKLITAHLGNGSSITAIEKGKV
FT                   IDTSMGFTPLQGVVMGTRCGDIDPAIIAYIIKIHPKYRNSEALNALMNKESGLLGISGI
FT                   SGDMRSIVKAATESNKKAKLAFETLCYSIKKYISSYYGILNGIDGLVFTAGIGENSPVV
FT                   REKICVNLHAIGIEIDTEKNNEPSSKERFVSTAYSRVKIMIIPTNEELMIARESRDCLR
FT                   T"
FT   CDS_pept        479725..479955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_315"
FT                   /product="conserverd hypothetical protein"
FT                   /protein_id="BCI50714.1"
FT                   /translation="MKNIEILAVKVKKATERLKRLTDENLKLKLEVEYLRKESACGRKQ
FT                   TSEYVVLRKNTEEAAAKIERIIKKIDTAKVS"
FT   CDS_pept        479958..480248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_316"
FT                   /product="ZapA-domain protein"
FT                   /protein_id="BCI50715.1"
FT                   /translation="MAVTRERIMGREIDLNIDNIDELSFNKAVNFVNEQWLEIKRENAN
FT                   VADTQKIAALTAVKIAAELLKLKYLHESISNSYENKIKEFIRQLDEANHIN"
FT   CDS_pept        480376..481695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_317"
FT                   /old_locus_tag="TGRD_320"
FT                   /product="replication-associated recombination protein
FT                   RarA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13803"
FT                   /db_xref="GOA:B1GZX1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX1"
FT                   /protein_id="BAG13803.1"
FT                   /translation="MKQTNFLENAANRKNKPLAARMAPSSFEEFTGQDNIVGDGKLLRR
FT                   SIEADNLGSVIFFGPPGTGKSALARIIALKTKAYFEEVNAVTTSTADIRKIIAAAEART
FT                   EMSGRKTILMLDEIHHFNRSQQDALLLDVEKGIITLIGITTENPFFYINAAIISRSTVF
FT                   EFQSLSKKALLYVMESALKDKENGLGSYKVKMSEEAREHLLVNACGDARKLLNALEIGV
FT                   LSAEVDGEGIRIFDIRAAQESMQKRAVLYDRSGDAHYDHISAFIKSMRGTDPDAAVYWM
FT                   AKMLAAGEDPRFIARRIIICASEDVGMADPGALTLAVSALNAVQFVGMPEARIILAQVA
FT                   IYVACAPKSNASYMAVEQALSEVKDGKARNVPSHLKDANLDSEKLGHGRGYKYPHDFEG
FT                   HYTQQEYWTDPVEFYVPTKEGCEEKIRERLLGIRKKKNKA"
FT   CDS_pept        481652..482251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_318"
FT                   /old_locus_tag="TGRD_321"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="MTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_321"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13804"
FT                   /db_xref="GOA:B1GZX2"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX2"
FT                   /protein_id="BAG13804.1"
FT                   /translation="MSGYLESEKRKIRHEFLALRNRMDADSAAVCSAGIFAGIKKLSAY
FT                   EKAKTVMFYLSYDSEVVTDFMINSAFGSGKIVVIPLIKNFIDEEMYAVKISRLEDACLS
FT                   VYGIRQPDINSVNINIVEKDNIDLVFVPGLAFDIKGHRTGYGKGCYDRWLKSVPFEKIV
FT                   GLAYDFQVTKQLPIGEYDIPVSIIVTEKRVIQIKEN"
FT   CDS_pept        482263..483819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_319"
FT                   /old_locus_tag="TGRD_322"
FT                   /product="ribonucrease Y"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_322"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13805"
FT                   /db_xref="GOA:B1GZX3"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZX3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13805.1"
FT                   /translation="MGNITVIVITAFVASIVGYILRLIYAKLNIRSVEQTSKRVIEEMK
FT                   LIAETKAKEIILDARLIVDRERKEFEHKIKERRQFIQNMENKLNQREESLDRKMDAVDK
FT                   KEKNLSEREKDFSSKEHLLSVKFSEVDKVKEEQKKFLERISGMTREEAKKILISGMEED
FT                   AKQCAAVLLQKLEQEMRENADKKSKEILSIAIQRVAADHTADITTSTIQISNDEIKGRI
FT                   IGREGRNIKAFEHATGVDLIVDDTPESITISAFDGIRRQIAKIALERLIADGRIHPARI
FT                   EEVVKKVKKDMEQHLKETGEQAVIEAGVPCSNLEIIKLLGKLKYRTSYGQSQLQHTLEV
FT                   TWLAGAIAGELGLDVMFCKKAALLHDIGKAVDHEVEGTHHQISANIAKKYGESHKMINA
FT                   ILSHHEGFEVPSSPEAFVIATADAISAARPGARKESVERYLKRLEKLEKVVKEFRGVSI
FT                   AYAMQAGREVRILVEPEKINDNQTQILAHDIAKKIEQELEYPGQIKITVVRETRVQEIA
FT                   K"
FT   CDS_pept        484326..485564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_320"
FT                   /old_locus_tag="TGRD_323"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_323"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13806"
FT                   /db_xref="GOA:B1GZX4"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX4"
FT                   /protein_id="BAG13806.1"
FT                   /translation="MSEDLEFNCGGNSGDGRLIYTVTQISDEIKLILEDSYPTVWIRGE
FT                   ISNFKLYNFGHIYFNIRDKNAQIRAVVFRNTGISLSFSPEDGMKVLVYGRVSSYPKRGD
FT                   YQVIVNRIERYGRGELYEAYEKLKEKLKAEGFFDESAKKPIPDIVSRIGIVTSQDGAAL
FT                   RDILKVIDSLNANVEILIYPVRVQGKEAEKEIPQAIEYLNSRHKDLDVLLVGRGGGAVE
FT                   DLWAFNTESVARAIFASEIPVVSCVGHEVDFTIADFVADMRAPTPSAAAEMVLRSRNYI
FT                   KTRIELLGESLSRAINFILGDRSAELDRLISSRALTKPRLIYEYKISYLDGLGSRLLKS
FT                   IGRLFESKSENLENVSRRLDIVSPLSVLKRGFSICFDSNNEIIKDSKNVNVGDDISIKF
FT                   ASCSLNAQVKSYE"
FT   CDS_pept        485557..485772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_321"
FT                   /old_locus_tag="TGRD_324"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_324"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13807"
FT                   /db_xref="GOA:B1GZX5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZX5"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13807.1"
FT                   /translation="MNKKQLNFEKSLKKLEEIVSEIENADPDLDKALALFAEGAELIKS
FT                   CLAKLNETKKKIEVIISSGKTEFFKE"
FT   CDS_pept        485784..486677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_322"
FT                   /old_locus_tag="TGRD_325"
FT                   /product="geranyltranstransferase/ geranylgeranyl
FT                   diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_325"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13808"
FT                   /db_xref="GOA:B1GZX6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX6"
FT                   /protein_id="BAG13808.1"
FT                   /translation="MKNIDFKKYILQKVEYINLVLKKFLPKDNSVVSQGMRYSVLAGGK
FT                   RLRPVLVILAAELFGVKAENVIPAACAIEYLHTYSLIHDDLPAMDNDDLRRGISANHKK
FT                   FGEAAAILCGDALLTESFSLITKSKSSEKNINEAVRILAYYGGYKGMIAGQTEDILETG
FT                   KWSKKNKILLGEKIKFIQIQKTAALMIASLKIGAVLAGADKEGLKALEVYGKNAGIAFQ
FT                   IVDDILDVYADKKLLGKEGSDAENGKLTVLSLCGKREAEKKAYEHIKKAKKAVSVFGNK
FT                   SEIFVYLLDYIADRTY"
FT   CDS_pept        487122..488966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_323"
FT                   /old_locus_tag="TGRD_326"
FT                   /product="1-deoxy-D-xylulose-5-phosphate (DXP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_326"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13809"
FT                   /db_xref="GOA:B1GZX7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX7"
FT                   /protein_id="BAG13809.1"
FT                   /translation="MKVLDSINNPQDLKKLKKENLIDLAKEIREEIINTVSKNGGHLAS
FT                   SLGVVDLSIAIHYVFDSPHDKIIWDVGHQSYAHKILTGRKSKFKTIRTHSGLSGFPKRS
FT                   ESEYDAFSVGHSSTSISAALGFAAARDLKNEDYKIVAVIGDGSMTCGLAFEGLQNAGHL
FT                   KKNMLVILNDNEMFISQKVGAVAGYLAKLLTAGMARKFEEKVMKTVSRFHGFGSPVGKF
FT                   IKRVKVMLFPGMFFEEMGFTYIGPVQGHNINNLIVILENLKDVKTPVLLHVITKKGKGY
FT                   APAEEDPVKFHSVGKFDIKSGRIAKGEAITYTKVFSDTLIELAQSDDKIVAVTAAMPEG
FT                   TGLDKFSEKFPDRYFDVGIAEGHAVTFAAAMAAGGMHPVCAIYSTFMQRAIDNIIHDVA
FT                   LQNLPVVFAVDRAGLVGEDGGTHHGAFDLSYLNYIPNLVVMSPSDENELRNMLKTALNS
FT                   NTPCVIRYPKGTGIGAALYKLPCCILQIGKATVLRQGRDICFLAVGNHVETCLKASDLL
FT                   LERNVNASVVNMRFLKPLDINTLKEMLLKTRKFITVEENALTGGFGETVKAFLCSSGAV
FT                   VECIGLPDKFIEHGSLRFLREKYGFTPESIVEKALQML"
FT   CDS_pept        489760..490512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_324"
FT                   /old_locus_tag="TGRD_327"
FT                   /product="predicted rRNA methyltransferase YqxC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_327"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13810"
FT                   /db_xref="GOA:B1GZX8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX8"
FT                   /protein_id="BAG13810.1"
FT                   /translation="MKKKKNKKRLDVLLFEKGFAETRTKAQAFIMSGNIFVNNQIQYRP
FT                   GTLVGKEDSIEVRNANPYVSRGGLKLESVLETLAIDLEGYICLDIGASTGGFTDCMLQK
FT                   GAIKVYAVDVGAGQLHYRLRQDKRVVNIENVNFRYFDNSFLKDNIDFTTIDVSFISLDK
FT                   ILPVAYRSISKNGFVLAMIKPQFELEASEIKKGVVRDKKLRQKAINKIKKVALDLGFKI
FT                   ISEADSCLKGLRGNLEHFIFLSKKHIFF"
FT   CDS_pept        490850..493306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_325"
FT                   /old_locus_tag="TGRD_328"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_328"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13811"
FT                   /db_xref="GOA:B1GZX9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZX9"
FT                   /protein_id="BAG13811.1"
FT                   /translation="MTDYNHSEIEKKWQKKWKGDRVFETKEQQGKEKYYCLVMLPYPSG
FT                   NLHMGHVRNYSIGDVFARFHKMTGKNVLHPMGWDAFGLPAENAAIKNKIHPAKWTKQNI
FT                   AHMREQLKVLGISYDWNREFATCTPEYYRWNQWFFIKMWERGLIFRKSANVNWCPSCNT
FT                   VLANEQVSKGLCWRCDSHTQQRDLEQWFIKITDYADELLEGHKQLCGWPEQVLSMQKDW
FT                   IGKSFGMEIEFAVTGTGKKLKIFTTRPDTLFGATFIVVAPEHKIIDEMKSQITNYNEIA
FT                   KYVIESGGKSNIERSSCKEKTGIRLEGINALNPAIGEEIPIFTADYVLAGYGTGAIMAV
FT                   PAHDQRDWEFAKKYNIPVIEVIKSSNSCDGNQSVDKDIYEDKGVLVNSRQFNGIKSSEA
FT                   FDIISEWVEKQDFGKKIINFKLKDWLISRRRYWGTPIPMIHCKICGTVPVPEKDLPVML
FT                   PEDAEFTGEGESPLKSSKTFVNVKCPKCGMDAKRETDTMDTFVDSSWYYARYCDNRNDN
FT                   AAFDSAKVNYWMPVNQYVGGIEHACMHLIYSRFWYKVMRDLGIVKHGEPFENLLTQGMV
FT                   TLSGSVMSKSKGNIVSPDEIIEKYGADTARLFTLFAAPPQKQLDWSMEGVEGCWRFINR
FT                   IWRLFDIVHTKTEFSATEKDKNDILRIMHRTIKKVTVDIEKEFQFNTAISSVMELVNAL
FT                   YTYKYHSNDDGISAEVYKTVILLMTPFTPHLCEEIWDRLGYKEYVSVYPWPSFDESTIK
FT                   QSSVELPVQINGKLRGKIIVSAEDSEDEVKKIIEKDKKIAVHLKGRQIAKFIYVKGRIV
FT                   TILLDS"
FT   CDS_pept        493322..493855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_326"
FT                   /old_locus_tag="TGRD_329"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_329"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13812"
FT                   /db_xref="GOA:B1GZY0"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY0"
FT                   /protein_id="BAG13812.1"
FT                   /translation="MKKFMLILALFILLSAYLISCSYLRSPAAVKILPEYIKKVYVKSF
FT                   NSTKQFDIEIEFTDVIKKEIIMDGRLSLADTEEEADVVFIAIIEKYSLQPLTYDENRMS
FT                   LRYKLSIKANILLSDKNKNVIWKNTNIERVHIYRDCIRDLYNGIIFYDGMSERKARSVV
FT                   FNKFSKYIVRQMAR"
FT   CDS_pept        494114..495103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_327"
FT                   /old_locus_tag="TGRD_330"
FT                   /product="peptide chain release factor 2"
FT                   /note="RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13813"
FT                   /db_xref="GOA:B1GZY1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY1"
FT                   /protein_id="BAG13813.1"
FT                   /translation="MEPDFWNDQNKAKKTMAELDDLKNVCRLWYDMSREVKDLIDLSML
FT                   ATDENDEKLLKDVEDGSKKLEKELSVFEVRTKLGGEHDKNNAIISIHAGAGGTESCDWA
FT                   QILLRMYSRWAEDKGFKTEVVDSLDGDEAGIKNITMIIRGEYAYGFLQSEIGVHRLVRI
FT                   SPFDSNKRRHTSFSSVDVIPEVEDSIDIIIEDKDIRIDTYRASGAGGQHINKTDSAVRI
FT                   THLATEITVQSQNDRSQIKNRTTAMKLLKARLYELEQEKQRASYEKHYNEKGAIEWSSQ
FT                   IRSYVFMPYQLVKDHRTGYKTLRMDLVMDGDIDDFISAYLSWKLEKKK"
FT   CDS_pept        495237..495857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_328"
FT                   /old_locus_tag="TGRD_331"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_331"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13814"
FT                   /db_xref="GOA:B1GZY2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY2"
FT                   /protein_id="BAG13814.1"
FT                   /translation="MRIVKEGYQFIIVPLILGLVFLIAGRGIILIAMVTLCVLVSLFCL
FT                   YFFRDPEIEITRGDNLILSPCNGMVLEVSENETEKVIRVFLSVLDVHLQRSPVPGKVKS
FT                   VEYKSGKFLKAIEPQAHIVNEQNIITIENESGKYLVKQIAGILARRCVSWVKPGDVLKP
FT                   GDKIGMIKFSSQVDLHIPRNTDIKVSRGDKVVSGVTIFATLNK"
FT   CDS_pept        495867..496670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_329"
FT                   /old_locus_tag="TGRD_332"
FT                   /product="phosphatidylserine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_332"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13815"
FT                   /db_xref="GOA:B1GZY3"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY3"
FT                   /protein_id="BAG13815.1"
FT                   /translation="MSENLKKGIYIIPSLFTCGNISCGCLSIISSINGNFTKSSWLLIF
FT                   AIAFDMMDGRIARLTKTTSEFGVQLDSLSDLTSFGIAPAVMMYQLVLTSMGKIGKSIFV
FT                   LFILCSALRLAKFNVKANAKKVHSSFMGLPTPASAGLLISFVLSYELFIVDPGQSLTFN
FT                   TIPILMKNMPAFFKTMPVIMVLLSLLMVSNIPYVSFKKMEFSSPKVFRLLILMVLFVWL
FT                   IATFPQNIIFILFTLYAFSGIFAYATKYWKILKRIYSSKVENNGN"
FT   CDS_pept        496660..497172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_330"
FT                   /old_locus_tag="TGRD_333"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_333"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13816"
FT                   /db_xref="GOA:B1GZY4"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY4"
FT                   /protein_id="BAG13816.1"
FT                   /translation="MEIEQLLILVKPDGIKKSLTGNILTKLSESRMVIIGAKIVKVSRD
FT                   LAEAHYCHLKDKLFFNELLDYIRGKIYGEPWDRVLAFVYQGEDAVSRMRKIAGATNPEE
FT                   ADHVSIRGSYGRITTKGVYENVIHCSSDPSEAAREIKLWFKPEEIVKEIYPVKKIVVEK
FT                   EEKIVWA"
FT   CDS_pept        497297..499066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_331"
FT                   /old_locus_tag="TGRD_334"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /note="PEPCK"
FT                   /note="GTP"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_334"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13817"
FT                   /db_xref="GOA:B1GZY5"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY5"
FT                   /protein_id="BAG13817.1"
FT                   /translation="MATPIELFIEEMQKLFQPDEVYIMDGSQEEAEKLANIAQKSKVDG
FT                   KIVLEKLNEKEYPNSYYHRSNTNDVARTEHLTFVCTPSKTEAGPNNNWMDPVEAKEKMM
FT                   GFFKGAMKGRTMYVIPFVMGPPKSKYAKNCIQVTDSVYVALSMRIMARVGKQAVERIGS
FT                   SSDFFRGVHSIGDVNPDRRFIMHFPQENLVMSFGSGYGGNALLGKKCYSLRIGSYLGYQ
FT                   EGWLAEHMIIIGVEVPDGKVIYFLGAFPSACGKTNLALLEPVLKGYKVWTLGDDIAWIN
FT                   VGEDGRLYAINPEAGFFGVAPGTGLKTNPIMIKTLKNDKFFPTLFTNTAVDNSDNTPWW
FT                   EGASDEIPSDLTNWQGQKYDKNLDKAAAHPNSRFTVSIYNCPTLSPEYNNPKGVPISGI
FT                   IFGGRRKDTIPLVYEAKDWNSGVFTASIIGSETTAASSGQVGNVRRDPMAMLPFCGYNM
FT                   GEYFQHWINIGKKVKKLPKIFMVNWFRKDENGKFMWPGFRDNSRIIKWMIYRIEGKTGA
FT                   KESEIGLFPEENAIDLSGLDIKKETMEKLLKVDKQDWKREVAMIEEFYAKFGDKIPRDL
FT                   RKHLTELKKKLGL"
FT   CDS_pept        499163..499398
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_69"
FT                   /note="pseudogene of ADP-ribose pyrophosphatase"
FT                   /pseudogene="unitary"
FT   CDS_pept        499493..501247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_332"
FT                   /old_locus_tag="TGRD_335"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_335"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13818"
FT                   /db_xref="GOA:B1GZY6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZY6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13818.1"
FT                   /translation="MKRSGYCGDIRESSIGKEIAVCGWVHSRRDHGGVIFIDLRDREGI
FT                   LQIVFQPENKEIFEAAEKLRSEYVIAVKGWVRNRPFGTLNTNMSTGNVELVAVELKILN
FT                   TSPGLPFEISDYIDTSEELRLKYRYLDLRRPNLQKNFVMRHKISKEIRNFLNEEGFLEI
FT                   ETPFLTKSTPEGARDFLVPSRLHHGNFFALPQSPQLFKQILMSAGFDKYYQIVRCFRDE
FT                   DLRADRQPEFTQVDVEMSFVDEEDVMVVIERMLARVFKMTLNLDIKMPFERMPYSEAML
FT                   RFGSDKPDTRFEVEIKDFSRELKNSGFSVFSSVISKGGIVRGLCIPKGASFSRSEIAGL
FT                   TKFVGEYGAKGLVWMKITDTGADSNIVKYFKEYEIRVFISKLNAKSGDLIVFLADEEKT
FT                   VAQGLGALRLKVGRESGLIDKNKFNFLWVVDFPLMEWDKEEQRWQALHHPFTLPKDADS
FT                   LTKENAGRAKAKAYDVVLNGIELGGGSIRIHKSGIQKKIFNILDISDESAEKKFGFLLK
FT                   ALTYGAPPHGGAALGFDRLCALISGEDSIREVIAFPKTQKAVDPLSNAPAAVSDNHLKE
FT                   LGLQQIEN"
FT   CDS_pept        501392..502852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_333"
FT                   /old_locus_tag="TGRD_336"
FT                   /product="cyclic-di-AMP phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_336"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13819"
FT                   /db_xref="GOA:B1GZY7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZY7"
FT                   /protein_id="BAG13819.1"
FT                   /translation="MNNPLEKIRFWIIDILIKSARKLEAKRPKNPVVRNPKNLFSKEIK
FT                   IPVFISSGFTIIAIYCMFVMGFAVNCKTMLATSIFITGSAVFFIIYVKNREKIILKDRD
FT                   TVVLICLLFIIAVLIFQILIEYISPFVSPVSAFALMSAMLLSPRFGTMHAVFLSLFMGF
FT                   LNVMRFDIFFLMLCGSIIALADLHNIRRRSDFISTGIKIAVVNTAIISMFYFFGSYNIL
FT                   EFERNIFYGLLNSAFAVIILLVFMPLFEKLFSRTTSMKLIELSDFDNPLLKRLMLEAPG
FT                   TYHHSVMTADIAEQAANVINDNSLLARVGAYYHDIGKLKNPQYFIENQTSGYNPHDELT
FT                   PAMSNLILVSHVKDGVTLAKKYNVDNEIINIIGQHHGTTLIHTFYHRALEESPDIDIEN
FT                   FKYPGPKPATKIAAIVMISDSSEAACRSIEEPTAARIKDTVEKIINNKFIDGQFSNCPI
FT                   TLKDLETIRDSIISTIIGIYHIRIEYKE"
FT   CDS_pept        502849..503274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_334"
FT                   /old_locus_tag="TGRD_337"
FT                   /product="16S rRNA maturation endoribonuclease YbeY"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_337"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13820"
FT                   /db_xref="GOA:B1GZY8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZY8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13820.1"
FT                   /translation="MKKDNNIINFVNFPKQHVPLLKIAAATVLKSEKIKRYQVNFIMVD
FT                   DKEIRKLNTKYRKIKRITDVISFLVVPEFFMGDIYISKTRSQEQAKEYSNTWQQELAYL
FT                   VIHGLLHLCGYTDYDAVNKTKMFTKQDKIFKCLFYRL"
FT   CDS_pept        503253..503954
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_70"
FT                   /note="pseudogene of putative HlyC/CorC family transporter"
FT                   /pseudogene="unitary"
FT   CDS_pept        503971..504687
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_71"
FT                   /note="pseudogene of putative HlyC/CorC family transporter"
FT                   /pseudogene="unitary"
FT   CDS_pept        504712..505405
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_72"
FT                   /note="pseudogene of recombinational DNA repair protein
FT                   RecO"
FT                   /pseudogene="unitary"
FT   CDS_pept        505642..506722
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_73"
FT                   /note="pseudogene of ammonium transporter AmtB"
FT                   /pseudogene="unitary"
FT   CDS_pept        506826..507166
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_74"
FT                   /note="pseudogene of regulatory protein P-II for glutamine
FT                   synthetase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(507274..508344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_335"
FT                   /old_locus_tag="TGRD_338"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_338"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13821"
FT                   /db_xref="GOA:B1GZY9"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZY9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13821.2"
FT                   /translation="MKILIGLSGGVDSAVAAYLLKKQGYEVTGTTMSIWDNFLPAPKTK
FT                   VNDSCLGPENENIETAHKIADFLTIPLYVTDCSGEYKKVVLENFRNEYKEGRTPNPCIR
FT                   CNAYIKFGILPAAVKKTGLSFDKFATGHYANIGFDSSTNMYKLYKAADLNKDQTYFLYR
FT                   LTQKTLSETIFPLGIYTKEQVRNIAKKIGLPSAEKPDSQDFYCGDYNDILQFPANPGNI
FT                   VDKNGRVLGKHNGIWNYTIGKRKGLGLLGGTKDPLYVINISAKQNMVTIGTKEDLYSSS
FT                   LTAKKVSWCSILPPKKTIEATAKIRRQHKPEKAFIIPQEDSSVKVEFAQPQMSVTAGQS
FT                   IVFYKDDTVLGGGVII"
FT   CDS_pept        complement(508428..508912)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_75"
FT                   /note="pseudogene of [FeFe] hydrogenase H-cluster radical
FT                   SAM maturase HydE"
FT                   /pseudogene="unitary"
FT   CDS_pept        509054..509507
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_76"
FT                   /note="pseudogene of PIG-L domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        509615..510398
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_77"
FT                   /note="pseudogene of LPS core biosynthesis
FT                   glycosyltransferase KdtX"
FT                   /pseudogene="unitary"
FT   CDS_pept        510395..511350
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_78"
FT                   /note="pseudogene of tetraacyldisaccharide 4'-kinase"
FT                   /pseudogene="unitary"
FT   CDS_pept        511366..511839
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_79"
FT                   /note="pseudogene of D,D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /pseudogene="unitary"
FT   CDS_pept        511912..512312
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_80"
FT                   /note="pseudogene of DUF3108-domain lipoprotein"
FT                   /pseudogene="unitary"
FT   CDS_pept        513423..514172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_336"
FT                   /old_locus_tag="TGRD_340"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13823"
FT                   /db_xref="GOA:B1GZZ1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GZZ1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13823.1"
FT                   /translation="MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQLKK
FT                   DGFTFDLAYTSVLKRAIKTLWNVLNTMDLLWTPVVKDWRLNERHYGALQGLNKAETAAK
FT                   YGEEQVKIWRRSYDIAPMALDENDERYPGKEARYSGLLKGEIPLAECLKDTVARVVPYW
FT                   GKEVVPQIKAGKKIIIAAHGNSLRALVKYLDNISDSNIVNLNIPTAMPLVYELDENLKA
FT                   VKNYYLGDPEAVKKAMETVASQGKVKK"
FT   CDS_pept        514204..515844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_337"
FT                   /old_locus_tag="TGRD_341"
FT                   /product="metallo-protease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_341"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13824"
FT                   /db_xref="GOA:B1GZZ2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ2"
FT                   /protein_id="BAG13824.1"
FT                   /translation="MIRKFKLLLRNNKILLIIVSIVLILIVLSIWGLSKLESFYRIMTI
FT                   AMLPVNLLVSFTNAAAFVFMYVLFSRSGFEKLKKNKIKAGDIAVSFKEVIGLESAKREA
FT                   FEVVQLIKDRKQLQKIGGKIIKGILLIGPPGCGKTLLAKAIATECKVPFLSMAGSEFVE
FT                   VFVGVGASRVRNLFKKAREYAYAEGACIIFIDEIEVIGRGRSFSYMGGGEEINSTQNQL
FT                   LVEMDGLDNKKSNVIVIAATNADDSVLDKALLRPGRFDRKIAITLPNLKERERLFGFYL
FT                   KKVKVVPEVKVCRLAKKAVYKSPADIENIIKEAALIAVRKKKEVIDIKDLSEAMDRIDL
FT                   GMETYIDMTPKELGMTAYHEAGHAVAIYLMHPTDDVFKVTVKSHHGSLGLVAPFPKEEL
FT                   QIEQREELLSDIMVSLAGYVAEKIKYNTTTTGVSMDFSHAMTTANNMVWKVGMGNGGFV
FT                   GDFSVIPRKEMSQSLKEKLNNETISIINSCYAKIEEFLKTNWDAVDAVAKKLISEKELD
FT                   FDELEEVMKTVGKRKPKPSEYNALVGCAE"
FT   CDS_pept        515866..516609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_338"
FT                   /old_locus_tag="TGRD_342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_342"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13825"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ3"
FT                   /protein_id="BAG13825.1"
FT                   /translation="MLKYIIFLLVIVFFFNDCSVSYPKNYIVRSLEKLVKKECNQDSKA
FT                   YLVGRTLYLDMEFDEITSADDKTALQAIRKMNLAIFTAGRIVLSSDSDIKYIVVTTYDS
FT                   YKNLAFRIAHNIDDIKNYFYMRISHSNFNSRKLLEIEGPLTAANMIEDRHCIADQEYIG
FT                   RLIVSQINMLFAADVVLVQMPRLQYVAVENETLIFSVSDIVDSKNIYLVKNILLEKTKD
FT                   YSKKYNIYFKGIKVVAFGGEALLID"
FT   CDS_pept        516654..517183
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_81"
FT                   /note="pseudogene of HTH-XRE domain transcriptional
FT                   regulator"
FT                   /pseudogene="unitary"
FT   CDS_pept        517341..518888
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_82"
FT                   /note="pseudogene of acetyl-coenzyme A synthetase"
FT                   /pseudogene="unitary"
FT   CDS_pept        518918..519919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_339"
FT                   /old_locus_tag="TGRD_343"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_343"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13826"
FT                   /db_xref="GOA:B1GZZ4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ4"
FT                   /protein_id="BAG13826.1"
FT                   /translation="MNIRERILELAKKTKSKIILPESFDIRILKAAQILTKDGIASVIL
FT                   LAEDIKEVEKIASAVGVDLNAVEIIKIDINLLNKKKVEEFVDARMKKGMTLQDASDLLK
FT                   KPLYFSMMYLKSGKCDACVAGAVYDTSDVLRASIQVAGFTECTKLVSSYFLMIPPDGHN
FT                   IAKEPVLFADCGVNPDPQVLGLKDIAVATVENFKKLFPGRQVNVAMLSFSTKGSANSKV
FT                   LSKVIEATELVKSHFAGYSDINVDGEFQFDAAVVQSVGKKKASGSSVAGNANILIFPDL
FT                   NAGNIGYKIAERYGGFQALGPIIQGLALPISDLSRGSSVDDICLICAIMLLK"
FT   CDS_pept        complement(520242..521066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_340"
FT                   /old_locus_tag="TGRD_344"
FT                   /product="metallo-beta-lactamase superfamily 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_344"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13827"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ5"
FT                   /protein_id="BAG13827.1"
FT                   /translation="MSLNFCILASGSSGNCSVIWTEKATALIDCGCSAKYIIENLGALG
FT                   IVPQNLTAALITHAHRDHISTSGLGFLHKNNIPVYLHEDAFEDAFRKYGQKIEECASIP
FT                   LYENFKIKDIFVESFEVYHKDENVSRTFGFTFSSEINARKYKIGYVTDTGRICRKIIRN
FT                   LIDSNILVLESNYNRMMLDSSFRSYDNKKWVLSDWGHLANEDAASAIAEIKMLSAGRDS
FT                   LKYVFLAHISSHHNTPEIALKTTKEILISKGISDIKLFTARRKHRCPVIRIR"
FT   CDS_pept        complement(521063..522112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_341"
FT                   /old_locus_tag="TGRD_345"
FT                   /product="putative peptidase M42 family cytoplasmic
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13828"
FT                   /db_xref="GOA:B1GZZ6"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ6"
FT                   /protein_id="BAG13828.1"
FT                   /translation="MEKLLKDLLISDGISGYEENVAKIMTAALSKSCESVEIDNFGNVI
FT                   GKSGRGKKKIMIAAHMDEIGMTVKHINEKGFIYFIKIGGINDSILPGKTVEIINKKGEH
FT                   ITGIIGTKPPHLMTSEDVKQPLKHDSMFIDIGLSSRNEVLKVADIGDQIIFEPVAGILN
FT                   GNFYYGKAADNRISCYTMVKVMEMLAKLRDLNAEIYACATVQEEVGLKGGKTSSFKVNP
FT                   DFALIIDTTVAGDMPGIEEKVSALKLGKGVAITMIEASGRGTIVPQKVRKLMLEAAHEN
FT                   NIPHQIDIIDVGMTDGAVIYTNREGILTGILSIPTRYIHAPTSVFNIKDVNSAVDLAVK
FT                   TIEKAAGKL"
FT   CDS_pept        complement(522310..523551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_342"
FT                   /old_locus_tag="TGRD_346"
FT                   /product="peptidase M48 family"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_346"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13829"
FT                   /db_xref="GOA:B1GZZ7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR027057"
FT                   /db_xref="InterPro:IPR032456"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ7"
FT                   /protein_id="BAG13829.1"
FT                   /translation="MNIYTLIMLFFIIAVYLVETAANLLNVKNISNNIPPEFDGYFDRE
FT                   KYSKAQEYLKANTKLSVISSTFFLTAQIIFIVLKGFNYVNTIAVSFSFGTILTGLVFAG
FT                   IVFSAFEILKIPFSVYSVFIIEENFGFNKMNVKTFISDLLKSWIITAIIGAVIFAAILW
FT                   LFANVYRYAWLYAFAAIVIFELFITFIAPVTIMPLFNKYTSLEDGELKNSIEEYAKKEN
FT                   FKMKGLFKMDGSKRSTKSNAFFTGFGKFRRIVLFDTLIQKHTVDGLTSILAHEMGHFKL
FT                   GHIVKHIIFSSALSGIMLFIFSLLIDKAWLYDAFFMRTQDIYAGIIFFSFLYAPVSLII
FT                   SPILSYFSRKHEYEADLYSITTYRKPQAMINALKKLSVDNMSNLYPHKFKVFLEYSHPP
FT                   VLERIKAINRIKLG"
FT   CDS_pept        523730..524365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_343"
FT                   /old_locus_tag="TGRD_347"
FT                   /product="thymidylate (dTMP) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_347"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13830"
FT                   /db_xref="GOA:B1GZZ8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ8"
FT                   /protein_id="BAG13830.1"
FT                   /translation="MKKNLFITFEGGEGSGKTTHSLLLKKYLEKRGYEVLLTREPGGTI
FT                   LAEAVRRILLNPDSNIVPLSELFLYEAARAQHVEEFVFPALNAGKAVICDRFTDATVAY
FT                   QGYGRKLNLQLIDSLNSTTSFGLTPVLTIYLDILPSEGLSRAKRAKKLNRKIYSDKIER
FT                   ESLQFHESVREGYLSQAEKYPERIKVVKTQETVEKTEVCIREIIDLVL"
FT   CDS_pept        524366..525325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_344"
FT                   /old_locus_tag="TGRD_348"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_348"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13831"
FT                   /db_xref="GOA:B1GZZ9"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZZ9"
FT                   /protein_id="BAG13831.1"
FT                   /translation="MFESILGQKKIKKIISNQVKSGKIAHAYIFVGQDGVGKRLTAVEF
FT                   AKILNCNVDDFIKTDAGTCGKCISCKKIEKNIHPDLHFIDFARQAELEEECLEKQRTLK
FT                   IETIRYMQKEVATKIHEGKWKIFIIEPAERMNAAAANSLLKTLEEPPENTIIILIAKHK
FT                   ETIPQTILSRVQTLFFQPLGQNEISSWLMLNCSVDAAKARDIAELSEGSLENAKKLVGK
FT                   NEKEEFSLWLKFKTRNFYISDILELSKNIAAAGALECVDAMIAEAKKDFRMYPQRTAPA
FT                   LDLLSASRVLLLKNVNAMTVLDNLFFDLSDLKKMSGLL"
FT   CDS_pept        525369..526175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_345"
FT                   /old_locus_tag="TGRD_349"
FT                   /product="conserved PSP1 homolog protein"
FT                   /note="COG1774"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_349"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13832"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B1H000"
FT                   /protein_id="BAG13832.1"
FT                   /translation="MPMVIGVALRKTKDKIYADVGYFDLKLNDKIILETEHGVEVGTVC
FT                   EKEKVMQESKDPIGKVLREITEEDKKRLTENERKNLRAWNIVLQKVVKYKLDMKLICVQ
FT                   YIFDRSKLFVYYISGTRVDFRELVKELGRILRTRIQMVQIGVRDESKMVGGIGICGHVL
FT                   CCQTFLKDFSSVTIDMAKEQDLLLNTAKLSGLCGRLMCCISYENDIYRAVKKELPEIGK
FT                   TVLTPEGRAKITAIDCIRENVTVDFGDKSFKVFSIKQINESSRKGK"
FT   CDS_pept        526176..527714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_346"
FT                   /old_locus_tag="TGRD_350"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13833"
FT                   /db_xref="GOA:B1H001"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:B1H001"
FT                   /protein_id="BAG13833.1"
FT                   /translation="MKFYITTPIYYANDIPHIGHSYTTIASDIMARWKRLKGFDVFFLT
FT                   GTDEHGAKIVAAAKKKGEIPQKLCDKMSAKFKEAWELLNISYTDFIRTTERKHFVSVEK
FT                   ILSILFDKGFIFKKKYEELYCIGCERFYAQKDLDENGCCPFHKTKPVLQSEENYFFRLS
FT                   SFQNALIDRIVDANHREHIEIQPEERRNEIIGKLKLGLEDVSFSRSAVEWGIPLPFDGG
FT                   QTAYVWVDALINYITGVGYQENETKFQKYWPADIHLMAKDILWFHSVIWPAILMGAGLP
FT                   LPKKLYSHGFFTLNGNKMSKSLGNVVSPRELVDKYGVDAARYLAATIIPFGPDGDISWQ
FT                   RLTLKYNTDLANNLGNLISRTLKMAEKYFNLYVPQTIPDLELVRKVVTVLKKKFALNMD
FT                   NMQFHKAAETLQSAITLVNRQIEIDAPWKLAKTDTDKLASCIYAYLQSADIIIMHLLPF
FT                   MPTMAEKIWQITGAGCDINLTAKKYFKDAVIPENGFSISNAKLQSPGILFPRIA"
FT   CDS_pept        527848..530411
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_83"
FT                   /note="pseudogene of putative helicase/methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        530425..531189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_347"
FT                   /old_locus_tag="TGRD_351"
FT                   /product="TatD family deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_351"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13834"
FT                   /db_xref="GOA:B1H002"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B1H002"
FT                   /protein_id="BAG13834.1"
FT                   /translation="MIIDTHAHMSDSRFDNDREIVIQKAFDCGIEKIFEIACEMRYWDR
FT                   ALELSKRDNIFLSVGVHPIETTKATREDYYKLQVLIQDKKCIAIGEIGLDYHYDSSLQN
FT                   TNTQKESFFKQIDIAVKYNKAVIIHCRDAYDEMIDFFKKYKNVPKGVIHCFSGTPKQAK
FT                   MFIEMGFLLGINGPVTYKKSDNLKQVVFETDLNKLLVETDCPYLAPQKYRGQRNEPSYI
FT                   AETLKEIATIKNILINEVVQITTQNALKLFGI"
FT   CDS_pept        531448..532047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_348"
FT                   /old_locus_tag="TGRD_352"
FT                   /product="TatD-associated radical SAM protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_352"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13835"
FT                   /db_xref="GOA:B1H003"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023821"
FT                   /db_xref="UniProtKB/TrEMBL:B1H003"
FT                   /protein_id="BAG13835.2"
FT                   /translation="MNTVSYVFGDNLYLNITNRCMMACPYCIKHKWANKFKGNDLKLEK
FT                   EPSCEEVIEAIGDPKKYNEVIFCGYGDSLINLESVKEISKWIKENSGKVRINTAGLANR
FT                   YYGKNILPELKGLVEVISISLNGSNPKEHNELNHPMFKEESFNEIIKFAEEAKNHIPEV
FT                   VITAVEFPGFDISKVEKIAKEVCVRFKMRPYLNNEY"
FT   CDS_pept        532037..532870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_349"
FT                   /old_locus_tag="TGRD_353"
FT                   /product="3D-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_353"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13836"
FT                   /db_xref="GOA:B1H004"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="UniProtKB/TrEMBL:B1H004"
FT                   /protein_id="BAG13836.1"
FT                   /translation="MNIRFFVNILKLSFIALGILVLASIFSAITLMFTRAYINTGEKTY
FT                   TVKPYKNISLKTVLDKNGIFLNDDDIVSHDISKPIKPLQTVKIIHVTKEQKKIIENTPF
FT                   KVTWSRKYNSNLRKVELQKGKEKNIIKTINKISYNGILYNTNVVNEQTMEREYSRLVLF
FT                   KANNAIEKVYDLSKAKKIKMVATAYYPGDPLAWKDGTITFLGQKMQRGIVAVDPNVIPL
FT                   KTRLFIPGYGYGYAGDKGSLIRGKRIDLGVNNAKEEKSWRFKDVNVYILEKSDKY"
FT   tRNA            complement(533054..533139)
FT                   /locus_tag="TGRD_tRNA24"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUG"
FT   CDS_pept        complement(533294..533749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_350"
FT                   /old_locus_tag="TGRD_354"
FT                   /product="N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_354"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13837"
FT                   /db_xref="GOA:B1H005"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1H005"
FT                   /protein_id="BAG13837.1"
FT                   /translation="MNIRPARVMDVKEIHKLVEYHANNKEMLHRSLSAIYENIQEFVVL
FT                   ESEDNIVGCGALHVSWENLAEIKALAVSDKYKGQGFGRKIVKILQDNAKNLGVSRVFAL
FT                   SFKPKFFIKLGYEIIPKETLPHKIWSECINCHLFSECGEVPLLITLK"
FT   CDS_pept        complement(533897..534469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_351"
FT                   /old_locus_tag="TGRD_355"
FT                   /product="2-oxoglutarate synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_355"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13838"
FT                   /db_xref="GOA:B1H006"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B1H006"
FT                   /protein_id="BAG13838.1"
FT                   /translation="MQNEIVIAGFGGQGVLLAGTLIAQAAIEQGLHTTWFPSYGAEMRG
FT                   GTANSTVVVSSDEIGSPLAFNPDTLIALNEPSLNKFISRVIDNAIVIANSSIIPQNMEY
FT                   KVKPYFIPVTDIADKEIKNLRTANTVAVGTLIRILELHRFNIQQNTDEKGITLKSVLSA
FT                   CEKIFASKPQLIETNKKAIQAGYDFIK"
FT   CDS_pept        534657..535694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_352"
FT                   /old_locus_tag="TGRD_356"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_356"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13839"
FT                   /db_xref="GOA:B1H007"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1H007"
FT                   /protein_id="BAG13839.1"
FT                   /translation="MRHTALEVLKERKTKILNAVIHHYIRIGKPVGSDVLTKEYNISLS
FT                   PATVRNLMAELEEDGYLTHPHTSSGRIPTDKGYRSYVDSLVKLQSYAIEEEERIKREYE
FT                   GKHNEIEDILSETSRILSGLSQYTGFVMTPKAQYDKIKNIELVQISEEELLVILLTQSG
FT                   MVKHKKVKAYLAYVQLGKLRIFLNEKLRGISIAQVNRKIISEIKDFRRNESEILKIAEK
FT                   ISYVFYNIQDDIYIDGTSNVVAASDFSDFEPVKLLIKFNEDKEKFIEIINKDFNNGGIN
FT                   VKIGSENTLDGLKDLSMITTTYKNRERAVGVLGIIGPKRMEYEKMMLLVNRISEMLNRF
FT                   FKEMS"
FT   CDS_pept        535770..536342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_353"
FT                   /old_locus_tag="TGRD_357"
FT                   /product="chaperone protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_357"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13840"
FT                   /db_xref="GOA:B1H008"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B1H008"
FT                   /protein_id="BAG13840.1"
FT                   /translation="MENKKQRILIEQEIHDCNYNKARDEKICELEILKQSIEEKKKQAQ
FT                   DYYDQLLRLKADFENYIRRSEKEKKDYLEWGKEKILLKQISIDDVLRQALKSAKLGNNI
FT                   ESIVLGLEMISKEFSKMLKEEGVKEIECDKFDPNICEALEYIGSEEEDGKILEVYQKGY
FT                   KMNEKLIRAAKVKVAKNNKENIVGNEK"
FT   CDS_pept        536450..538315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_354"
FT                   /old_locus_tag="TGRD_358"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_358"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13841"
FT                   /db_xref="GOA:B1H009"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H009"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13841.1"
FT                   /translation="MAKIIGIDLGTSNSAAAVMEGGKTTLIPSAEGTTLGGKAFPSYVA
FT                   FTKDGQLLVGEPARRQAVTNPEGTINAFKRKMGTNYKYKVNGKEFTPQQLSAFILQKIK
FT                   KDSEAYLGETITKAVITVPAYFNDDQRQATKDAGAIAGLEVVRLVNEPTAASLAYGIDK
FT                   VGKEQKILVFDLGGGTLDVTIMEMGAEGTFEVLSTSGDTQLGGTDMDNALIDYIAEDFK
FT                   KTNGIDLRNDKMAVQRLKEAAEKAKIELSNVLETDINLPFITADASGPKHLAMKFTRAT
FT                   LENLVRHIVERCKASIDQAVKDAKLTAETVTKIILVGGPTRMPIVQKFAEDHVGKKAER
FT                   GIDPMECVCFGAAVQAAVLTGDVKDILLLDVTPLTLGLETMGGVRTSLIDRNTTVPAKR
FT                   SQVFSTAADNQPSVEINVLQGERAMAKDNLSLGRFMLDGIPPAPRGVPQIEVTFDIDAN
FT                   GILHVSAKDKGTGKEQSIKISSSTKLSKDDIDKYVKEAEQYASEDVKRKEEIEVRNEAD
FT                   NLIYSVEKSLKDHGDKVSADERLIIEQSLTAAKDALKGSDVATIKSAKEALTTASHKLA
FT                   EVVYKASQVQDTQGAAQGQSQGNPQQTADNRGKVVDAEIVDENKE"
FT   CDS_pept        539075..540226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_355"
FT                   /old_locus_tag="TGRD_359"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_359"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13842"
FT                   /db_xref="GOA:B1H010"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B1H010"
FT                   /protein_id="BAG13842.1"
FT                   /translation="MKRDYYEVLEVSKTASVDEIKSAYRKLALKYHPDKNQGDKEAEEK
FT                   FKEINEAYEMLSDVQKRQQYDTFGHDAAGGMPDGRNPFGGKGSYTQYSGDFSSVGDIFG
FT                   DIFGDIFSGGSSRAKNRASQRRGEDLRYDVEVSYLDAMKGTKISIDIPKKEICFVCRGT
FT                   GSKDGSVPKQCPQCKGKGQVKYSQGFFSFSQECSQCKGNGIIINNPCPECRGEGTANKR
FT                   KPIKVRVPAGVDEGTSLKIAGSGNAGSNGSLSGDLYVIVHMKQTAGFERNGDDLYTEIS
FT                   VSFSQAAMGIEYEVPVIEGHIKVKIPPSTQPGTILRVRKQGFPKLGRKNKGDLYVKINI
FT                   SVPKSMNDEQKLALFEYAKSMGEVPKDSKYQSDNFFSKIFGNK"
FT   CDS_pept        540661..541023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_356"
FT                   /old_locus_tag="TGRD_360"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13843"
FT                   /db_xref="GOA:B1H011"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B1H011"
FT                   /protein_id="BAG13843.1"
FT                   /translation="MNYESIFIISPEVPAEKIEELTTKAVKIIEDSKGTFKMSQQFGKK
FT                   RFAYPINKLREGSYVYTEFSGNGETVNALESFFKFNDLIVRFLTVKIEKKKVVAKKTAK
FT                   SEPQAAKTTNDKGEIK"
FT   CDS_pept        541020..541487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_357"
FT                   /old_locus_tag="TGRD_361"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_361"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13844"
FT                   /db_xref="GOA:B1H012"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B1H012"
FT                   /protein_id="BAG13844.1"
FT                   /translation="MSQEQNSFRLPEQNSVIIVGRLTRDPELRRTVTGKAICSFDIAIS
FT                   GRMKDPVTGDWKDAEPTFVPIIVWNNQAERCGERLKKGLPVYVEGRLKTNKWEGKDGIK
FT                   RSRLEVVASRVQFLFTIKQESSAIDAKPIDSINELQEQSDNTVDDDENIPF"
FT   CDS_pept        541506..541808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_358"
FT                   /old_locus_tag="TGRD_362"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_362"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13845"
FT                   /db_xref="GOA:B1H013"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H013"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13845.1"
FT                   /translation="MTFIRKPAGQAKPQKYSTDAYGRPAGKFRRNGPIRKKVCRFCADK
FT                   VEIDYKNLSLLHTFVTEKGKILSGRMTGTCAKHQRELDTAIKRARMIALLPFTVN"
FT   CDS_pept        541848..542297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_359"
FT                   /old_locus_tag="TGRD_363"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_363"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13846"
FT                   /db_xref="GOA:B1H014"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H014"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13846.1"
FT                   /translation="MKVILKSDIANVGRQGEIKEVSAGFARNYLIPQSLVMEANDLNLK
FT                   IWKRERGILEKHREEIINSAREIAFKMEASKFTAKVKIGENGKIFGSITTATLVKIFED
FT                   NGFKVNKRDIILSDNIKEIGDHEISVRFHPEVVAKIKLSVINEKE"
FT   CDS_pept        542327..543697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_360"
FT                   /old_locus_tag="TGRD_364"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_364"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13847"
FT                   /db_xref="GOA:B1H015"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B1H015"
FT                   /protein_id="BAG13847.1"
FT                   /translation="MANIIEKVSPQAVDVEMSVLGAMLIEKEAILKVMDIINENDFYKE
FT                   IHRQIFLVINDLYIGNHPVDLLIVSEALKKNAMFSKVGGTRYLTELIDSVHTAANAEHY
FT                   ASIIRDKSISRQLINIGSAMISNAFNEQNTPDEILDKFQAALFNVSQQKGRKGFSSVSK
FT                   LVRPMLQKLEKLHSNPKEISGLSTGFADFDSKTTGFHPSELVIIAARPSMGKTAFALNI
FT                   AEHVAVVKKNPVAIFSLEMKQEALMIRFLASLARVNIGRLRNGQYNSTDWPRLTGAAEK
FT                   IAGAPIFIDDDSNISVIELRIRARKLATELKTRGERLALIIIDYIQFIHGSGRKFESRQ
FT                   QEVSDISRSLKALAKDLDVPVVVLSQLSRRTEDRGRKDNKPQLSDLRDSGAIEQDADVV
FT                   AMLYREGYYNREDPDLQRKAILIIGKQRNGPTGDINLIFEGEYTKFSDESKVQDDYQ"
FT   CDS_pept        543694..544863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_361"
FT                   /old_locus_tag="TGRD_365"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_365"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13848"
FT                   /db_xref="GOA:B1H016"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1H016"
FT                   /protein_id="BAG13848.2"
FT                   /translation="MKKKMPSVVAVTNKTRQTVFFRQNWVEIDRSDFHFNLKKIKEYIA
FT                   KDTKIMVVIKANAYGHGGVALAKETQRAGVAWIGISSLEEGIQFREAGIKSNILILGNI
FT                   FPFENFQVAVAHSLTPTISTMSGLAALEYWAVRLNKKINFHLKIDSGMGRIGVVPEASY
FT                   PILQKIVQMPKTNMTGMYTHFAVADTDPVFTQQQLDIFTNIVKFARINLGLKFIAHAAN
FT                   SAALFRNKRTHLDMVRPGISIYGLTPFKHAERFLKLKSVLSWKTKIIFLKKVPAGFCVS
FT                   YGRTFVTNRASVIATIPVGYADGYNRLLSNKCDVLVRGKRCPIAGRITMDMTMIDVTDV
FT                   KGVTLGDEVVLIGVQGKEHIKVDELAKIQNTINYEVTSSISVRVPRIVV"
FT   CDS_pept        545031..545843
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_84"
FT                   /note="pseudogene of outer membrane lipid-exporting
FT                   ABC-type transport system, periplasmic component MlaE"
FT                   /pseudogene="unitary"
FT   CDS_pept        546686..547813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_362"
FT                   /old_locus_tag="TGRD_366"
FT                   /product="HemN-like Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_366"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13849"
FT                   /db_xref="GOA:B1H017"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B1H017"
FT                   /protein_id="BAG13849.1"
FT                   /translation="MTCLYIHIPFCKQKCLYCSFFSIKYDNVLANRYVDALIEHVGQFK
FT                   NENILSIYVGGGTPSVLSSEQIQKLLQALSDILNLSTIKEFTFELNPESVSKEKLHILK
FT                   QLGVNRLSIGLQSVEDKSLKFLGRLHSFKTFCYVYDTARKEGFTNINIDLIYGLPKQTL
FT                   EDWEQVLKKTLLFNSEHLSLYPFSVEENTPFYKNGIITNDDIQRDIYDESMKILTNNGY
FT                   NHYEISNWSKKERESFHNTNYWRNLEYIGLGAGASGYLKRRRYKNIENIEKYIELCSSL
FT                   QVVKGDCFRQYSNLSFLETENEYIDSKLYKTETIMLGLRLLDEGINISCFNNPKHYYIL
FT                   LECLKNKMLNRKGGRIKLAKEYIFVFNQIVLKFME"
FT   CDS_pept        548017..550599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_363"
FT                   /old_locus_tag="TGRD_367"
FT                   /product="protein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_367"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13850"
FT                   /db_xref="GOA:B1H018"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H018"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13850.1"
FT                   /translation="MLKTILVAIFGSQNDRDIKAIQPVIEKINALEPYIKKLTDVELKE
FT                   KTVEFRERLSKGETLDDVLPEAFACVREASVRTIGLRHFDVQLIGGYILHKGKIAEMKT
FT                   GEGKTLVATLAAYLNALPQTGVHIVTVNDYLAKRDKEWMGVVYEKLGLTVGNVGNETKN
FT                   EERRMAYNCDITYITNNEIGFDYLRDNMVIAKDDRVLRPLNYAIIDEVDSILIDEARTP
FT                   LIISGACAESTDKYYISDRIVPRLKGRIITENEEIKAKYADVDLAKGYDYLIDEKNHSA
FT                   VLTEQGVQKAEKMLGVKNIYDDLQSEWVHHLTQAIKAHNLYRRDIEYVVKDGKVIIVDE
FT                   FTGRLMPGRRWSDGLHQSIEVKENLKIADENQTLATITFQNFFRMYKKIAGMTGTATTE
FT                   SEEFWEIYKLGVIEVPTNNPMIRKDYHDVIYRTEREKDNAVVNEIESLWKKGQPVLVGT
FT                   RSIEKSEKISTMLRIKGIPHQVLNAKYHELEAQIIAGAGTKSAVTIATNMAGRGTDILL
FT                   GAGDAVQNEEVKKSGGLHIIGTERHESRRIDNQLRGRSGRQGDPGSSKFFLSMEDELMR
FT                   LFGSDKMSVIMQKLGLKENEDIQHLWISKAVENAQKKVEGMNFDIRKRLIDFDNVMNKQ
FT                   REAVYKLRNEILEGQDITDTIKDMISESIEEKITAWAVGKYTEEWDWASIDVWLLRTFG
FT                   IKYETGNKDEISNLSRESARSAISGKVFEAYEHRKEQLTPELMLNMQRIVLLQMIDSSW
FT                   RDHLYELDQLRHDIGFRAYAQKDPKVEYQKESFALFESMMNRVRDNTIEYIFKVQIDAK
FT                   LQKMAIQTTNSDFRKNDGKKINKGSNKIGRNDQCPCGSGKKFKKCCGA"
FT   CDS_pept        550756..552303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_364"
FT                   /old_locus_tag="TGRD_368"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_368"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13851"
FT                   /db_xref="GOA:B1H019"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B1H019"
FT                   /protein_id="BAG13851.1"
FT                   /translation="MSKLAKFKISMNLKKIILCIITALLAVCSFPKINLFFLAWVAFIP
FT                   LIFVITRSGLKDSFFYGLISGFVFNAAGLYWLIPMLKFNTGSYVQAVTAACTLWIYLAL
FT                   YWGIWCLYLNFSQNILSNTLKNYLYSNTLIILFGSCIWVLLEYIRTYFLTGFPWMLIGH
FT                   SQFKFTEIIQIAEFTGVYGVSFLIIFCNLCFYFWISTQKGNKYLYTALVLTVAISIFGA
FT                   VRAYKFRFFGDQEFTVSIVQPNVDQDKKWDQFYKSDILSNLKEYAFKIAENKTDLIIWP
FT                   ETVLPGSIPEDKQSYESIKYMVKTAGGFNIIGSAYNNDFNAALAFTESDGEYKAVHKKN
FT                   HLVPFGEYIPFRNLFSRFFGILNQMGDSKKGQDTNVFDNGKIYAGAVICSENFFPDISR
FT                   NFILSGAKVLTNHTNDAWFFNTAAPHQHFIMNIFRAVENRKAVIVSANSGISGIIEASG
FT                   VIAEKTASSESIILTGKFLQNNFKTFYTKYGDLFVNMCAGLLLALVLLELCIRIRKI"
FT   CDS_pept        552416..553435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_365"
FT                   /old_locus_tag="TGRD_369"
FT                   /product="DNA polymerase III subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_369"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13852"
FT                   /db_xref="GOA:B1H020"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H020"
FT                   /protein_id="BAG13852.1"
FT                   /translation="MNILKMHDFNKLISLQKISSVYLLAGEESYFINMCLNKIEKFTAT
FT                   DDLNRDVFYASESSADDILNALQTLPFLSEIRVVIVKGVNKMKAIDAERLTDYLSNTIE
FT                   TSCLILLYFDNYKKETVAKRREFINKCIASKNCVSVNCRKQYENEVKEFIKNEFAQKGK
FT                   EVSYDVISRIIEENGNDLLNISNEIEKLSLFAGKNKKDITQEDLEKISGYTKETGIYAL
FT                   SSEIEARDLKKTMFVLEKLLNEREEPVIILSAISSVVRKMLNAKSMIEEQGLSTAEIAS
FT                   ALRIHDFYAETFFTNLKKYSTDTLKESLKTILKTDTAIKTGSNDAASALEKTILSICK"
FT   CDS_pept        complement(553589..553873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_366"
FT                   /old_locus_tag="TGRD_370"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13853"
FT                   /db_xref="GOA:B1H021"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:B1H021"
FT                   /protein_id="BAG13853.1"
FT                   /translation="MAKLKTGRHTSTLKEARKTKKRTERNKAIKSKIRTSIKKVEEAVK
FT                   NNNVKVAQEHLSVVFSEWDKAAKKNIVHYKAASNKKARLSKLVAGIITK"
FT   CDS_pept        complement(553934..554677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_367"
FT                   /old_locus_tag="TGRD_371"
FT                   /product="thiazole biosynthesis protein ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_371"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13854"
FT                   /db_xref="GOA:B1H022"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B1H022"
FT                   /protein_id="BAG13854.1"
FT                   /translation="MQNDIERYQRQLLLKDVGEAGQKKLFNARVLVCGAGGLGSPALTY
FT                   LAAAGIGYIGLCDFNIVSISNLNRQILYTQAEMGKQKAQIAKEKLEKFNPDVKVRAYSE
FT                   RLTEDTTGDIFKNYDVLIDATDNFPSRYLINTAAYKNSVPLICGAVCEFEGILTTIVPK
FT                   ENTSCFQCIYPFKPSTDLTSKTFGILGAIAGIIGTMQALETVKLILGLHCLKNKILIFN
FT                   GIENIYRVKEVIKRKNCKACHISVE"
FT   CDS_pept        complement(554679..554882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_368"
FT                   /old_locus_tag="TGRD_372"
FT                   /product="thiazole biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_372"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13855"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B1H023"
FT                   /protein_id="BAG13855.1"
FT                   /translation="MITVKVNGKNKEVKENTSIADFLKSNNIDPIGVTVEHNLEVINPG
FT                   SIAEIMLKDGDTLEVLRFVGGG"
FT   CDS_pept        complement(554869..555504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_369"
FT                   /old_locus_tag="TGRD_373"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_373"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13856"
FT                   /db_xref="GOA:B1H024"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B1H024"
FT                   /protein_id="BAG13856.1"
FT                   /translation="MKKQIPKGLYAITAENFSNGKDNISVVKEMLDAGIKILQYRDKYK
FT                   TKLEKFKQCEIIRRLTLDYNVFFIINDDIDIALSIQSEGIHLGQDDLPLAKARGIAGPD
FT                   ITIGISTHLPKQALLAAEHGADYIGVGPIYKTFTKDNVVDPVGLGYLDFCVKNINIPKV
FT                   AIGGIKFSNLLEIYRYNPENICMVTEITASENIEFTVKKVKEAMNDYC"
FT   CDS_pept        complement(555501..556607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_370"
FT                   /old_locus_tag="TGRD_374"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_374"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13857"
FT                   /db_xref="GOA:B1H025"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:B1H025"
FT                   /protein_id="BAG13857.1"
FT                   /translation="MTFYDIKRQYNTFDFENYTTGVSDKMVESSMQKEILNDMDFLNLL
FT                   SPKALNHIEEMAQKAHETSIKHFGKGILLYAPLYVSNFCINNCIYCGFSTKNKIKRKVL
FT                   SFEEIEENCKIVSEYGIRHILLVTGESSVKTPLSYLKKCVEILKNYFDVVDIEIYPLEE
FT                   SGYKELADAGADGLTIYQETYNEELYKLLHTQGAKSDYKYRLDTCKRAGKANYRNLNVG
FT                   VLLGLNDFVSEIFFAGIHAKYLQKSFSSAEIGMSFPRLRPAVGTYKPKTVISDKNLIQA
FT                   ICAVRLFINRISIAVSTRESKELRSNLIPLGITKMSAGSSTEVGGYAEKRKCSDGQFKI
FT                   NDTATVDEVKKMIYKKDYQPLMKDWTIL"
FT   CDS_pept        complement(556754..557524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_371"
FT                   /old_locus_tag="TGRD_375"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_375"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13858"
FT                   /db_xref="GOA:B1H026"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B1H026"
FT                   /protein_id="BAG13858.1"
FT                   /translation="MNKDFFNIAGIELKSRIFIGSGKFSNNKLIPEIIKSSQAQVMTVA
FT                   VRRFDFQNPKENILSYIPENIHVMPNTSGARNADEAVRIAHIAKNAAKTDLIKIEIIND
FT                   NKYLLPDNYQTAKACEILAKEGFKVFAYMNADLYAARDMQNAGVAAVMPLGSPIGTNKG
FT                   LKTKEMIRILTEEIIAPIIVDAGIGKPSDACECMEMGCAAVMINTSISSSQNPVLMAEA
FT                   FKDAVNAGRKAFLAKLGAVSDRAKASSPLTDFLN"
FT   CDS_pept        558286..559026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_372"
FT                   /old_locus_tag="TGRD_376"
FT                   /product="conserved TPR-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_376"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13859"
FT                   /db_xref="GOA:B1H027"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B1H027"
FT                   /protein_id="BAG13859.2"
FT                   /translation="MKKNLGLIVVCLCFSVCFAENRYKTQIANAEESFKKSNFSKTIEI
FT                   YESLVQIEKVNNPYIYYNLSNAYYRNGNLGKAILNMEKALRLAPRDREIKNNAEYLNTV
FT                   AGQVRRKNFPNTFLRYFSLNEITTAFAVITILFLTALSLFIIKRKLILKKAVAVSVVFL
FT                   IICIPLFALKVYSEVATKEAVVLSASNIKSGPGENNPDIFIIPEGKIVSVIFENGNWNN
FT                   IKTESKNKSLTGWIEKSALGNINA"
FT   CDS_pept        559019..559600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_373"
FT                   /old_locus_tag="TGRD_377"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_377"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13860"
FT                   /db_xref="GOA:B1H028"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H028"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13860.1"
FT                   /translation="MHKVAIFGGSFDPVHKSHIQIAKLAFKSLDLKKMIFVIAYTPPHK
FT                   TKQYAYIEDRISMLKLATGNMQKTEISLYEAQKLETVYSYQTLDYFNSLYPEDEIYMVI
FT                   GSDSLLDLPIWNNIDYMAGRYKFIVAKRHGFDEVNKNVKYLDRCVFIDKETEDISSTEI
FT                   RRLVKEDYKKAVSMLNKKVYNYIIQNGLYK"
FT   CDS_pept        559764..560360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_374"
FT                   /old_locus_tag="TGRD_378"
FT                   /product="YqeK-like HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_378"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13861"
FT                   /db_xref="GOA:B1H029"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B1H029"
FT                   /protein_id="BAG13861.1"
FT                   /translation="MCKNAEKQIFDYLSENLSPKKLEHSYNVAILAAELASKHNLDIVR
FT                   VRTAGLLHDCAKFMTDEEFIDFFKKRDKTLKYFKKDVIKFSPHLLHSFAGEIIAKEKFK
FT                   IKNRDTLNAIKNHTLGRKNMRAIEKIIFIADCVSYDRKLEGAKRIRNLAKNDLNKAFFE
FT                   VLTKKIEHIIDKGMWLCPQIIDTWNWYVSNNKKDN"
FT   CDS_pept        560332..561357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_375"
FT                   /old_locus_tag="TGRD_379"
FT                   /product="LytR-related transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_379"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13862"
FT                   /db_xref="UniProtKB/TrEMBL:B1H030"
FT                   /protein_id="BAG13862.1"
FT                   /translation="MFQTIKKIIKILLVLITVAVSAYIYIDKNDVVTKKLKGKDYVSFS
FT                   VLLYGTEKIFPGRLDVYTALYDKRTNTLKVLSVNTDAVVLKKREKARSLKTMFNENSKK
FT                   DINAAIKKLYLDLYEIIGNAAAADFYINTTFEMFDIAAGRNKKFLKDNFENIDLESLNR
FT                   LETVEYFMHLPSPAIMKIYKNYGFFDTNIPKLSFMSSALRTKSLKPILMFCEMPVKYTK
FT                   TRVEFDKQNIEEFLNKIYYAVSVPYTNTKDVLIDIKNASKKPRMAEKAAWLLRKNKLDV
FT                   LEWSNLYATYDKTLIKDYKGNFMQALIIAEILKTGKVIVSYNNRIFSDIDIFIGKDCII
FT                   T"
FT   CDS_pept        561384..561836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_376"
FT                   /old_locus_tag="TGRD_380"
FT                   /product="ribosome silencing factor"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13863"
FT                   /db_xref="GOA:B1H031"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B1H031"
FT                   /protein_id="BAG13863.1"
FT                   /translation="MAKINFLALAEKAAEIADNKKAIDTIILDIRGVTAIANYFVITTA
FT                   LSTPQINAISIGIEKIFKEQDIKSLRKDGVSSSSWRVIDYGGIVIHVMSTEIRESYKLE
FT                   KLWKNSKVIESKILKVKSEKQLADIESKSAKTKKELKKLKNQLRMK"
FT   CDS_pept        562116..562476
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_85"
FT                   /note="pseudogene of type II modification methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        563537..564646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_377"
FT                   /old_locus_tag="TGRD_381"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_381"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13864"
FT                   /db_xref="GOA:B1H032"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:B1H032"
FT                   /protein_id="BAG13864.1"
FT                   /translation="MFKINFEKYDFTLIAAVCICTVFGAFMVFSSSTVMADVKWTSPYK
FT                   FFLRQILWVIFGFAAMFVTSFLINYKFYKRYAKWIYLFALVLVIAVLFVGVLRLGAKRW
FT                   LQIGPFTLQPSELAKIAVVIAIADFISRKKKLVEKWKGLIAPGFIILLMLFPIVVEPDL
FT                   GTPILVAVVCFAMLFCAGMKMNVIFAGGLALILLMVEEIMRKPYRLTRVKDYLASFVNI
FT                   DVSSYQVKQSLNALGSGGFWGKGLGKSEMKLMYLPEAHTDFIFPIIGEELGFLGAVSVI
FT                   AFFMYLFFKGIKMSKNMPDVFSQYLCLGITFLIVFQAIINISVTTGVFPAKGLALPFIS
FT                   FGGTALIITMATSGILINLSQYNKKQSRT"
FT   misc_feature    564709..565787
FT                   /note="split to N-terminal and C-terminal components by a
FT                   single deletion mutation which caused frameshift"
FT   CDS_pept        564709..565287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_378"
FT                   /old_locus_tag="TGRD_382"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_382"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13865"
FT                   /db_xref="GOA:B1H033"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="UniProtKB/TrEMBL:B1H033"
FT                   /protein_id="BAG13865.1"
FT                   /translation="MEMGDRNIIIASSGTGGHIYPGIALAEEFKNKGYNPIFFISNNTA
FT                   SIKILKNSGFEYIEFNVSGMPGEISFLFITFLVKMKFSFFKALIKIVKLNPLAVIGTGG
FT                   YIAVPVLFAAKILHKKTFIHEQNAIPGKANILLNKITDKTFISFQSSEKYFKKKILFSQ
FT                   TIPLEKIFCRYQKKKYYGNLNLKTEFLRF"
FT   CDS_pept        565221..565787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_379"
FT                   /old_locus_tag="TGRD_383"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_383"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13866"
FT                   /db_xref="GOA:B1H034"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:B1H034"
FT                   /protein_id="BAG13866.1"
FT                   /translation="MSVSKEKILRELKFENGIFTVLVFGGSLGAVKLNEVACETLLKLS
FT                   FKNRIQVLHITGSGNYIKIQEKIGDNPDYRVFEYMHDIGAAYAASDVVVCRSGAGSVFE
FT                   LKALDKPAVLVPYLYAADNHQYWNAKEIEKDGKVIIIEEKNLAKESLSNAIYALKENIK
FT                   SNTAESIIKFPRKLVFEEIIKCMKS"
FT   CDS_pept        565772..566524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_380"
FT                   /old_locus_tag="TGRD_384"
FT                   /product="5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_384"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13867"
FT                   /db_xref="GOA:B1H035"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:B1H035"
FT                   /protein_id="BAG13867.1"
FT                   /translation="MHEILISNDDGVKAPGLRPLMKELSKIGKVYVIVPKTQMSGTGHG
FT                   ITLAKYKKVEKIEKDFYVIKGGTPADCVKYGLYHFFKNKTDLVVSGINTCPNLGQDVIY
FT                   SGTVGAAREGALRGVPSLAVSAAEVCATEYEHSAIATREIAEKVLKRKKFFKNICLNIN
FT                   IPQNYKGIKVAPLGLRIYDESVETVVDERGNFSYRLSGKYISGGKNKGTDIDTVDKGYI
FT                   SVTPLRIDQTDFTFIKKLNYKVIIPSKK"
FT   CDS_pept        566678..568696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_381"
FT                   /old_locus_tag="TGRD_385"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_385"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13868"
FT                   /db_xref="GOA:B1H036"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B1H036"
FT                   /protein_id="BAG13868.1"
FT                   /translation="MKNEFKLISKFKPSGDQPQAIDKLYHNYLNNKNSQILLGVTGSGK
FT                   TFVMASVIEKLQKPTLIISPNKILAAQTYAEFKAFFPNNSVEYFISYYDYYQPEAYIPS
FT                   SDTYIEKDASINDHIDRLRLKATTSILERKDVIVVASVSCIYNLGSPKDYQNMCVEIIA
FT                   GKEKTISLLLTELIASRYERNEVEFKRGKFRVKGDTVEIFPAYLETAVKIEFCGDTVER
FT                   IKEFNPVTGEVISKKDKAYIYPAKLFVTDKYKVDKALKTIQIELNTRLEVLKSQNKFLE
FT                   AQRLEQRTKYDIEMLKETGSCNGIENYSRHLSGGLSGAKPTTLIDYFVQENDDFLIITD
FT                   ESHISLPQIRGMYEGDRSRKQTLVDFGFRLPSALDNRPLKFQEFEKVIRKFMMVSATPG
FT                   TYELNRSKKYIVDLIIRPTGLVDPEIVIRPISGQIQDLMQEIRKNVEKKQRTLVTTLTK
FT                   KMSEDLAAYLKEKGFKVEYLHSEIDTLTRIEILKNLRLGKFDVLVGINLLREGLDLPEV
FT                   SLVVVLDADKEGFLRSEPTLIQICGRAARNIDGRVIFYADTVTGSMQRALREMNRRRDK
FT                   QLEHNKKNNIKPKSIIKAVHELDEFRNLSREESMNHIVAEEQLNYNITPKNIGNIIKEV
FT                   ELQMRESADNLDFESAAALRDRMLELKNMKSCKSSKR"
FT   CDS_pept        568789..569079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_382"
FT                   /product="hypothetical protein"
FT                   /protein_id="BCI50716.1"
FT                   /translation="MNSIGLVFIIIGVILITLSVVAVTVFLILMLIGIKKSAIEFRRFI
FT                   KKINSELDGVNKVSGVASMRRKLSSLVIKGISFLFYAFLSVSERKNRTHGE"
FT   CDS_pept        569081..569290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_383"
FT                   /old_locus_tag="TGRD_386"
FT                   /product="YtxH family uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_386"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13869"
FT                   /db_xref="GOA:B1GZF0"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF0"
FT                   /protein_id="BAG13869.1"
FT                   /translation="MSDNRDTLLAFVLGGLIGATLGILYAPKSGRETRSNIKKFGEEIV
FT                   DTVSNLSDDFKDDESQFKVSSKIK"
FT   tRNA            569360..569432
FT                   /locus_tag="TGRD_tRNA25"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   tRNA            569511..569583
FT                   /locus_tag="TGRD_tRNA26"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   CDS_pept        569676..570173
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_86"
FT                   /note="pseudogene of CpXC-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        570160..570720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_384"
FT                   /old_locus_tag="TGRD_387"
FT                   /product="SpoVG-domain DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_387"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13870"
FT                   /db_xref="GOA:B1H038"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:B1H038"
FT                   /protein_id="BAG13870.1"
FT                   /translation="MTLAKISLLVLIAPLVLCSSLYAELKITKIIHDNKSFEIVLNDDI
FT                   KISNILLKNNDVKLPIYRSKNKVYKQFGILKREFRQYLVSALYQNKISSKTEKTVFKTN
FT                   KLSISKKHLKIKAFVSVIFDDDIEIECRIMQSAKGLWIAWPSNKKDGVWVKDFEFINKD
FT                   LKKAVEKKLIDDYIFKNDKIKGK"
FT   CDS_pept        571296..571736
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_87"
FT                   /note="pseudogene of ribonucleotide reductase repressor
FT                   NrdR"
FT                   /pseudogene="unitary"
FT   CDS_pept        571782..574085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_385"
FT                   /old_locus_tag="TGRD_388"
FT                   /product="cobalamin-dependent ribonucleotide reductase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_388"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13871"
FT                   /db_xref="GOA:B1H039"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR024434"
FT                   /db_xref="UniProtKB/TrEMBL:B1H039"
FT                   /protein_id="BAG13871.1"
FT                   /translation="MLRDKKEELISENKVNLENNALTVLKKRYLKKDKDGNVIESPEDL
FT                   FYRVAENIAQADKIYDEDTDITILIREFYLTMSSCDFLPNSPTLMNAGRHLQQLSACFV
FT                   LPIDDSMDSIFETLKNTALIHKSGGGTGFSFSRLRPKKDVVRTTSGISSGPISFMQVFN
FT                   AATEAIKQGGTRRGANMGMLRIDHPDILDFIICKDKDDSLNNFNISVAITKKFMDALEK
FT                   GEYYNLYNPRNGVIIGRLNANEVFGKIVDQAWKNGEPGIVFVDRMNHKNTTPSAGSIES
FT                   TNPCGEQPLLPYESCNLGSINLGHFVKNNDVNWEKLEKTVKTAVHFLDNVIDVSNYPIQ
FT                   KIGEVTRSNRKIGLGIMGWADLLLYLGIPYGSNDSLALAEELMGFIHSKSRKASEELAF
FT                   KRGSFPNFKKSIYAKGSPVRNATTTTIAPTGTIGMIASASSGIEPIFALVYKRMQCLDN
FT                   EEMYEVNPYFEKLAKENGFYSPELIDKISEKGSIRGFKEIPEKIKKIFVTSHDIAPEEH
FT                   IKMQAAFQKFTDNAVSKTVNFPNSATKEDVKKVYILSYKMGCKGVTVYRDGSRNVQVLN
FT                   LANKKEEYSQGALHEKKPRTRPKKTTGLTFLMHTGCGKMYVTVNEDDRGMCEVFTQLGK
FT                   SGGCTSSQAEAISRLISLALRSGVDQQGIIDQLKGIRCPSPTLADGGIILSCADAVAKA
FT                   LEAYKREKMTPVLSARDMSVSEPYASKYKKKHYTSGLSGNSSGACPQCPECGEMLTFAE
FT                   SCVICRGCSYSKCF"
FT   CDS_pept        574586..576145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_386"
FT                   /old_locus_tag="TGRD_389"
FT                   /product="ABC transporter ATPase component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_389"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13872"
FT                   /db_xref="GOA:B1H040"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H040"
FT                   /protein_id="BAG13872.1"
FT                   /translation="MSEKLKSLQFNLDFFKKLGVFSKNRNLLQYLPTAGTVISAQKILL
FT                   MPTFDAIPNIVNTSIKLQESQNRDKSLKEPYSASITSISYVLDECKMLLGNLLAERNEV
FT                   RNKFCDNIQRGTNKDYELPKNNLDNVIKIWNSLIQHRILEVESGITFTLKMKTNLSVNY
FT                   PAYQMSDGEKVALYLIAYVLQSPKDGFVIVDEPEMYLHKTILNKLWDILEDERKDCIFI
FT                   YLTHDLGFATSRALAKKVWIKSFSVPDKWEIEYIKGNELPEELLMELLGSRKNILFCEG
FT                   KKGGIDEQIYNILFPDFTIIPVESCFSVINYTKAFNKMPNLTTKAIGLIDSDHHGADRL
FT                   EKLKSNDIFSFSIAEIENLFFDESFLKLLSEKLLVQDKNAVESIKSEVTLQLEKEMELQ
FT                   ISNYISMKINYYFTDSHLTKGNNLKEVEKNYVRFKKEIKICAWTEHRKVELEKIIKDKD
FT                   YKRVLSIFNNKGLKQIATKHFGVSDFTDRAIDYLKNNLKAQDAIKKYFPVEIWNRIELN
FT                   KL"
FT   CDS_pept        576262..577416
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_88"
FT                   /note="pseudogene of site-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        577403..578097
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_89"
FT                   /note="pseudogene of putative type II restriction
FT                   endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        578234..578791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_387"
FT                   /old_locus_tag="TGRD_390"
FT                   /product="dCTP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13873"
FT                   /db_xref="GOA:B1H041"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B1H041"
FT                   /protein_id="BAG13873.1"
FT                   /translation="MVKNDKWIKKMAFEYKMIEPFEPRQIRCGKISFGTSSYGYDMRLS
FT                   NEFMIMKVKNKDFVLDPKRTSGNLLESITVKDYIEILPNSVVLGKTIEYFRIPRNIVTI
FT                   AFGKSTYARCGIFVNITPFEPEWNGYVTLSIANMTSVPAKVYANEGIAQVLFLGASEVC
FT                   EVSYADRRGKYQTQKIITSAKI"
FT   CDS_pept        578838..580367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_388"
FT                   /old_locus_tag="TGRD_391"
FT                   /product="glutamine-hydrolyzing GMP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_391"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13874"
FT                   /db_xref="GOA:B1H042"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1H042"
FT                   /protein_id="BAG13874.1"
FT                   /translation="MILILDFGSQYTQLIARRIREEKVYCELCPGNKPIKSFSGIKDLK
FT                   GIILSGGYESVYSKDAPWPDPEIWELDVPILGICYGMQLIAELHGGKVAPSKRREFGLA
FT                   NVNVKCNSSLFNGLSSEETLWMSHGDKLSKIPKGFEITAKSDNSPYAAIENTAKNIYGV
FT                   QFHPEVKHSVNGRTILKNFIFKICGLKRDWTMKSYIVEEVKRIHKQVGKSKVLCALSGG
FT                   VDSSVAAVMLYKAIGKQLICVYVDHGLQKLGETERVRKVFGRMFGKNLIIVSAKKIFLS
FT                   KLKGITDPEQKRKIIGHTFIEVFDGEVKKLKGINFLLQGTIYSDVIESVSIKGAKSPIK
FT                   SHHNVGGLPEKMKMKLVEPLRFLFKDEVRVLGKELGVPSEIIDRQPFPGPGLAIRTLGE
FT                   ITKEKLNILKEADNIVTEEIIKAGLYEKIWQSFAIILPVKTVGVMGDARTYEYVIAIRA
FT                   VNSEDAMTADWVKLPYELLSKISSRIINEVKGTNRVVYDISDKPPATIEWE"
FT   CDS_pept        580367..581251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_389"
FT                   /old_locus_tag="TGRD_392"
FT                   /product="ABC-type phosphate transporter phosphate-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_392"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13875"
FT                   /db_xref="GOA:B1H043"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B1H043"
FT                   /protein_id="BAG13875.1"
FT                   /translation="MKISKLITVLLIYVFFYACVKSQVGDRHGGISIQIRGSDTIVNLI
FT                   QEWVEKFVEQNPSFNISVTGGGSGTGFASLINGTCDIAMSSRRIEEKEKMLAESKNINP
FT                   VEFKIGLDGLAVLVNKNNPVNKLTLEQLRDIFMARITNWKEVGGRNRKIVILSRESNSG
FT                   TYMFFKERVLGIGDKNNKNEFSTQSLMMSSSQTICNEVCQNPNALGYVGMGFVDERVKP
FT                   VSVAVNAESEYVYPMPENVMNGTYPISRPLYIYTNGESQDVVKMFIDYALSAAGQKIVL
FT                   EADFIPIRKQSVK"
FT   CDS_pept        581412..582281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_390"
FT                   /old_locus_tag="TGRD_393"
FT                   /product="ABC-type phosphate transporter permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_393"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13876"
FT                   /db_xref="GOA:B1H044"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1H044"
FT                   /protein_id="BAG13876.1"
FT                   /translation="MRKIIDTVIETVIFICGILSIVFVILIFGFLFKEGFSFFKDFGII
FT                   KFITGQFWYPTSDTKSFGILPLIIGSVLVTVGACIIMVPIGIMTALYISEIAPKGVRDV
FT                   LKSLVELMAAIPSIVIGFVGMVTLVPFVRTLFNIPTGLTAFSGSIMLAFMAMPTIVTIS
FT                   EDAIRSVPCQYKEGALALGATKWQTIRRIVLKAAMPGIIAAIMLGIGRVIGETMAVMMI
FT                   TGNSARIPHSIFEPVRTMTAVIASEMGETVVGSIHYRALFAIALVLFIVTFIVNFIADL
FT                   FLGNNKNK"
FT   CDS_pept        582278..583132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_391"
FT                   /old_locus_tag="TGRD_394"
FT                   /product="ABC-type phosphate transporter permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_394"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13877"
FT                   /db_xref="GOA:B1H045"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B1H045"
FT                   /protein_id="BAG13877.1"
FT                   /translation="MIKLNPKLSQKFSYTILFLATVLTVIPVVMIIFIIIKNGVSAITW
FT                   EFLMSMPKDGMRGGGILPAILGTLLIVTCAIAITLPIGVFAAIYLNEYAKNNLLTRIIK
FT                   LAIVNLAGVPSVVYGLFGLGIFVMFLKLGVSIIAGALTLSIMELPVIITTSRNALNSVP
FT                   YYFRDASLSLGVSRWQTIRYIVLPNAISGILTGAILSISRISGETAPILFTATAFSVPH
FT                   LPRSVLDQVMTLPYHLYIISTQIPNMPENVIFGTALVLLLMVLTMSFIAIVARIYLRKR
FT                   RKW"
FT   CDS_pept        583126..583878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_392"
FT                   /old_locus_tag="TGRD_395"
FT                   /product="ABC-type phosphate transporter ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_395"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13878"
FT                   /db_xref="GOA:B1H046"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H046"
FT                   /protein_id="BAG13878.1"
FT                   /translation="MVDKIKVEDLSCYYNKKCVLESLNINIAQNEILSIIGPANSGKTT
FT                   FLRTINRMNDLDATYSREGKVYLIGDNIFDMNMENLRKRIGMLFAMPIPLPMSIYENII
FT                   YAPKRLGLISKKSEQDAIVEQALRDASLWNEVKDRLSLSAMKMSGGQQQRLCIARILAI
FT                   NPEVILFDEPCTGLDPISTAKVEESMIELKQRYTIVLVTNNVKQASRVSDRTAFFLMGK
FT                   LVEIGKTDRLFVSPKEKQTEDYITGRFG"
FT   CDS_pept        583957..584712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_393"
FT                   /old_locus_tag="TGRD_396"
FT                   /product="ABC-type phosphate transporter ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_396"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13879"
FT                   /db_xref="GOA:B1H047"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H047"
FT                   /protein_id="BAG13879.1"
FT                   /translation="MSKIEIKKFNLYYADFHALKNININIEEKRITAMIGPSGCGKSTL
FT                   LRSINRINDTIENVYTNGEINISGENIYGEKIDVDALRRNVGMVFQRPNPFPISIYENV
FT                   AFGLKVNRITSNKSIIDETVERSLKAVLLWNDIKDKLRKSALILTLEQQQRLCIARLIA
FT                   IAPHVILLDEPCSSLDPVATQKIEELIIQLKDRYTIVVVTHNMQQAARISHNTAFMLLG
FT                   EIIEFDKTEKIFTNPSKKETGDYISGRFG"
FT   CDS_pept        584837..585514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_394"
FT                   /old_locus_tag="TGRD_397"
FT                   /product="phosphate uptake regulator PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_397"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13880"
FT                   /db_xref="GOA:B1H048"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B1H048"
FT                   /protein_id="BAG13880.1"
FT                   /translation="MRRFDVEMSDLQNHLLNMAVLVQKMIKTAMQELVERDPKQADTVF
FT                   CLEKEVNIQEIVIDDKCLKLIALNQPVSIDLRFITSAMRINSDLERMGDEAVNISEMAL
FT                   DLIKYPKIKSLVYIPKMVEAVQNMVMDCIKAFNTSDSELAVSVLAKDDEVDDLKNRVLT
FT                   NLKNLILKSSDIDTIQRTVDLIFVTKSIERLGDHATNISEDVIFMVHGKDVRHPYSSHG
FT                   VPG"
FT   CDS_pept        585856..586131
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_90"
FT                   /note="pseudogene of putative alpha-D-glucose-1-phosphate"
FT                   /pseudogene="unitary"
FT   CDS_pept        586128..586538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_395"
FT                   /old_locus_tag="TGRD_398"
FT                   /product="peptidyl-tRNA hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_398"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13881"
FT                   /db_xref="GOA:B1H049"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:B1H049"
FT                   /protein_id="BAG13881.1"
FT                   /translation="MTDFGVSPKKQEELDKKFEKCKVQESDIEEKFIRSSGKGGQNVNK
FT                   VSTTVYLKHYPTGIEVKCRRERIQGLNRFFARRLLAEKIEEKVLGRISEKRQKIERIRR
FT                   QKRKRSKRAKEKMLEGRKMCLAKKEMQGKIIY"
FT   CDS_pept        586538..587227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_396"
FT                   /old_locus_tag="TGRD_399"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_399"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13882"
FT                   /db_xref="GOA:B1H050"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B1H050"
FT                   /protein_id="BAG13882.1"
FT                   /translation="MNIKKPEPHYLGHRCRLRKKFIPGGFSNLADYEILELTLTYVLPR
FT                   KDVKALAKEMINKFGSLKQVFDADTDQLKGIKGISDYSAEFLLFLKKFISLYLSLDIKE
FT                   KDRLSSPKNVKDYLISTLSGENIEKFYAILLNSGNRVTDCLEIESGTVNKSLLIPRKIA
FT                   EIALKCRAASVVIAHNHPGGTLKPSQNDINATVAVKKALESIEISLLDHIIISNNNYFS
FT                   FKEYSLI"
FT   CDS_pept        587717..588719
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_91"
FT                   /old_locus_tag="TGRD_400"
FT                   /note="pseudogene of restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        589077..590067
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_92"
FT                   /note="pseudogene of adenine-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        592395..593651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_397"
FT                   /old_locus_tag="TGRD_401"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_401"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13884"
FT                   /db_xref="GOA:B1H052"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H052"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13884.1"
FT                   /translation="MDKIVIRGGKKLKGEIVVSGSKNSALPILFATLLTDDPVMITNVP
FT                   SLTDIDTAIAFLNFIGKKTVKEGNTVKAYSSYKYKHIAPYDLVRKMRASILIMGPLLVR
FT                   LKRIEVSLPGGCAIGARPVDIHLAAFKKLGAKISVKGGYVKTSAKNGLKGATISFRVPS
FT                   VGATENILLTAVLAKGKTIIKNAAREPEIEDLANVLTKMGAKVMGAGTKNIEIEGVDKL
FT                   HGFMHEVIPDRIEAATYLIAAAITKGGVILKKVIPQHLKSVNDKLKKCGLCIKETKNTI
FT                   SAEWVKNLKPQNVKTEAYPGFPTDVQAQWMSLMCLLNGESCIEENVFENRFLHVSELQR
FT                   FGADITVNGKTVNIKGVKEFSGAPVMVSDLRAGAALVLAGLAAKGKTVVSRIYHLNRGY
FT                   DMLEKKLKKLGADIRIIHN"
FT   CDS_pept        594125..594859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_398"
FT                   /old_locus_tag="TGRD_402"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_402"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13885"
FT                   /db_xref="GOA:B1H053"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H053"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13885.1"
FT                   /translation="MANITMKALLEAGVHFGHQTRRWNPKMAKFIFGMRNKIHIIDLQK
FT                   TLKELKKNYKVVRDFTSTGKDIIFVGTKKQARLPIKEEALRCGAYFVSERWLGGTLTNF
FT                   ETLKKSITRYKEIEDMKETGVFKLLSKKEQSRIEKERIKLEKSLEGLKNMSSLPGLMFV
FT                   VDSHEETTAILEARKLEIPIVAVCDTNCNPDLVDYPIPGNDDAIRAVKLFCTVIADAVL
FT                   EGKSIIGKQEDNKVKEAAIEVK"
FT   CDS_pept        594889..595485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_399"
FT                   /old_locus_tag="TGRD_403"
FT                   /product="translation elongation factor Ts"
FT                   /note="EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_403"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13886"
FT                   /db_xref="GOA:B1H054"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:B1H054"
FT                   /protein_id="BAG13886.1"
FT                   /translation="MSTELITRLREMTGAGIMDCRNALKESDNDIDKACQWLREKGIAS
FT                   AVKRAGKSAKQGLVQSYIHGNGTLGVLLEVNCETDFVVKTRDFQSLVKEVAMQVAAASP
FT                   NYVSREQVPAGIIEAEKEIYKAQLKEEGKPEKVHDKIIEGKIEKFYSQVCLYDQIYIKD
FT                   ASGKETIKDLVVNAIAKTGENIVIKRFARFKLGEE"
FT   CDS_pept        595488..596189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_400"
FT                   /old_locus_tag="TGRD_404"
FT                   /product="uridylate kinase"
FT                   /note="UMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_404"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13887"
FT                   /db_xref="GOA:B1H055"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B1H055"
FT                   /protein_id="BAG13887.1"
FT                   /translation="MAAKRVLLKLSGESLSDGSSSISANSLLRTVNEIKSAVTCSRVQL
FT                   AVVIGAGNIWRGACKFIERVTADKMGMLVTVMNSLALSDALAKAGMKSNLFSANGVSGF
FT                   AENFNREKVIRCIEQGNTTVIFAGGTGNPFFTTDTTAALRAAEIKADMLLKATQVDGVY
FT                   SADPKKNKDAVKFNSLTFKEALDKHLKIMDYEAFSLCMQTNISITVFDFYKDGNLKKVL
FT                   NGEKVGTIVEA"
FT   CDS_pept        596190..596750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_401"
FT                   /old_locus_tag="TGRD_405"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_405"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13888"
FT                   /db_xref="GOA:B1H056"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H056"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13888.1"
FT                   /translation="MHTQSFFSAAEEVMKRTIDRLKCELSSIRTGRVNSAAIETIKVES
FT                   YGSIMPINQIASISVSDARTIEIRPWDVSQLSAIEKAILKADIGMSPANDGKLIRVSVP
FT                   HLTQERRKEIAKSIGKMAEEFRVAIRNERRVLVENIKKLEKDKVITEDDKKKLEVEAQK
FT                   VTDGYIKKIDDSIVVKEKEVMQV"
FT   CDS_pept        596772..596945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_402"
FT                   /old_locus_tag="TGRD_406"
FT                   /product="4Fe-4S binding ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_406"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13889"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1H057"
FT                   /protein_id="BAG13889.1"
FT                   /translation="MAYQINENACVGCGACAGSCPVSAIEQKEDKYTINSDKCKGCGVC
FT                   ESTCPVSAISQK"
FT   CDS_pept        596956..597630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_403"
FT                   /old_locus_tag="TGRD_407"
FT                   /product="undecaprenyl diphosphate synthetase"
FT                   /note="UPP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_407"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13890"
FT                   /db_xref="GOA:B1H058"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B1H058"
FT                   /protein_id="BAG13890.1"
FT                   /translation="MIPGHVAIIMDGNGRWAEKRSLPRTFGHKQGGKTVKKIVKAASNL
FT                   GIRILTLYAFSTENWKRPQSEIKELFSLIMQFIKEELIELNNCIKLRILGDLSKFPENI
FT                   RTEIENASKITSQNTGLELNIALNYGARQELIHAFEEMSKQNIKKPTEEIISSFLYTAG
FT                   QPDPDLLIRTSGEFRISNFLLWQIAYSEIYITDKLWPDFTQQDLETAVSEFQKRERHFG
FT                   GL"
FT   CDS_pept        597789..598586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_404"
FT                   /old_locus_tag="TGRD_408"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_408"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13891"
FT                   /db_xref="GOA:B1H059"
FT                   /db_xref="UniProtKB/TrEMBL:B1H059"
FT                   /protein_id="BAG13891.1"
FT                   /translation="MLLTRILTAVAGIPFILACIYSGNIPFYVMMFIISSLCVQEYLMI
FT                   SKKYNPHTAVSLAMAATFFVFLYFFKDFPADKVIVSAIVMIFVLFGIEIFGENPTFCIG
FT                   RISSSFLGAFFIPLALMHMVYIRNLHGGMKLVFFIFIVIWILDTMAYAFGKALGKHKLA
FT                   NNISPNKTLEGAIAGIVFGVLAAVACRCTFMSNILTLQNAIILGLVIAVSGQFSDLAES
FT                   LIKRDGNVKDSGKVVPGHGGVFDRFDSYLFTAPVAYYVLQILK"
FT   CDS_pept        598583..599740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_405"
FT                   /old_locus_tag="TGRD_409"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_409"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13892"
FT                   /db_xref="GOA:B1H060"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H060"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13892.1"
FT                   /translation="MKRITILGSSGSIGKQTLNIISKMKENVCIEGLAVGSNIKILKSQ
FT                   IKKFKPASVSVNSPAEAQNLKKWCISNNIKTDVYKGNTGLEKLTTMPKTDMILAAIIGA
FT                   VGLKSIIAAIKAKKDIAIANKEAIVMAGSYIMKLAAENGVSVLPVDSEHSAIFQCCTDE
FT                   KKSQIKRIILTASGGPFYKYDKDFSKITVEQALDHPTWKMGRKITVDSATLMNKGLEAI
FT                   EASVLFGVSIDKVEIIIHPQSVVHSMVEYVDGSVIAQLSNPDMKLPIQYALTYPERLPS
FT                   NIKPLNLIEINKLEFYNPDFNKFPCLSLAYYAAQKGYTVPAVMNAANEMAVASFLNKEI
FT                   KFTDIAKIVGRTIKTHKISKSTSLDTFIEADYWARHYAEKLINEI"
FT   CDS_pept        600253..601335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_406"
FT                   /old_locus_tag="TGRD_410"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13893"
FT                   /db_xref="GOA:B1H061"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:B1H061"
FT                   /protein_id="BAG13893.1"
FT                   /translation="MKFYKRTETRKISIGSVIIGGGSPVAVQSMTNTNSRDWKATVRQI
FT                   KQLEETGCEIVRISLPDIESACNLGKIKKSIKIPLVADVHFDYRIALEAIKQGADKLRI
FT                   NSGNIGSKDKISVLAKEAKKAHIPIRIGVNAGSLKEVHNFSDNFLRAKALSSAAMEHVK
FT                   ILEKHNFQDIVVSLKASDIDTTVKAYKIFASKRNYPLHLGITEAGSIFSGTVKSAAGLS
FT                   IMLYDGIGDTIRISLTANPVEEVKTAYSLLQSMELRSSGIEIVSCPTCSRCEVDLIKIV
FT                   SEIEKKTSAMKNLKRFSKPVKVALMGCIVNGPGEAKDADFGIAGGKNTGILFKNGKLIG
FT                   KVNVDKWVEKIISMIKSYCR"
FT   CDS_pept        601356..601832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_407"
FT                   /old_locus_tag="TGRD_411"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_411"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13894"
FT                   /db_xref="GOA:B1H062"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B1H062"
FT                   /protein_id="BAG13894.1"
FT                   /translation="MSEIYLTREGRKKLIKELNELQKRKPLIQDEIASAREHGDLRENA
FT                   EYCAAKETLANLIRRIMELTSKIACAKIIEEQNIDSDKVFIGVTVTIKDEYGADYQYAI
FT                   VDLEEADPVANRISIQSPLAQGLLGHTAGETVAVELPAGKTKFKILKISRYQGN"
FT   CDS_pept        601905..603614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_408"
FT                   /old_locus_tag="TGRD_412"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_412"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13895"
FT                   /db_xref="GOA:B1H063"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H063"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13895.1"
FT                   /translation="MFFSKMLIPTLKEAPSDADIVSVKLMVRSGMIRKLASGFYELLPL
FT                   GLKVLRKVENIIRQEMNSAGGQEVIFPLVFPKALWLETDRWNAYGKELFKLKDRKDAEF
FT                   CLAPTAEEVVTDLIRKDIKSYKQLPVMLYQFGTKFRDEIRPRFGVMRSREFLMKDAYSF
FT                   HADEADLEKYYKTMFDAYTNICIKCGFQFRAVEAASGVIGGSFSHEFMVLTDTGEEEMT
FT                   WCSCGYGANSAKTECLKIEQSKEEPLPSEEIFTTDVCAIEDVAKLLNLSPKKFIKTMIY
FT                   IADKKPVAVLVRGDYEINEIKLQTLLGADGMLLADEQTVISVTNAPIGFAGPAGLKNIK
FT                   IIADLSVAELSNALTGANKKDYHLKNVNFKRDYNADIVADIRKVKRGDTCPRCKKEELK
FT                   FSRGIEIGHTFKLGDKYSKSMNASYLDANGKEKFIIMGCYGIGVTRILAAIIEQSHDDD
FT                   GIIWTNNIAPFEVVIVPLNYADEKTKETTEKIYKELSSKGLDVLIDDRDERAGIKFKDA
FT                   DLIGIPYRITISEKNLANGNVELKARRDGKDDAVRLFKPEGVVIELLKIFKK"
FT   CDS_pept        603840..605204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_409"
FT                   /old_locus_tag="TGRD_413"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="glycine cleavage system L protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_413"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13896"
FT                   /db_xref="GOA:B1H064"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B1H064"
FT                   /protein_id="BAG13896.1"
FT                   /translation="MNFNKYDIAVIGLGPGGFTAAVRAAQLGAKVAVIEKSFTGGTCLN
FT                   CGCIPTKFLWQSLKTKQKIQKSYEYGFKAVLEPVIFSDIIAKKDKNIANIRKGMEMVLA
FT                   SHKLDVIIGSALFKDKNTLTVLNNERGTVSEDVIYEVLADKIIIASGTKPSIIKGSAFD
FT                   GSKVISSTEVLNLKEIPKNMLIIGGGAIGVEMATIFSGFGCQVTLSEYENCLLPNEDEE
FT                   ISEEIRKNLLRHGVNVLTSCADALDDIDKYEKVLIVTGRTPNNDLGLDNIGIKMAKKGF
FT                   IETNEFCQTNIENIYAVGDIAGKNLLAYTAQNEGALTAENVVRGNFIAVDNFIVPQAVF
FT                   AMPQSASVKVLDFSKYQDVVFGKFPFTASGRAFIENERAGFVKCAVDKTTKKPLAFWIV
FT                   GAHSDELINTASQILKSGMEYISRETMFHPSFSESLLNAYEYALGKCTELVKNKD"
FT   CDS_pept        605155..606285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_410"
FT                   /old_locus_tag="TGRD_414"
FT                   /product="adenine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_414"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13897"
FT                   /db_xref="GOA:B1H065"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1H065"
FT                   /protein_id="BAG13897.1"
FT                   /translation="MNTRSENVRNWLRIRIEMLFEEYKYFDYRFPEPQYLGAKHTHLSW
FT                   INKFIPDEISVVLDAFSGSQSVSFLFKQLGFKTIINDFLNFNNQIGKALIENKSYTLDS
FT                   NDLAILFQPATNKDDFDLIEKTFTDIFFEREEAIFLDNFRANISLLENEYKKAVAFTVI
FT                   NRSITRKITMGHFGHMQALVYANDPERIRRNRSLIRPIKELLPSYNNAVFDNTNDNRSF
FT                   NQNILDLLPQLSNIDLAYFDPPYCDSHANYQGFYHLLETYTEYWKDKEFVNGIKRYEPQ
FT                   RYSGFDKKRDVFSSFEKLFELSSEIPYWLISYNNKSYPGIEDFEELILKHRDVTIETKT
FT                   YQNDRGGKGSVAGSQEILFVCKPRKKYFIPIKSRNN"
FT   CDS_pept        607311..608634
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_93"
FT                   /note="pseudogene of endonuclease-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        608616..609606
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_94"
FT                   /note="pseudogene of UvrD helicase-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        609743..610807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_411"
FT                   /old_locus_tag="TGRD_415"
FT                   /product="aminomethyltransferase"
FT                   /note="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_415"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13898"
FT                   /db_xref="GOA:B1H066"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B1H066"
FT                   /protein_id="BAG13898.1"
FT                   /translation="MKRTYLFDEHKKLGAKFTEFGGWEMPVQYTSIIDEHNAVRTNVGV
FT                   FDTAHMGTFTVTGENAEKFLNYVTLGNISGLPDKKARYSMILNEEGGIKDDIIVYKFGS
FT                   EYMIVVNAGNLEKDFNWLSKHKMEKVEIKNISSDISLIAIQGPKSAEILQSVSETDIKS
FT                   MKYFTVSILKLKDISVDFYRVARTGYTGEDGFEIFISKDQVNKFWEKLMSLSVKPCGLG
FT                   CRDTLRLEACMPLHGHEIGENINPIDAGFQKIINWDSDFIGKNRLLLLKDKSMKKSIAF
FT                   ECTSGIARNSNEIFSGNKKVGYVTSGSFSPTLKKAIGIALIDADAGTDELEVEIHNNRK
FT                   KIKTVTKPFYKKQK"
FT   CDS_pept        610804..611339
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_95"
FT                   /note="pseudogene of secretin-like protein (COG4964)"
FT                   /pseudogene="unitary"
FT   CDS_pept        611367..611900
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_96"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        612238..612537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_412"
FT                   /old_locus_tag="TGRD_416"
FT                   /product="ERF superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_416"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13899"
FT                   /db_xref="UniProtKB/TrEMBL:B1H067"
FT                   /protein_id="BAG13899.1"
FT                   /translation="MNLRGTQFLILKSKFRDYDYRNCEDILEVVKKMPSEEFIIGLDAE
FT                   VVLIGYKIVCQRCSCFFDRKLKRNSNLKKDNDKAQIMGVCSSYAIVIDAAPQIT"
FT   CDS_pept        612877..613212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_413"
FT                   /old_locus_tag="TGRD_417"
FT                   /product="DUF1828-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_417"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13900"
FT                   /db_xref="InterPro:IPR014960"
FT                   /db_xref="UniProtKB/TrEMBL:B1H068"
FT                   /protein_id="BAG13900.1"
FT                   /translation="MHVHRRQQKLAKGKECHIQIHTAFVDNHDEFITVLVKATKHPDEH
FT                   WVILTDEGYIINDLCKSGIKLDSLGGGKLLENILSNFGVIRAEYPTRTDRKSFVPTKVI
FT                   SIHGCTN"
FT   CDS_pept        613928..615571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_414"
FT                   /old_locus_tag="TGRD_418"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_418"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13901"
FT                   /db_xref="GOA:B1H069"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H069"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13901.1"
FT                   /translation="MSKFGLKNTPQWQGLEKNYREIKKIHLRELFKDENRFNKFSIRDN
FT                   DLGITFDYSKNIINSDTFKLLIEFVKAAKVTEYAKKMFSGEKINWTEKRAVLHTALRNR
FT                   SNMPIYVNGKDVMPEIKAVLKKMENFSNDLRSGKWVGATGKKVTDVVNIGIGGSDLGPK
FT                   MVCESLKYYADGPNVYFVSNIDGADIYEVLKKLNPGTTLFIVASKTFTTLETITNALTA
FT                   RKWLTDKLGDKAVANHFVALSTNVKKVKEFGIDENNMFEFWSFVGGRYSLWSAIGLPIA
FT                   CYVGFDKFIELLDGAYYIDQHFLNAPYEKNIPVIMAALGVWYNNFWGASSHAVLPYSQY
FT                   LNKFPAYLQQGDMESNGKTINFEGRRVDYGTGPIIWGESGTNGQHSFYQLIHQGTKFIP
FT                   CDFIGFVNPPEKIGDHHEKLMANYFAQTEALAFGLTKEEVAKNLKKAGISPADIKILTP
FT                   HKIFEGNKPTNSILFDELTPRTLGALIALYEHKIFTQGIMWRINSFDQWGVELGKVLAN
FT                   VILPELKGQTDNKHDNSTKNLIKIFNSNKK"
FT   CDS_pept        615579..616631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_415"
FT                   /old_locus_tag="TGRD_419"
FT                   /product="23S rRNA methyltransferase RlmN"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_419"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13902"
FT                   /db_xref="GOA:B1H070"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H070"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13902.1"
FT                   /translation="MQLLKQNYKKYILDLNDAQFNRAVKPIIEQDYRINQIIEWIYAKK
FT                   AVSFESFTNIPKELRNKLDEKFFLRTLKIVKKEKSLIDSTIRYTFRTADKKYFFAVFLP
FT                   ANGKNSVCISSQIGCPIMCAFCSSGKTKLARNLSRGEIIEQILQVENDTKEKISGILFM
FT                   GMGEPMLNFNNLISVLNSLLSSKEFGIGKRHITVSSVGIVPAVKKLADDNFGVRLALSL
FT                   HAVDERQRKKLVPDNLGFSIEDILKAGKYYLKKTNSHLTIEYVLVKGINISSADAHKLA
FT                   RLLKRCDLINSDVQVNLIPFNPVTDVQFQRPDKKSINKFKSILKLNGITVNVRQSKGAN
FT                   INAACGQLGY"
FT   CDS_pept        616698..617126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_416"
FT                   /old_locus_tag="TGRD_420"
FT                   /product="transcription antitermination factor NusB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13903"
FT                   /db_xref="GOA:B1H071"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B1H071"
FT                   /protein_id="BAG13903.1"
FT                   /translation="MGTRRKARECSLHMLYAVDNCNVPIESIYNSFAVYFPKGEAYRMF
FT                   ALDLFKGVCDNKEDLDSLIKQCAKNWEIERMAAVDRNIIRLATYEIMATTNIPIRVIID
FT                   EAVEISKKYSTKDSSKFVNGILDKLKKIRTQKNQKNLE"
FT   CDS_pept        617185..619209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_417"
FT                   /old_locus_tag="TGRD_421"
FT                   /product="DNA ligase NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_421"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13904"
FT                   /db_xref="GOA:B1H072"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H072"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13904.1"
FT                   /translation="MIMGNIQNRIDYLRKELIRHNGLYYESNNPEISDSEYDNLAKELE
FT                   QIEKENPLFALPDSPTKKISGFVSSSFEQIKHSSPMLSLDNTYSQKETAKWYERIEKNL
FT                   NNKNTEFTIEPKIDGVSASLTYINGSLTAGATRGDGETGEDITENIKKVKNIPYKLKAD
FT                   NPPYFFELRGEVYIDKSDFRKLNEEILMSVGQKFANSRNAASGSLRQKNPQITAERKLR
FT                   FFVHSLGKIDGKQFESQSDFLQYCRKCGFQLQDNFKICHSLKEIMDFMEIMINNRDLLH
FT                   YEIDGLVIKVNSLQLQKELGYTNKSPRWAIAFKFPAKQATTKLSRIRVQVGRTGIITPS
FT                   AILESVTLAGVTISHATLHNFEEIERLNVNEGDTVLIERAGDVIPKIVKVVKKENRGFF
FT                   KPPHNCPSCNSGIVKENEEEVAYRCINPECPAQFRRHLIHFVSRNAMDIDGFGKAVIDQ
FT                   FLDRKKIQVLADIYYLKYDDFIKLDLFKEKKTSNLMKAVAASKKHPLSKLLFALGIRRI
FT                   GEKVSEIIAKKFKSMEALFNASIEDFTRVPEIGSILALSLKEFFENKTVRNVIDNLIAA
FT                   GVNMIEPEAEQSGTQFDGKMFVLTGELKNHTREQAGKIIRSLGGKVASSVSKKTDYIVA
FT                   GVNAGSKLKKAKELNVKIVDEAEFDILTGKLSLIENTKF"
FT   CDS_pept        619283..619999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_418"
FT                   /old_locus_tag="TGRD_422"
FT                   /product="23S rRNA pseudouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_422"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13905"
FT                   /db_xref="GOA:B1H073"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B1H073"
FT                   /protein_id="BAG13905.1"
FT                   /translation="MKQQIEIIYQDENILVVNKPSGMFVIPGRNIYENKTLVEILRNQL
FT                   KQKLWVVHIIDRDASGVLVFAKNPETHRNISVQFENSKIRKKYIALLSGVLEENEGTIN
FT                   KPLIISGKNVRIDITGKESITDFKVLENFRSYTLVNALPLTVKRHQIRIHFWSLGHPLA
FT                   IDGEYGTLDPIFLSSFKRGYKIKKGKTENPLISRLTLHAAALTLILPGSGEEKTFEAAL
FT                   AKDFEVAVKQLRKYGR"
FT   CDS_pept        620134..621186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_419"
FT                   /old_locus_tag="TGRD_423"
FT                   /product="conserved Fe-S center protein"
FT                   /note="COG2768"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_423"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13906"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B1H074"
FT                   /protein_id="BAG13906.1"
FT                   /translation="MTSKVYFLSWDMRNELYNFLKAAMIFNHVKARNLLAVKIHFGEDG
FT                   NEGYIKPEYVLPVVKIAREKTAYPFLTDASTIYVGKRSDAYHHILTANKHGFTVEKCGC
FT                   PIIIADGLRGNTEEEVEVNLKYFKTVAIAREIYNADNFIFMSHFKGHEITGFGGALKNI
FT                   GMGCGSKAGKYAMHHLSKPTVSQKLCSGCRTCVKYCCQKALSLVSNKIVMDKEKCAGCG
FT                   QCIVNCVFKVFKLKWNEDPPAVQEKMIEYASGVLKDKKSAYINFLNHISKYCDCFALAK
FT                   NEPLMSDVGIVAGIDPVAVDQASYDLVNKAFGKNFFKEIFPEIDPTIQLKYAQELGLGS
FT                   RDYELIKYIL"
FT   CDS_pept        621271..621894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_420"
FT                   /old_locus_tag="TGRD_424"
FT                   /product="recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_424"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13907"
FT                   /db_xref="GOA:B1H075"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1H075"
FT                   /protein_id="BAG13907.1"
FT                   /translation="MNIEKIEKIKSKKDMFKVFLENGKSLAVFADSIVKFGIKTGCDIS
FT                   ENEFKELAYYDKSVGAVSYALALVSKRSYSSKNLQVKLIQKGCEPETAAKAVKKLEELN
FT                   YVNDKKFAKVYAAYLSQKGEGEFVIKAELEKQGIEKSLINDILETIKADIEPYEQIIKI
FT                   LKTKFKKFSGKDKNEIRRTASFFLRRGFSSQDIVKAFRLCSRSR"
FT   CDS_pept        621948..623504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_421"
FT                   /old_locus_tag="TGRD_425"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase /
FT                   IMP cyclohydrolas"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_425"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13908"
FT                   /db_xref="GOA:B1H076"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B1H076"
FT                   /protein_id="BAG13908.1"
FT                   /translation="MSTALLSVSDKTGIIDFAKELKNLGWNIISSGGTAKILKENSIEC
FT                   REISEVTEFPEILGGRVKTLNPKIHGGILAIRNKTDHIEQLKRHGIGTIDIVVVSLYPF
FT                   EAAINKIPKPADKKIDQNVIENIDIGGVALLRAAAKNYKDVIVICDLNDYKVVIKNLKN
FT                   NSITEELKLALAAKAFRHTAYYDSLISTYLTYEKFPMQIAIPLRKLSKLRYGENPHQEA
FT                   ALYSNGIEQDKSVVISAKQLHGKELSYNNYLDLEAAWQLVHEFNNPACAVIKHNNPCGC
FT                   AESTDIKDAYLKALDCDPVSTFGGIIAFNKAVEKDTAVEVSKLFVECVIAPDYSKEALD
FT                   ILTQKKNIRLLIQTIPYQEEKNSVEYRIMSHGMLAQDRDNQLLNEIKLMTKRQPTKAES
FT                   EALDFAWKVSKHVKSNAIILARGTQTVGVGAGQMSRIDSLKIAAEKMKSVKHGLDERLF
FT                   PLVLASDAFFPFPDVVEESAKVGVTAIVQPGGSVKDNESIKSADDRNIAMIAAGMRHFR
FT                   H"
FT   CDS_pept        624277..625104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_422"
FT                   /old_locus_tag="TGRD_426"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_426"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13909"
FT                   /db_xref="GOA:B1H077"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1H077"
FT                   /protein_id="BAG13909.1"
FT                   /translation="MKQKKKKITVSDITLLKKYFGFKGINTICQSAKCPNIGECFKKRT
FT                   ATFLILGEYCTRECDFCAVEKYNPELVDINEPAKIAKAIKRLGLSYSVITSVTRDDLSD
FT                   GGAEHFAKTINEIKTLIPESKVEVLVPDFLGNTKSIDIVLNAKPDVFSHNLETVPALYG
FT                   KVRKGADYKRSLKVLRYAKAAGFKVKTGIMLGLGETETQVFETIEDIKSTNIDTLTIGQ
FT                   YLAPTKEHYPVIREYSPAEFKTMEIFAVSSGIKQVASGRYVRSSYLAEENFCI"
FT   CDS_pept        627663..630809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_423"
FT                   /old_locus_tag="TGRD_427"
FT                   /product="transcription-repair coupling factor Mfd"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_427"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13910"
FT                   /db_xref="GOA:B1H078"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:B1H078"
FT                   /protein_id="BAG13910.1"
FT                   /translation="MNKIYLSGIGGSGKAHYLFRRISEMRSSIGGDINEVSDFRMFAFV
FT                   KDEELSSFYDDLHSFFNSAFHTPQDCELDVPVVKSSHSAPDIFILPSDNMQQRTFATDK
FT                   IKNLKSFIVCATDISINSPVLDSKNNIGINVAQNQKCDFSNLVTSLSSFGYTRTSFVED
FT                   KLQFAVRGEIIDVWTVAGEMPVRILFKYNTVEAIRVFDPESQLSNVFISEIKILPVSFS
FT                   ECNSTIKDYFDINDKENTMLYFDYLIGEEAEKSFDKYELIINDPLNAISQYQGYKSFTG
FT                   FQGNVNLFFNSLKDFAENDVKIKIYCANDSDRERISDLFYENRWNYKNPEFLYGSLSRG
FT                   FYLENAKVTCISSREMLYKKKPVSFPKIRGGSRLEGIWEILAGDYVVHEKYGIGRYIGL
FT                   KTISRENSISEYLCIEYKNGDKLYIPPEQIKTIKKYIGVEGVKPKLYSMDTLAWERVKS
FT                   RAREAAAKFAEELLKLYVQRSLIKRKPFGPGTAWEKELENTFPYDETPGQLKAIEDIKN
FT                   DFLKPYPMERLVCGDVGYGKTEVVVRAAFKAVHESMQTAILVPTTVLAQQHYNTFCDRL
FT                   SPFPIKVAVLSRFQTKAKQKEITQDLENGLIDIIIGTHRLLQKDVKFKNLGLLVIDEEH
FT                   RFGVKQKEKIKSMKKNIDILMLSATPIPRTLSSSLSGFRDLSVIETPPFGRLPIETSIS
FT                   LYDENLIKNIIEAELSRNGQVFYVYNKIETILTKAASIRELVPGIKLGIIYGQMKAKDI
FT                   EEIMWKFINMELDVLLATTIIESGLDIPSVNTMIIEEVENFGLSQLYQLRGRIGRDRKK
FT                   AYCYLFYKDKTLSDEAVKRLEAIREFGELGSGFRLALKDLEIRGAGGILSSSQHGFVRD
FT                   IGYDMFAKLLEEEGKKVKGDAVESQEKKNTVIDLQINALIPPTYIEGEDIRILFYRKLS
FT                   NAQNIKAIENIKNELLDRFGKIPNETQMLFEITNLRLTAEKLDIERIAEDNNYIYLYFS
FT                   RKADFSKADITKLTNDYSRIIEFITGKYYAFKLKKDMIDTNTVEYLEKFLSCLVFYIRT"
FT   CDS_pept        631017..631584
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_97"
FT                   /note="pseudogene of ADP-L-glycero-D-manno-heptose
FT                   6-epimerase"
FT                   /pseudogene="unitary"
FT   CDS_pept        631563..631974
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_98"
FT                   /note="pseudogene of 2-dehydro-3-deoxyphosphooctonate
FT                   aldolase"
FT                   /pseudogene="unitary"
FT   CDS_pept        632099..632641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_424"
FT                   /old_locus_tag="TGRD_428"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_428"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13911"
FT                   /db_xref="GOA:B1H079"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B1H079"
FT                   /protein_id="BAG13911.1"
FT                   /translation="MKNKKDIIKRAKNIKLLACDIDGVLTRGEIILLNSGEEIKIWNVR
FT                   DGMGYNELLKMSPEIKTAWITGRRSFQVEKHAKDMSIDYLVQNCTSKVVALERILKENG
FT                   FKTSEAAYIGDDIIDIPVLRVAGLSVCPIDACEEVKKYVDYVSVLSGGKGVVREVIELI
FT                   VKAKGKWKKSLNRYIST"
FT   CDS_pept        632662..633198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_425"
FT                   /old_locus_tag="TGRD_429"
FT                   /product="putative LPS/organic solvent-exporting ABC
FT                   transporter, periplasmic component LptC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_429"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13912"
FT                   /db_xref="GOA:B1H080"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:B1H080"
FT                   /protein_id="BAG13912.1"
FT                   /translation="MNFSKRYVIWFLMIIILFLSVFRFFICSAKKTAIEETLPIAEQII
FT                   EEFTITETHEGKLEMILKAESAIVNESENIAHLKLPVIKFYDKGSYISTFVAESADINM
FT                   DTYDIKGNGKCTVNSANNEYLQTESLIYNAKEELIYSNNNVKITRPSGTVCGTSFRSDT
FT                   KLDKIVIKNQRILID"
FT   CDS_pept        633191..633877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_426"
FT                   /old_locus_tag="TGRD_430"
FT                   /product="putative LPS/organic solvent-exporting ABC
FT                   transporter, ouermembrane component LptD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13913"
FT                   /db_xref="UniProtKB/TrEMBL:B1H081"
FT                   /protein_id="BAG13913.2"
FT                   /translation="MIKLNIALFIVFIFTVISFAGGISGKTLITGKEMEVRKAGEITIL
FT                   KGNSKVVTDGNVMTASKMIYDKKNSILSAFDNVILLSKMQSGERFEVCGNFANYYINDK
FT                   KGKFWGDNAVAKYFAQNSSSTLPIILHAQKIYIDRNLETLSAYDNVIIETSSGTVYSDN
FT                   AVFNGKTLNAIFQKYKKRPIAHISYDDRKGFYEADEMIFNIAYDNKKIIMNGGVAGKIE
FT                   MEDKTK"
FT   CDS_pept        633874..634593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_427"
FT                   /old_locus_tag="TGRD_431"
FT                   /product="putative LPS/organic solvent-exporting ABC
FT                   transporter, ATPase component LptB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_431"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13914"
FT                   /db_xref="GOA:B1H082"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:B1H082"
FT                   /protein_id="BAG13914.1"
FT                   /translation="MILRTKDLFKRYKHRTIVNGVNISVRQGEIIGLLGPNGAGKTTTF
FT                   YMMVGIIKPYDGSVYLDDTEITNWPMYKRARAGIGYLSQESSIFRGLTVEDNLMSIAQM
FT                   LPVSKAEQKEKVNLMLEDFGLTKQCKQLSITLSGGEKRRLEIARALITNPKFLLLDEPF
FT                   IGIDPITTYDVQKVTKKLKEKGLGILITDHNVRETLEIIDRVYIIHEGKIMFEGNAKEL
FT                   LENPKARKVYLGDNFRM"
FT   CDS_pept        634788..634935
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_99"
FT                   /note="pseudogene of ribosome-associated translation
FT                   inhibitor RaiA"
FT                   /pseudogene="unitary"
FT   CDS_pept        635078..635536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_428"
FT                   /old_locus_tag="TGRD_432"
FT                   /product="nitrogen regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_432"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13915"
FT                   /db_xref="GOA:B1H083"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B1H083"
FT                   /protein_id="BAG13915.1"
FT                   /translation="MKIMDFLSKDAIIIDMKSTDKKSAIIELVETLKKTKKVKKTDEII
FT                   SIIWEREKLGSTGIGQGVAIPHGKTNVLQEHMGVLGTSHKGIEFNSLDGELVHIIFLLV
FT                   GPVEVAGQHLKALSKISRLFKDKFLRQAIKDAVAAEEVVKIIEQEDTC"
FT   CDS_pept        635536..636371
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_100"
FT                   /note="pseudogene of HPr(Ser) kinase"
FT                   /pseudogene="unitary"
FT   CDS_pept        636368..637231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_429"
FT                   /old_locus_tag="TGRD_433"
FT                   /product="RNase adapter protein RapZ"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_433"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13916"
FT                   /db_xref="GOA:B1H084"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H084"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13916.1"
FT                   /translation="MIKLYIISGMSGAGKSQALKIFEDFGFVCVDNIPIQIVADFIDIC
FT                   LKDSIRYKNVAISVDSRAGKSLTSFKDLLIVFKKKNIGYKIIFFNATDSVLLRRYSETR
FT                   RRHPLGKSVSEGIKLERKIMDRIFTVADEIIDTSDLTIGELKKVISMLADICQSGKQYL
FT                   NTSILSFGYKYGLPNDADIVYDVRFITNPNYVHGLKFKTGRDEAVRKYIERQKEFSVFF
FT                   NIFSKLIETTLPGYIKESKSHLTIAIGCTGGQHRSVFTAEKLAGFLKSKKYKVKLNHRD
FT                   ILRHDN"
FT   CDS_pept        637498..637908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_430"
FT                   /old_locus_tag="TGRD_434"
FT                   /product="PTS
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_434"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13917"
FT                   /db_xref="GOA:B1H085"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:B1H085"
FT                   /protein_id="BAG13917.1"
FT                   /translation="MIKVVVSAHGKLAQELVNSAEVVAGKQSNLYVVKKSDNDSLVQMQ
FT                   NRINNLLKSINDEDGILILTDMIGGSPCSASASTCRSLNTEILSGVNLPMVLSAIFLSK
FT                   NTKTVSDLAEKVLLDGQKSIINVKKMLFNKIK"
FT   CDS_pept        637995..638498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_431"
FT                   /old_locus_tag="TGRD_435"
FT                   /product="PTS
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_435"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13918"
FT                   /db_xref="GOA:B1H086"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:B1H086"
FT                   /protein_id="BAG13918.1"
FT                   /translation="MPIVLVRIDDRLVHGQIVQGWLKILDVNIILVVSDIVTLDTMQQM
FT                   LMTMAVPDNIKLDIKNLKNATNGITNGQYDKERVMILAVSPSDILYMIEAGADFKSVNV
FT                   GGMHFISGKRQLLRNLCVNDNDVESLHKIHIKSVEIEGRILPEDEKKDIIPLIEKEYRS
FT                   MHSR"
FT   CDS_pept        638626..639273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_432"
FT                   /old_locus_tag="TGRD_436"
FT                   /product="PTS
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IIC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_436"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13919"
FT                   /db_xref="GOA:B1H087"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:B1H087"
FT                   /protein_id="BAG13919.1"
FT                   /translation="MSENVIFLAFIAALCTVDIIGFGQFMICSPIFCASLIGFLMDDIG
FT                   TALWIGMIVEMIWIDAIPMGVAVPIDISSISILSTFWVCKYFMGLHEAAIWGLILAVPF
FT                   AYLYRWIDVWGRNFNVKIMHWVEKGIQNGKDGRINFGIASGLFFFVSRAFLFYIFAMII
FT                   GGWIYANIYLQFSELVLECFKKAWYLLPVSGFGMVIHNFRNVKTPFLRHRDD"
FT   CDS_pept        639266..640042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_433"
FT                   /old_locus_tag="TGRD_437"
FT                   /product="PTS
FT                   mannose/fructose/N-acetylgalactosamine-specific component
FT                   IID"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_437"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13920"
FT                   /db_xref="GOA:B1H088"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:B1H088"
FT                   /protein_id="BAG13920.1"
FT                   /translation="MIKIYFKMFIRAFFIQALWNYERMQNIGFLFILKPFLYKIYLNKD
FT                   KRKKALLRHTEYFNTHPYMANLIIAIIANLEQKMAKGSSNEKVSDISAVKSAMEGPLAA
FT                   IGDSFFGGTLRPLAALISVFMLIFLKTSDSWFGAYNVLVPLLFIFLYNVVHIFVRYRLM
FT                   FVGLIFDRESIVRLSKFDFKLLWKMGNVSKFIISAAALFLYLKVFGFGPAANSILPKIT
FT                   INIVFIYGIVLVLSIFVSKKFSPTFLFYATILTCIA"
FT   CDS_pept        640065..640328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_434"
FT                   /old_locus_tag="TGRD_438"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_438"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13921"
FT                   /db_xref="GOA:B1H089"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B1H089"
FT                   /protein_id="BAG13921.1"
FT                   /translation="MKEKIIVVLNKMGLHARPAAMLVQIINEYQASVKILKDGFEVDAK
FT                   SIMGVMTLAAGQGSKLNFVADGLDENEVLSAIENLFKSKFGE"
FT   CDS_pept        640337..642073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_435"
FT                   /old_locus_tag="TGRD_439"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase
FT                   PtsI"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_439"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13922"
FT                   /db_xref="GOA:B1H090"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B1H090"
FT                   /protein_id="BAG13922.1"
FT                   /translation="MPDKDIIIKGVAASPGIAIGKAFLFENDDFCLVHKEIPQNERKDE
FT                   KKRLNDAIEKTKAELKITHDKINGILGKNYAQITNVYLLILDDPSIRKDVDKFIDEGVN
FT                   AEYSVFMVIDKIVRSFETIKDDYFKERILDIQDIGKKVLRNLLGKQRTTLASSNEDSIV
FT                   VSHNLAPADTVAIKEKLVKGFATDIGGKTSHTAIVAQGLAIPAVAGLKVISSQAKTGDT
FT                   IIVDGNKGEIILNPSAEILTKYKKECDMQFAKRKELEKLKDLPAETIDSHKVLIFANID
FT                   NPDEVQSVLDSGAMGIGLYRTEFMYFNRKTMPSEKDHFEEYFKVAEAISPYPTIIRTID
FT                   LGGDKLTRMGLLSMKHEENPFLGLRAIRLCLKYPDIFVDQLRAVLKASAYGKVKLMYPM
FT                   ISTLEELHEANRILEKVKQDLKKEHIKFDEKIEVGSMIEVPSAAMIIEAIAKEVDFVSI
FT                   GTNDLIQYTLAVDRVNENVASLYDPLHPTILRFIKRIIDESHKAGIDVGMCGEMAGDPY
FT                   YTPVLLGLGLDEFSVASAQIPKIKRVIRNISFGNVQRIAEEILKCGDRDSISKIISTIQ
FT                   MQ"
FT   CDS_pept        642261..644048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_436"
FT                   /old_locus_tag="TGRD_440"
FT                   /product="membrane GTPase, elongation factor 4"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13923"
FT                   /db_xref="GOA:B1H091"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:B1H091"
FT                   /protein_id="BAG13923.1"
FT                   /translation="MSNIRNFCIIAHIDHGKSTLADRLLEYTGTISRREMKDQILDDME
FT                   LERERGITIKAKVVRMDYTDKNGVKYILNLIDTPGHVDFTYEVSRSLAACEGAILVIDA
FT                   TQGVEAQTLANTMLARNAKLKIIPVINKIDLPTADANSAYEQMKEGLEVDADPILASAK
FT                   EGLGIREIVDSVIANVPPAKVVKEDPLSALVFDSFYDSYRGVIVIIRVFAGKIRKGMKV
FT                   KFMVSDAEYEVLEVGYIKMKMIESDELSSGEVGYVVARIKDIHNIKIGDTITESENPTR
FT                   HPHKGYKEINPFVFAGLYPNMTSEYDGLKTALGKLKLSDSSLVYFPETSVALGFGFRCG
FT                   FLGSLHLEIVKERLEREFGLNILVTAPNVIYKAKSKDKFVKIDNPAKFLNSSDIEEIWE
FT                   PYVEATIVCPVDYLGSILDLCRKRRGKQMLMKYMNTKIVILKYHIPLAEIIIGFYDALK
FT                   SASKGYASFDYVHINPQLGDLVKLEIMINAEVVDAFTVITHKDKAQSIAHYLTEKLRDI
FT                   IPRHMFEVPIQAKVNNKIIARETISVVRKDVLAKCYGGDITRKRKLLEKQKEGKRKMRR
FT                   FGKVDIPPEAFIAVLKIDG"
FT   CDS_pept        644148..644921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_437"
FT                   /old_locus_tag="TGRD_441"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_441"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13924"
FT                   /db_xref="GOA:B1H092"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B1H092"
FT                   /protein_id="BAG13924.1"
FT                   /translation="MELRLFLIGCVLFFTAMFMLAVKKYFKTSLSQRLFKKVYSWLDTG
FT                   WTALIIASFIMFFFIQAFKIPSGSMRETLLEGDHLFANKFIYGFRIPFTSNGKKYAALK
FT                   KVRRGDIVIFQCPPEALTISERESGIKKDYIKRCVAVAGDKVEIKDKKLYINNIFVNDT
FT                   YATFGDYAIFQKFNLFNTRKEYQKAWEKGKFTLISASFIRDNFGPVVVPEGHYMMMGDN
FT                   RDFSFDSRFWGPLSDKYIKGKALFLYWPVKRWRII"
FT   CDS_pept        644918..645337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_438"
FT                   /old_locus_tag="TGRD_442"
FT                   /product="NfeD-like membrne protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_442"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13925"
FT                   /db_xref="GOA:B1H093"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B1H093"
FT                   /protein_id="BAG13925.1"
FT                   /translation="MIWITWLIIAAVLIIFEILTSSVFFFTCLATGSVFAAASAYFNFS
FT                   SWVEFIIFIVVSILSLYLIRPIFKRVMSKSETVNSNIDVLIGATAVVTEKITPLKTGLV
FT                   KVSGEIWRAESDIELETGEIVKIKNIDGTTLTVRK"
FT   CDS_pept        645437..646357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_439"
FT                   /old_locus_tag="TGRD_443"
FT                   /product="stomatin-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_443"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13926"
FT                   /db_xref="GOA:B1H094"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B1H094"
FT                   /protein_id="BAG13926.1"
FT                   /translation="MAVLILAIVAFAVIFIANSVKIIRQYEKGLVETLGKYTGTKDSGA
FT                   NIIIPIFQRILRVDMRERVIDVPPQSVITKDNVSVVVDAIVYFQVTDPVKVVYNIENFA
FT                   IAALKLAQTNLRNVIGDMELDSTLTSREKINTQLRVVMDEATDKWGVKVTRVEIQKIDP
FT                   PRDITDAMSKQMKAEREKRANILEAEGLRQAAILKAEGAKQAIILDAEAVKEKQILEAT
FT                   GEAEAIRKVAEAEKYKIEVVYNAIHEGKPTNDLIAIKYLEALGKVADGQATKIFMPLET
FT                   SGVTASIGAVAELFKDTPKLAKVAK"
FT   CDS_pept        647920..648435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_440"
FT                   /old_locus_tag="TGRD_444"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_444"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13927"
FT                   /db_xref="GOA:B1H095"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H095"
FT                   /protein_id="BAG13927.1"
FT                   /translation="MIILNTGDGKGKTTSAVGQIIRSLGHEFRVCLIQLFKGENFYGEQ
FT                   KILVKLDNLDFFPFAKEHPDCIKGVNLDKVVSQCRSAVKKLRDLADVPEKYDLIVLEEF
FT                   NIALRDKFIDENEFIDIIKRLSQKSNVIVTGRGAPQSLIDIADLVTEMKEIKHPYKKGV
FT                   QSQRGIEY"
FT   CDS_pept        648547..649377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_441"
FT                   /old_locus_tag="TGRD_445"
FT                   /product="ABC-type cobalamin (B12) transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_445"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13928"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B1H096"
FT                   /protein_id="BAG13928.1"
FT                   /translation="MRIIVYIIAFLFLFADIACTEEYRRIISLAPSITESLYELGVEQF
FT                   VKGITIYCSKGMTEKEIIGTLLEPDIEKIALLNPDLIISTKEGNSKAVIEQLKRFGFEV
FT                   YVVETAKNFNEICVNYYNLAKKLDRKKEAEKIINAAKHSIEEVYGKINALNRLKVFWEI
FT                   GARPLYTAGKQSFVNDYNYYTKTVNLYKDADMRYLAVNIEDIIKRNPDIIVLVNAGVDI
FT                   NSEEIRNWNKYKMIKAVRNSKVIMIYAGDIFTPTPLTFVKGVAILAKVIYEDVF"
FT   CDS_pept        649377..650369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_442"
FT                   /old_locus_tag="TGRD_446"
FT                   /product="ABC-type cobalamin (B12) transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_446"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13929"
FT                   /db_xref="GOA:B1H097"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B1H097"
FT                   /protein_id="BAG13929.1"
FT                   /translation="MANKKFLFVYILMPVSVLVVFLFSLTIGLDGISFVDVVKALFEGA
FT                   DGNVVVMIKQIRLPRIFMACMVGAGLAISGCVFQAILKNPLADPFTLGISGGASLGTSV
FT                   AFISGLAAIRSFFIPFCAFAGMIVSVSVVYLLSMQKRFNSNAMILSGIVVSYIFSSAVM
FT                   LMFALSTENSVQTAFLWLMGNFSSFDERLLPFITVVVLISIIILSLSGNIINAVSLGGE
FT                   KSKTFGINIERNIKFLFLTASFVTAATVSICGVIGFVGLMIPHIMRKITGTNNVILIPA
FT                   SAFAGAFFLPLCDTLSRMLFSPVLIPVGVITSIIGGLFFICLLLKPDRK"
FT   CDS_pept        650425..651210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_443"
FT                   /old_locus_tag="TGRD_447"
FT                   /product="ABC-type cobalamin (B12) transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_447"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13930"
FT                   /db_xref="GOA:B1H098"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H098"
FT                   /protein_id="BAG13930.1"
FT                   /translation="MIRIENISAGYLNKEILKNISCDIDKKDFFGIIGKNGTGKSTLLR
FT                   VLCNLIKPYSGNVLIDGRNINSFSRKEFAKTISFLPQHIDTSLSFTVSEFIMFGRYPYM
FT                   NMFKIPSDDDYAAIKKVMNFLCIKNFAEKNINELSGGEKQIVLIAQVLVQETDIIVFDE
FT                   PTSHLDIGNQNDILEILKDLNEKCDKTIILSLHDLNAAGEFCSKLVLIENGSVCRQGTA
FT                   EEVLNYRDIERVYNTTVVVKTNPISNRPYVIPVSKTGKR"
FT   CDS_pept        651214..651370
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_101"
FT                   /note="pseudogene of TonB-dependent outermembrane cobalamin
FT                   (B12) receptor"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(651375..653210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_444"
FT                   /old_locus_tag="TGRD_448"
FT                   /product="putative undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_448"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13931"
FT                   /db_xref="GOA:B1H099"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B1H099"
FT                   /protein_id="BAG13931.2"
FT                   /translation="MNYKLWFWVVNIVSTVLRFLVTSKIDITIDEVYRHLDLFYFDHSP
FT                   ITAYLTKASILIFGNNELAVRFPTALIFFFICWIFFICTKKLYNERTAFTGVLLLNILP
FT                   AFSLWGFTITLLNSLFAFFWISTLLVFIILIETDNKNYWYLLGIITGFTMLSGYNNALI
FT                   SFSVFTPLILLPSHRYWFKRKEPYLALIISALIFLPVIIWNIGNNSLSHSTGILPPKFS
FT                   LTLLETSLAVQACYYISTFLFLIFITAALLCVKEVYQKKDRAAIIIACFSFPAFFPIKG
FT                   IAVFNEILPHWTTATGYLVLSIYAVHLTLKFWHIKWFRVYSYAAWGFALFTLITVSMHT
FT                   YPTEKFLPTNQRHVISEPEKIYIKNEFHNWENTVRIMNLKEKPFIFMYKSYPASKFVSS
FT                   DNNDAYGIRQKYLNSHTADVLKPEKDLRQKLIEFDHSVFKFINSNLKSKFLDFYISLIS
FT                   YCDSTYFNLSFFVILIISIGILWNNKKERFWTALIFLASVVAIGAVITFFLKYYFERPR
FT                   PLKVLGDKNVNTFFEKLYFNAFPSGHAQIAFSICTFMFIVVKKYWYWYLILALGVSFER
FT                   IYAGSHFPFDVLVGAIIGIIFSYATVALFRKYFKI"
FT   CDS_pept        653434..653724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_445"
FT                   /old_locus_tag="TGRD_449"
FT                   /product="DUF1805-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_449"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13932"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A0"
FT                   /protein_id="BAG13932.1"
FT                   /translation="MQLKEFIVKRKKYYGFECELFSGSNLVFIKGNNGFIMCGYLNLET
FT                   AERMRNIAAVVTGVKTVDDMLKKNIVSSTTHAQKVGIKPGMSVLEVLERIF"
FT   CDS_pept        653766..654297
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_102"
FT                   /note="pseudogene of DNA methylase N-4/N-6"
FT                   /pseudogene="unitary"
FT   CDS_pept        655033..655993
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_103"
FT                   /note="pseudogene of adenine-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        656024..657130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_446"
FT                   /old_locus_tag="TGRD_450"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13933"
FT                   /db_xref="GOA:B1H0A1"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A1"
FT                   /protein_id="BAG13933.1"
FT                   /translation="MNKKIETPYYLIDERKLLRNLKKIKYVRDNSGAKSVLALKCFSTW
FT                   AVFDLMSKYMDGTTSSSFYEAKLGHEKFGKETHAFSVAYSSDDVKALKNIADKIIFNSV
FT                   SQLNMFYNDIKHIKVGLRINPGISYSHFDLADPSRKYSRLGVTLEEEIMSVLDKISGLM
FT                   FHYNCENDDFKSFSVMLDEIAAKYEKVLNKVEWVSLGGGLYFTKDGYPLDKFCKKLKSF
FT                   SKKHNVLVYLEPGETAIIKSCELITTILDIVKNVKDIAIVDASIEAHMLDLLIYRTPAE
FT                   INAKDGKNEYIIAGRSCLAGDIFGEYKLADKLKVGSTVHFANAAGYTMVKKNWFNGLKM
FT                   PSIVVKKLDGKMEIIKKFLYNDFLKDLS"
FT   CDS_pept        657148..658365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_447"
FT                   /old_locus_tag="TGRD_451"
FT                   /product="putative carboxynorspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_451"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13934"
FT                   /db_xref="GOA:B1H0A2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A2"
FT                   /protein_id="BAG13934.1"
FT                   /translation="MGKRNILLLGAGGVSHVAAHKLAQNNDLFGDIYLASRSLENCEQI
FT                   LESIERKKNYKNTSKKIQIRQIDALNIPEMVKLMKDLKISITVNLVSVFCNMSILEACI
FT                   ETGSAYIDTAIHEEPNKVCEDPPWYANYEWKRKDRCQDKCITAILGAGFDPGVVNAYVA
FT                   YAKRHFFDDIDTIDIMDVNAGNHGRYFSTNFDPEINFREFVKVWTWIDRQWVCKPIHSE
FT                   KKVYDFPVVGKQTIYLTGHDEIHSLSKNIDANSIRFWMGFSDHYINCFNVLKNIGLLSE
FT                   KPVRTAEGVEVVPLKVVKACLPDPKTLAPYYRGKTCIGDLIVGTKDGHRKEFLIYSVCD
FT                   HRFCYEEVESQAISYTAGTPVIAAAILIAKGDWDVKKMVNVEELVPDPYLDLLKDMGIS
FT                   TETMTI"
FT   CDS_pept        complement(658754..659782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_448"
FT                   /old_locus_tag="TGRD_452"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_452"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13935"
FT                   /db_xref="GOA:B1H0A3"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A3"
FT                   /protein_id="BAG13935.1"
FT                   /translation="MKKLKVAVAGATGAVGLEIIKMLENRNFPVESIKFLATERSVGKK
FT                   LIYKGKEVSVELLKKNSGKGINIALFSAGATVSKEFAPCFASDGCFVIDNSSAWRMNKE
FT                   IPLVVPEVNPHDLKKEKKLIANPNCSTIQMVVALKPLHNFAKIKRVIVSTYQAVSGAGQ
FT                   KGINELKEQTKAWAKGEIIPEANKFQYQIAFNLIPQIDVFTENGYTKEEMKMTNETKKI
FT                   IGDNSIEVSATCVRVPVFRSHSESVWIETEKPLSPGQAKELLSKTDGIQLLDDPENKKY
FT                   PMPLFAENMQITYVGRIRSDISTISTKNNALTFWIVSDNLLKGAALNAVQIAETLLKKE
FT                   LL"
FT   CDS_pept        complement(659862..660923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_449"
FT                   /old_locus_tag="TGRD_453"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_453"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13936"
FT                   /db_xref="GOA:B1H0A4"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A4"
FT                   /protein_id="BAG13936.1"
FT                   /translation="MSKTYKIAIIPGDGTGPEVIKEGIKIIETAAKKNDFKLDFTDYDL
FT                   GGQRYLKTGEILPESVIEEFKKFDAMYLGAIGHPDVKPGILEKGILLKLRFELDQYINL
FT                   RPVKLYPNVETPLKDKKPEDIDMVIVRENTEGLYTGAGGFLKKDTPQEVAIQESINTRF
FT                   GIERCIRYAFKLTQNRAKNNKLTLCGKTNVLTYASDLWQRTFNAVAKEYPQLKSDYVNV
FT                   DATCMWFVKNPEWFDVVVTDNLFGDIITDLAAMIQGGMGVAAGGNINPEGVSMFEPMGG
FT                   SAPKYTGLNIINPIASINAGAMMLEKIGESKAAKDIDNAVIKALESGKIKSMSAGKMGL
FT                   STTEVGDLIASFI"
FT   CDS_pept        complement(660968..661459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_450"
FT                   /old_locus_tag="TGRD_454"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_454"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13937"
FT                   /db_xref="GOA:B1H0A5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0A5"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13937.1"
FT                   /translation="MSDIILKGKVHKYGSNVNTDEIIPARYLNTTDPTILSKYCMEDID
FT                   KNFVKNVKAGDIIVAENNFGCGSSREHAPIAIKASGISAVIANSFARIFFRNSINIGLP
FT                   ILESQKAVKAIENGDAVEINLTKGIIKNITKNESYQSQPFPEFMQKVIKSGGLLGYIKS"
FT   CDS_pept        complement(661678..662940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_451"
FT                   /old_locus_tag="TGRD_455"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_455"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13938"
FT                   /db_xref="GOA:B1H0A6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0A6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13938.1"
FT                   /translation="MGNTITEKILASHCGKKVVEPGEFIEPKIDIALSNDVTAPLAVKE
FT                   FRKTGIKKVFDKNKIALVMDHFTPNKDILSAEHVKFVREFAKEHKIKHYYEGGNVGVEH
FT                   ALLPEKGIVVPGDVIIGADSHTCTYGALGAFSTGGGSTDIAAAMATGKIWFKVPNSIKF
FT                   ILNRKLNKWVSGKDIILYIIGLIGVDGALYNSMEFDGPLCKKLTMADRFTITNMAIEAG
FT                   GKNGIFTPDEITENYVAKRAQRKYKFYISDKDAKYLKIYEIDCSKILPQVSMPFLPSNT
FT                   KAVKDIKKTYIDQVVIGSCTNGRIEDLRVAASIIKKGKKVNSNVRTLIIPATPEVYSQA
FT                   LDEGLLRIFMDAGAIISAPTCGPCLGGHMGILASGEKCASTTNRNFRGRMGHVESQLFL
FT                   VNPAVAAASAIKGYIASPDEI"
FT   CDS_pept        complement(662944..664494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_452"
FT                   /old_locus_tag="TGRD_456"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_456"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13939"
FT                   /db_xref="GOA:B1H0A7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0A7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13939.1"
FT                   /translation="MEKDIIIFFDTTLRDGEQSPGASMNLKEKLLVANQLAALGVDVIE
FT                   AGFPISSQGDFEAVKTISQQIKTSSIAGLCRASEKDITTCWNAVKYAKKPRIHIFLATS
FT                   DLHIEKKLQKTRAQILDMAVKTIKYGKSLCKDVEFSAEDAGRSDMDFLCKVVEAVIDAG
FT                   ATTVNIPDTVGYTTPIEFGNKIAEIKRRVPNVNKAIISVHCHNDLGLAVANSLSAIENG
FT                   ARQIECTINGIGERAGNTSLEEIAMTLKVRHHYYNVKHTLKTNELYNTSKLVSRLTGIL
FT                   VQVNKAVVGANAFAHESGIHQDGVLKARETYEIMSPADVGVPESLLVLGKHSGRHAFFK
FT                   RIKDLGYKLDEKTLEHLFEKFKILADKKKTVFDDDIIALIEEDTSSGKETFILNYLSAT
FT                   SGTGTIPTATVKISKSEGNKKTKSITLQAAACGSGPVDATYKAIDKIINMDIKLTDFSL
FT                   RSVSSGEDALGEVVLKAEYKGTIYSGKGTSTDIIEASAKAYIQAINKAKLFYDNKKGK"
FT   CDS_pept        complement(664793..665828)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_104"
FT                   /note="pseudogene of S-adenosylmethionine:
FT                   tRNA-ribosyltransferase-isomerase (queuine synthetase)"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(665825..666949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_453"
FT                   /old_locus_tag="TGRD_457"
FT                   /product="SpoIID-like putative peptidoglycan hydrolase
FT                   enhancer protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_457"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13940"
FT                   /db_xref="GOA:B1H0A8"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A8"
FT                   /protein_id="BAG13940.1"
FT                   /translation="MNIKGLLLFIVFFLCCNIYASYDAQETINVGIILNTSSFTTGGLE
FT                   DFFISDASNKKLRLTKGTVEVLCSEEGISIKKHLLSPPVKIESSNGSIFANSKLYRGYL
FT                   MIIKSENKMNIINVLPIEDYIKSVLPKEAVANWNIEALKSQAVISRTYAITNLNKHSSQ
FT                   GFDICSTTHCQVYDGASVEVDSCNKAVLETQCKVLSYDGKFAQTVFHANCGGHTEDPKY
FT                   IWNWKDMPPYLKGVKCGYCDTAPHTKWEKTLDESFIRKKLSNNNIGKIKSIKIKGKTPT
FT                   GAAKELKITHSKGEVTLNAYQFRLAVDTWYIKSHTFDFIKTDGNKFYFKGRGWGHKVGL
FT                   CQWGAKGMAEKGKTYKEILAHFYPGTTIKKVVYK"
FT   CDS_pept        complement(667230..667491)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_105"
FT                   /note="pseudogene of epoxyqueuosine reductase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(667493..668515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_454"
FT                   /old_locus_tag="TGRD_458"
FT                   /product="holliday junction resolvasome helicase subunit
FT                   RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_458"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13941"
FT                   /db_xref="GOA:B1H0A9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0A9"
FT                   /protein_id="BAG13941.1"
FT                   /translation="MNEIKRIVEGSKLTEENRIENSLRPQILDDFIGQDKLKNNLKIFI
FT                   EAAKKRHEALDHCLFYAPHGLGKTTLSHIIAKEMGCNLRITSGPVLERVGDLAAILTNL
FT                   SDGDVFFIDEIHRMNHFVEESLYPVMEDFELDIIIGQGPSARTIKLPVPRFTLIGATTR
FT                   AGLLSSPLRDRFGIIEHLDFYAIKELEHIVNRSAAIMNIGVDEDAGKEIARRSRGTPRI
FT                   VNRLLKRVRDFAEVRGGKITHAIAKGALNALEVDSAGLDKIDRLILTVLIEKFGGGPVG
FT                   IDTIATAVAEESDTITDVYEPYLIQSGFVARTPRGRVVTSDGYKHIGIDPPKNSQRELL"
FT   CDS_pept        complement(668561..668911)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_106-2"
FT                   /old_locus_tag="TGRD_459"
FT                   /note="pseudogene of DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(669306..669920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_455"
FT                   /old_locus_tag="TGRD_460"
FT                   /product="holliday junction resolvasome DNA-binding subunit
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13943"
FT                   /db_xref="GOA:B1H0B1"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0B1"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13943.1"
FT                   /translation="MIDYLYGTLDSKSTDGITIDVNGIGYEISVPISTFLKLPETRNPI
FT                   KIYIVESTAGMYGGVISLYGFFTIEEREMYLLIKDKVHGIGAKKAMEYTDKISKSFANF
FT                   KTAIISKNPSMLNEIFGFTKKTADKLIVALKDKISTVNVLNKEKQTGAETIKNTMVSEA
FT                   IAGLITLGYKMQQARVAVTNVYEHNENITLEDLIKKSLQYL"
FT   CDS_pept        complement(669948..670520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_456"
FT                   /old_locus_tag="TGRD_461"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_461"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13944"
FT                   /db_xref="GOA:B1H0B2"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0B2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13944.1"
FT                   /translation="MIILGIDPGLSLTGWGVVEAFSRDKVNPLQYGCIKTMPSVPLIQR
FT                   LQTINTKLQSVIDKYKPEVASIEELFFFKATKSIAAVGQTRGAIILTASLNKIPLFEYN
FT                   PKSVKTALTGYGSADKYQMQRIVKTFLRLKEIPKPDDAADALAIAVCHVNTINWNANNN
FT                   NNASVFLKNKVFKESAKPNLLKKLFSL"
FT   CDS_pept        complement(670543..671298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_457"
FT                   /old_locus_tag="TGRD_462"
FT                   /product="DNA-binding regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_462"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13945"
FT                   /db_xref="GOA:B1H0B3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0B3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13945.1"
FT                   /translation="MSGHNKWASIKHKKTATDVKKGKVFTKIIREIVVATKESGAQIEN
FT                   NARLRKAIEDAKEANMPQDNIKKAIQRGTGEIPGAIYEEMVYEGYGPAGVALIVEVTTD
FT                   NKNRTASDIRKMFSSHNGNLGEAGCVGWMFERKGYITVKKSAADEEIVMNTVLEAAVED
FT                   FKSEADSDVYEIITLSSDLETVKNVLKEKNITVESAEVTMVPQTQIALKSDNAKNMLKL
FT                   MDALEDHDDVKNVYANFDISSEDMEKLNA"
FT   CDS_pept        complement(671374..671790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_458"
FT                   /old_locus_tag="TGRD_463"
FT                   /product="FoF1-type ATP synthase epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_463"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13946"
FT                   /db_xref="GOA:B1H0B4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0B4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13946.1"
FT                   /translation="MNKFEVEILSPEGIVFKGATPSVSFPTTRGIITVLSGHINLITKL
FT                   NSGEIIIEATDGTKKIIVSGGFIEIVNNNVNVVAEFAAHSDEISRQKIKQAIDHAKDMK
FT                   NKRKEFVNMYAIESQLKKSAVDLKSGLEIKRKKI"
FT   CDS_pept        complement(671825..673237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_459"
FT                   /old_locus_tag="TGRD_464"
FT                   /product="FoF1-type ATP synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_464"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13947"
FT                   /db_xref="GOA:B1H0B5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0B5"
FT                   /protein_id="BAG13947.1"
FT                   /translation="MENKENVSVQGAVIRVQGAVVDFKFEDAVPEVYEALILKMPGGSD
FT                   LILETMFEMDNSEVRTIAMGSTDGMKKGMKATRTFAPIKVPVGEKTLGRIFNVLGEPID
FT                   ALGKIDDSVKRHPIHRAAPAFMDQKTSPEMLETGIKVIDLVSPFTKGGKIGIFGGAGVG
FT                   KTVIVKELIRNIAAVHKGHSVFAGVGERTREGTDLWMEMVESKVMDKTVLVFGQMNEPP
FT                   GNRMRVALTALTMSEYFRDEKGEDVLLFIDNIFRFAQAGSEVSALLGRMPSAVGYQPNL
FT                   AKDMGDLQERITSTNKGSVTSVQAVYVPADDYTDPAPVAIFAHLDATLTLDRSIMEQGL
FT                   YPAVNPLTSSSRLLDPNIIGEDHYNTAMSVKKILQKYKDLQDIIAILGMDELSDEDKLT
FT                   VSRARKVQKFLTQPMFVAETFTGLEGRYVKTENTIKGFKDIIEGKYDFLPEQAFYMVGS
FT                   IEESAEKSKKYS"
FT   CDS_pept        complement(673240..674085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_460"
FT                   /old_locus_tag="TGRD_465"
FT                   /product="FoF1-type ATP synthase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_465"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13948"
FT                   /db_xref="GOA:B1H0B6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0B6"
FT                   /protein_id="BAG13948.1"
FT                   /translation="MAQNLQQLKKRIKTSDSIAQIAKAMEMIAASKIRKAQNYVEKHNP
FT                   YARKIKYMVQRILTDKDLYDEIEKFSKERKGKRLIYIISPDKGLCGGLVVNLFKKVSFN
FT                   VQSSDYVVAIGKKSANDATRYNYNVLASFGMGTSFPKYDDIYPIIDIAKKLYISGEVTK
FT                   VSVIYTEFKNMLVQKPAIEEILPVKPDKSFKENKMDYIFEPDPQQVLEDLLPYYFEVEF
FT                   YSAFMNAYASEQAARMTAMKNAKDNANDISASLTNIYNKSRQEKITNEILDLANGQQEI"
FT   CDS_pept        complement(674060..675601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_461"
FT                   /old_locus_tag="TGRD_466"
FT                   /product="FoF1-type ATP synthase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_466"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13949"
FT                   /db_xref="GOA:B1H0B7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0B7"
FT                   /protein_id="BAG13949.1"
FT                   /translation="MKPEEIIQKIEKELYSTQVKPELINFGVIETVGDEIVKASGLSNA
FT                   GYYEEIEFEDESIGFVLNIDEDYVSIVLLKNSGHIVRGMKVKSTGKVLSIAVSYKLIGR
FT                   VINTLGQPIDGNELKHIDSVHYPVEKIAPGIIQRNSVDNPLKTGIKAIDAMTPIGRGQR
FT                   ELIIGDRGTGKTAIAVDTIINQKKLDMGLKSVICIYCSIGQKKSNLASITAKLKEEGAM
FT                   DYTVVIAATASEPASMQYIAPLAACAIGEYFMDKGKDVLVVYDDLTKHAWAYRQISLLI
FT                   KRPAGREAYPGDIFYLHSRLLERAARMSDKNGGGTLTALPIIETQGNDMSAYIPTNVVS
FT                   ITDGQIYLEADLFNSGIRPAINVGLSVSRVGGAAQTKSMKQLAGPVRLELSQFRELQSF
FT                   TQFGSDLDEYALKRLERGKRITEILKQQQYKPYDEISEILSIFAVTSGLFDDINVNKVL
FT                   EAEQQMTEFIKKTYPETVKKLATGEKIDDSLKAELEQEIKEFKKINNYGTESATA"
FT   CDS_pept        complement(675598..675954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_462"
FT                   /old_locus_tag="TGRD_467"
FT                   /product="FoF1-type ATPase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_467"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13950"
FT                   /db_xref="GOA:B1H0B8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0B8"
FT                   /protein_id="BAG13950.1"
FT                   /translation="MKISKIRELTKSIVKYDELSTKDLEWIFSNFSRQELKLFMRLLSK
FT                   EIKNNTVTASFAGELSYENKKKINAMFPNRKILFKRDDENISGGVRFEYGDFVLDYSVS
FT                   GIIKRILNGIRENL"
FT   CDS_pept        complement(675935..676444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_463"
FT                   /old_locus_tag="TGRD_468"
FT                   /product="FoF1-type ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_468"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13951"
FT                   /db_xref="GOA:B1H0B9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0B9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13951.1"
FT                   /translation="MEIIQKFGLEAKLFLFQLINFLIIVFILKKFLFAPLKKILDERKR
FT                   KIEQSLQDAENAKIALENASEKKKNILAKAKSSADTLMATVKVSIKETKEKAVIEAKQR
FT                   SEQIIDEAKQKAATEFESMNKKIGKISVDISGKVMSKVLSDLFTETEKQKLMSRALEKI
FT                   DENIKN"
FT   CDS_pept        complement(676464..676670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_464"
FT                   /old_locus_tag="TGRD_469"
FT                   /product="H+-binding type FoF1-type ATPase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_469"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13952"
FT                   /db_xref="GOA:B1H0C0"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C0"
FT                   /protein_id="BAG13952.1"
FT                   /translation="MIFTLAGGIIIAVGGLGPALGIGFIGAKAVEAIGRNPEASGKIMI
FT                   NMLIAMAFAEAIAIYSLIFAFTK"
FT   CDS_pept        complement(676667..677422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_465"
FT                   /old_locus_tag="TGRD_470"
FT                   /product="FoF1-type ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13953"
FT                   /db_xref="GOA:B1H0C1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C1"
FT                   /protein_id="BAG13953.1"
FT                   /translation="MQLSPEILFSIAGFPVTNTVIATVITDIAIIALVLTASRAIALKP
FT                   SNIQNAVEAIVDYFRETTEEIAGEKASFIYPWVLSFFLFILISNLLAQFPGFESIRFQT
FT                   LTSEHHGVPFLRAATSDLNFTLALAAISVIVTHYFSIKYTGIKAYLTRFITFKMFPIFL
FT                   FVGILEFVNEITKLISFSFRLFGNIFAGERVMSNMYGLFPFGLPLPFIILEIMVALIQA
FT                   IVFAMLTMAFMHIMTDKSHSEARKKGEMK"
FT   CDS_pept        complement(678005..678661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_466"
FT                   /old_locus_tag="TGRD_471"
FT                   /product="lipoyl(octanoyl) transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_471"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13954"
FT                   /db_xref="GOA:B1H0C2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C2"
FT                   /protein_id="BAG13954.1"
FT                   /translation="MLRWIDDIPRNAAMNMALDEMLFNEYKNNPVLRTYYWDNAYTTIG
FT                   YFQKAKDAGGSGLVRRFTGGLTVNHHNDISYSVITSSDFFNVYNQQEIYRNIHLAIQKA
FT                   LQALGINSIILNKKTRNTSIICVQTFCENDLILNGKKIAGSCLRRRGSKLIVQGSIHIR
FT                   LNIAEKKVFSVNFAKNTAEFLKTEIKTSSFDNNDIKQAQKIAGEKYSNLQWNNKF"
FT   CDS_pept        complement(678645..678968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_467"
FT                   /old_locus_tag="TGRD_472"
FT                   /product="6-O-methylguanine-DNA methyltransferase
FT                   DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_472"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13955"
FT                   /db_xref="GOA:B1H0C3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C3"
FT                   /protein_id="BAG13955.2"
FT                   /translation="MKKIPKDIIEKMKNYPDFYVKVWKACFKISAGKTLTYLQLAKNIG
FT                   APKAARAVGTALSKNPFAPVIPCHRVIRTDGKMGGYSAAGGIKKKLKMLRYEKETGKDA
FT                   SLD"
FT   CDS_pept        complement(679059..680357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_468"
FT                   /old_locus_tag="TGRD_473"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_473"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13956"
FT                   /db_xref="GOA:B1H0C4"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C4"
FT                   /protein_id="BAG13956.1"
FT                   /translation="MTDHKNKKLENIPKLPGVYIMRDGVGSIIYIGKAKSLKNRVSSYF
FT                   NADINSKAASIITAMRKIDYILCTSEREALIIERQLINKVQPYFNSMWKDDKSYPYIKF
FT                   SIDEDFPRLALTRKKLKDGALYFGPYPQVFYIKKFVRWLVKLFKIRPCKMDLSEESLPE
FT                   EKKVKSCLYYHTEMCTGPCLGKIMSKDYKKKIKDIELFLNGKFKKLEDDWKTQMFDLSE
FT                   NMRYEEAKEIRDRLYALQNMSERVIISEITQDEINNSVKRANSINELKNVLRLKHQPAV
FT                   IEGFDNSNIQGTNAVASMVRFQNGIADKKNYRRFKIKTVAGADDFASMKEVVFRRYSSL
FT                   IRKNEKLPDLILIDGGKGQLGAAVSALEELQSQIPIISLAKKNEEIFLPSKDSAMLLSR
FT                   HSAALRLLQSVRDEAHRFAVSYHRKLRAKEFGV"
FT   CDS_pept        complement(680379..681920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_469"
FT                   /old_locus_tag="TGRD_474"
FT                   /product="putative peptidoglycan lipid II flippase MurJ"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_474"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13957"
FT                   /db_xref="GOA:B1H0C5"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C5"
FT                   /protein_id="BAG13957.1"
FT                   /translation="MGNKTLAKNAVKTAFGTALSRILGYIRDMLVANLFGIGMSADAFY
FT                   AALKIPSLFRRLFGEGSFSAAFIPVLSEYLNTKEKTETQKFLNAIFTVLLLILAAISIL
FT                   GICFAPALAKLTAWGFANNPEKMQLTIELTRLLFPLILFICLAAFLLAVLNTLHSFFIP
FT                   ALAPGAISFSEVFYMLIFAPAIIQGNQLKGLAVSIVAGGALYFFIQYPKLKSLGWHLKF
FT                   KIDLKHPGIKKIAFLMIPSMIGLSADQINAFVDNVCASFLGDGPAGVLYYSNRLMQMPL
FT                   AVFGLAFATASLPAMSKAYIQKDITALKNSLNYSIRFTVFILLPAAAGLMVIGLPIVKL
FT                   LFEHGKFNYSGSLMTYNALFYYSLGLPAYGAAKIFANVFYSFQDTKMPVKIAISAMILH
FT                   VILCFLLMRPMGVGGFALATAASSYFNLFLLAAYLRKRIGKLGLKKILLSSSKSLFASV
FT                   ITGITAWNVCRISENLFISVPISIISGLAAFAAVSYILKSEELNSFMQFLSRKQK"
FT   CDS_pept        complement(682367..683147)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_107"
FT                   /note="pseudogene of uvrD superfamily helicase-like
FT                   protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(683188..684352)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_108"
FT                   /note="pseudogene of putative ATP-dependent endonuclease
FT                   YbjD"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(684724..685581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_470"
FT                   /old_locus_tag="TGRD_475"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_475"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13958"
FT                   /db_xref="GOA:B1H0C6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0C6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13958.2"
FT                   /translation="MDIIVISGPTASGKTKKAVEFCKEKNGEIISCDSRQIYKYLDTGT
FT                   NKEGVFLQNGLRRIDGVLQHLTDILNPDQNYSAAKFVKDADLKISEILKKGKVPVVTGG
FT                   TGLYIKALLYGLDEMPKADKTLRKELKTKSQDELYSVLLKSDPEAAEKNKKNPQRLLRA
FT                   LEVNILSGRTMQEHFKSKSPRYNFGHYSISVDNKILYKKTNERCKYMIESGMIEETQKV
FT                   LNMGFDKNCSALSGIGYRHIIQYLEKKISKEDLILEFSKDTRHYAKRQNTWFKAQPDVD
FT                   FMFY"
FT   CDS_pept        complement(685636..685714)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_109"
FT                   /note="pseudogene of putative nuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(685796..687583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_471"
FT                   /old_locus_tag="TGRD_476"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_476"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13959"
FT                   /db_xref="GOA:B1H0C7"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0C7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13959.1"
FT                   /translation="MPINILSQETVNKIAAGEVVERPLNAVKELVENSLDAFASSITVE
FT                   IEEAGKKLIRVSDNGFGMDKKDLELSILRHATSKIDDFKDLMHIHSLGFRGEALASIAA
FT                   VSNFAIKTRKKGENSGWKLSVAGAKDIKVMPWSGAEGTITEVKSLFFNTPARQKFLKSD
FT                   STERSRIINSLEETALANYDISFKIFSENKTVFSAAQTDSKTERIADILGKDFAKTLKN
FT                   IKIDHPKISLDVYFTGRDNSLPNKKYQYLFVNSRPVNYPKRLMHCVYQSYKESIPRDKY
FT                   PGILIYTDVDPSEIDVNIHPAKREVKFADENGIYDILFKALRNALMSQGHPEIKITYPP
FT                   LDKEKSAKQEVEGSTAPRFPKIQQPVIYAREPKPKYNYASLKQTCSIDKYADVFAKQEE
FT                   LTPENFDSNIKVIGQVFDTYIIASNKGDLYIFDQHAAAERVRYEFYLSQMKSQTIKIQQ
FT                   MLMPENFDLSPSISELLKANINIFNELGISIEEFGQNSFRITAYPALLGNISMEQIVKT
FT                   IISDIEDDKHAEIEQKRDKIIRSACRASIKAGDNVSFIEAKKLINDLFKCKQPFTCPHG
FT                   RPTAYKISLNEIEKFFKRK"
FT   CDS_pept        complement(687574..690148)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_110"
FT                   /note="pseudogene of type III restriction-modofocation
FT                   system, restriction subunit"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(690281..691769)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_111"
FT                   /note="pseuogene of type III restriction-modification
FT                   system, methylase subunit"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(691885..694308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_472"
FT                   /old_locus_tag="TGRD_477"
FT                   /product="SMC-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_477"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C8"
FT                   /protein_id="BAG13960.1"
FT                   /translation="MPIKINNLTISGIRGIQNTINLQLNGKSILLYGENGSGKSSITDA
FT                   IEWLYKDSVSHLENTEINLKDALRNSYTDKAINSEVYIKDNQNFNISKKLFYKGSKLVS
FT                   DLSNTSETYMLASEKENLLIRYYLLRNFVSQTKSDKLKLLSDIIGFSEVTKTKEILKKT
FT                   FNSVKNKIKNQNFESLINIQKETLISKIGATVSQENNLIEKINEKIKPLNLEIVAATIK
FT                   DIDMILEQISKQSVNKELLSSQAFLETTKEDLASLKNDRILIDKEYKEFYAKFNEIVAD
FT                   TQSVMQTYLAELLKAGNLLIEKKYPNDNTCPLCLQQKDLAKLNAEINQRLEEIKASSQI
FT                   KDKFDNAKKSVSDISSKRIKRIEVMLNNLILLKPENTTDIKKALENLKIKFKNYYETTE
FT                   KKVIAGDKLPDNNELLITDNDFEIHTEIIKRLESINKTIKNNKATEIYSNISASKEAFL
FT                   KIKRFENEKSKLEHQKKSLELIYNEFTKQQKEGLESFINNFSAKINEFYQYMNPDELFQ
FT                   EIQIVPMGEEDELKGITIEYKYNDERVYPPQKYFSDGHLNCLGIAFFLASAIAFNKKNN
FT                   FIVFDDVISSFDTEHRIRFANLLFEKFSGYQIILLTHEKEWFNYASQIAKKKGWLINTI
FT                   KWSETKGTYLEEKPSDLKEFIEKELADGRAETLGNPIRQYLEHILKDICFNLEAQVNFR
FT                   FNDINEKRMLDELLNSLKSRINKKGESCWTEQLKTIDNVGNSAILGNLLSHDNPFNPKL
FT                   GDLKAFWADIQNLKKIFFCQDKDCKKPKVSMKNYDTVNNKIRCGCGKTEYYWKK"
FT   CDS_pept        complement(694483..694941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_473"
FT                   /old_locus_tag="TGRD_478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_478"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13961"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0C9"
FT                   /protein_id="BAG13961.1"
FT                   /translation="MINNIVDIYFDAPMSFEARNISTLKGIVGLYFIFSSNIFIKYPFG
FT                   CSKLLYVGMSEKKTNSIGSRLIGHFEGKSKNAGLVNYRKAEPLKFTYINFDMLKDIWKF
FT                   RIEDLESYFILNFVENFGVYPICNNKAGFEILNSDITTHFKIDWSYFK"
FT   CDS_pept        complement(695190..697727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_474"
FT                   /old_locus_tag="TGRD_479"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_479"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13962"
FT                   /db_xref="GOA:B1H0D0"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D0"
FT                   /protein_id="BAG13962.1"
FT                   /translation="MKQYWNIKAKYSGMMLFFRLGDFYEMFGDDAVKAAPVLEVVLTRR
FT                   VGIPMCGVPYHSVNSYIRKLITKGFKVAICEQLEESGTTKGIVKRGVTKVLTPGTILED
FT                   TLLESKENNFLMSVIFDDTAASATFAAADISTGEFFVSETTLKSIEAEVLKYNPGELII
FT                   SAGSMQNKHISDFTAKLKVSVSDIDNSFFDIEKAQNITAELFGGNAVKKFGLNKKEIVC
FT                   ACGALLAYIKEMQPQSVSIFSEIKYIRNSDFMYLDTAAIKNLELLNSMTSGKTENSLLS
FT                   VMDSTKTPMGARTIRQWLIKPLLDISKIKNRQNIVRFFIKNPNVRKEIVEKLKTVSDIE
FT                   RITARVSSGSANPKDLTALKNSLKTINNISGIIKSAEGLGFNIPENAQITNKISSYLSD
FT                   EPPVSLKDGNAIKNGVNAELDELRKMSTDTKAYISNLEAKERAASGINNLKIGYTSVFG
FT                   YYIEISKSNAASAPKHYVRKQTVTAGERYITEELKILEEKILSAQEKTLRLENSLFNNL
FT                   VQEISVFTADILKTSQIISEIDIFCGFAENATEYNYVCPKISEGRELSIKDGRHPVVER
FT                   ILKNGEFTANDIAFDENSKIMILTGPNMSGKSTYLRQTALIVIMAQIGSFVPSQSAEIG
FT                   LVDKIFTRIGAGDNLAGGESTFMVEMSETANILNQYTQRSLIILDEVGRGTSTYDGMSI
FT                   AWAIIEFLADDKRKANTGAKTLFATHYFELTGLSETLKGVVNYSVDIKEWNGDVIFLHK
FT                   IVKGSADKSYGIHVAKIAGMPHQVIERAYEILSRLEKNSVEYSKRDESPQIEFFSDSGG
FT                   EPQILTELKNIDIDSLSPIEAFNIMHNWKNKYK"
FT   CDS_pept        complement(697736..698305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_475"
FT                   /old_locus_tag="TGRD_480"
FT                   /product="putative Lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13963"
FT                   /db_xref="GOA:B1H0D1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D1"
FT                   /protein_id="BAG13963.1"
FT                   /translation="MKRIIGYIILVLIIFIIFNIGKKVEKKVGSFNKNPYEIYISKYSK
FT                   RFAVDSLLIKAVMKKESNLNPRAVSSTGAVGLMQIMPKTAREIANQLNIMNYSGKNLKE
FT                   AEINIMFGTYYLKKLLNSYNNNLILALAAYNAGIGNVENWYSKDPEIEEKIYKIPFKET
FT                   RAYVRSIISIYKIYHGAEKLKTFLRI"
FT   CDS_pept        complement(698302..699558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_476"
FT                   /old_locus_tag="TGRD_481"
FT                   /product="tRNA-2-methylthio-N6-dimethylallyladenosine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_481"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13964"
FT                   /db_xref="GOA:B1H0D2"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0D2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13964.1"
FT                   /translation="MNYLIETIGCQMNVCDSDMLVSIFSAYGASKANNLSEADVVILNT
FT                   CSVRSQAEQKAFSYLGRVKEFKQKNPCIKIVVIGCMAERLGPNIKKRFSSVDLIIGAKD
FT                   IGNAALKIMNLFRTDYSAKKVNSEIKSKIVRYITIMRGCDNYCSYCAVPFVRGREVSIN
FT                   CETIVNECSSMVKNGAREIILLGQNVNSYQYEDVNFASLIKKTAAIENLERIRFMTNHP
FT                   KDLSDDLIKIMATEPKVCPHIHIPMQSASDKILKAMNRKYSYEHYLGLIKKLRTAVPDV
FT                   SVTTDIIVGFPGETDEDFEDTLKAVKTIRFGGLYVFRYSPRPDTKAAEMIDDVPFEEKK
FT                   RRHAVVLKESNKISIEIVSEMLGSTQQVLAEEIKNGIIKARTKNGRKVFAEGRKEYIGK
FT                   HINVNIKEAKINSLFGDIV"
FT   CDS_pept        complement(700171..700827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_477"
FT                   /old_locus_tag="TGRD_482"
FT                   /product="A24A family putative leader peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_482"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13965"
FT                   /db_xref="GOA:B1H0D3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D3"
FT                   /protein_id="BAG13965.1"
FT                   /translation="MISFILEIILVSYAGFKIGNGICKTSFIKFLSALSFALLFYRFSF
FT                   SFQFILFAFLTFSLISVSTTDYFHRIIPAIVPIFLIITGFIFSFMNSALGETYPSRFIN
FT                   SVLGILTGGGVLLVAGFLGQLIYKKEAIGGGDIKLMAGVGVFIGWEKALFAVFIAAVMG
FT                   GIAGLILLAAKKIEKKGYIPFGPFLSAASFITLFIPQPYIFFIWGTLLIRKITAL"
FT   CDS_pept        complement(702508..703158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_478"
FT                   /old_locus_tag="TGRD_483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_483"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13966"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D4"
FT                   /protein_id="BAG13966.1"
FT                   /translation="MLNPIMHYIIICEGGSENAYIQELNKYFKEQEINIIFRPSPVNTG
FT                   HFKEVIKKYKCERKKNKFYIFVDYDIYKKNTNKNNDNYTKKSKGIPDFLFNYFNFEDFL
FT                   ILHLNKNSILEYQKKCDDKNHFNIPMKSEIYMPLIKNFFNDYKKGNLPADFKISEESLK
FT                   KLFFNNQDADIKFESDFACFLQEIILQDSKRRCLTSSKNTTSSTKSLEKDSQK"
FT   CDS_pept        complement(703290..704498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_479"
FT                   /old_locus_tag="TGRD_484"
FT                   /product="conserved hypothetical ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_484"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13967"
FT                   /db_xref="GOA:B1H0D5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D5"
FT                   /protein_id="BAG13967.1"
FT                   /translation="MLSFFRIQNYRSILNMKVDFSYAEGKAPNNYQDFLKTPFLEISPK
FT                   DKRNRFIPCMSIYGANASGKTNIIIIYNLIVVKSNIQDFYFPNRLNNKYNSTIFELEFF
FT                   IGSAKFKHFIEYDHIEIKKESLLKNDKIIYEIDNTLCGNERYNFNAVTNEQYNDEKIKN
FT                   ILSVECSEKIENVYLQKRVFMSVIAQQYSGLNEDIRTAFKECYCNMSIYKSNNITKGML
FT                   RLLNNFLNKPNENEYVKDIFDKVSNIIHKFDIDILRIAPTTKHIEIKDKKLKDYYENFP
FT                   ERIPSFDPDKGTVRRDFIYSYHEDIDGQEIVFDMKRDESKGTNVLFGLITTILLAFDRG
FT                   SILAIDELDNSIHPLILEKIIEMFKSKEYNKKNAQLIFTIHCADILDMDILRVSEVALI
FT                   NKI"
FT   CDS_pept        704836..705225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_480"
FT                   /old_locus_tag="TGRD_485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_485"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13968"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D6"
FT                   /protein_id="BAG13968.1"
FT                   /translation="MLDNFLVYTITDNGSGTKKGKIFIKPERFKIQYKTIVSEGNVKYE
FT                   VILPYTLLVIERKVKKQLNLTNSLIQEHIIPKRIQICSSSYWNNGYCIFHVCHLSKGKE
FT                   QYKTYSNFKTYYYICQKTNKKIYGL"
FT   CDS_pept        705263..705845
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_112"
FT                   /note="pseudogene of superfamily I helicase-like protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(707153..707464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_481"
FT                   /old_locus_tag="TGRD_486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_486"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13969"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D7"
FT                   /protein_id="BAG13969.1"
FT                   /translation="MRKITFILIVELMIISACARYFKSPIPNRFQEGHLQGYINGQAVL
FT                   ASSWYATDFEEEREKFEDIVIRNPIIERKLLKESYDRLNNKKKTEEAEQIEKTKNKQQ"
FT   CDS_pept        complement(707709..708221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_482"
FT                   /old_locus_tag="TGRD_487"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_487"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13970"
FT                   /db_xref="GOA:B1H0D8"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D8"
FT                   /protein_id="BAG13970.1"
FT                   /translation="MTKGILAVYPGSFDPPTNGHLDIIIRASHLFPKITIAVTKSINKK
FT                   HIFSLQERINLLQKIIKNLKNVKVASFSGLLANYLAKINSFVLIRGLRALSDFEYEFQM
FT                   ALMNRNLNKKIETIFLMPDQSYTFLSSGMVREIAMLGGDTKDFVPECVKIELKKRSLDL
FT                   SKDNFIE"
FT   tRNA            complement(708428..708515)
FT                   /locus_tag="TGRD_tRNA27"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCG"
FT   CDS_pept        complement(708702..710840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_483"
FT                   /old_locus_tag="TGRD_488"
FT                   /product="LPS assembly outer membrane protein LptD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_488"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13971"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D9"
FT                   /protein_id="BAG13971.1"
FT                   /translation="MKNFLSRKIAVCVAILLLAVLKVFGYEINIFADNLEYDERSNQLF
FT                   AKSNVIFGWEGKKVFADYVEFEKKTVKAHGNVRVEESENTIYADNVTYNYDEKNGSIEE
FT                   TFGNHHSSNVFIRAKSMEIKNKDTYAINGIKLSKCDLDNPHIHIRAKQGKLILNKRLII
FT                   YNAVFYIEKIPIFYLPVFTKSLKSDKSFGSDLKFEINPKFTDKKSIYLNMLISCALSES
FT                   LKAKVSADFFNKSGNSQEIKIDYKEKDASGSISVNEPQNLEKRTLKADYFRTIDSIWNV
FT                   RSKVWITKDKGIDNYRHEYNKWDIWDSFLSLKNFYPYSYSYVTTTRHGNDTNLNISVEH
FT                   KAYNDSANEHKVSYTLLPKIELTSHYRNIFMGIMRKFSFMYQNVYRRYQYEQVYYSDDY
FT                   ETYDKSFYQSKSRLNYKLLRAFKVGNPLTLVPALKIVLKPSSTGDFGQKEYRGLFTKYS
FT                   GSLNTRFRVNDWMDWNIKYSLRARTKKNSLCVETLSGGNGIEKNSVSFNNDMYLGKQTM
FT                   VQNSFSYNLQRKNNRLSPLITEVTYMLNDYTTVFAKQTQVLYPLRLGSLNLDLAVGQLD
FT                   KAYLNFGAFYQEYQFDKIQMDDKDYLKHITLSQRYDKSGFYKTREINNTLGFGLCLTPK
FT                   WRIDYNIKATIPLNISRIAIGEQKLKIYRDLHCYIFSIALKHSIKDNKSEIFFKFTPKS
FT                   KASSNKEKKAAWWSSKEE"
FT   CDS_pept        complement(713576..714088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_484"
FT                   /old_locus_tag="TGRD_489"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_489"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13972"
FT                   /db_xref="GOA:B1H0D8"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0D8"
FT                   /protein_id="BAG13972.1"
FT                   /translation="MTKGILAVYPGSFDPPTNGHLDIIIRASHLFPKITIAVTKSINKK
FT                   HIFSLQERINLLQKIIKNLKNVKVASFSGLLANYLAKINSFVLIRGLRALSDFEYEFQM
FT                   ALMNRNLNKKIETIFLMPDQSYTFLSSGMVREIAMLGGDTKDFVPECVKIELKKRSLDL
FT                   SKDNFIE"
FT   tRNA            complement(714295..714382)
FT                   /locus_tag="TGRD_tRNA28"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCG"
FT   CDS_pept        complement(714569..716785)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_113"
FT                   /old_locus_tag="TGRD_490"
FT                   /note="pseudogene of LPS assembly outer membrane protein
FT                   LptD"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(716769..718034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_485"
FT                   /old_locus_tag="TGRD_491"
FT                   /product="folylpolyglutamate synthetase"
FT                   /note="tetrahydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_491"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13974"
FT                   /db_xref="GOA:B1H0E2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0E2"
FT                   /protein_id="BAG13974.1"
FT                   /translation="MFFKILKEYEGMTPGLSRIKKFFKSIDNPQNKLKAVHIAGTNGKG
FT                   STAAFISEILKAGGYKTALYSSPHLIDITERIKIDGENIPSKIFNGLSKKYLERAVKYK
FT                   LSYFEYLTALAFIYFAEQKTDIAVIETGLGGRFDATNVIKKPLICAITSIAKEHQEILG
FT                   AETEKIAFEKAGIIKGDAYVVCGKLPKRAITVIKNKSNPYYLYGKDLKVANNKSSRSRQ
FT                   KFDYTSKNAELKNIEIGLLGRHQAVNASIAIFAAGLLNKKGYYLSEAHIRTGLKNAVWQ
FT                   GRFDIRKIHSNNKNFELIIDGAHNIQGLNAFFETFEQLGFSKKKRIFIFTVMKEKKYKY
FT                   MVKKTASFAKKVILPRINNDRALNPEVLKKEFSKYIAQNKICTADSVKNACAMISDNET
FT                   SVAVGSLYLVGEILKYINETME"
FT   CDS_pept        complement(718016..718840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_486"
FT                   /old_locus_tag="TGRD_492"
FT                   /product="acetyl-CoA carboxylase carboxyl transferase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_492"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13975"
FT                   /db_xref="GOA:B1H0E3"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0E3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13975.1"
FT                   /translation="MKMTIDNISEKKGVPEGIWTKCKKCDYILLQKDFEENLMVCPKCG
FT                   YCTRLSARKRIEFTVDKGSFKEMDEAIQPVNFLCFPGYSDKIKKSEMSDAVVTGEAKIN
FT                   GYSVVIAVMDFEFMGGSMGSVVGEKIVRAIEKALKKKRHVIIISASGGARMQEGTISLM
FT                   QMGKTSAALAKLADNRLAFISILTDPTTGGVAASYAMLGDINIAEPKALIGFAGPRVIE
FT                   QTIRQQLSEEFQRSEFLEKHGMVDIVVERKNIRDVLTKALTFFYNRQCFLKF"
FT   CDS_pept        complement(718906..719890)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_114"
FT                   /note="pseudogene of D-arabinose 5-phosphate isomerase
FT                   (API)"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(719869..720516)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_115"
FT                   /old_locus_tag="TGRD_493"
FT                   /note="pseudogene of phosphoribosylanthrabulate isomerase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(720564..721538)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_116"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(721538..722538)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_117"
FT                   /note="pseudogene of adenine/cytosine-specific DNA
FT                   modification methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(722507..723117)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_118"
FT                   /note="pseudogene of conserved hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(723292..724190)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_119"
FT                   /note="pseudogene of adenine/cytosine-specific DNA
FT                   modification methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(724912..725301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_487"
FT                   /old_locus_tag="TGRD_494"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_494"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13977"
FT                   /db_xref="GOA:B1H0E5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0E5"
FT                   /protein_id="BAG13977.1"
FT                   /translation="MDKIIESLKFDDKGLMPAVVQDWKDNVVLMVAYMNKEAVKRTLET
FT                   KKATFWSRSRQSFWVKGESSGNIQELKEFYYDCDADCILLKVNQIGDAACHTGYRSCFF
FT                   TKVKSALDTEIVGERLFDPDKVYRK"
FT   CDS_pept        complement(725414..726196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_488"
FT                   /old_locus_tag="TGRD_495"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_495"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13978"
FT                   /db_xref="GOA:B1H0E6"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0E6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13978.1"
FT                   /translation="MLGIRVIPCLDVTDGRVVKGTNFVNLKDAGDPVEVAKQYNSDGAD
FT                   ELVFLDITATHERRDTTVDLVRRTAEKVFIPLTVGGGIRTTEDIRNLLNAGADKVSLNS
FT                   SAVKDPSIIKKASDKFGIQCIVVAIDAKKTGEHKWNVFVHGGRIDTGIDAVLWAKKAAA
FT                   FGAGEILLTSMDKDGTKDGYDSELLKAISSSVVIPVIASGGAGKVEHFSKACEYGASAV
FT                   LAASLFHYKELTIKEVKEHLKSKNIPVRQIRAEFAINN"
FT   CDS_pept        complement(726190..726924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_489"
FT                   /old_locus_tag="TGRD_496"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
FT                   methylideneamino] imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_496"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13979"
FT                   /db_xref="GOA:B1H0E7"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0E7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13979.1"
FT                   /translation="MIIIPAVDIRQGNSVRLKQGNIDAETIYSKDPVFIAKLWKSKGAK
FT                   RLHVVDLDGAFSGTNINKAIIKNICAAVDIPVEVGGGIRNMDKIKEVFDIGAAYAILGT
FT                   VAFNNPEIVKKAITRYGSEKIIVAVDAKDGKVAISGWKDITPIEASELVNKLKEIGVQE
FT                   ILYTDISRDGMFTGPDFAGLKKLSESGMRIIASGGVKTIDNLVKLKKYEKDGVFAAIVG
FT                   SALYTDDFKLEDAIEEIEGIKC"
FT   CDS_pept        complement(726925..727557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_490"
FT                   /old_locus_tag="TGRD_497"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_497"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13980"
FT                   /db_xref="GOA:B1H0E8"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0E8"
FT                   /protein_id="BAG13980.1"
FT                   /translation="MTKKIAIIDYGFGNIKSVLNALHHCNAEAHVIDSPSKISDFGGAI
FT                   LPGVGAFGPAADFLKSKSFDKAICSYVNSGKMLYGICLGFQLFFSKSYENGEYEGLNLI
FT                   SGEVKKFEFEDKTLKLPHMGWNNIETTNSAYSKKMFDTIVGKETFYFVHSYYGIPKNLS
FT                   QASSFCNYGINFCSSVAHRNVWGSQFHPEKSGENGLKILSNFINEVK"
FT   CDS_pept        complement(727692..728279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_491"
FT                   /old_locus_tag="TGRD_498"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_498"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13981"
FT                   /db_xref="GOA:B1H0E9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0E9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG13981.1"
FT                   /translation="MKQRKAKITRKTKETNIVVEINLDNILLPSVSTTIGFLDHMLELF
FT                   AVHSGIGFKIKASGDTHIDDHHLVEDAGITIGQALKEAVGDKKGIVRYGHFLLPMDETL
FT                   SYVALDLAGRFYLSYEADIKFQKNGFNYDLIQEFFYALASNAGITLHIKMIKGRNNHHI
FT                   AESIFKAFGRALRQAVSYSKSKKTVPSTKGIL"
FT   CDS_pept        complement(728300..729517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_492"
FT                   /old_locus_tag="TGRD_499"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_499"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13982"
FT                   /db_xref="GOA:B1H0F0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F0"
FT                   /protein_id="BAG13982.2"
FT                   /translation="MDAKQISIYVSDIIEDIKNNGDEAVFKYLKKFDNVDLSKKGYRVS
FT                   QKVIDDAAKRIPKQLKNVIKSSYSNILAYHKYERSQIKKRWNYVKNGLKIGQFYRPVES
FT                   VGLYVPGGRFPYPSTVIMTAVPAMAAGVKRIVMVTPPKNMNDAVLFSAKLCGIKEIYCI
FT                   GGVMAVGALAYGTKTLKKVDMIVGPGNAYVNEAKKQVFGRVGIDSLAGPTEVAIIADKD
FT                   VPTDYVVADVMAQVEHDPLAKTYLLCESAKKMSEIEKLLPKEALKQLRTELCSLNKAVD
FT                   IVNNIAPEHLELLVKNYQILLKNVRNAGAVFVGYQTPTASGDYWAGPSHVLPTNGSAKF
FT                   SSGLSVMTFLKRSAYIEMNKNNKKAYKTIADFAQAENMQYHKKSAEVRYLIPSFFSKCK
FT                   ERTVDI"
FT   CDS_pept        complement(729663..731474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_493"
FT                   /old_locus_tag="TGRD_500"
FT                   /product="ComEC-like cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13983"
FT                   /db_xref="GOA:B1H0F1"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F1"
FT                   /protein_id="BAG13983.1"
FT                   /translation="MRSIIRTLCKRPIITVFITYVFALILLDTFGYFSYEKQSYLYKLI
FT                   DNNATVSIEGRILSVPQLLKDGKRFVIKTNIINGRAVSEKIIVNSPSGYSVTYGDIINV
FT                   EGKLKKPFSSAFPLLFDYQKYLARSGIYVVLDISSLEYIDSKPNIIKKFAFAFRQDIIK
FT                   KFDDYFKRPYSDVLKSLIIGDKSTLSRDIKNSFSDSGIMHILVVSGLHVGFISIIVLFI
FT                   LKLTGLSLKKVSLLSIPFIFFYCFATGANPPALRSAIMFSCVIFSLSLGREPLIYNSLA
FT                   LSALIILIFQPQQLFTASFQMSYSATIGVVCFYKNVLGLFRNVKGKILRFFCGVLSVTI
FT                   SAQLILIPVCMHYFGKISIISFVTNIIVTPLTGIILYLGIIFYILTFIFHNAAALCSFI
FT                   LSLLLKFVLSVTIFLGNIKFAVVLIPKPSVIQLLLFFLFMFCIGYFENKKKFIFSGIIL
FT                   ISSFLYFIFPAVHEKNKVFFNVYKGNSITALQIKNNSANAFILYNKSKYYDRYYIDSFK
FT                   QFMAFSGIKKADITAVGFDEEKIYSDLINFNISTIEPAGAKTLDFHLNDYLIRVDTSAK
FT                   KLYIDDIEFSFKDKTSFYYNKKKKVFK"
FT   CDS_pept        731516..732511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_494"
FT                   /old_locus_tag="TGRD_501"
FT                   /product="thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_501"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13984"
FT                   /db_xref="GOA:B1H0F2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F2"
FT                   /protein_id="BAG13984.1"
FT                   /translation="MKNIDISSIGEFRLIDMIKNQFADSKDNKNIVAGIGDDSFCFKSG
FT                   KNNICITKDMLVEDVHFKKDWTNPQEIGRKSIEVNVSDIAAMGNVKPEYAFIGLGLPPK
FT                   TSEIFIKNLYKGFKKACDKYKMAIAGGNTVRADKTIISVTIVGIGIGRERVIKRNGAGI
FT                   GDLIGVTNTFGDAGAGVALLYKYGTKHKYNKYEHFLISKQNNPKARLKEAQKISKHLTS
FT                   LTDASDGLYISVDLLAKDSGKGAEIYMDKIPVSSSLKKVFREDKKRLDLALFGAEDYEL
FT                   IFTVPSLKAKLLKKLVPHISYIGKIDSSKKVKYFYDGKEQKIKYLGYKHF"
FT   CDS_pept        732462..732932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_495"
FT                   /old_locus_tag="TGRD_502"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaE"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_502"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13985"
FT                   /db_xref="GOA:B1H0F3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F3"
FT                   /protein_id="BAG13985.1"
FT                   /translation="MTAKNRKLNIWGTNTFKEKIFFTKTSKETSDLGKKFAAALKSGDI
FT                   VFLKGDLGSGKTTFTQGVVKVFGNKGFARSPSFMLVNEYNADGIKLFHIDLYRLKPSSV
FT                   WDMGIEEYLYSGNISLIEWADRLVGAEDDNRWNVEIKSSAGSERKIKIEKKK"
FT   CDS_pept        732929..733585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_496"
FT                   /old_locus_tag="TGRD_503"
FT                   /product="tRNA threonylcarbamoyladenosine biosynthesis
FT                   protein TsaB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_503"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13986"
FT                   /db_xref="GOA:B1H0F4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F4"
FT                   /protein_id="BAG13986.1"
FT                   /translation="MKILAVESSGRTFSTALNEDGRHAASFYYDCGRIHSEMIIPSVER
FT                   LLRDTGNVFQDIDKFAVSTGPGSFTGIRVGMIAIKTFAQILNKPIAAVDTLSILEKSFV
FT                   EIKGIKTVPAIDALRCEVYVKDGGKIVIKSIDLFIKDLKKYKNKVLVIGDAAISYKEKL
FT                   SKGLGKYSVSLPYIMHMPKAQVLATMAYHSAKSTDYTKIKPLYIRRSWAEETSRK"
FT   CDS_pept        complement(733624..737310)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_121"
FT                   /old_locus_tag="TGRD_504"
FT                   /note="hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(733708..734180)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_120"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(737383..739549)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_122"
FT                   /note="pseudogene of type II modification methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(739546..739858)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_106-1"
FT                   /note="pseudogene of type II modification methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(740379..740741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_497"
FT                   /old_locus_tag="TGRD_507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_507"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13990"
FT                   /db_xref="GOA:B1H0F8"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F8"
FT                   /protein_id="BAG13990.1"
FT                   /translation="MIQKQIFFINNFIIIASIIFIVIFFIPIFKINISLDYKINGNDLI
FT                   VNMKNLNIKKDLFVKLDKNTMIISHHTGSFKINSYDAQRSQIVLDIRQFNVENGLKIFY
FT                   SFKKNVISYILKNKKC"
FT   CDS_pept        complement(740760..742466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_498"
FT                   /old_locus_tag="TGRD_508"
FT                   /product="multidrug resistance type (mdlB)-like ABC
FT                   transporter, ATPase/permease component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_508"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13991"
FT                   /db_xref="GOA:B1H0F9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0F9"
FT                   /protein_id="BAG13991.1"
FT                   /translation="MVRRFKKETNIGNFLELGCSEWKYEYEKGLRLYYKSLKKIVFNLL
FT                   RNYKTEVFQYLGIDFLLKFINIITTFFLVVFIDTVDISNNFVLIFVTLYISVLVFSSVS
FT                   VLFKTLTLYLLENKVLFDFRKIILTKFLNSRYNVNSNLSKGPYLSQRVINDTELINDLF
FT                   VAPIAKSISSIFFLACLLPIFLQFNFLIILLLILSAVLPSLFFPFFNRKNRCFTSKYQE
FT                   KFALYSSKLSDVIDSVREIKLFDLYKKETDEIDSKVEDLVLINVKRIFWGFTSGQFGVS
FT                   LQHIIIGILLGFLGCQVQQKVITLGQAIFIYSISDNLFYVINDFWSLYFSIKNSDVPWK
FT                   RIKRILLRKCENNDVNNDVKKINSIVFQNVSVEKNSRVILKNLNLKINSKDKTVLIGNT
FT                   GVGKTTILNLIVLFDNVSAGNILINGEDLYGIDIKNFRSKISYFTQDSFLFNTTIKENI
FT                   LLNLDHNNLIVNQKYLEILKICKLDNLDDKRVVGNKGVFVSGGEKQRITLARCLMKNPE
FT                   VLLLDEFGNSIHENMEIEIYKNLINFYKDKIIIAVSHRVSIANLFDKKIQV"
FT   tRNA            complement(743859..743932)
FT                   /locus_tag="TGRD_tRNA29"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   CDS_pept        complement(744037..744372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_499"
FT                   /old_locus_tag="TGRD_509"
FT                   /product="aspartate 1-decarboxylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_509"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13992"
FT                   /db_xref="GOA:B1H0G0"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G0"
FT                   /protein_id="BAG13992.1"
FT                   /translation="MKFVLNSKIFRATVTQANVKYEGSITIDMDLCDKAGFWTGEKVLV
FT                   VSNTTGARLETYVIPGCSGVICMNGAAAHLIKAGEEIIIMGFKLSDKPINPRIVFVDKN
FT                   NKVLKIK"
FT   CDS_pept        complement(744418..745416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_500"
FT                   /old_locus_tag="TGRD_510"
FT                   /product="mechanosensitive channel MscS-like"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13993"
FT                   /db_xref="GOA:B1H0G1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G1"
FT                   /protein_id="BAG13993.2"
FT                   /translation="MIPSNFMLWLKSIILFVLIFSVGFLFKKYFIKFIQNIFVRDRLVL
FT                   LGEAFAISSSYISFWFFLIALYAAFLIAPVNNMVVIHKLFYGVFAFSIVVFVASVLSKV
FT                   FRKSIPEKIGVNVIKFSVIFVGLILILNQAGIKLTPILTALGIGSLAVALALQDTLVNF
FT                   FAGINILLSKQIARGDYIKLDSGQEGTIIEVNWRITLMKTISNTVISVPNSKLSSAILT
FT                   SFQFRKAEVSASVNCGVAYGSDLECVEKIAILAAQEIIYKYEDSVKTYTPIVHFIGFED
FT                   SSINFTLIFRVKNVYVRNFIQSEVFKNLYKKLNEEKIEIPFPQRVVTLNKH"
FT   CDS_pept        complement(745413..745772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_501"
FT                   /old_locus_tag="TGRD_511"
FT                   /product="RNA polymerase-binding transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_511"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13994"
FT                   /db_xref="GOA:B1H0G2"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G2"
FT                   /protein_id="BAG13994.1"
FT                   /translation="MNKKDLASLKKILIQKKMDFLNKMSKAQRGIYDDSNTSVGDEIDT
FT                   ASQNSEKEMYFELVASDKMTLDAINDALVKIEKNAYGKCEGCSNNILLERLKVIPWAKY
FT                   CIQCQEESENPKNKK"
FT   CDS_pept        complement(745784..747265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_502"
FT                   /old_locus_tag="TGRD_512"
FT                   /product="arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_512"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13995"
FT                   /db_xref="GOA:B1H0G3"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G3"
FT                   /protein_id="BAG13995.1"
FT                   /translation="MKKISKLLLAKQSKAPLFDTLLAHAKRDVVSFHCPGHKNGKGIDR
FT                   ELKDYTGEEVYKFDVTVFDEVDSLHDPVGSIKKAQELMAQAYGVEHSFFLVNGSSVGNI
FT                   AMFLAACDSGDSVIVSRSSHKSIMAGIIMSGVWPIWIQPKIDQNLDLIFNSTYNQVKDA
FT                   LDRYPEAKAVFITSPTYNGIVTELSRIVDLCHRRGKTVLVDEAHGVHLLFNNQLPESAV
FT                   SAGADLCVQSTHKILSAMSQGSVLHFNSKLVDFNRVKRVVSMLQTTSPNYLILATLDLA
FT                   RRQAFLRGEENFNRVIKAAEWGRAYINDNINSMKCFTRQEVQKLGFDLDVTKLTVNVTK
FT                   TGLSGYEIESILAKEYNVQLDYADLFNLVAIMSEGSEKSDVEVFVNALENISEKYRGKQ
FT                   KNWILKIPSLATEMVMRPREVFLSNSTKKVSLKKAAGHVAAQTLTPYPPGIPVVIPGER
FT                   ITKEICDYLIDMSSKDIRVSGQETGMLRTVKVFTN"
FT   tRNA            complement(747290..747363)
FT                   /locus_tag="TGRD_tRNA30"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GTC"
FT   tRNA            complement(747386..747457)
FT                   /locus_tag="TGRD_tRNA31"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   CDS_pept        747837..748283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_503"
FT                   /old_locus_tag="TGRD_513"
FT                   /product="[ribosomal protein S18]-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_513"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13996"
FT                   /db_xref="GOA:B1H0G4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G4"
FT                   /protein_id="BAG13996.1"
FT                   /translation="MKIVNFSERFLDDITEIEKQSFANPWTKEMLLDSAKNTAVKFKVL
FT                   IENRTVAGYYIISTVADETELLDIAVDPKFRRGYFGQAMLADIKKESTNKQTGVIFLEV
FT                   HQSNNAAINLYKSFGFKEIGVRKKYYKNEDALVLRLINRKESTL"
FT   CDS_pept        748280..748882
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_123"
FT                   /note="pseudogene of TPR-repeat lipoprotein"
FT                   /pseudogene="unitary"
FT   CDS_pept        748901..749806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_504"
FT                   /old_locus_tag="TGRD_514"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_514"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13997"
FT                   /db_xref="GOA:B1H0G5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G5"
FT                   /protein_id="BAG13997.1"
FT                   /translation="MKIYLKAPAKINFFLEIKNKRADGYHNLESIMQTVSLYDELSFEL
FT                   TKNTISLECNDKSLYAYKTNIVYKAAMAVKKHYNTDKGVKIYLKKEIPIGSGLGGGSSD
FT                   AASTLKALAKLWNIKTKKDELEQIATKLGADVPFFLTGGTALCEGIGEIVTPLKSAGKL
FT                   NIVLVNPGFDVLTADIYKKIKFPLTNQAKIHIIKNLIFNNSFNKKEAFKSCFNRLEEFI
FT                   FPNYPEILEIKRVLNKLCCASLMSGSGATVFGILDSDAKTEKLKSRLNRCGWKIWFVTT
FT                   IDTSFHSLFPSTQSQSSGIV"
FT   tRNA            749792..749862
FT                   /locus_tag="TGRD_tRNA32"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   CDS_pept        750038..750764
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_124"
FT                   /note="pseudogene of type IIS methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        750774..751418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_505"
FT                   /old_locus_tag="TGRD_515"
FT                   /product="adenine/cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_515"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13998"
FT                   /db_xref="GOA:B1H0G6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G6"
FT                   /protein_id="BAG13998.1"
FT                   /translation="MLESNKIYNLDCFTFFNQVEKESIDLAIIDPPYNMKKAKGDTFKS
FT                   HQDFLYFTFKWINALIPTLKETGSLYIFNTPFNCAYILQYLVDKGLIFQNWITWDKRDG
FT                   LGTSKTKYSNGQESILFFTKNKKHIFNYDEIRVPYESTERIEHASKKGILKNGKRWFPN
FT                   DKGRLCGEVWHIVSERHRNKINGKTIKNEHVASKPLELIERIIKASSNEKI"
FT   CDS_pept        751715..752886
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_125"
FT                   /note="pseudogene of type IIS restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(753000..754664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_506"
FT                   /old_locus_tag="TGRD_516"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_516"
FT                   /db_xref="EnsemblGenomes-Tr:BAG13999"
FT                   /db_xref="GOA:B1H0G7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G7"
FT                   /protein_id="BAG13999.1"
FT                   /translation="MLLALSIKNYALIEYLTIDFTGGFTVITGETGSGKSILIKSIELL
FT                   TGARADLSSIRSGCSACDITASFEYSNSKVDDFLDNFSISAGNNIVLIRRTIENTGKSK
FT                   AFINDSHVSILALATLGKLLIDFHGQDEKHSLLDLDAQLEILDNEIEDIRPLLKESAAL
FT                   YAQIKNLRSKLEALNLSDAERGRKNDLYSFQVREIEDAELETGEDKKLELDIPKLKNAE
FT                   KISALSQEIISALYSSENSILGNILKTKKNIEAINSYGADASGAVSLIEQAYYQTEEAY
FT                   REVDIILSKTRLDPEKLNASLERVELIKKLKKKYGSSIESVIEYKNKIAGELNSLNNCK
FT                   DNFEKLKKELKSETKRLSELCETISKKRQEAAQVFAKSVREKLFDLEIKNAVFEVKFDR
FT                   KELSADGYDLVEFMFCANKGEKTIPLKNSASGGELSRTLLALKLSSKIKTDRVVIFDEI
FT                   DSGTGGKTGGNIGKKLSELARRKQVFSVTHLAQIAAFAGTHIKIYKETENSRTYTKAKV
FT                   LTETEHIEEIARMISGEKITKAALEHAKDLVAASVKS"
FT   CDS_pept        complement(754664..755485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_507"
FT                   /old_locus_tag="TGRD_517"
FT                   /product="poly(p)/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_517"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14000"
FT                   /db_xref="GOA:B1H0G8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G8"
FT                   /protein_id="BAG14000.1"
FT                   /translation="MEYSTGIIYNKSKANAKKLAFEIALWLKQNKCRVFVSDSMSVKHR
FT                   KVDFVLSIGGDGTMLKVIRTFSPLSVPVKGINLGSLGFLTDTDTNEIFMLLEDILSSGF
FT                   IIEKRVLLSAEFEYKSGKIKVIAVNDCVVRSLSGGKLITVDVNIDKNFTAEYKCDGMII
FT                   ATPTGSTAYSLAAYGPIVYPNLPVFILTPISPHTLTQRPMILSDKSNISFITKNKDSNG
FT                   KIMISMDGQENYTLSNGTKVKFALYRKPLKLIKNRSKSYFETLKAKLHWSV"
FT   CDS_pept        complement(757023..758372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_508"
FT                   /old_locus_tag="TGRD_518"
FT                   /product="23S rRNA (uracil1939-C5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_518"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14001"
FT                   /db_xref="GOA:B1H0G9"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0G9"
FT                   /protein_id="BAG14001.1"
FT                   /translation="MSLKNKIINVSAEKIVFPGRSLCRCSDGIVLFSEGLLPGEAADVL
FT                   VIKEKKTFREALLKNITSKSAERIEPLCPSFGFCGGCSFQNISYESQIKYKQEYISELL
FT                   NFAGVKISKILISPQIWHYRNKMEFSFFNNKGIADLGLHCKGMFNRYVSVPPCFIADKG
FT                   FLQVVETVKRFANGNNFSVYNNKTHEGFFRHLVLRKAGNNNQFLINVITNVVDCESVFL
FT                   EPLIKELSEFSCSIYWTSNGRKSDAVLADRLTLMCGKPFITERLNIGGKDYFFDISPFS
FT                   FFQTNSKATEILYTEILRLLNPSKYTVLLDLYCGTGAIGISMAHNVKRVIGVECIGQAI
FT                   DNAKENALANNVFNAEFYASDAEDWIKENKSCFDAVVVDPPRSGLTKDIIKFLLESKAK
FT                   RIIYVSCNPSTLARDLQLITENSKCKIKEIIPVDMFPQTYHIETVVLLEF"
FT   CDS_pept        complement(758435..758932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_509"
FT                   /old_locus_tag="TGRD_519"
FT                   /product="YajQ family cyclic di-GMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_519"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14002"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0H0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14002.1"
FT                   /translation="MADKFSFDIVSEVNMMEVDNAVNQARKELANRFDFKDSKSSIELN
FT                   KKDKKITLIADNEYKMKALKDILEGRFAKRNVSIKSLDYKVQENAFEGYIRQTAEIISG
FT                   LSSDRAKELSKLIRDSKIKVQAQIDGTKIKVISTKKDDLQLVIAYLKQLSFPLPLQFTN
FT                   YR"
FT   CDS_pept        complement(759257..760459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_510"
FT                   /old_locus_tag="TGRD_520"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14003"
FT                   /db_xref="GOA:B1H0H1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H1"
FT                   /protein_id="BAG14003.1"
FT                   /translation="MGQRIVYLDNSATTIVDSEVIKEMQSYFSDIYGNASSFHYFGRQA
FT                   KTVLDNARKKTASLLNSSPEEIFFTGCGTESDNIAIFGILNAYGEKGHIITSRIEHHAV
FT                   FYSCKHLEANGYEVTYLNVDEDGVVSVEDFKKAVKDNTLLVTIMHANNEVGSIQPIEEI
FT                   ASELKKINEKRKKKIYFHTDAVQTAGKLYLDVKKLGIDLLAISAHKFNGPKGVGALYIK
FT                   SGTNIVPMTFGGHHENGLRPGTENIPYISGLAKALEISNAKIEEYNKRVFALRKKLKEG
FT                   ILNAIPEVIINGSGSRAVSNILNVSFNYIEGEALLLMLDMEGVAVSTGSACASGSSEPS
FT                   HVLSAMGVNPVASQGAIRFSFGYHNVEEDVDYVLEVLPKVISSLRSMSPVWKQKTLGNK
FT                   E"
FT   CDS_pept        complement(760499..761012)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_126"
FT                   /note="pseudogene of putative endolytic murein
FT                   transglycosylase MltG"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(761016..761438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_511"
FT                   /old_locus_tag="TGRD_521"
FT                   /product="putative Holliday junction resolvase RuvX"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_521"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14004"
FT                   /db_xref="GOA:B1H0H2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0H2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14004.1"
FT                   /translation="MNRIMGIDYGLKRIGIAITDFLRITASPFDTVKNVSLKKNALKIL
FT                   EIAKNRDVSIIVLGLPLNMNGTEGGMAETVRKFIEKIKFLSDIEVTTVDERLTTVQAER
FT                   MLIEEADISREKRKGIKDKVVAALILQTYLDIQSDE"
FT   CDS_pept        complement(761525..763528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_512"
FT                   /old_locus_tag="TGRD_522"
FT                   /product="NADH-Fd-dependent Fe-hydrogenase, catalytic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_522"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14005"
FT                   /db_xref="GOA:B1H0H3"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H3"
FT                   /protein_id="BAG14005.1"
FT                   /translation="MEKYLTVNGRKVSFTDEKNLLEIIRKENIELPSFCYNSELSIYGS
FT                   CRLCMLEIEGKGILFACSTPPESGMKIRTNNEHIIEMRKIIIELLLANHDRECTTCGKS
FT                   ETCQLQTLARRLGINKIRFKNVMHKEPKDVSTYSLVRESGKCILCGNCVRFCDEIQSVG
FT                   AIGFANRGSKSVICPSLGCDLESSGCVYCGQCARVCPTGAIMPKSEISYVWKVLSDPKK
FT                   KVVVAIAPAVRASIGEVFGFAGGNGTETAGKIVTALRSMGFAKVFDVSFAADMTIVEEA
FT                   DEFLNRLKKNKDMPLFTSCCPAWVKFVEQYYPDFISNLSSCRSPQAMYGSVAKKIMPEM
FT                   LKISKEDLTVVSIMPCTAKKFEARRPELSKNGVADIDYVLTTQELARMIEEAGLLFGEL
FT                   EPSAFDMPLGFKTGGGVIFGNSGGVTEAVLRDIVSNNSGGAGKTEQFVFVRGEDGLREV
FT                   KVNFGGRELNIAVVYGLKNARKILKDIKVDRSRYDFVEVMACPGGCIGGAGQPVYKDLS
FT                   VRKTRTKVLYESDKTMELRRPQDNPYVQKVYKDYFNKPGSCAAHEYLHTGHKNRKRFNE
FT                   TFEIYKPDQKGNIKVSVCFGNSCMQRGSEEILKHIISFVENGKYKGSVGIEVSMCLEKC
FT                   FRGPVVKVANQTLEHCTTKAAEEAIQEELMKK"
FT   CDS_pept        complement(763600..765471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_513"
FT                   /old_locus_tag="TGRD_523"
FT                   /product="NADH-Fd-dependent Fe-hydrogenase, NADH
FT                   dehydrogenase component 51kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_523"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14006"
FT                   /db_xref="GOA:B1H0H4"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H4"
FT                   /protein_id="BAG14006.1"
FT                   /translation="MIDLDNITRSVKKAGENITKRIVVCAGTGCVASGSIKVFESFIIV
FT                   AKELGISVCVELKGGNIGTLLSKSGCQGFCQKGPLVNILPAEILYINVKVDDVKEILKK
FT                   SIKNNSLIDRLCYSDNGKVCKGQNEIPFYKKQHRVVIKQCGVMDPENIKEYISIGGYRA
FT                   AEKACAEMTDKEICDVVLAAGLRGRGGGGFPVGKKWNLARNQTASKKYIICNGDEGDPG
FT                   AFMDRSVMEGNPHGIIEGLVIAAKATGADEGYVYVRTEYALAVKRMKKAVKDASDIKVL
FT                   GKNIFGSGHNFTLHVMEGAGAFVCGEEIALIASVEGKRGMPLPKPPFPAQSGLWGKPTT
FT                   INNVETLATIPMIINYGADVFRETGTVSSPGTKTFALTGHVLNTGLIEVPLGSTLRQII
FT                   FDISGGVTDGKGSVKDGNFKAVQIGGPSGGCLTEEHLDLSLDFDSLKKVGAMVGSGGLV
FT                   VMNKSICMVNIAKFFMQFTQNESCGKCVLCREGTKQMLLMLSDITEGKADEDTISLLEE
FT                   LARAVQIGSLCGLGKTAPNPVLSTLKYFRNEYDAHVKEKRCPAGECKSLINYEITDKCI
FT                   GCTVCAVKCPAKAISGERRQKHKIAIVKCVKCDICIKSCKFNAIEIV"
FT   CDS_pept        complement(765486..765959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_514"
FT                   /old_locus_tag="TGRD_524"
FT                   /product="NADH-Fd-dependent Fe-hydrogenase,
FT                   ferredoxin-binding component 24kDa"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_524"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14007"
FT                   /db_xref="GOA:B1H0H5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H5"
FT                   /protein_id="BAG14007.1"
FT                   /translation="MDSNYSKFKTVCRILKENSFDKSKLIPILQAVQEEYKYLPKEILV
FT                   FIALSLNTSPAGVYGVATFFSHFTLKHKGRHIIKICDGIACHVKKSNSLINALKNKLGL
FT                   KEAEYSTKDVFFTIETVSCLGACGLAPVFLIDEDIYGQMTPDKAVELIDKIME"
FT   CDS_pept        complement(766161..767339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_515"
FT                   /old_locus_tag="TGRD_525"
FT                   /product="NapA type Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_525"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14008"
FT                   /db_xref="GOA:B1H0H6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H6"
FT                   /protein_id="BAG14008.1"
FT                   /translation="MVYEVFDFLISLASILFFAKVFGEIALKLGQNPVIGELLAGIFIG
FT                   PSVLGIVRETPVLSNISELGVIILLFEVGLSTDIKEFLKASGWAMVVAFVGVIVPYFLG
FT                   YFVFLCFGLTDMQAIFAGAVLTATSVGVTIRVFMDLKCLKTEEAKIVLGAAIIDDVIGL
FT                   TMLAVILKLITGGIVSFGTVVCISGTAVLFLVLSVVAGVLIAPTIFKFISKMKQSYIAF
FT                   IMGIVFCFIVSALSTKIELGHIVGAFVAGLVLSTIKQSEEIKKDIKSIYAVFVPIFFVL
FT                   MGTKVDISTFNPFVVANKEILILTGALFVVAFVGKIVAGFAVLKKGINKLLIGVSMVPR
FT                   GEVGLIFAEIGLKNNVFATRDYSSLVAVIMLTTFITPIILKYLISKQKKIIQ"
FT   CDS_pept        complement(767447..768118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_516"
FT                   /old_locus_tag="TGRD_526"
FT                   /product="thymidylate synthase ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_526"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14009"
FT                   /db_xref="GOA:B1H0H7"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0H7"
FT                   /protein_id="BAG14009.1"
FT                   /translation="MKIKLLKFTNDPEKICAVAAKLCRSSENIDEISGNFTKEKIKELL
FT                   SRIISSGHYSVLEHSSFTFGVEGISRVLLAQLTRHRIASFSVQSQRYVRFENGVEYVVP
FT                   DTIKKNKTLLKKYDDFLKNTETLYKEFLDEGIPAEDARYILPNASATKIVITMNARELK
FT                   HFFSLRCCNRSQWEIRDMACLMLNLVKKKAALLFSDAGPDCVRKGCNEVFSCGKPWKKY
FT                   K"
FT   CDS_pept        complement(768128..769417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_517"
FT                   /old_locus_tag="TGRD_527"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_527"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14010"
FT                   /db_xref="GOA:B1H0H8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0H8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14010.1"
FT                   /translation="MSTLVVLGTQWGDEGKGKVIHYLAKQADYIVRYQGGNNAGHTLIH
FT                   ENKPFILHLIPSGILFPDKYCLITNGVVVDPKALKEEIAILDKNNISVEKRFFISEQAH
FT                   IILPYHKLIDGILEEENVKIGTTRRGIGPAYADKVKRIGIRVVDYLEKDVFEDLLEKNL
FT                   IEKTPILKNSGVDIANLKEEILKDREELSIFLEPFVTDTSIMIANAIKKNKKILFESAQ
FT                   GTMLDLDFGTYPFVTSSNPIAGGVCSGAGVGPTKIDSVLGVVKAYTTRVGEGPFTVELF
FT                   DEMGKFLREKGAEYGATTGRPRRCGWFDAVVVRHSVRLSGIKHLILTKLDCVEDIDKIK
FT                   ICVAYKYKDKLYKEFPASRTVQKYAEPVYEEMPGFKGKVKGIIDFEKLPLNAQKYVKRL
FT                   EQLVDAPIDLISLGRKREETIEVRKGVNWF"
FT   tRNA            complement(769504..769576)
FT                   /locus_tag="TGRD_tRNA33"
FT                   /product="tRNA-Glu"
FT                   /note="codon recognized: GAA"
FT   tRNA            complement(769582..769654)
FT                   /locus_tag="TGRD_tRNA34"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   CDS_pept        complement(769767..770228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_518"
FT                   /old_locus_tag="TGRD_528"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_528"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14011"
FT                   /db_xref="GOA:B1H0H9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0H9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14011.1"
FT                   /translation="MNIVTGQLNAHGKKFAIVVSRFNEFITNKLISGAEDILKRHSVAD
FT                   EDISVYWVPGAFEIPAVAKKIAENGKDNGVICLGCVIRGATPHFDYISAEVSKGVASIA
FT                   LQSNVPVIFGVLTTDSIEQAVERAGTKAGNKGSDAAMSAIEMVNLYSAI"
FT   CDS_pept        complement(770412..771623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_519"
FT                   /old_locus_tag="TGRD_529"
FT                   /product="bifunctional 3,4-dihydroxy-2-butanone-4-phosphate
FT                   synthase/GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_529"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14012"
FT                   /db_xref="GOA:B1H0I0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0I0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14012.1"
FT                   /translation="MKNKVFASIGDAVKDIKVGRMVIVVDDPGRENEGDLICAAEKASP
FT                   EVINFMTKYARGLICVPMKHERLKELEIENMVEKPTEKKGCSFTVSVDYKIGTTTGISA
FT                   YDRSVTVRKLIDKTAKHEDFARPGHIFPLRCKEGGVLARTGHTEAAVDLVRLAGFYPAG
FT                   IICEIMNNDGTMARMSDLIKFAKKHDLHIITIGELVNYRRRTEKFISEIVNVDLPTRYG
FT                   DFKLVLFEDLITKDSHIAVVKGVVKNRQNVLVRVHSSCETGDIFHSLRCDCGDQLETAL
FT                   KAVGEAEQGVVLYIHQEGRGIGLANKLKAYRLQEKGMDTVEANKALGFDPDLRDYGIGA
FT                   QMLSELGIKSINLMTNNPGKINGLESYGLKITKRVPLEISPSKSNEKYLKTKKEKMGHM
FT                   LKKV"
FT   CDS_pept        complement(771655..772272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_520"
FT                   /old_locus_tag="TGRD_530"
FT                   /product="riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14013"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I1"
FT                   /protein_id="BAG14013.1"
FT                   /translation="MFTGLIEDIGTVKNISGSKVEIETKLDGIAKGNSISVNGVCLTVV
FT                   FVNKGCFVADYSPVTDRITTLSKLKQNSRVNLERAIELSSRLGGHIVSGHVDGIAEIKE
FT                   IKNLRQFFRIVCSCGENISAYCVSRGSVAVDGISLTLSSILVSGFEIFIIPETFNNTIL
FT                   QFKKKGDEINIETDIIAKYVEKFTNKKTNNISLEILKENGFV"
FT   CDS_pept        complement(772398..773465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_521"
FT                   /old_locus_tag="TGRD_531"
FT                   /product="bifunctional
FT                   diaminohydroxyphosphoribosylaminopyrimidine deaminase /
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_531"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14014"
FT                   /db_xref="GOA:B1H0I2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I2"
FT                   /protein_id="BAG14014.1"
FT                   /translation="MNGNKYMQLALDLAQKGKGRVYTNPLVGCVIVKDNKIVGRGWHQC
FT                   FGGNHAEVNAIIDAGKNAEGADLYVTLEPCNSYGKRTPCTLTIIKAGIKRVYYAVPDSN
FT                   VSGGREILERNNIKVHEGLLKKQSRILIKDYLKHLKNKPKVSIKAAMTLDGKIATYEYD
FT                   SKWITSEKSRNFVHKMRARYDAVLVGMNTALKDNPILTTHSKNLKNPIRVVIDSGLKLP
FT                   KSHHLFDACVPTVIVYDLNITNIPKYLNREGIILSPVNIDAAKKDFSVIIKKLDSLSIK
FT                   RILIEGGSEIIASALFSDVVDDIYFFIAPKITGGRTAISVVGGTGVKKMSESLCIKNMK
FT                   VKKIGPDLLITGQIR"
FT   CDS_pept        773903..774156
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_127"
FT                   /note="pseudogene of GatB/YqeY family protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        775286..775612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_522"
FT                   /old_locus_tag="TGRD_532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_532"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14015"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I3"
FT                   /protein_id="BAG14015.1"
FT                   /translation="MKKGILAFVVSVFVLSFVSCDKTNKLCNGNNAENEAKAEEYAANK
FT                   KLFLNKEFDLLGKTVTSADLEKWFKDEHGIEYGDIKIKLTAEQKLQSDHIATVKEKEQK
FT                   NPKN"
FT   CDS_pept        complement(775764..777023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_523"
FT                   /old_locus_tag="TGRD_533"
FT                   /product="rRNA maturation-related GTPase CgtA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_533"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14016"
FT                   /db_xref="GOA:B1H0I4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0I4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14016.1"
FT                   /translation="MFIDKVNTYLAAGRGGDGCISFRREKYVPYGGPDGGNGGNGGDIY
FT                   FESDQHKTTLLDLSYRPKFKAEDGQKGSSGDKSGRYGEDLIIKIPLGTLIFKNGEFFAD
FT                   LKTVGERILIVKGGRGGRGNASFKTGRHTVPRIAEKGAPGETAEVNLELRLIADVGLLG
FT                   LPNAGKSTLLSQISAAKPKIADYPFTTLAPNLGVVNYKGKHFTAADIPGIIEGAYKGIG
FT                   LGFEFLRHIRRTKVLIHVIDVNGFDGRDPYENYKIINNELKKYSKHLAKKHVIIVLNKI
FT                   DSAVSLEQIKNFKKHLKVKKLFETSAATGYGIDALLKEMLRMLEKPVAFSTEGEVEPLH
FT                   VKKYIYEPEFKISIENGIFVATGAKVETLTEVTKFNEDESLRRYRNILKKMGLEIELKK
FT                   MGARPGDTVRIGDFEFTFEK"
FT   CDS_pept        complement(777047..777298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_524"
FT                   /old_locus_tag="TGRD_534"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_534"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14017"
FT                   /db_xref="GOA:B1H0I5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I5"
FT                   /protein_id="BAG14017.1"
FT                   /translation="MAHVKAQGSSTNGRDSNGQRLGVKIYGDQKASAGAIIVRQRGTKY
FT                   HPGVNAGMGKDNTIFAKVTGTVKFIRKSGDRCYVNIEC"
FT   CDS_pept        complement(777328..777642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_525"
FT                   /old_locus_tag="TGRD_535"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_535"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14018"
FT                   /db_xref="GOA:B1H0I6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0I6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14018.1"
FT                   /translation="MYAIIKTGGKQYKVEKGVSLVVEKLKGVEAGQEVILREVLLLADG
FT                   EKLTVGKPIIESARVVAKVVSQKRGPKVLVFKRKPKKGYKKLQGHRQYVTELEITGINT"
FT   CDS_pept        777746..778933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_526"
FT                   /old_locus_tag="TGRD_536"
FT                   /product="pyridoxal phosphate-dependent aspartate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_536"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14019"
FT                   /db_xref="GOA:B1H0I7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I7"
FT                   /protein_id="BAG14019.1"
FT                   /translation="MYISKRVLSIKPSPTLAIDAKAKALKQQGIDVINFGVGEPDFDTP
FT                   VNIKEAAIIAINAGFTKYCPVAGTPELKNAIINKFKRDNGLTYTPEGIIVSSGAKHSLY
FT                   NLFQSTIDDGDEVIIPAPYWVSYTDMVILAGGKPVIIHTSDKTNFKATPENIEKALTSK
FT                   TKAIIVNSPSNPTGVTYTAEELKAIAQVCVKNKILIISDDIYEKLIYDDFKFTSIAEVS
FT                   PEAKEFSIVVNGVSKAYSMTGWRIGYAAGPKNIISAMTKVQSQSTSNASSISIKAALEA
FT                   LNGTQKYVESMKKEFEKRRNYIVEKLNAIKDIDCRKPEGAFYVFPNIKAFLGKTFNGKV
FT                   INTDIELADYLLDCAKIAVIPGSAFGAEGYIRLSYATSVENIKTGIERLETALKG"
FT   CDS_pept        complement(779028..780272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_527"
FT                   /old_locus_tag="TGRD_537"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_537"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14020"
FT                   /db_xref="GOA:B1H0I8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0I8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14020.1"
FT                   /translation="MNYKAPRGTHDIFGINASGMSWLEQKAKVIFKRHGFEEVRTPVFE
FT                   DAALFMRSIGQTTDIVEKEMYIFEDRKKRKLALRPEGTASLVRAFIEHRMDVSMPAGRF
FT                   FYMGEMFRYERPQAGRYRQFHQIGAEFFGSSSPAADAEIIILAQHLLSSVGINEMNIYI
FT                   NSLGCEKCRPFFRETLVKYLGSVRDLCEDCLRRLEKNPLRILDCKTDSNKFTAVPRMSD
FT                   YLCNCCKDNFSLTQSLLKSVGYNYTVDERLVRGLDYYTKTVFEIRSDAVGSQCALAAGG
FT                   RYDNLVGELGGQDTPAVGFALGSERVLLAVQKTGFFGSFQESEKIFIAVADQELFSEAF
FT                   SFAVKAMRNGLKGNKNISVFGPINGKSLTSQLKFADKIKAVKTIVFARTEFEYGKFLMK
FT                   NMKDKTQTEFLISEF"
FT   CDS_pept        complement(780289..780948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_528"
FT                   /old_locus_tag="TGRD_538"
FT                   /product="DUF502-domain cotainig membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_538"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14021"
FT                   /db_xref="GOA:B1H0I9"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0I9"
FT                   /protein_id="BAG14021.1"
FT                   /translation="MENEKQKKKTLKEKIGVLIKKYVMTGLVVVIPLWLTFSIMKILFK
FT                   WVSSFAFPVVNYFVVDTYWVHIIARISSFFISIISIIVLGLITNRVFGKSALNSAEKFI
FT                   KKLPVFGKVHSAAKQFINFIFGNDNVEKFKKIIFVPYPSKGVYSVAFLTGEQSVKGEKY
FT                   LCAFMPTTPNPTTGFLLLFKEEEVVYTDYTVEQAFQFVISVGVINMRNNKKIKLNE"
FT   CDS_pept        complement(780938..781969)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_128"
FT                   /note="pseudogene of phosphomannomutase"
FT                   /pseudogene="unitary"
FT   CDS_pept        782337..784406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_529"
FT                   /old_locus_tag="TGRD_539"
FT                   /product="bifunctional transglycosylase/transpeptidase"
FT                   /note="penicillin-binding proteins 1A"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_539"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14022"
FT                   /db_xref="GOA:B1H0J0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J0"
FT                   /protein_id="BAG14022.1"
FT                   /translation="MKRKKPKKKSFLSFLTIALIVAVLVIAVSKITANFIDNLPSIKQL
FT                   ENYTPNLSTKIYDKDNNLIAELFTERRIFIPINKIPVNLQNAFIAIEDKDFFKHWGISI
FT                   KGIMRAFSRILLKMKIAEGGSTITQQLAKTIFLTRDKTLIRKIKEAILTIQLEKNYSKD
FT                   EILQLYINQIYFGCGAYGVQTAARIYFNKNAQDLNLAECATLAAIPKSPNYYNPFNNAK
FT                   ASLARRNLVLLRLRELGYITKEKEEEALAVALPTKETALKENMGHYLLEFLRIMLEPKY
FT                   GTNVLFKGGLSIYTTIDMKAQVGAEKAIEEALANFDKNKLKVFEKSRQKPVKVQGALIA
FT                   IDPKNGAIRAMVGGRNFRESQFNRAIQAKRQPGSAFKPFIYLAAIEKGLTPATLLNDEP
FT                   MVFVYKGKGNSWNLVSRDITTLETIAETVSEKDLINTNKIWTPTNYDKKYRGPVILKTA
FT                   LASSINICAIETIMQITPLKVIQSAKNLGITTPLANSFSLALGSSDTTLQEMVSAFAVF
FT                   ASGGIKTTPYIITKITDRDGKILEQNIPQQKEVLSSQDCFIITNMLKAVVEKGSGWNAK
FT                   NLGRPCAGKTGTTNDSSDAWFIGYTPQLAAGVWVGYDDHSISLGEKVTGGIIACPIWTQ
FT                   FMKEALDGELVLDFMQPENIEWALIDPLTGLLALSKTSGASLEAFVKGTVPTKY"
FT   CDS_pept        complement(784466..785932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_530"
FT                   /old_locus_tag="TGRD_540"
FT                   /product="ribonuclease G"
FT                   /note="RNase G/E type IV"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14023"
FT                   /db_xref="GOA:B1H0J1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J1"
FT                   /protein_id="BAG14023.1"
FT                   /translation="MLKNTLNIQTEKTVKKEIIVNRTFEESRVAILDNGKLFNLFIERR
FT                   ESEKILNNIYKGRVKNIVPALNSLFVDIGFGRGAYLDVCDILKEHRSKKNMIKAGQDIM
FT                   VQVYKEPIHNKGAKVTMAISLTGRLLVYMPFSNNIGVSKNIKDKHEYNRLKSMTAELKK
FT                   DISGGIIIRTKAEKATKAEIKNEIKYLIRLWASITERFDDAKPMSLIHKDLGLVFQTVI
FT                   DYFSDDVIFMRIDSQKELKDVTDFVEIVLPEFLDRIVFYDDRTPIFKKYGIEEEIKRLC
FT                   SNKVWLSSGGYLIIQEAESLCAIDVNSGKFTAKSTQEDTAVITNLEAAEEIARQLRLRN
FT                   IGGIIVIDFIDMKKASNRRKVLETLRKATKVDKAKIEIWPITRLGLIEMTRERKRKSLF
FT                   SILGDICPVCHGLSFVLSKESIFINVCDEIKQLKIDGYDGRIKIKLNIDVIEYFMKKKA
FT                   RLEELFGVEFDIEASTELLREEYKILYLNS"
FT   tRNA            complement(786401..786486)
FT                   /locus_tag="TGRD_tRNA35"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: UUA"
FT   CDS_pept        complement(786797..787066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_531"
FT                   /old_locus_tag="TGRD_541"
FT                   /product="DUF1844-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_541"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14024"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J2"
FT                   /protein_id="BAG14024.1"
FT                   /translation="MSKDVDQYFFNLITMLASSAWCQLGKIQDPVEGKIKKDLKGAQIT
FT                   IDMLLMLRDKTKGNLTKKEEEMLASAISNFQINYADEVTKCKVC"
FT   CDS_pept        complement(787726..789210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_532"
FT                   /old_locus_tag="TGRD_542"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_542"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14025"
FT                   /db_xref="GOA:B1H0J3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0J3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14025.1"
FT                   /translation="MSGIRVRFAPSPTGDLHIGGVRTALFNWLFAKNKGGKFILRIEDT
FT                   DETRSTGESAKVILDAMKWLELEWNEGPGNENLKYSPYSQMKRKERGIYRKYADELVAK
FT                   ELAYPCYCTPEEIDVMRKKAKADKLPPKYDGKCRHLTPGQRKQKEIEGKKAVVRFKMFG
FT                   SGTTVLNDIIRGRVKFDNSLLDDFVIMKASGVPAYNFACVVDDYLMEITHVLRGDDHIS
FT                   NAPRQMHIYNALGWEMPEFAHMSMILGAGGARLSKRHGHTSVLEYRKEGYLREALINYL
FT                   ALLGWSTEDSQQIFTIEELKQKFSVERCGISPSIFDPAKLLWLNGEKIRSKTPQQVYEL
FT                   FIDWLKYTGNEKLTETWDVELLKKALILEHDKIKLLKDIPSLVDFFFTKNVDYKEEAVK
FT                   KTLLSEKSKDIAKLVLIESAARLPNQLDFSAISLEQYARNLAAEKNIKTGQVFHPIRVA
FT                   ISGRMQGPGLFQMMEVMGKEDVVRRINVAINKFFQK"
FT   CDS_pept        complement(789307..790146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_533"
FT                   /old_locus_tag="TGRD_543"
FT                   /product="prephenate dehydrogenase"
FT                   /note="PDH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_543"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14026"
FT                   /db_xref="GOA:B1H0J4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J4"
FT                   /protein_id="BAG14026.1"
FT                   /translation="MLKVCIVGLGQMGASLGLALKKNSKSLKNCYHITGIGRRKGTLDA
FT                   ALKLKAADETSLSLQSARDADIVVICTPVDTIVPLYGQLSKIVAKNTIITDAGSVKYSV
FT                   EKGIRDSLKKNGGVSFIGSHPMVGKEKNGIFSSDADMFKNANVVITSVVKQSAENALVS
FT                   RMWKDAGANIVKMSARKHDELVAFTSHFPHIIAFLLNKIYKKTRRKNPQIDMLTAGSFK
FT                   SMTRVAVSSADMWAPIFATNSRNIEKYLNEFIEELNVFKQSLKDKQKVREEILKTQK"
FT   CDS_pept        complement(790146..791168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_534"
FT                   /old_locus_tag="TGRD_544"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /note="DHAP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_544"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14027"
FT                   /db_xref="GOA:B1GYQ4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYQ4"
FT                   /protein_id="BAG14027.1"
FT                   /translation="MIITLRKGAKQKEITAVTEKVKGLGYKPHVSKGEDITIIGMIGDS
FT                   AEKYKEVFEAMDVVEHVNEIQKPYKLASREFKRENTVIKVSRNVDIGGKKIHVMAGPCA
FT                   IESRDLLNDTGKIVKEAGGTILRGGAFKPRSSPYAFQGLGEEGLKYMEEAGEKLHMPTI
FT                   SEAMTVDQVELLSKYCDIIQIGARNMQNYDLLKAAGKQKKPVLLKRGMAATVKELLLSA
FT                   EYILSQGNYDVILCERGIRTFEDSTRFTMDLNAVPVLKKFTHLPVVLDPSHGIGIREHV
FT                   GTMAKASIAVGADGIIIEVHPRPEEALSDGPQSLLPEQFRNLMKELDLVAKAVGRELLD"
FT   CDS_pept        complement(791210..792343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_535"
FT                   /old_locus_tag="TGRD_545"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_545"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14028"
FT                   /db_xref="GOA:B1GYQ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYQ5"
FT                   /protein_id="BAG14028.1"
FT                   /translation="MDITKLIRKECEGFKPYVAGKPIETIKREMGLKSVIKLASNENPL
FT                   GASKKAIEAIKENLKEIFYYPDSNSYALKKGLSEHYRLGIRNIFIGAGGDEIIELIAKL
FT                   FFNKEEEIVISKHSFIRYEMAAKLMGSKAVVVAMKEGFKHDLTAMAKACTEKTKAIFVT
FT                   NPNNPTGTYNTKEELCKFLKEIPLNKAGLKPIVVLDEAYFEYASLDEDYPDGLDFLKEN
FT                   PNLIIFRTFSKIYGLAGLRVAYGFASEEIVDYIERTRPPFNVNRLAQIGGTAAIGDKEQ
FT                   VTKSLKLVKEGKEYLYKEFKDLKIEYIKSAGNFILFKSFPYKGKELFDALVKEGVIIRA
FT                   LDEYELTDWARVTIGLSEENELFIDKLKKIFGRGKNK"
FT   CDS_pept        complement(792554..793633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_536"
FT                   /old_locus_tag="TGRD_546"
FT                   /product="P-protein"
FT                   /note="chorismate mutase/prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_546"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14029"
FT                   /db_xref="GOA:B1GYQ6"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYQ6"
FT                   /protein_id="BAG14029.1"
FT                   /translation="MASKIQLQSARKRIDKVDKEIARLINRRAELALEVGKAKGRGYKE
FT                   GEGAIYVPSREKEVLKNVISSKSILGEEALKNIYTEIISACRNLESPTKIAFLGPWATF
FT                   THQAAIKNFGSSGYFIPVTSPREVLTEVESGRVDFGVVPVENSNEGSVNMTLDMLVETE
FT                   LKICAEISLKIEQCFLVKDRKSKILRIYSHEHALAQCRNWTLRNYPEAELIPVSSTAEA
FT                   AKKVVKEDFAAAIAGEASAKIYDLYILHKGIQDSRENFTRFFVIGKILTKASGKDKTSL
FT                   VFTVKDKVGELCNILGIFNRNGVNLAKIESRPTKKKAWEYMFFVDLRGHVEDENIVKTI
FT                   ESLKRSCVFVKSLGSYQKA"
FT   CDS_pept        complement(793747..794352)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_129"
FT                   /note="pseudogene of multicopper oxidase YfiH family
FT                   protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(795059..795769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_537"
FT                   /old_locus_tag="TGRD_547"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG1579"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_547"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14030"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J8"
FT                   /protein_id="BAG14030.1"
FT                   /translation="MDNLRSELELLYELQNYDNRIVDIREKIGKVLSLVEEKNKSLEYK
FT                   KKETETKKKKFVKLNSLKKEKESALDSKEKVISVHSLELNTVKSNDIYKALLLKIEKAE
FT                   CDKSVIENEILEFMDKIEKEFVIVKSAEDELKKIEKIVKNEINKFENFIKKLEKEATAV
FT                   EKEREEYKLKINRTILMQYERLRDCRDGQGICLIGDESCECCGMMLRPQLINQAYKCHE
FT                   LVFCDNCSRILLQK"
FT   tRNA            complement(795937..796008)
FT                   /locus_tag="TGRD_tRNA36"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUG"
FT   tRNA            complement(796082..796155)
FT                   /locus_tag="TGRD_tRNA37"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   CDS_pept        complement(796263..798155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_538"
FT                   /old_locus_tag="TGRD_548"
FT                   /product="glutamine-hydrolysing NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_548"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14031"
FT                   /db_xref="GOA:B1H0J9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0J9"
FT                   /protein_id="BAG14031.1"
FT                   /translation="MKYGFIKTAAATPHISVANPSVNVAEIIKLIEQANACGVELLVFP
FT                   ELCVTGYTCGELFLSDVLMHSVSDALNMVCKTTVGEKALVFVGSPIWNEGKLYSCAVAF
FT                   QNGKVLGVVPKTALPSYSEFYELRHFVSGRDISGSIKLCRQTAPFGTDIIFAAKNNDTV
FT                   KIAAEICEDMFIISPPSNRHVQAGASVIVNLSASNELIGKVDYRKTLIKSQSGRLSAGY
FT                   VYASAGSGESVSDIIFSGVRIIAESGEILAEGGLFESGLTLCEIDTQRLAYERRRLNVF
FT                   ESYNSSGYRTVEFNFDETGTELMRHISQLPFVPEDLKSVSSRAELILQMQSRALAERLK
FT                   FTGSNAVLGISGGLDSCLALLAVVRSYEILGRSKKDIIAVTMPGPGTSLKTVESVSELA
FT                   EALGIQIRKIPITDIVRKHLTDIKHSGKEDTVYENAQARERTQILMDIANAEEGLVIGT
FT                   GDLSENALGWCTYNGDHMSMYAVNSSVPKTLVKHLVSYESERVVKYKKALLSILNTEIS
FT                   PELLPSDNGKISQKTEDIIGPYELHDFFLYYTVRFGQKPDKTLMLALKAFKGKYDIEEI
FT                   KKYLRVFIERFFASQFKRNCVPDGIKIGTISLSPRGDWRMATESSAKEWLDSIK"
FT   CDS_pept        complement(798271..800256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_539"
FT                   /old_locus_tag="TGRD_549"
FT                   /product="PriA helicase"
FT                   /note="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_549"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14032"
FT                   /db_xref="GOA:B1H0K0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K0"
FT                   /protein_id="BAG14032.1"
FT                   /translation="MIVLESVLPVPLNKIFYYLPPENMNPESIVGKRVKVQFGKRILTA
FT                   YAISCRNVESDSGLKLKRIIKIIDDDSLITGETMEIADYISKNYVCSLGEALASIIPVS
FT                   MKPPKRIPKNRNKYEKKIYERHILNAQQSNAVNLINESLGKKVYNAFLLYGVTASGKTE
FT                   VYIKAVEYVLKQNRSAIMLIPEISLAIQFVDIMTKRFGASIGVWHSGISNIEKYSLFSK
FT                   AKNGSIKIMIGARSAVFAPFKNLGLIIVDEEHEHTYKQEQKPSYDTREIAKRRGVYHNA
FT                   VVVLGSATPSLESYKDALENRLNLIELNERICKKELPEVKVLTLRDRIFKAGLLLPETI
FT                   EAMSKALARKEQIIVFLNRRGYSPTIMCRKCGIVYQCSKCSVSMVFHRNPELLKCHYCG
FT                   LTKNLPVACSVCKSRDIAVFGAGTQKVEDELKKLFKTAKIFRLDRDTASSEENYEKVYR
FT                   GIKNEEYDILIGTQMIAKGFDFPRVSLACVVNADTSLYLPGFKSVEKTFQLITQVAGRS
FT                   GRRDMRGSVIVQTNHPQHYAIEYAKNHDFVSFYKTEIEERKKLFYPPYCDVAKISIRNK
FT                   EEKKADDDSEKLFSLLENSIKSYKLGLKLLGPVPAYIAKLNNVYRQHIIIKGGRENILK
FT                   LAGLLETFKQSSGTFIGIEVMPSDLI"
FT   CDS_pept        complement(800253..801014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_540"
FT                   /old_locus_tag="TGRD_550"
FT                   /product="uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14033"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K1"
FT                   /protein_id="BAG14033.1"
FT                   /translation="MKQSECLKILNLARKSLEEYKNWGENEVYKASSANVSCGKAVFPK
FT                   TGRQAFYAEISSSGEELGELREKVSFCKKCPLGEKRLNAVFGCGSPDADLVFVGEGPGY
FT                   DEDHIGKPFVGRAGQLLTKIIEAMGQARESVYIANIVKCHAMIDPSNPEKRSNDRPPTL
FT                   EEMEICRPYLDMQLEIIKPKIIVTLGASSTKGLLNSIESISRIRGSVREYKGIKLIPTF
FT                   HPAALLRNQDLKKFVWEDMKKVMHYLDTGEI"
FT   CDS_pept        complement(800962..801615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_541"
FT                   /old_locus_tag="TGRD_551"
FT                   /product="phosphopantothenate-cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_551"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14034"
FT                   /db_xref="GOA:B1H0K2"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K2"
FT                   /protein_id="BAG14034.1"
FT                   /translation="MSKKLTFLILSGPTKEYIDPVRFISNESSGKMGNALAQAALKREC
FT                   GVIFISGPSSIFPTNVKLIKVTTALEMFKEAKSNFKKANIIISVAAIADYCPVKTCKCK
FT                   IKKDSLGMLIKLKRNIDIIGYCGKNKKNQIVAGFALETENLIGNARLKLKNKKLDLITA
FT                   NGKESFGSDSATMYIIDADGVLEMKNKNKKIIAEKIIDETIRMFKNIESSKKIS"
FT   CDS_pept        complement(801615..802151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_542"
FT                   /old_locus_tag="TGRD_552"
FT                   /product="phosphopantothenoylcysteine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_552"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14035"
FT                   /db_xref="GOA:B1H0K3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K3"
FT                   /protein_id="BAG14035.1"
FT                   /translation="MALENKNVILGICGSIAVYKSCDIIRQLVKLKANVECILTRGGSE
FT                   FITPITLQTLSKNKIYIDMFAVTDKWEISHISLGQKADIIVIVPATADIIARLACGRAN
FT                   DLLACTVLASKADILICPAMNTNMFNHKATRKNIETLKSYGYRFVMPEKGELACGDGGD
FT                   GRLASVEVIMKEISR"
FT   CDS_pept        complement(802439..803068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_543"
FT                   /old_locus_tag="TGRD_553"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_553"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14036"
FT                   /db_xref="GOA:B1H0K4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K4"
FT                   /protein_id="BAG14036.2"
FT                   /translation="MNKRLNNSSAKSLGNIIIISAPSGAGKTAICNAVVKSSRNVVYSV
FT                   SYTTRCPRKDETNGGEYFFIDRTEFQKMIEEGKFAEWAKVHGNYYGTSKVFLGKMLKMK
FT                   KNILMDVDIQGGMSIKKQYPGACMIFVMPPDLKTLKERLVSRNKDHKKIIKMRLGNAVE
FT                   EVKSVQKYEYLVINDKLDKAVIAVKTIIKSLKYKIQKNKKYFNDFF"
FT   tRNA            complement(803093..803166)
FT                   /locus_tag="TGRD_tRNA38"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCA"
FT   CDS_pept        complement(803314..803928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_544"
FT                   /old_locus_tag="TGRD_554"
FT                   /product="XTP/dITP diphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_554"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14037"
FT                   /db_xref="GOA:B1H0K5"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K5"
FT                   /protein_id="BAG14037.1"
FT                   /translation="MIKEIVLATENRHKEEEIKSILKDLDIEIVPMTSFPDYPTMIEEG
FT                   ATLEENASNKARKVAEFFKKWTIADDSGLEVDYLNGRPGIYSARYAGENCSYDDNNKKL
FT                   LAELRDVPEEKRTANFRTVVAVASPAGRLFLADGKIFGTIKKHTAGTAGFGYDPVFYVP
FT                   EYEKTFAELGCEIKNSLSHRAKALQKVKKIIKSLSNSQLSF"
FT   CDS_pept        complement(804163..806814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_545"
FT                   /old_locus_tag="TGRD_555"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_555"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14038"
FT                   /db_xref="GOA:B1H0K6"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K6"
FT                   /protein_id="BAG14038.1"
FT                   /translation="MKKVYNSKEIEEKWCKYWIENKTFSAKLDGNRKPFTMFIPPANIT
FT                   GSLHMGHALNVTLQDIIIRFKKLKGYNTLWVPGTDHGGIATQNVVEKLLKKEGRTKYDL
FT                   GRDKFLEKMQQWKTETGSAILDQLKKLGCGLDWDRLAFTMDESRSKAVKKAFIKLFNKG
FT                   LIYRGKRLVNWCSRCATALSDIEVEYEDERSNLWYIKYPLRDCGEYIIVATTRPETILG
FT                   DIAVAVNPDDNRYAKFIGKTVKLPLVDREIKIISDYVVDKSFGTGAVKITPAHDAVDNE
FT                   IGKRSNLETIEVIDTSGRMINVLSKYLGLSVEEARKEVVKDLKASGFLVKTEDYVHSVG
FT                   KCYRCSAKIESLMSEQWFLNVKKMSEKAVEAVNDGRMSFYPQSWKKPYVLWLENLKDWC
FT                   LSRQIWWGHKIPVYYCVDEKGKRTNCSPVASLDRPAVCSCCKGRKFIQDEDVLDTWFSS
FT                   ALWPMSIFDWGEDENNEDLRYFYPASVLATGHEIIYLWVARMVQFGLEFMKDVPYSNVF
FT                   IHGIVRDKNGKKMSKSLGNVVNPGDIMDKYGTDALRFALAQVAAPGRDMQISEESFLAA
FT                   RNFANKIWNASRFIIINSQDISELDKNIQTFELADEWIIAEFAATASKVKADYESYNID
FT                   SAAREIYDFFWTKYCDWYVELSKIRIMSADLNVKKRVLSILVYVLKSTLQLVSPVMPFI
FT                   AEEIWRILNKGEKYIGIISESSFAEVKEGNSGSIEKMKVLQDIIVKIRILRSEMNISPA
FT                   VWIEALFNVLDERKEKVAKENESYIKQLARISSIRFVRNITRTKNSALIVAGGFEIFLL
FT                   LEGLIDIDKEKARLAKEIALAKQEVGRTTLKLQNKYFIKRAAESEIEKIKLRLNEANLK
FT                   IEKTKESLKFLG"
FT   CDS_pept        806969..807670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_546"
FT                   /old_locus_tag="TGRD_556"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_556"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14039"
FT                   /db_xref="GOA:B1H0K7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K7"
FT                   /protein_id="BAG14039.1"
FT                   /translation="MKAKTVLITGISRGIGKELTSSFSKNGWNICGCYKNNSPDYTVPN
FT                   SKFTKVDISKHNEVKELIKSSISEFGKIDCVINNASVAKRATIFRMTNEMWEHVIKTNL
FT                   NGTFYIIKEALRTMIKQRSGSIINIASISAFKSYVGAAGYSASKSGVISLTRTAAREAG
FT                   RFGITVNAVLPGFHFTSMGDNAGDAYIEEVKRKSVLNATTDIKELADFILFLAGVKTVS
FT                   GQIFNFDSRIA"
FT   CDS_pept        807766..808863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_547"
FT                   /old_locus_tag="TGRD_557"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /note="KASII"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_557"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14040"
FT                   /db_xref="GOA:B1H0K8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K8"
FT                   /protein_id="BAG14040.1"
FT                   /translation="MKDTKQFGITGIGIISPLGSGKEINWRKLINSESQVRYDKQYNAY
FT                   TAPVYGFKMQADMRQYEMAKSAIFEALQEADIRNSRYKKKRIGFCIGESKINPFNRVFT
FT                   FENTLLERLKKIFRFHGTMLAISAACATGALAITKSCNFIESELCDAVICGSAETSIHP
FT                   LYISAFKNMKLLAKHNPSPFDKNRDGFAIAEGACFIIVEDIKKALSRGVKVYCEIKGFS
FT                   NKIYSNDTLSVHSHKKMKDIIKKAINSETPDYIHMHGSGTKLNDYYESMAVAENFENAD
FT                   KISLSSTKAATGHMLGVSGMIGAVFSALAIKNNIVPPTLNFKHTDINLGLDYTPNKAKR
FT                   KIINSALSLSFGFGGQGAALFFKKL"
FT   CDS_pept        809349..811958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_548"
FT                   /old_locus_tag="TGRD_558"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_558"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14041"
FT                   /db_xref="GOA:B1H0K9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0K9"
FT                   /protein_id="BAG14041.1"
FT                   /translation="MNLSKFTIKSQEALAEAQNIASEYGNQEITSEHLLYALVKQQNGT
FT                   VGEIIKKSATPEQQNMLYANISKDLLSEIEKKPKVSGGNLFLSQGLNKILNNSEKTAKN
FT                   LKDEFISTEHIFIAVSEEISENASKILKKHGLTKDIILKILVSIRGDQRITDQNPEDKY
FT                   QALEKYGKDLTDLAKRGKLDPVIGRDEEIRRCVQVLSRRTKNNPVIIGEPGVGKTAIVE
FT                   GLAQRIISGDIPENLKDKKVMALDLGALIAGAKYRGEFEDRLKAVLKEIQSAQGRIILF
FT                   IDELHTIVGAGSAEGTVDAANMLKPMLARGELKLVGATTLDEYRKYIEKDAALERRFQP
FT                   VFAGEPSVEDTIAILRGIKEKYEVHHGVKIKDSALVAAATLSARYIMDRYLPDKAIDLV
FT                   DESASKLRIEIDSMPAELDSVEHRLRQIEVERQAVKKETDAASKERLANMEKEIDKLKR
FT                   DSAEMKVQWEKEKSSISEIRRLKAEIENMKIEEQKAERNGDLNAVAEIRYGKIPQAQKQ
FT                   LEEENKKLLKQQKEKKMLKEEVDEEDIAVVVSKWTGIPVTRMMESEMQKLLKMEDKLHG
FT                   RVIGQDEAISAIANAVRRSRSGLSDPNRPIGSFLFLGPTGVGKTELAKALAELLFDDEK
FT                   NIVRIDMSEYMEKHSVSRFIGAPPGYVGFEEGGQLTEAVRRRPYCIVLFDEVEKANREV
FT                   FNVMLQLFDDGRLTDGRGKTVDFKNTVIIMTSNIGSQHIQESENYDEMKNKVMQELRNY
FT                   FRPEFLNRIDEIIIFRNLGEMELNKIIEIQIKSFESRFAAKNIHVKLTDKAKDFISSKG
FT                   YDPAFGARPLKRAIQTYLLNPLSSKLISGEFKEGDNIFVSAAEKAGDRLEFKKKYVN"
FT   CDS_pept        812160..812810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_549"
FT                   /old_locus_tag="TGRD_559"
FT                   /product="dethiobiotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_559"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14042"
FT                   /db_xref="GOA:B1H0L0"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0L0"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14042.1"
FT                   /translation="MYKGIFVTATDTEVGKTYVSCKIAETLEKSGINTGVFKPVSTGNR
FT                   NDAKALIKAAKIDENTETVTPVFFKNPMSPYGASLLERRASDKIFDLKKINNAFKYFLN
FT                   KYEFTVVEGVGGILVPLKQNFFVSDLIKKFNLPVIVVARFGLGTLNHTLLTVEKLKRDR
FT                   QKILGVILSGKKNNNDVSVKSNALIIKKITNLSVLELGYNEKIDLEKNIWIIK"
FT   CDS_pept        812795..814198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_550"
FT                   /old_locus_tag="TGRD_560"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14043"
FT                   /db_xref="GOA:B1H0L1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L1"
FT                   /protein_id="BAG14043.1"
FT                   /translation="MDNKIKTALTNSDKNNIWHPFTQMADWLNDDPCKPLIIDRAKGSY
FT                   LYDVDGKKYLDGISSLWVTLLGHKNPRIDKAVKKQIDKVSHTTFLGLTHKPAIDLSEKL
FT                   LKILPDNLKKIFYSDDGSTAVEIALKMAYQYWQFKNEKRSFFLSLKNAYHGDTIGAVAV
FT                   GGTDLFHSRFRSLLFKSFFAMSPYCYRCVYRKKEIKFPVTAENFKDHNIQMHCRGQCIK
FT                   EVESILVKNNKKIAAAVIEPINQAAAGMIIMPKGYLKEYANLCNQYGIPLICDEVATGF
FT                   GRTGKMFAVEHENIKPDFICLSKGITGGYMPLAVTATTNEIYSAFLGKYEEFKTFFHGH
FT                   SYTANPLACTAANAVIDTLNQNKILQKLQSKIKHLEKELTSLLEHYRVGNIRHCGVMAG
FT                   IEIVEDKKTGKPYDSKLKTGAKICANLRKHGIIIRNLGNTLVLFLHLTMTNRETSKIIS
FT                   AIKIELDNL"
FT   CDS_pept        complement(814184..815344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_551"
FT                   /old_locus_tag="TGRD_561"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_561"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14044"
FT                   /db_xref="GOA:B1H0L2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L2"
FT                   /protein_id="BAG14044.1"
FT                   /translation="MLDDFLLKKLSEMENAGLLRTLNTIQSNPAVRIEVNGRKFINFSS
FT                   NNYLDLAGNKEINKAVADAIEKYGFAGTSSRLVCGNLSIHEELEAGLAVFKNKQASLVL
FT                   PSGYQTNVGIISALMANEKNSCIIMDKLNHASLWDGVKLSGSRIFVYEHCDMNSLEKTL
FT                   KRAHKYEIKLTITEAVFSMDGDFAPLKDFTELCRKYGAVSMVDEAHSTGVFGKEGKGLA
FT                   EVFGVSNKIDITVGTLSKAFAAQGGFVCGSLKLINFLINKSRAFIYTTAISPAVCAAAL
FT                   KSLEILKGSATERAFLLKTAEYLKKKLNKLGFNTSNTQSQIIPVITGSVENTERISLYL
FT                   REKGIYIPAIKPPTVPKEQSRIRISLTAGHTTRDIEKLTDSISEIV"
FT   CDS_pept        complement(816185..817426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_552"
FT                   /old_locus_tag="TGRD_562"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_562"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14045"
FT                   /db_xref="GOA:B1H0L3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0L3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14045.1"
FT                   /translation="MAINKVSSKPVCRDGVKKVVVAYSGGLDTSIILSWVKENYGCEVV
FT                   ACCVDVGQGKELEGLDEKAKKTGASKSYIIDAKKEFVTNYIYPTIKVNALYENKYYLGT
FT                   SLARPIIAEKIADVVKKEKADAVCHGATGKGNDQVRFELAFKSLMPNVKIIAPWREWDI
FT                   KSREDAIDYAKKRDISVPVTKAKPYSSDANLWHISYEGGVLEDLENEYDESMFKMTVSP
FT                   EKAPDKPMYLAIAFEQGIPVSIDGNKFTPVELITKLNEIAGANSIGRADIVENRLVGMK
FT                   SRGVYESPAAAVLYAAHEELESISIDRDTLHFKQLLAHKYAEIAYYGLWFSPLREALDA
FT                   FINETQKYVTGSIKLKLYKGNIIIVARQAKYSLYSEKLATFEKDEIYNHKDAEGFINLW
FT                   GLPTKMQAMLRKSE"
FT   CDS_pept        complement(817408..818604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_553"
FT                   /old_locus_tag="TGRD_563"
FT                   /product="acetylornithine transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_563"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14046"
FT                   /db_xref="GOA:B1H0L4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L4"
FT                   /protein_id="BAG14046.1"
FT                   /translation="MNIKQIEDEYFMHTYKRGDLVVKETKNQFIWDENGRKYLDFFAGI
FT                   SVCNVGHCNEAVIKAAKKQLDSFSHVSNLYYAPPQIKLGEELVKRTFPGARVFLSNSGA
FT                   EANECAIKIARKWGFLNPSKEGNRYEIICFFNSFHGRTLTTLSATGQDKFHKFFKPLQE
FT                   KFVFAEINNMDSVKKLANNRTVAIMIEPVQGEGGIIPSDETFLKELRAFCDDNNFLLIF
FT                   DEIQCGMGRTGKLYAFENYGIKPDIVTLAKSLANGLPLGASIAGEKCAGTFLCGDHGST
FT                   FGGNPVSCAAALAVLNIINSEFLNNSLKIAEYLRIKLENLKDKYSVIKCVRGLGLMIGM
FT                   DLKINGKDIVNYCMDKGLIINCTNDTVLRLLPPLIITKKDVDFAVKILEGALKWQLTK"
FT   CDS_pept        complement(818601..819439)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_130"
FT                   /note="pseudogene of type II restriction endonuclease"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(819544..820619)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_131"
FT                   /note="pseudogene of adenine-specific DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(820627..821376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_554"
FT                   /old_locus_tag="TGRD_564"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_564"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14047"
FT                   /db_xref="GOA:B1H0L5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0L5"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14047.1"
FT                   /translation="MSELTVVKFGGSLTENPQAQNKFLEELTLISKRQNIILVHGGGPE
FT                   INALLEKFAITSRFVNGLRFTDADTLGVVELALSGKVNRVLTTGLIKNGANAVGISGKD
FT                   GKSVICRQVEYLGFVGEPVKVNRKLIDILIKSRFLPVIASIAADVEGNIMNVNADTLAA
FT                   SIAVAFKAQKLIFLTDVAGVFDKNNNIIKEIKIKEINSLIEDKTITGGMIPKIKGCAES
FT                   VKKGLKEVWIAEGISGIQKIKGTVIKK"
FT   CDS_pept        complement(821437..822183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_555"
FT                   /old_locus_tag="TGRD_565"
FT                   /product="PD-(D/E)XK nuclease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_565"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14048"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L6"
FT                   /protein_id="BAG14048.1"
FT                   /translation="MRQDFKISYSRVNMYLFCPYKYKLMYLDNLHIPINADIIFGHIIH
FT                   KALEKFHVGKEQSYDMLFECYDDAWRNDGFADPQQIFEYYECGRRMLASYYKSFNASDT
FT                   EVIYVEKAFDANIGKYKFIGIIDRVDRYPDGKYEIVDYKTHAKIWEQERVDKDLQLSFY
FT                   VYACKNVFGFDPDKISVYFLSENKKIYTKRSRSEISDAIDVAIETAENVAAENFDPDVS
FT                   KCHMCGFKLKCKFSAYKKASAELCPA"
FT   CDS_pept        complement(822167..822769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_556"
FT                   /old_locus_tag="TGRD_566"
FT                   /product="16S rRNA (guanine966-N2)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_566"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14049"
FT                   /db_xref="GOA:B1H0L7"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L7"
FT                   /protein_id="BAG14049.1"
FT                   /translation="MSLKVIAGSARGRIIKTLPHDNLSIRPMLGRIKKSIFDIIQFKIP
FT                   YSIFIDLFAGAGSVGIEALSRGAKKVVFAELSDISLSLIKRNVNMLGFNDKAKIVKCDI
FT                   IKDFAVLQDKYDIIFMGPPYKDENKKALALTYPVLRNVMRYDILKDDSILITQKHIKEP
FT                   VGNLVGLECFRTEKYGDTIISFYKHAKLENIRNETGF"
FT   CDS_pept        complement(822774..823190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_557"
FT                   /old_locus_tag="TGRD_567"
FT                   /product="YjbQ-like secondary thiamine-phosphate synthase
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_567"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14050"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L8"
FT                   /protein_id="BAG14050.1"
FT                   /translation="MIYSEYINCETKGYTDIINITDDIKRIIARSGITNGIATLGVTSS
FT                   TSAITTLEFEPGLIADFRKSLEIVAPVDGFYAHDEKWHDGNGFSHIRSSLIGTSKTIPV
FT                   VSKSLMTGTWQQVILVDFDNRPRSRKVFVQIFGE"
FT   tRNA            complement(824164..824236)
FT                   /locus_tag="TGRD_tRNA39"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCC"
FT   CDS_pept        824393..824662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_558"
FT                   /old_locus_tag="TGRD_568"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_568"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14051"
FT                   /db_xref="GOA:B1H0L9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0L9"
FT                   /protein_id="BAG14051.1"
FT                   /translation="MKKPDIVKQVSDISGLTQGDSNKAIKALVKVIQITLKNNGVISLS
FT                   GLGSFRAKTRKARQGRNPKTKEVILIPPGKKVSFKPTTTLRKII"
FT   CDS_pept        825083..826366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_559"
FT                   /old_locus_tag="TGRD_569"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_569"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14052"
FT                   /db_xref="GOA:B1H0M0"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M0"
FT                   /protein_id="BAG14052.1"
FT                   /translation="MEKNYINVGLIGYGTVGKGVVKILEENKKIVLRKVGNPIRIKSIC
FT                   DLNPIDKPELHVKNFKDIIKDPEIDLIVELIGGYEPARTIITESLKAGKNVVSANKAAL
FT                   AKYWDQIFTTAQIYQKSVYYEASVGGVIPVVQGLSEGLASEEILEIKGILNGTTNFILS
FT                   EMKKHCVSYEEALKSAQKAGYAEADPSFDVNGIDTANKLAILASLAWGSWVKVKSISVI
FT                   KGIADLDIEDILITQDFGYNVKLIGSAQKTKDGIDLSVQPCLVNHEHAFATVENEYNAI
FT                   MITGKDSGDVLFYGKGAGQLPAASAVVSDIINLSKSIVTNTAGIVPDVVYDSTKKIKIL
FT                   PAGKSKAPYYLKFTVIDKPDVLSKISGILSKFKVSIARSLAQFNISKKNYGRISIITHE
FT                   TYSENIEKAINAIKSITKSKTVKIKIEI"
FT   CDS_pept        complement(829085..829282)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_132"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(829395..831080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_560"
FT                   /old_locus_tag="TGRD_570"
FT                   /product="diphosphate-fructose-6-phosphate
FT                   1-phosphotransferase"
FT                   /note="PPi-PFK"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14053"
FT                   /db_xref="GOA:B1H0M1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011183"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M1"
FT                   /protein_id="BAG14053.1"
FT                   /translation="MAWKSVDVSELQIERRKFEPVLPDILKNGATSVKPVEGKITQSVA
FT                   DRSKIKEIFKNIYGLPEITFKKGTNNAIAEKAVKVAVVLSGGQAPGGHNVIAGLFDGLK
FT                   IANSKNTLIGYFGGPSGILENKYKVISEKLLCKYRNTGGFDFIQSGRTKIETSEQFCLT
FT                   KDNLLMSNVDALVVVGGDDSNTNAAMIAEYLKKEKLDKCVIGVPKTIDGDLKNKYIETS
FT                   FGFDTATKIYSELVGNICRDVNSAQKYWHFIRLMGRSASHIALEVGFKTQPNIVLVGEE
FT                   ILEKKLRIVKVVENIVDVIVKRSQAGKNFGVVLVPEGLIEFIPEMKKLISTLNDALAEN
FT                   ASVVAEINSVAGKKEFICTKLPAKLSDLMKSLPSGIASQLMLDRDPHGNVQVSLIETEK
FT                   LLIEMVHKKLYELKKENKYGGKFSAITHFFGYEGRCGIPSNFDANYTYALGYNAAVLVL
FT                   NGLTGYLSSVRNLARSPKQWECGGIPLTMMMNIEKRHGKEKPVIQKALVDLNGKPFKEF
FT                   VKNRDKWALSESYIFPGPIQYFGPADITDMTTRTLKYEQSGLLK"
FT   CDS_pept        complement(831152..831548)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_133"
FT                   /note="pseudogene of lipopolysaccharide heptosyltransferase
FT                   II"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(831571..832982)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_134"
FT                   /note="pseudogene of Kdo2-lipid IVA 3' secondary
FT                   acyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(832957..834196)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_135"
FT                   /note="pseudogene of 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(834297..834869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_561"
FT                   /old_locus_tag="TGRD_571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_571"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14054"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M2"
FT                   /protein_id="BAG14054.1"
FT                   /translation="MRKIKNFRINLRIKEILGIIKKLVNVVELSIEVEEAVRRCCRFYS
FT                   RFLVPSAVYETFSKEMLPFVFEKDVPSKWIAESVFFVTIGGDLYEEYKKDEGTFGEHTG
FT                   KIISAVAVDALEQSKNFIRRLISSEAQEENCEISRNVDIPPLLYETTTGCIPADKIGIS
FT                   VEDGKLNPRYSECGLFYWIPSKKKTKK"
FT   CDS_pept        complement(834869..835801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_562"
FT                   /old_locus_tag="TGRD_572"
FT                   /product="protein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_572"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14055"
FT                   /db_xref="GOA:B1H0M3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0M3"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14055.1"
FT                   /translation="MRFFRSVDIDFIGNRYKFFTISGLLLLLTVGAFIYRGGLNYGIDF
FT                   TGGILMRISFQNEVGLQDVRIAVEESGINSFELQSSGNLVMIRIKKDLEAQEEFETLIK
FT                   SSIQLRFPDNPVKIEGIEYIGPTVGEYLSKQAVYAFLFAFLVMIVYVAFRFKSSLWGIV
FT                   SVVGIIHDIVISLGFVILANKEINITIVAALLTVVGYSINDTIVLFDRIKENLKLLVKE
FT                   DFVAVINKSINEVLVRTIVTSLTVFIVACSLFFFGGEVMHTFAYIMIIGTVLGVFSTIF
FT                   VCAPLICEWRIKTNKRLKIAIKQDGVRSK"
FT   CDS_pept        complement(835814..837241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_563"
FT                   /old_locus_tag="TGRD_573"
FT                   /product="protein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_573"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14056"
FT                   /db_xref="GOA:B1H0M4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0M4"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14056.1"
FT                   /translation="MKINWKLLITVTLLAFSVWALWPSLKFALMSDEKKEQSEKERDPV
FT                   LGRTLKLGLDLKGGTYLLLETDTSHLNGAVKVKDAVSRAIEIIRNRIDQFGVTEPMIAK
FT                   QGDKWIVIQLPGIKDPKAAKDLIGKTALLEFRIVNTSEEARQVLDLIYEKRITPVQYRE
FT                   NSSAYPDIKAVMPEGASVFESRSNMDYYVLDKALLTGAALANAKVEFGGEYGQMMVSIE
FT                   FNRDGGKIFEYITERNIGKSLAIVLDGIVQSAPVIRTRISRGERASIEGNFNSEDAKVL
FT                   AAVLRAGALPVPVRLIEERTVGPSLGDDSIKKGFMSSLIGIVLVFLFMFIYYRSSGLIA
FT                   DVALSLNLIILMAIMAYLKFTLTLPGVAGIALTLAMSVDANVLILERIREEIAVGKTAK
FT                   MAVDAGYQKVFWTIFDANFTTLIAALFLFQFGAGPIKGFAVTLSIGLIVSMFTAVTVTK
FT                   LIYEFLFKKNLLLKIKI"
FT   CDS_pept        complement(837242..837937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_564"
FT                   /old_locus_tag="TGRD_574"
FT                   /product="uncharacterized metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_574"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14057"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M5"
FT                   /protein_id="BAG14057.1"
FT                   /translation="MVKIMDDKNKYSNIVLKDIKKNPIVNAFIKSANDYLGTIGYTEHG
FT                   VRHVKLVASIAENVLLYLDYSKRLQELAGIAGYMHDIGNVVNRKDHGQSAALVAMRLLK
FT                   DMGMTPEETALIISAVGNHEEETGDPVNPVAAALILADKSDVHKTRVRNPDISKYDIHD
FT                   RVNSAVEKSFLKVLKDKKVISLQLTIDTQISKVMEYFEIFMSRMLMCRRAADFLDCAFE
FT                   LIINERKLL"
FT   CDS_pept        complement(837981..838370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_565"
FT                   /old_locus_tag="TGRD_575"
FT                   /product="protein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_575"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14058"
FT                   /db_xref="GOA:B1H0M6"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M6"
FT                   /protein_id="BAG14058.1"
FT                   /translation="MGKFVNLFIFLLAIISMPSLSFAQPLSEGLSSFGGLMPLILIFVF
FT                   FYLFLLRPQQKKAKKHRDLLNSLKKDDRIITGGGLYATVNAVKGNTVEARISDGVYVQI
FT                   VKQLISAVITKEDEESAKIPEIVKK"
FT   CDS_pept        complement(838389..838537)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_136"
FT                   /note="pseudogene of queuine tRNA-ribosyltransferase (part
FT                   II)"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(838673..839855)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_137"
FT                   /note="pseudogene of DNA helicase II PcrA (UvrD
FT                   superfamily)"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(840685..841269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_566"
FT                   /old_locus_tag="TGRD_576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_576"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14059"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M7"
FT                   /protein_id="BAG14059.1"
FT                   /translation="MVRVLLSLLTVFSLVLLSSCGKKQTLLNTAVLPSAEKTMVEVDIN
FT                   TLKKMDDDVSKCYENNNENKEKKTDSVWDNAVGYITGFFVVFNIFSVLQEQINRANMEA
FT                   AGRVPLQVQLENEQKARIAWTEVNARDRANYEKGLLKRNAYLSSQIDGLNKEIAGLKHV
FT                   SDLYRQDFNRSHYENTQLRLENARLRIAMDD"
FT   CDS_pept        complement(841421..842089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_567"
FT                   /old_locus_tag="TGRD_577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_577"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14060"
FT                   /db_xref="UniProtKB/TrEMBL:B1GZF1"
FT                   /protein_id="BAG14060.1"
FT                   /translation="MLQKIWKYGEVRKLCDCTSKGCFNYAAKYMLKQARINYRKTLVEA
FT                   KGRVATAKKDKILIMCDKNGRLAPFRQYSKALGLGFNREFPASVVASADVFTNAATAGS
FT                   VGLVDGWSTTFERPIFGILSALTNFAKIGICRVGTEIGRVSIPNYYLRVLHSSKAGQKI
FT                   LGELRRFYNLKDWFKKNPDVKGKEAVEKVRFNEALERNAEIVQKLNEDLMRKNNYDIND"
FT   CDS_pept        complement(842166..842693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_568"
FT                   /old_locus_tag="TGRD_578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_578"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14061"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0M9"
FT                   /protein_id="BAG14061.1"
FT                   /translation="MALQCQKFTFVVIIAFGCLKDKAQELSQRMSDEAVHFTDGGYVNA
FT                   CWFTLTYDNNNLPILPQYGKRSDEIKEQLKILKSYGRRYAKKSSVYNRHSYNMLPTHFE
FT                   HRVNPNEYCCGCEHNELVRELNKYSTFRKLDVQTFIKDLRDYLSYHRNLKIRCFYCGEY
FT                   GNILDRPHCIWA"
FT   CDS_pept        complement(842719..842839)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_138"
FT                   /note="pseudogene of queuine tRNA-ribosyltransferase (part
FT                   I)"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(842839..843504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_569"
FT                   /old_locus_tag="TGRD_579"
FT                   /product="uncharacterized metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_579"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14062"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N0"
FT                   /protein_id="BAG14062.1"
FT                   /translation="MDEILTFEEIKNNLEIRTYFEFMDKTFALMGYKEHGRGHALYAAE
FT                   IAERILKYLGYSKREQELAKIASYIHDMGNLVSKYGHDQSSSIMFLNVIGDNRYNEDIF
FT                   AIASAVGCHEDKTVDPVSAIAAALVLGDKTDVRRERIRAEDLYYVYKHSRIIAACQKVD
FT                   VVINKEEMTIGLRIKIDATICSVMDYFEIFMSRTNFCRRASSVLNCNFELYINEDKFL"
FT   CDS_pept        843737..847586
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_139"
FT                   /note="pseudogene of Na+-driven multidrug efflux pump NorM"
FT                   /pseudogene="unitary"
FT   CDS_pept        847587..847882
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_140"
FT                   /note="pseudogene of putative cytidylate kinase"
FT                   /pseudogene="unitary"
FT   CDS_pept        847945..848649
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_141"
FT                   /note="pseudogene of hydroxyethylthiazole kinase"
FT                   /pseudogene="unitary"
FT   CDS_pept        848654..849577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_570"
FT                   /old_locus_tag="TGRD_580"
FT                   /product="quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14063"
FT                   /db_xref="GOA:B1H0N1"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N1"
FT                   /protein_id="BAG14063.1"
FT                   /translation="MKETINKLKKEKNAVILAHIYQLPEIHNIADFVGDSLDLSRKAVQ
FT                   TNADVIVFCGVHFMAETASILNPKKKVLIPDLNAGCPMADMIIAEKLKEFKSRYKNPVV
FT                   VAYVNTSAAVKAESNICCTSSNAVNVVKSIAGETGAENSDIIFVPDKNLGSHVQKLAGV
FT                   KMNVWNGFCPTHNNLILPGYLLKAKEEHPHAKILVHPECRPEVASAADHVMSTGVMCRY
FT                   VEKSTAKEFIIGTETGILYTLKKNNPGKNFYPVSSFAVCPNMKKITLAKVLDVLTNMKN
FT                   TISVSEDIRQKAYRPILKMLEINAQG"
FT   CDS_pept        849833..851959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_571"
FT                   /old_locus_tag="TGRD_581"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   (class III) large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_581"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14064"
FT                   /db_xref="GOA:B1H0N2"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N2"
FT                   /protein_id="BAG14064.1"
FT                   /translation="MENEGFFSSIVKRNGTKEAFNSKKISAAIAKAGETTGEFGQDTAN
FT                   KLAIKALSLLLDTIEDRKPTVEKVQDAVEEVLLYSKYKKTARAYILYRDQHSKIREIYS
FT                   AFNIDLVDQYLEKIDWQVNENSNMSYSLQGLNNYISSGISKIYWLNKIYPENVRKAHSE
FT                   GDLHLHDLGLLGAYCAGWDLQDLLLNGFKGASGKSEAKPAKHFRTVLGQIVNFFYTLQG
FT                   ESAGAQAFSNFDTLLAPFIYYDKLNYEEVKQALQEFLFNINVPTRVGFQTPFTNLTMDL
FT                   TVAPYYKNEPVIIGGKHRDKKYGEFQKEIDRLNQAFLELMLAGDAKGRVFTFPIPTYNI
FT                   TKDFDWNNKNISALWDITAKYGVPYFANFINSDMKPEDARSMCCRLRIDNRELRKRGGG
FT                   LFGASPLTGSIGVVTINLPRIGYLAKNESDFIDRLKENMDIAKQSLEIKRNVLEKFTSN
FT                   NLYPYVGFYLRIVKERFNKYWKNHFSTIGIIGLNEACINLFGEGVGSIKGKSFGEKILD
FT                   FMREILINYQKETENNYNLEATPAEGASYRLARLDIQKYPDIISASKTIGMPFYTNSSQ
FT                   LPVDYTEDIFENLDLQDSMQAKYTGGTVLHMFVGERIKDTESLKNFIKIVCENYSLPYF
FT                   SITPTFSVCPQCGYIEGEHTECPKCKQEKLDDIDRQIKVLEDILDNRHPSLCTVKEYKE
FT                   ESGTCQTKSLSAAK"
FT   CDS_pept        851981..852160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_572"
FT                   /old_locus_tag="TGRD_582"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   (class III) small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_582"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14065"
FT                   /db_xref="GOA:B1H0N3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N3"
FT                   /protein_id="BAG14065.1"
FT                   /translation="MTINEIQKKIQELKLQKDSVEGTKCEVYSRVVGYLRPVASWNEGK
FT                   REEFKIRKNYCFCK"
FT   CDS_pept        852210..852803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_573"
FT                   /old_locus_tag="TGRD_583"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   (class III) activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_583"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14066"
FT                   /db_xref="GOA:B1H0N4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N4"
FT                   /protein_id="BAG14066.1"
FT                   /translation="MQIGGLQKLSLIDYPGTPAAVIFTQGCNMLCPYCHNPQLVYPYLF
FT                   EKTLNENEILYFLKKRQGLLKGVVITGGEPTLQNDLFNFIKKIKNLKFLVKLDTNGTNP
FT                   KILQELIREKLIDFVAMDIKSSAEKYKLFFKGNLNLIMQSLHVIKSSDIAHIFRTTYDT
FT                   DILNKRDLDEIKATIENSEYIVQKCRKQFNSPEK"
FT   CDS_pept        complement(852938..855343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_574"
FT                   /old_locus_tag="TGRD_584"
FT                   /product="cobalamin-dependent methionine synthase MetH"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_584"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14067"
FT                   /db_xref="GOA:B1H0N5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N5"
FT                   /protein_id="BAG14067.1"
FT                   /translation="MNKQKFLDILKSRILIMDGATGTELQKKKYLDGVEIPEEINIKFP
FT                   ERIADIYSSYINAGSDIILANTFGANLIRLKQHGLLDKADDIIKSGIDLIREISSDTIV
FT                   AGDISSIGEYIEPLGSLTFDEAYNSFAFQVSLLQKHGADVIVIETMTEIKETKAAILAA
FT                   KENFDGAIIVQMTFSKDGVTVTGTDLKSFIAMAESLGVDALGLNCSIGSRDLAELAKVL
FT                   CVNTNLPISFKPNAGIPVLINRETCFPETKEEFIEASLKAYSYGVNMFGGCCGTNPEFI
FT                   KILSGELMNKAPKIRSVKSKYFLSTRTKTIDINEAEKPVIIGERINPTNRKKFQEELLK
FT                   GNLSTVKDEARSQVWSGANLLDVNMGVPGTDEIKLLINAVNQIQETVSVPLCIDSSNSG
FT                   ALEQAVKNCAGRPLINSVNGEQAKLDVILPIAKRYGAALIALTTDDNGIPATAEKRLKI
FT                   AAKILNFADRCGLERKNIVFDYLVLSASSSPDQIGETLKAMRESKRMYPECKLVLGVSN
FT                   VSFGLPSRQTINSTFLKMAVAVGLDFAIANPHENWDIDDPFAKNLLENKDKGAVKYMEV
FT                   FTSFRKQIPETETEKLTTDKQLYFAILNGNRDSVDDILSQIIASGDSNPFRTVNNNVLK
FT                   ALNVVGEKFASKEYFLPQIIMSAQAAQSAFAIVKATLKKDEASSAGKIIIATVKGDMHD
FT                   IGKNIVGAVLESYGFDVIDMGVNVDSQSIIDEAHKINPIAIGLSALMTTTMPEMGMVVK
FT                   LKNAARVPTKIIVGGAAVTEKFAKEIGADAYARDAMEAAGYVKTLQKN"
FT   CDS_pept        complement(855711..856340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_575"
FT                   /old_locus_tag="TGRD_585"
FT                   /product="MetH-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_585"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14068"
FT                   /db_xref="GOA:B1H0N6"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N6"
FT                   /protein_id="BAG14068.1"
FT                   /translation="MLRISTIEIPYNKLLVRLGYLQTKTKLDEKTAVMIKETLSLAQKL
FT                   IKPKAVVAFENIATISGNKTSNEISFENGYKIKSGNIAKLLKNCFKVYGIGITVGGALE
FT                   LRIDEFLKKKETFNALISDAAGSVAAEETINLANAQIKAYEEKNGNMVTRRYSPGYGDW
FT                   ILEDNRQFLNWIGAEHIGIKLNEFCHMKPEKSVSALIGVAKGWSER"
FT   CDS_pept        856693..857091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_576"
FT                   /old_locus_tag="TGRD_586"
FT                   /product="acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_586"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14069"
FT                   /db_xref="GOA:B1H0N7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N7"
FT                   /protein_id="BAG14069.1"
FT                   /translation="MNVLHLRIAYADTDQMGMVYYGNYLTFFERGRAELLRDIGFEYKT
FT                   IEKRGFYFPVIYAECKYLAPAKYDDVITIETRLTEVTAASTTCSYKVKCDGKLLVTGKT
FT                   KHPFVNKMMRPVRFPEDIKELIEKHLEK"
FT   CDS_pept        857117..857566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_577"
FT                   /old_locus_tag="TGRD_587"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_587"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14070"
FT                   /db_xref="GOA:B1H0N8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N8"
FT                   /protein_id="BAG14070.1"
FT                   /translation="MFQALKEASKARESREVPIGAVIVKDNKIIARGFNKCIALSDPTA
FT                   HAEIVALRKAAKKLKNYRLNDCYAYATIEPCLMCAGALAKARIKKIIFGAFDKKADCYK
FT                   NILKTGDIKKLSRRLVIVGKKEKHLSAECANIIKDFFKKIRQQKA"
FT   tRNA            859614..859684
FT                   /locus_tag="TGRD_tRNA40"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCG"
FT   CDS_pept        complement(859960..862056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_578"
FT                   /old_locus_tag="TGRD_588"
FT                   /product="Fe2+-transporter membrane unit"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_588"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14071"
FT                   /db_xref="GOA:B1H0N9"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0N9"
FT                   /protein_id="BAG14071.1"
FT                   /translation="MNTDKNITVALVGNPNSGKSTIFNSLTGSNQNVGNYPGITVEKKE
FT                   GLKKYKGYNVNFIDLPGTYSLSAYSDDEVVVRNFLLNEKLDVVVNVIDSANMERNLYLF
FT                   TQIVELDMPVIMVLNMVDILKSHGKTVDKKVMSDILGVPIFATVASKDVGIVDILDCVV
FT                   NTFENVEFKNQIRVKVDYGDDIKGETEKLEKLISEDSVLSKFPKSWLTIKLLDNDPLAL
FT                   KLVCKAGNETEISEQIKKSRNHIKEHFGRKVEIEIADRRYGFAKAVVKMVVKKTGREKI
FT                   DMTEIIDSFTLNRYMGIPIFAVVMYIIFKFTFTFSEPAVKLLGLFFRWFGGAIMGLIPD
FT                   GPVRSLIVDGIIGGVGGVLGFFPLVLFMFFAIAFFEDSGYMARAAFVMDKIMSRFGLHG
FT                   KSFLPLMLSTNGCAVPGILATRTLDSKRDRLITMFVVPFMICGAKLPVFALIIGTFFSA
FT                   KYQATVMFFMYFLSVVIALGIAKLLSVTILLKGESTHFVMELPPYHLPTIKGLFLKMWE
FT                   RSWLYVRKAVTVVILISILVWAVFAYPQAPLNENFTEAEKSALQLDCSIAGRVGKIFEP
FT                   LFKPIGIDGNRVIALIAGFAAKEVIVSTLSTVYSIAGEVNSGYTRTLREKIATDDDWSP
FT                   LKGIAFLIFCLIYTPCIVSVAVFFKETGSSYKWLALLVIGNTIFAWIVSFIVFQLGTLL
FT                   NIGM"
FT   CDS_pept        complement(862060..862398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_579"
FT                   /old_locus_tag="TGRD_589"
FT                   /product="Fe2+-transporter binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_589"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14072"
FT                   /db_xref="GOA:B1H0P0"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P0"
FT                   /protein_id="BAG14072.1"
FT                   /translation="MKYLKKIIKLIYRYWHERWVKAHFQKYKSFNDCLKYNGMAKLSDA
FT                   VPGVYRFITAYCDGKLAYRLLEMGFVPGEYLTVIENTGLKGSTMIKIKDSKIALSNKIA
FT                   DKILLKKK"
FT   CDS_pept        complement(862493..862965)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_142"
FT                   /note="pseudogene of Fe2+-dependent repressor"
FT                   /pseudogene="unitary"
FT   tRNA            complement(863206..863279)
FT                   /locus_tag="TGRD_tRNA41"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   CDS_pept        complement(863335..863734)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_143"
FT                   /note="pseudogene of"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(863747..864883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_580"
FT                   /old_locus_tag="TGRD_590"
FT                   /product="DUF362-domain/Fe-S containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14073"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P1"
FT                   /protein_id="BAG14073.1"
FT                   /translation="MSVTKISLIKCDDYSKADNAVREAVRLLGCISVFISPSEKILIKP
FT                   NLLSPKDPSKAITTHPEIVRVVIKLVKEAGAVPAVGDSPGGAIRNIKNLWETTQMERIC
FT                   KEENVELINFEASGSKEFDINDKNIKKVNFSNAALDCDGIINLPKLKTHALMSFSAGVK
FT                   NLYGLVPGLMKVEYHKYAFKSKDFADLLTNIYLFFKDKIRFTLIDGVLSMEGNGPSAGE
FT                   VRKTNLIAASSDTAVLDAYLLNELNYDISNSGILKNLKITKDILKTVEVSGEKSESFNL
FT                   KKFKFPSVRKLDLFPKSLIRILGKFLWVKADINEKICVKCMLCARACPAEAIRAAGNQY
FT                   PHIDAEKCISCFCCHEMCPHKAVKFKKSMLAKIFIKEN"
FT   CDS_pept        complement(865083..868550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_581"
FT                   /old_locus_tag="TGRD_591"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_591"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14074"
FT                   /db_xref="GOA:B1H0P2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P2"
FT                   /protein_id="BAG14074.1"
FT                   /translation="MHLKKVEVCGFKSFADRTVLDFEPGISGIVGPNGCGKSNISDSIR
FT                   WCLGEQKAKSMRSSNMQEVIFGGTQTRTTTGMAEVSLTFDNSQNGLPVDYSEVIITRRL
FT                   FRSGESEYFINKTQCRLKDIRGMFLDTGIGYDGYSIIEQGKVDFLTTAKPEDRRELFEE
FT                   AAGIAKYKVKREETLRRLEKIDTDMSRLSDALVIHKQQIADLNSAAKKAKQYKEYKENL
FT                   AKYEIVSLVRHITCGIGEIERIKKNLDPKVKEFESDNVFIAQLDVEIQDMRFSLDGRNE
FT                   QYVNINRDLSEIKTQIGVADQIIQHAMSREIEIKAEQERLGHELVTIRDKVVQMEEQLK
FT                   TLNTDDGSLSVEVVCLENVFKEKELQYNSIKVGLLELESKENEVRSRISELKSEKEQQL
FT                   KLKTELAEIKTRLDADIISLERMITMLENDVEFANREIAEIDAELTTADKSRWLFESEN
FT                   EKINKTVSENEEKIKTLENSLLQYKETLVSDEARIATLKEFDQQDPVRSSIRAVLSLGN
FT                   VARGPVSSLIDVNDDKIGLIASALGEKLNYLVCETSERVERAIKFLEDNGLCRLSFIVA
FT                   EKISDSYRKSDIGLPLGYVELIKYFRYNPEDEKIIRFLCSYTLVCGNKIYGNVIVQGGG
FT                   KISFEKPMLIEEQIKKLQKKSDEIRRSISSVQSEIEQIREYQINSRLEKERLGFDTIKI
FT                   KTQIEEKHSRIEEKKNGLKRIAGEINRHKEEINSKKTELASFSRKIFGFETKLANYENE
FT                   EGKLYEELKTVDNGIFSVRKEEELIAPLMMSARSSWDKKAAELENMRRGQQYILDNISN
FT                   IKQQIVYAENRIRENSEKLLELLATQETEAVKMHQLYEQQTQKEAEMRISLTDKQTLQD
FT                   ALDAKIKEWRGLCGKVDGLNSEIKNMQSDIKNFEYQKNNLKKRLAETYGKNYEDIKNDF
FT                   EGVDEANSEEIAEIKRKMESLGAVNLAAQEEYDALEKRYSFLLMQQQDLLEAKDDLYEV
FT                   IKKINRVTVENFKMTFDIVKGNFKEIYRKLFGGGEADLMLTDENDLLESGVDIYAQPPG
FT                   KKLQNISLCSGGEKALTGVALLFAFFVVKPSPFCILDEVDAPLDDANVGRYNAMVKEFS
FT                   AQTQFLIVTHNRRTMEMADVLYGVTMEEQGISKIISVKMNKQNDAVTQ"
FT   CDS_pept        complement(868737..869918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_582"
FT                   /old_locus_tag="TGRD_592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_592"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14075"
FT                   /db_xref="GOA:B1H0P3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P3"
FT                   /protein_id="BAG14075.1"
FT                   /translation="MKIIKADTREQFKRFVRFPWKVYSKNSPWVPPLISDAEGILSENK
FT                   NPFWLHAKKQLFLAYDDNNNVIGRIAAIIDYNYITFQYDKCGFFGFFECYDDTEAAGSL
FT                   LSATENWLKEQSIDRMIGPMNPSINDECGFLSEGFDIPPSLMMVYTPQYYLRLVEQYGL
FT                   KKVKELYAYDMDISEASRVGRLERVIAAAKKKLPTLKIRTMQESSFEEDLKVVKSIYNR
FT                   AWEKNWGFVPWSDEEFAALASKLKILIIPQMVIIAEVAGSPVGMLISVPDYNYVLKKIN
FT                   GRLFLFGVFKFLYYRRKIDSLRLMIMGVIKEYRHKGIEAVMYEKGLKNALKIGYKHCEL
FT                   SWVLEDNIMTQCSAEMMKGRIYKKYAIYGNKVFSNQDFSSQKQCDFKNKNKES"
FT   CDS_pept        complement(870160..871137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_583"
FT                   /old_locus_tag="TGRD_593"
FT                   /product="uncharacterized NAD(P)-dependent reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_593"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14076"
FT                   /db_xref="GOA:B1H0P4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P4"
FT                   /protein_id="BAG14076.1"
FT                   /translation="MRVLVTGANGFVGSHIVETLLEVKHSVMCAVRKASNLRWLENLSV
FT                   EYKYGDLDDRKFSETIVKDVDGVIHCAGIVRAMSMDEYFKANAENTKNLCEAVLKVSPG
FT                   LKKFIFISSQAAMGPSVAGGVKKVTDKNNPVSDYGLSKLVAESEVKKNLCGKVPYTILR
FT                   PAVIYGPRDKDIFIFFNLVHKHLRLTTMTKRFLQLIYVKDVANAVTSCLENKKTDNNTY
FT                   YLANSTVYTWSEIGKIISSSADVKTIPLPVADFVFKFAAIAAGSLSYITKKPTVLNRQK
FT                   IVEMLQQYWTADTEPAENDLNIEFTSLEVASEITYNWYLSNKFF"
FT   CDS_pept        complement(871230..871914)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_144"
FT                   /note="pseudogene of Fe-hydrogenase B1/B3"
FT                   /pseudogene="unitary"
FT   CDS_pept        872593..872910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_584"
FT                   /old_locus_tag="TGRD_594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_594"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14077"
FT                   /db_xref="GOA:B1H0P5"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P5"
FT                   /protein_id="BAG14077.1"
FT                   /translation="MKYPHFSYVVARAFVIAIVYYIIVASVKSRRNTLYSGLMIKEISI
FT                   KNQRKTIDRSMNLWSKTIIFLLFLESFKTILMKAQLMKTVKSHFAFPDPDVAKLKYKNM
FT                   R"
FT   CDS_pept        complement(873033..875678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_585"
FT                   /old_locus_tag="TGRD_595"
FT                   /product="bifunctional acetaldehyde-CoA/alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_595"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14078"
FT                   /db_xref="GOA:B1H0P6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P6"
FT                   /protein_id="BAG14078.1"
FT                   /translation="MTGTKGKNVKLSERDVSAGYVIDSSEALNMLIQRVKKAQEVYSSF
FT                   SQEQVDAIFKAVSIAANRSRIPLAKIAVEETGMGIVEDKVIKNHFACEYIYNKHKDAKT
FT                   CGIISEDKPNGIKILAEPVGVIAGIIPTTNPTSTVIFKSLISLKTRNAVIFSPHPKAKK
FT                   STVVAARIMLDAAVKAGAPSDIIGWIDVPSLELTNLLMTHKDIAIILATGGPGMVKAAY
FT                   SSGKPALGVGAGNTPAVIDETADIKMAVSSILISKTFDNGMICSSEQSIIIVKDVYDEV
FT                   IKELKFRGAYILNEQEKEKIAKTIILKGKLNPAIVGQSACKIADMSGVKVPSNAKVLVG
FT                   EVSEISLEEEFAQEKLSPVIAVYMAENFEDAVEKAYRLVELCGAGHTSVLYTDERKQNR
FT                   INAFAGKLRTGRILINTPSSQGAIGDLYNFKLDPSLTLGCGSWGGNAVSENVGVKHLLN
FT                   YKTVAERRENMLWFRIPPKIYFKRGVTNSALRELQGKKRAFIVTDRFLFNSGVIYNITK
FT                   VLEEINVDYQIFFDVKPDPTVSTVNEALLLIRNYEPDVIIAFGGGSPIDAAKIIWLMYE
FT                   HPETDFKNIAMRFMDIRKRICKIPELGKKAQMIAIPTTSGTGSEVTPFAVITDDETHIK
FT                   YPIADYVLTPNVAIIDPDFADSMPKSLCAASGIDALTHAIEAYVSVLAANFTNSPALEA
FT                   AKLIFKYLPSSYAAGKDDPVAKEKVHYASTLAGMAFANAFLGLCHSVAHKLGAAFNLSH
FT                   GIANALVINQVIRYNATERPGKQTVFPQYKFPNAKAKYGQIADELNLGGGYHDDEKVDL
FT                   LINAITQLKKDIQIPLSIKDTGVLEKDFYDKLDELAEQAFDDQCTGANPVYPLIADIKN
FT                   IFIKAYNGEV"
FT   CDS_pept        complement(875810..877039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_586"
FT                   /old_locus_tag="TGRD_596"
FT                   /product="electron transfer flavoprotein subunit alpha"
FT                   /note="alpha-ETF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_596"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14079"
FT                   /db_xref="GOA:B1H0P7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P7"
FT                   /protein_id="BAG14079.1"
FT                   /translation="MVNSIKVFTDKCVGCKMCENVCPFNAISIVERLEYPKKFKLAVID
FT                   LNKCTYCGSCVQTCKFNAIELKKDVPLSVVDKNLYKGVWVYAEQRHGEVSGIVYELLNE
FT                   GKRLAEKLGTALSAVLIGSNIKSKARELIDRGVDKVYVCEDPIFIEFQDDPYSDALTQL
FT                   IEKEKPEIILMGATNIGRSFAPRVAARIRTGLTADCVFLEVDPETRNLRQTRPAFGGNI
FT                   MATILTPVHRPQMSTVRHKVFKEAKIEEGRKGEIIEYKTDMQTLLNRTKFLGFIKDTSV
FT                   AVNFVAADIIVSGGRGLGNREGFKLIKELAELLGAAIGASRAAVDLDWIPSSHQIGQTG
FT                   KTVAPKVYIACGISGQIQHRVGMGSSDIIIAINKDAACPMMKVATYALEGDLHEIIPCI
FT                   IKEIKSSRCS"
FT   CDS_pept        complement(877300..878088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_587"
FT                   /old_locus_tag="TGRD_597"
FT                   /product="electron transfer flavoprotein subunit beta"
FT                   /note="beta-ETF"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_597"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14080"
FT                   /db_xref="GOA:B1H0P8"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P8"
FT                   /protein_id="BAG14080.1"
FT                   /translation="MNIIICIKQVPNTTDVQIDPETGRLKREGVESIINPFDEYAIEEG
FT                   VRIKEKTGGKVIVITMGPLQSESALREAVSKGADEAVLISDRAFGGADTLATSYALSSA
FT                   IEFIGGYDIILCGEQSSDGDTGQVGPEIAEMLNIPHIAYVKKIELIDDKSIKVERMMED
FT                   GCDLIESPLPALLTVVKGINTPRIASLKGKIVAKKVVIKILNAADVGTDTKKTGLNGSP
FT                   TQVVKIFTPTQRNSDAEKFSGEAKEVAAALVKRLSEIRII"
FT   CDS_pept        complement(878300..879469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_588"
FT                   /old_locus_tag="TGRD_598"
FT                   /product="FAD-dependent short-chain acyl-CoA
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_598"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14081"
FT                   /db_xref="GOA:B1H0P9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0P9"
FT                   /protein_id="BAG14081.1"
FT                   /translation="MVMDYMLSEEERLMIETARAIAVEKMKPIREHYDEKEEFPWEIVK
FT                   EFAQSDLCGAYIPEEYGGFGKGIMGLVLVVEELCKVDGAIALSLAATALGTLPILISGS
FT                   EEQKKKYLPDIASGKKLAAFGLTEAGAGSDATGMATVAVKDGDYYVLNGTKCFITNGGD
FT                   AEIYTIFAKTNPDRGARGISCFIVEKGTPGFEFGKKEKKMGIRASSTRELIFDDCRVHK
FT                   DQLIGKEGHGLLTAQATLDNSRPGVAAQALGIAEGALDEAVEYARKRVQFGQPIASFQA
FT                   IQHLLAEMATEVEAARALLYASARMIDSGTGKRTSKESAMAKLFCSEVAMRVTTNAVQI
FT                   FGGYGYTREYPVEKMMRDAKITTLYEGTSQIQKNEIALNLIKESAAKSK"
FT   CDS_pept        complement(879509..880240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_589"
FT                   /old_locus_tag="TGRD_599"
FT                   /product="ribonuclease III"
FT                   /note="RNase III"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_599"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14082"
FT                   /db_xref="GOA:B1H0Q0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q0"
FT                   /protein_id="BAG14082.1"
FT                   /translation="MLNKNWEKFQKIIEYKFGDPKILATALTHKSYAAETVGENYNRRM
FT                   EFLGDSILSAIVAETLYLRYPRESEGKLSQFKAQIISAHNLSSWAREMDLGGCIYLGKS
FT                   EDTKEARQRESLLCDVFEAVIGAIYLDGGFENAKKFVLRFLNDQKEIEITDYKSRLQEI
FT                   LQSIYKELPEYKVIKESGPDHNKKFEVAVYIKSELLGKGAGNSKKEAQQFAAKQAMKNI
FT                   RAESEVWKLECGNKRRERTLK"
FT   CDS_pept        complement(880230..881471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_590"
FT                   /old_locus_tag="TGRD_600"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /note="KASII"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14083"
FT                   /db_xref="GOA:B1H0Q1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q1"
FT                   /protein_id="BAG14083.1"
FT                   /translation="MNKRIVITGIGVVTPIGIGNAEFTKALKEGRSGVSAIESFDTTAY
FT                   TTKFAASVKNFDPEKFIDKKKIKRMARFTQLGFTAAKMAVEDSRLNLSKEDLSRIGVIT
FT                   GTGIGGLDIIEREERVLLSKGARRVSPFLIPMIITNMLPGEIAINYGFTGPNYAITSAC
FT                   ASSNNAMGDALRLLRSGDADVIISGGAEGTIVPLGLAGFCSIKALSQRNNEPHKASRPF
FT                   DKTRDGFVMGEGAGIVVFETLEHALNRGARIYAEFAGYGASDDAYHITAPEPEGRAAVL
FT                   AMEKAIIDAGIYKEEVDYINAHGTSTVLNDRTETFAIKKVFGEKAYKIPISSTKSMTGH
FT                   LLGGAAVVELAATVFAMQEGFIHPTINYETPDPECDLDYVPNTSRIQQINCALSNSLGF
FT                   GGHNATVVIKKYVE"
FT   CDS_pept        complement(881481..881720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_591"
FT                   /old_locus_tag="TGRD_601"
FT                   /product="acyl carrier protein AcpP"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_601"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14084"
FT                   /db_xref="GOA:B1H0Q2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0Q2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14084.1"
FT                   /translation="MADFEARVKEIIVEQLGVDPAEVVTGASFVNDLGADSLDTVELVM
FT                   AFEEKFGIEIPDEEAEKIQTVGSAIDYVKTHVRK"
FT   CDS_pept        complement(881871..882614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_592"
FT                   /old_locus_tag="TGRD_602"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_602"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14085"
FT                   /db_xref="GOA:B1H0Q3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q3"
FT                   /protein_id="BAG14085.1"
FT                   /translation="MKLQGKVAVITGSAQGIGRSIAEVFASEGSRLVISDINIESAQKT
FT                   ADEIKTKYGFDTIAVAGNVSKLEDCEDLVKTSIDKFSKIDILINNAGITKDNLVLRMSE
FT                   SEWDSVIAVNLKGVFNCIKAVSKIMLKQRQGRIINISSVVGQMGNAGQINYSASKGGVI
FT                   AITKTCAREFASRNILVNAIAPGFIRTAMTDKLTEGQRQMMTSIIPLVRLGEVSDIAKA
FT                   ALFLASDDSSYITGHVLSVNGGMYM"
FT   CDS_pept        complement(882611..883540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_593"
FT                   /old_locus_tag="TGRD_603"
FT                   /product="[acyl-carrier-protein] S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_603"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14086"
FT                   /db_xref="GOA:B1H0Q4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q4"
FT                   /protein_id="BAG14086.1"
FT                   /translation="MSKIALMFPGQGAQTVGMGKDLYDKYLKAREIIDLAGNELKNIIF
FT                   EGTEETLKLTEYAQPAIFVVSMAAFEVFKESYGLSVDGFVSAGHSLGEYSALCAAGFFS
FT                   FKDGLAMVTARGKFIQKASAKTPGIMAAIIGMEKSAVEDLCKRASDVGVCEAVNFNSPR
FT                   QIVIAGTVSAVNKAVEFAATAGAKTVILNVSGPFHSSIMSPASDDMSKELEKYNFTAPS
FT                   FSVYTNCDALLTTDTSAIKEKLVRQIKSPVKWDEIVQNIIKLGYYKFVEVGPGKILSGL
FT                   LRKIDRSKKALNIEDSASLQKTLEELNK"
FT   CDS_pept        complement(883655..884641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_594"
FT                   /old_locus_tag="TGRD_604"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /note="KASIII"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_604"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14087"
FT                   /db_xref="GOA:B1H0Q5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q5"
FT                   /protein_id="BAG14087.1"
FT                   /translation="MNKKIGTEILGTGSYFPKKVLTNADLEKMIDTSDEWIRTRTGIKE
FT                   RRVSEKNEPTSELAYKASIEALEDAGILPEQIDLIIIATMTPDMLVPSTACFLHKRLGL
FT                   TNSAPSFDLSAACSGFIYGISAAKAFIESGLYKTILLVGAEELTKFMDWTDRNTCILFG
FT                   DGAGAIVLSASEENDNVLSVFLGADGSYSNLLFLPACGTACYDPADDMNGHTIKMQGKE
FT                   VFKSAVPKMVLAAEKALSFSKKELKDIKLFIPHQANMRIIEAVAKKMGVSMDRVFVNVH
FT                   KTGNISAATTITALDEAIKTGRLQKGDLAELIAFGSGFTWGATVIRI"
FT   CDS_pept        complement(884642..885658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_595"
FT                   /old_locus_tag="TGRD_605"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_605"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14088"
FT                   /db_xref="GOA:B1H0Q6"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0Q6"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14088.1"
FT                   /translation="MIIALDAMGGDFAPASTVEGAIFAAKESKHKILLVGIEKILVGEL
FT                   LKYRGRYDLKSLNIEIINATEFITMDEHPAKAVRQKKDSSLSVCARLVADGKADAFVSM
FT                   GNSGAAMSAALFYLKRIEGVLRPAISTVFPNFGGHCIIADMGANVDCTPEYLLQFGIMA
FT                   SLFCEKVASVENPRVGLVSIGEESTKGNELTLAAFELLKKADINFIGNVEGRDIPGGKV
FT                   DVAICDGFVGNVILKLGEGLTEMMLKLIRKEFKQHPMTWASLPFLWLAIKDLRKRVDYS
FT                   EFGGAPLLGVEGVCIIGHGSSNGKAVKNAIFAGAETAKHNIAAGIKEAILRYNNKVV"
FT   CDS_pept        complement(885658..885876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_596"
FT                   /old_locus_tag="TGRD_606"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_606"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14089"
FT                   /db_xref="GOA:B1H0Q7"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q7"
FT                   /protein_id="BAG14089.1"
FT                   /translation="MPNPKRKHTPHRRDCRRSANSKLDAPNLGKCLNCGAAKLSHRVCP
FT                   ECGFYNGRLIVPKKAKKSAEDIAEVNR"
FT   CDS_pept        complement(885879..886301)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_145"
FT                   /note="pseudogene of DUF177-domain protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(886430..888532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_597"
FT                   /old_locus_tag="TGRD_607"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_607"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14090"
FT                   /db_xref="GOA:B1H0Q8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0Q8"
FT                   /protein_id="BAG14090.1"
FT                   /translation="MLNLDNKIQYLKGIGPGRSQTFAKLGIITVGDMLTFFPVWYQDRK
FT                   NIVSIRDAYKQPQSCIFGKIGKAYDRQLSRGLCLLYIEIFDGVSTGYARFFRKKNPYSS
FT                   TDIFASIKKAFEPGTFAYIYGSTKTGNCGRFIDVDDYETVKNEKDKPLLFNRIMPVYPL
FT                   TEGLNQRFIREAVKSILDSVCGLYPDVLDLIPDFGGIPRLKSSLAIQKIHYPGTLEDVE
FT                   NARRAFALQEFFIFESALSLSHNNIRKKRKEQRYEIQKTLFTAFKRNLKLEFTKDQKKA
FT                   INDIFSDMQSLYPMNRMLMGDVGCGKTVVALSAVLLAVGSGYQTMIVAPTEILAEQHYL
FT                   TVSNMLLGLSVKAVLATSLTLKKKSEREKILAGFENGDIKIAIGTHSLIEDKIKFKNLS
FT                   LIVVDEQQKFGVMQKFAMSDKARSPDILMMTATPIPRSLALTVYGGMDMTAIKQLPPGR
FT                   TSVKTYFLAEQSAYIKAIEELKNKNQVYIVYPIIDESDKLVLKSAEQESKKLSQTWFRD
FT                   FKVGLLHGRMKSSKKNKIMLEFKNKEFDVLISTTVIGVGIDVPDVTVMIIQHAERFGLS
FT                   DLHQLRGRIGRGSKQSYAYLIGDLKNEAARKRLSVMTSTNNGFKIAEEDLKMRGHGELM
FT                   GTLQHGFPKFKAGDLIKDADIIEFTKNLAAKITEQDPYLSKGENAVLKSLIYKHFSDKI
FT                   KFINIG"
FT   CDS_pept        888667..888858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_598"
FT                   /old_locus_tag="TGRD_608"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_608"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14091"
FT                   /db_xref="GOA:B1H0Q9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0Q9"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14091.1"
FT                   /translation="MSYKCAVCGKGSRSGNTVSHSNKASKRLFRPNLQSLNILLNGIKT
FT                   REYVCTSCIKSNKAKKAI"
FT   CDS_pept        complement(889044..890077)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_146"
FT                   /note="pseudogene of lipid-A-disaccharide synthase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(890171..891024)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_147"
FT                   /note="pseudogene of NAD-dependent dehydrogenase MviM-like"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(891027..891768)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_148"
FT                   /note="pseudogene of pyridoxal phosphate-dependent
FT                   transaminase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(891792..892007)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_149"
FT                   /note="pseudogene of DUF1009-doamin protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(892068..892412)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_150"
FT                   /note="pseudogene of acyl-ACP--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(892397..892641)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_151"
FT                   /note="pseudogene of acyl-ACP--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(892774..893253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_599"
FT                   /old_locus_tag="TGRD_609"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_609"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14092"
FT                   /db_xref="GOA:B1H0R0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R0"
FT                   /protein_id="BAG14092.1"
FT                   /translation="MDNNIKNTKSTGTEKILSTEEILKCIPHRYPFLLIDKVKINTTDL
FT                   SKVVGYKCVSGNENFFQGHFPGMPIMPGVLILEAMAQTSCVMFLSRPEMKGCLAYFMSI
FT                   GNAKFRRPVKPGDILELCVEVLKDSGRRGKMKGRAHVDEKLVAEAEFSFIIVDRE"
FT   CDS_pept        complement(893243..894093)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_152"
FT                   /note="pseudogene of UDP-3-O-(3-hydroxymyristoyl)
FT                   N-acetylglucosamine deacetylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(894096..895064)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_153"
FT                   /note="pseudogene of UDP-3-O-(3-hydroxymyristoyl)
FT                   glucosamine N-acyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(895240..897513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_600"
FT                   /old_locus_tag="TGRD_610"
FT                   /product="outer membrane protein assembly factor BamA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14093"
FT                   /db_xref="GOA:B1H0R1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R1"
FT                   /protein_id="BAG14093.1"
FT                   /translation="MRTLLVLVLTSILTLFSTYTYAGTVIISDVSIEGLKNVKLISVLS
FT                   VVNLKKGKCYSNVVARKDVRSILEMGCFDNVEIRFDNISGNLTFVVTEKPYVERIAFNG
FT                   NLEFSEGKLKRESVLKEKNYYDFSKLEETKKKISSLYGDEGYADCKIEVYPSTDLDTNR
FT                   MTITFLITENNRIVVEEVKVKGMFFFKEKEILKLMNTNPGKMFREDIYQTDLKSIEMFY
FT                   KSNGFIDYKFVSPKVVYNDVRTKMFLTLNISEGSRYKISSITYDGNSIVDSKEIEKTIK
FT                   FKKGQIFNQDKIIEAMNLIYKLYYERRYTCAKIVPHFNKDIDGGIVDVNLSIEENSALY
FT                   VGNIYIGGLLSTRDQVIRRELLIKPGEVLTNGNLHGSIEKIYNLGFVNNVEHQLFATDN
FT                   PDVVDLKILITEKDFSGKIGGGIGYSSDNQLVTSAQIQHPNIFGLGQKLSLLGEFCKKK
FT                   QDYEIEWIEPYIFDKNMSLILNAFNVKKNMNYSSSKDHTYKENRIGFLIKAGHKINNYM
FT                   SLLFGYSYEHVKLLDISPSLELKIKEELDFAKERDKPSSIFTQFIYDLRDYVFNPSRGS
FT                   IHIADLYLASDLLGGNVNFVKGIVKSKWFFPTFWKFILSVSLQNGVIIPYKKNQSKIPI
FT                   YDRFYLGGADTIRGYALRTEIGSLKGSTIMGFMNIEYKFPIVFYKGRELIQGIIFYDIG
FT                   GSWGNYCNINLVLGSKKENVHSGIGFGIKIMVHLIPLKIEWGYGLNHEKAKRQSQVYFS
FT                   FGDN"
FT   CDS_pept        897956..899749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_601"
FT                   /old_locus_tag="TGRD_611"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_611"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14094"
FT                   /db_xref="GOA:B1H0R2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1H0R2"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14094.1"
FT                   /translation="MERKYNVAVVGAGHAGCEASLACARMGLKTLIITLNADSMARMPC
FT                   NPAVGGIAKGQMVREIDAMGGEIGRITDRAVLQFKMLNSSRGPAVWSPRAQCDKELYSV
FT                   LMSKSVQNQQNLEILQSEATSLTVKNGKVCGVKILTGETIEADAVVITTGTFLKGTIHL
FT                   GKMHFNGGRFNEVSALYLSKSLIEDCGLKLGRFKTTTTPRINSRSIDYSKMTEQFGDEK
FT                   PVPFSYSTKVEEWRKNLKQLSCWLTYTNPITHKIVSDNLGLSSIYIGEVNSKSPRYCPS
FT                   IEEKIERYPEKTSHHVFVEPEGYNTNEVYLNGLYTGLPFNLQQQMINSIVGLENAKVIR
FT                   YGYAIEYDYSSPLQIKKTLETKTVKNLFLGGQINGTTGYEEAAAQGFVAGVNAGLKVLG
FT                   KTPFILERNESYIGILVDDITTKGMDEPYRMFTSRAEYRLSIRNDNADLRLMDAGHSIG
FT                   LISDKAYKKFELYRKAFTDICENNAENLPDDEDLSPWSIEKAKEEVYIHKKYEGYIEIQ
FT                   NKMINKMKKSKDRKIPEDFDYNKLKSLSAETKQRLFEVRPQTIGQASRICAIKPSDIAI
FT                   LTVYLEKQKKERKQKKHNKIK"
FT   CDS_pept        900262..900546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_602"
FT                   /old_locus_tag="TGRD_612"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="COG4095"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_612"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14095"
FT                   /db_xref="GOA:B1H0R3"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R3"
FT                   /protein_id="BAG14095.1"
FT                   /translation="MTFLKILGYTAGFISMTSFIPQVYKTWKVKSAKDVSIQMFIIYST
FT                   STFLWIVYGIKSDPVQYPICVPNTIVLFLSIAQVILKIKYDRAEKNAQK"
FT   CDS_pept        900554..900805
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_154"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        900811..901641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_603"
FT                   /old_locus_tag="TGRD_613"
FT                   /product="16S rRNA (guanine-N7)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_613"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14096"
FT                   /db_xref="GOA:B1H0R4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R4"
FT                   /protein_id="BAG14096.1"
FT                   /translation="MSDFIENETLFTEFEHYAVKNVIPFFSKETRKKFETYFYELNKWN
FT                   KKFNLISFKNIRDLVYRHFCDSLYSAKAISDILTVYRLSIYSKRKRKREGAGRKQKSAE
FT                   SAFKVADLGTGSGMPGIPVKIALPCIKLTLIESITKKCRFLNNINNKLGFNTEILNKRA
FT                   EEIGQNTSYRQQYDFILSRAVSKLSPNLEISIPLLKIGGYFIVHKTKKSAESSKDGLQS
FT                   AENALKHLGAKLERTIYYNLPEYESDYCILIFKKHKDTPANFPRKSGIPEKNPL"
FT   CDS_pept        complement(901697..902587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_604"
FT                   /old_locus_tag="TGRD_614"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_614"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14097"
FT                   /db_xref="GOA:B1H0R5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R5"
FT                   /protein_id="BAG14097.1"
FT                   /translation="MQEKIIYEKFERERADSYLASIYKDYSRSYFQKLTDRQRVFVNDK
FT                   IIPVSHKLKRGDIITIEFEKEEKFQIKPEKIKIDIIYEDDDIVVVNKRSGIVVHPSYGH
FT                   LSGTLLNALMGYSAGKYNPYLIHRLDKDTSGVIVFAKTEKAKISISKQLQKRVVKKIYY
FT                   AAVKGVIAENRGIIKAPLGRSPKNRKLVSVNPLAKKVAITEFKVIERKDDYTLLKVRII
FT                   TGRTHQIRSHMKYINHPVIGDKQYGGPGTIGLKRCERQMLHAHNITFTHPSTSKTVKFI
FT                   AQLPNDMKAIFKLAN"
FT   CDS_pept        complement(902572..903327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_605"
FT                   /old_locus_tag="TGRD_615"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_615"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14098"
FT                   /db_xref="GOA:B1H0R6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R6"
FT                   /protein_id="BAG14098.1"
FT                   /translation="MHPILFTFGNFTIHTYGFSVATAFATAIFYLSYSIKKSKEKIISQ
FT                   DDLYSLVMYIMVFGVAGARLFFVFTDLNEFILYPLGIFKIWQGGLVYYGGFIASIIFAI
FT                   TYAKRKKIHLLKLGDFFAPALALGHALGRIGCFFAGCCYGKESSLPWAVVFINEHSLAV
FT                   RGKPLHPTQLYEAFANLLLFVFLYFYSKKGHKSGVSFAVYITGYAVLRFIIEFFRGDYR
FT                   GVQYFDFSVSQIISVFLFTAGVFIICRKK"
FT   CDS_pept        complement(903329..903796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_606"
FT                   /old_locus_tag="TGRD_616"
FT                   /product="signal peptidase II"
FT                   /note="prolipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_616"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14099"
FT                   /db_xref="GOA:B1H0R7"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:B1H0R7"
FT                   /protein_id="BAG14099.1"
FT                   /translation="MKAPFLIGIIMFILDQLTKILVDRFIIYASSVNVISFLDFFNIVN
FT                   VYNTGAAFGIFRGRNSFFALIVFLFLTALSGWLYKNWNKLHKIQIYAFCLIISGGLGNL
FT                   TDRLLRGAVVDFLDFGINSLRWPAFNVADSCIFIALVLILADILVFGRRKV"
FT   CDS_pept        complement(903793..906582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_607"
FT                   /old_locus_tag="TGRD_617"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_617"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14100"
FT                   /db_xref="GOA:B1GYK7"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYK7"
FT                   /protein_id="BAG14100.1"
FT                   /translation="MDKKKEYSKTVNLPKTDFQMKADLAYKEPVFIEEWDRERLYVKIC
FT                   EKNKDKEKFIFHDGPPYANANIHIGTGLNKVLKDFIIKYRSMSGNYVPFTPGWDCHGLP
FT                   IEQLVLKEMKTDKSKVDRVVFRKQAADFASKFVEIQKSEFKRLGVIADWDHPYLTLDPK
FT                   YEMFIVKVFGDLVEKGFIYRKKKPVYWCPTCETAMADAEVEYSDYSSDSIFVKFQIILL
FT                   PEPFKTKEILLKDFSVLIWTTTPWTLPANVALAFNKESEYAAAVYKFEDSREEKLIVAK
FT                   ALAENVKDKIKAVSFEIVWEAKGIDFVSLKCRNPLVEDRQSQGIVAGFVSIEDGTGIVH
FT                   IAPGHGQEDYQAGLEYGLEIISPVNDKGLYTKEVPEFENIHIYKANPLIIGKLDREGKI
FT                   LAKLRLTHSYPHCWRCGNPIIFRATPQWFLSVEHNDLRKKLLEAVKTVRWIPEYGENRI
FT                   TAMLEGRPDWCLSRQRLWGVPIPVFYCKECGEPLLDSKVIDKISALFGEKGSDLWFEVS
FT                   EKELLKGTGAKCLSCNSASFKKEEDILDVWFDSGVSYEAVLSSGNYKDLEYPADLYIEG
FT                   SDQHRGWFQTSMIPSVAVKGKSPYKNVLTHGFVVDGQGKKMSKSIGNIVSSDNLINKYG
FT                   ADVVRLWIASSDYKEDIRISDEIIRGLSDTYRKIRNTIRFLLGNIGDFDLKKALPFKDM
FT                   QETDKYALSRLQQLISISLAAYESYEFHKAAAAIGNFCTVFLSGFYLDVLKDVLYCDKK
FT                   DGIERKSAQSAMLKICSVIIRLISPILSFTAEEAWRELAKLLYDVPQSVFLLDFPVTDS
FT                   KYVLHAETLEKWEKILYVRKEALAAYERLRQNKVIGSNLEASLNIRYGQKYNEVFKDLK
FT                   LVNLTLGSWDVKCNFSDKEDDLLIEAAKSEYEKCARCWRHIDGIKDGLCPRCREVIDK"
FT   CDS_pept        complement(906647..906910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_608"
FT                   /old_locus_tag="TGRD_618"
FT                   /product="DUF167-domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_618"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14101"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GYK8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14101.1"
FT                   /translation="MIIKVRVIPNSKRNEVVSRVGSILRVKITAPAIEGRANEELCDFL
FT                   SDFFDVKRSMIFLRKGERGREKTIEVLGRLEEELNEVLDTIP"
FT   CDS_pept        complement(906938..907249)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_155"
FT                   /note="pseudogene of pyrroline-5-carboxylate reductase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(907236..907931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_609"
FT                   /old_locus_tag="TGRD_619"
FT                   /product="uncharacterized pyridoxal phosphate-dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_619"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14102"
FT                   /db_xref="GOA:B1GYK9"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYK9"
FT                   /protein_id="BAG14102.1"
FT                   /translation="MKNIHRNIEFIKNTVNSAKNTSVVVELIAVTKTFPYQCILEALKC
FT                   EIKHIGESKIKEALPKFEQLGSSLVGITKHFIGHLQSNKVKKAVENFDLIHSLDSVKLA
FT                   GSISLYAANIDKLQNCLIEVKVSQEITKTGVNPNYVEDFYKQCLSIPNILIKGLMVIAP
FT                   YSDNPEDSRPYFKQVYNLFENIRKSYGSSEFNILSMGMSDDYKIAVEEGATMIRIGSAI
FT                   FGKRNYGNK"
FT   CDS_pept        complement(908056..908264)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_156"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(908240..909318)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_157"
FT                   /note="pseudogene of hypothetical protein"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(909468..910274)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_158"
FT                   /note="pseudogene of WcaA-like glycosyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(910286..911046)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_159"
FT                   /note="pseudogene of RfaF-like LPS heptosyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(911443..912738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_610"
FT                   /old_locus_tag="TGRD_620"
FT                   /product="adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14103"
FT                   /db_xref="GOA:B1GYL0"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL0"
FT                   /protein_id="BAG14103.1"
FT                   /translation="MLRAKSTLLSFSQIKYDVKDIKLAEKGSKRILWAEKKMPVLKQIK
FT                   EKFLREKPLKGKKISSCLHVTAETANLAVALKAGGAEVYLCASNPLTTQDDVAASLVKH
FT                   YNIPVFAVKGENNETYYKHINAVLDIKPQITMDDGADLVTTVLLKRRDLLKDIIGGTEE
FT                   TTTGVVRLKAMAKDKALAYPVIAVNDALTKHFFDNRYGTGQSTIDGIIRATNILLAGKV
FT                   VVSAGYGWCGRGFAMRAKGLGAHVIVTEVDHLKAIEAAMDGFEVMPMREAAEKGDIFVT
FT                   LTGNLNVIGGSHFPLMKDGAIVCNGGHFNDEIDLKALKKISKSVKNVRDFVDEYTLRNN
FT                   KALCVLGEGRLINLVAAEGHPASVMDMSFANQAFSVRYLVKNYKNLENNVHIVPEKFDN
FT                   EIASLKLNSMSIKIDVLTAEQKEYLNSWQFGT"
FT   CDS_pept        complement(912725..913906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_611"
FT                   /old_locus_tag="TGRD_621"
FT                   /product="S-adenosylmethionine synthetase MetK"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_621"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14104"
FT                   /db_xref="GOA:B1GYL1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL1"
FT                   /protein_id="BAG14104.1"
FT                   /translation="MSNQQGYFFTSESVTEGHPDKVCDIISDSILDAILKQDLKARVAC
FT                   ETFISKELLIVGGEIKTSARINTKDIIKEALKKIGYDRLSFGFDCNTCKIIDTINTQSP
FT                   DVAAGVDSGGAGDQGLMIGFACRETPEFMPLPIILAHRLAKRLTEVRRKDILQYLGPDG
FT                   KTQVTVEYADGKPKRIDTVVLSIQHTKEVLDRTGNYMTKKSKEEIVNKVIKYVLGKSID
FT                   KNTKIYINPAGRFLLGGPSVDTGLTGRKIIVDTYGGMAAHGGGAFSGKDSTKVDRSACY
FT                   MARHIAKNVVAAGFADKCTVQLAYAIGVADPVSIMVDTHHSGRISGPAIESAVRKIFPL
FT                   TPKGITDYLQLRRPIFAQTAAYGHFGREEKDFTWEKLNKVSELKRECGGYVAG"
FT   CDS_pept        complement(913966..914966)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_160"
FT                   /note="pseudogene of mannose-1-phosphate
FT                   guanylyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(914965..915591)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_161"
FT                   /note="pseudogene of putaitve ADP-heptose:LPS
FT                   heptosyltransferase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(915604..916668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_612"
FT                   /old_locus_tag="TGRD_622"
FT                   /product="recombinase A"
FT                   /note="RecA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_622"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14105"
FT                   /db_xref="GOA:B1GYL2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL2"
FT                   /protein_id="BAG14105.1"
FT                   /translation="MAKDEKLKALDLALSQIEKDFGKEAIMRLGEKHSKERVDSIPTGA
FT                   LPLDIAIGIGGIPRGRIIEIYGPESSGKTTLALCMVAEAQKLGGIAAYIDAEHAMDPEY
FT                   AQKLGVDINNLLISQPDSGEQGLEIADKLIRSGAVDIIVVDSVAALVPKAEIEGEMGDS
FT                   FVGLQARLMSQALRKLTSNISKSKTSIVFINQLRQKIGVMWGSPETTPGGLALKFYSSV
FT                   RLDIRRIESIKKGDEILGNRVRVKVVKNKVAAPFKQAEFEIIFGQGIDKLGYLIDMGVN
FT                   DGIIEKAGAFFSYNGERLGQGRDNVKTYLSENSAVAGEIEAKIREKILGEDEKKEYVEK
FT                   VESIKEKSFKSVKK"
FT   CDS_pept        complement(917483..918931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_613"
FT                   /old_locus_tag="TGRD_623"
FT                   /product="DUF2779-domain contianig nuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_623"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14106"
FT                   /db_xref="InterPro:IPR021301"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL3"
FT                   /protein_id="BAG14106.1"
FT                   /translation="MRYINKTAFINYLSCPTLGWMTRRNMLPKLTCSRNELLRLEGRKI
FT                   RNISWQLFSNAVEVGRLGTYDAVLYTKELLLDPGVKTICGASFVAGGYFTKVDILQKLD
FT                   DNSWHLFEVKSGNKYKVKYARDISFKAMVLAKSGLDVSKATILCLSNDYRLGMDISQLF
FT                   KRLDCTEKVKSKVQKFLILSDEVLENIESENMPEPYLKRNCKNCLVFDGCISKDIKNHI
FT                   FDLPRLSVLAIEKLITAGVDMIDKIPADFELSRMQQIVKNCVLTNTNYVSENLKTEMNN
FT                   IKQPFYYLDFESVMTIMPLYRDIAPHMQFLTQFSIDRTDDAGNILDHYEYIADQTKDCR
FT                   REVAERLIKCLGEEGNVITYANFERICISNLARLFSDLGEKLNKITERIVDLELILKKN
FT                   YYDINFHGRSSIKKVLPVLVPEMNYADLEIGDGGNAAASFAFMAMGLYDDKKIEETKKN
FT                   LLKYCARDTLAMVKIHQFLKTVVF"
FT   CDS_pept        complement(919165..920992)
FT                   /transl_table=11
FT                   /locus_tag="TGRD_pseudo_162"
FT                   /note="pseudogene of putative type II DNA methylase"
FT                   /pseudogene="unitary"
FT   CDS_pept        complement(921125..922000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_614"
FT                   /old_locus_tag="TGRD_626"
FT                   /product="3',5'-nucleoside bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_626"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14109"
FT                   /db_xref="GOA:B1GYL6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL6"
FT                   /protein_id="BAG14109.1"
FT                   /translation="MDNVGAANLYVDMHIHTNYSDGVFAPKEVVEYASKMKLAAISITD
FT                   HDCVDGIDEALEIASKTGLEIVPGIELSSEVILDSQKSEMHILGYYIDYKSEKLKKTLT
FT                   VFRKARYERAVEIFEKLKKSGAELKDDSFFKKIEDKVIGRLHFAKALVEEKLVGSVNEA
FT                   FQRYLSKGKLAYVPTKCSISAHNAIKLILNAGGIPVMAHPYYIHYNDENMFKSFIKDGL
FT                   MGIEAWHIKHSENTVKKFLSLAEKFNLIATGGSDCHGPHKKEHHIIGKMRVPYSVVENL
FT                   KRIKEKMVGS"
FT   CDS_pept        complement(922048..922326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_615"
FT                   /product="putative septum formation initiator FtsB"
FT                   /protein_id="BCI50717.1"
FT                   /translation="MDKKKLKKRFKIRYIIFLAVFLVLAFNEGNRTLLRRFFEQNKLKK
FT                   DIENARDENDLLKDRICYLENEPSYLERMVRSELKVIAAEEIEYRFS"
FT   CDS_pept        complement(922623..923927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_616"
FT                   /old_locus_tag="TGRD_627"
FT                   /product="enolase"
FT                   /note="phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_627"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14110"
FT                   /db_xref="GOA:B1GYL7"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GYL7"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14110.1"
FT                   /translation="MAKIVKIAGREIIDSRGNPTVEVDVRLGDGTLGRAAVPSGASTGS
FT                   REALELRDGDKKRFGGKGVLKAVSNVNDIIAPKLTGLEITKQQDIDDIMIKLDGTDFKS
FT                   SLGANAVLGVSLACAKAGSNSNKLPVYEYVREIYNVKSDKYVLPVPLMNIINGGEHADN
FT                   NVDLQEFMIAPVSAPTFREALRMGCEVFHGLKKVLNEKGYATGVGDEGGFAPNLKSNAQ
FT                   ALEVICEAVKVAGYEVGRDIVFALDVAASELYENNKYTLEGEVKEKVKTSKDMIAFYGD
FT                   LLKEYPIISIEDGLSESDWDGWKILTEKLKSRLQLVGDDLFVTNTKIFKDGIDKGIANS
FT                   ILIKVNQIGSLSETVAAVQMAYKAGYTAVMSHRSGETEDSIIADLAVALNTGQIKTGSA
FT                   SRTDRMCKYNQLLRIEEELGSKSAYLGKSAFSSIK"
FT   CDS_pept        complement(923949..924359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_617"
FT                   /old_locus_tag="TGRD_628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_628"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14111"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL8"
FT                   /protein_id="BAG14111.1"
FT                   /translation="MKMRFIFILIMFCLLLMSYTVLDYPKRALGFSIEKFKNEKTGRFY
FT                   EVFVMLKQQDCFDKSLNIIKDLEAEVVHKSFKNGYIIALNFSNSFDCCLNSTEAGIFIT
FT                   ETETGGVKVEVISNNSLLAKKLSVEFFEKLRA"
FT   CDS_pept        924692..925387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_618"
FT                   /old_locus_tag="TGRD_629"
FT                   /product="putative 8-oxoguanine DNA glycosylase and DNA
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_629"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14112"
FT                   /db_xref="GOA:B1GYL9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012092"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYL9"
FT                   /protein_id="BAG14112.1"
FT                   /translation="MKNSLIPISFLKTPTDNSSTAAGLKDFWKKVFPLISYREKHFSNV
FT                   WKNAAEEEIFAELVFCLFTPQSKAVLCWSAVNDLADKNMIFNSKGECIAKVINKVRFRN
FT                   NKAKYLIEARKLFTIDNKIKIKEKLKSFKNIYELRKWLIDSTKGIGYKEAGHFLRNIGI
FT                   GKDLAILDRHILKNLKVYGAIKELPKKLNVKTYLETEKQMQDFAKNIGIPMSHLDMLFW
FT                   CKNTGGIFK"
FT   CDS_pept        complement(927453..927749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_619"
FT                   /old_locus_tag="TGRD_630"
FT                   /product="YbaB/EbfC family putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14113"
FT                   /db_xref="GOA:B1GYM0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM0"
FT                   /protein_id="BAG14113.1"
FT                   /translation="MELFKMAKEAINMRSKMKDIDNRLRDLVMDLEYKGIKIKVNAKNE
FT                   FLSLNIPEYLLKEKKEKVEKLILSAFAEACKKAQNVMTEEVKKLTGGMKIPGL"
FT   CDS_pept        complement(928863..929813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_620"
FT                   /old_locus_tag="TGRD_631"
FT                   /product="biotin operon
FT                   repressor/biotin-[acetyl-CoA-carboxylase] ligase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_631"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14114"
FT                   /db_xref="GOA:B1GYM1"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM1"
FT                   /protein_id="BAG14114.1"
FT                   /translation="MSIIEILSTEKYTSGNEIGRFLGISRAAVHKQINRLRQIGYTIKS
FT                   SSKGYIIVKQCNLFNEYEIKANLKKPLNICKTIKYYKETASTQTVVKKLAEKDFGEGIV
FT                   VIAEKQTKGYGRIKRMWSSNAGGLWVSMLLKPVIRPDESSKLALLFSIVLNRILEKKYG
FT                   IRSEIKWPNDILICGKKVAGIIIEMSAEQDIINWVAAGIGVNINNSLPEDLKNISISIK
FT                   EVLKREINRAEFIVALLAEFESLYFNFQKDGFKQFLEEYNSKAAYKNALVTVDGGYNDA
FT                   ITGKSFGIDESGRLIIETKNKFEKIVSGTLRRAEK"
FT   CDS_pept        complement(929810..930658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_621"
FT                   /old_locus_tag="TGRD_632"
FT                   /product="carboxylating nicotinate-nucleotide
FT                   pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_632"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14115"
FT                   /db_xref="GOA:B1GYM2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM2"
FT                   /protein_id="BAG14115.1"
FT                   /translation="MVNNTDSLIDLALKEDGVFDDITTKEFIPKDKRAKAVLIANSPGI
FT                   LCGVDIFIKVFKAIDKKCKVSLKMKDCSQIKSGDKILEITGHTYTILSGERTALNFLQY
FT                   MSGIATLTNRFVTSINNGRTKIYDTRKTIPGYRELAKYAVRCGGGANHRMGLYDMVLIK
FT                   DNHLKLMKDLTAGISEFRKKHKNIPVEVECENLKQVEQALDSKADIIMLDNTTFENTKK
FT                   MISLIRKNSTKEYNPEIEISGGVSLKTAKKFAKLDADRISIGMITHSSSALDVTLEITI
FT                   K"
FT   CDS_pept        complement(931086..932186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_622"
FT                   /old_locus_tag="TGRD_633"
FT                   /product="cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_633"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14116"
FT                   /db_xref="GOA:B1GYM3"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM3"
FT                   /protein_id="BAG14116.1"
FT                   /translation="MNMKIELPKKEANAGQHAVIKILGVGGGGCNAINRMIAANVGNVE
FT                   FVAINTDAQVLLKSSAPDVLQIGEKITKGLGVGGNPEVGRKAAKESEEEIRGRLVGADM
FT                   VFVTAGMGGGTGTGVAPIVAKLAKEEGILTIGVVTKPFEHEGNVRMSQAEEGIKNLKEY
FT                   TDALIVIPNEKVFNVINERIALDAFYQIIDDVLRQSIQAITDVITVTGEINRDFADVKS
FT                   ILSNSGTALIGIGESTSSNVKEAVRKAVTSPLLDNYDISKAEKALVNVTTNSTASALTM
FT                   QEIFKDIKSYGINGHVFFGHTIDNRLDDKVKITIIATGFETTEFESAIKNRESQCDFFS
FT                   QHDLPQVEETDPSKPAYTYWKPKFLK"
FT   CDS_pept        complement(932188..933432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_623"
FT                   /old_locus_tag="TGRD_634"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_634"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14117"
FT                   /db_xref="GOA:B1GYM4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM4"
FT                   /protein_id="BAG14117.1"
FT                   /translation="MAKQALIAGLDIGSSQVCCVAGIRDEDARVVKVLCAICVPCDGIK
FT                   AGAVINIQEAALSIGKAFEETEKTADSQIENVIVAMRGNFIKSKTSKGVANINYSNKEI
FT                   TQETVENALESARKQIKINSDQEILQTVPREYILNQQRGIQNPIGMEGTYIEVDVHAFI
FT                   ASSSNIGNITKAMNSVGIKYDDRIYGYLAASDVLVTREEKELSCLVIDFGGLTTGLVHY
FT                   VDGIIKHTDEISDGSDYITRDIGHKLRAAYSVSKGIKEMYGAAFICSDFKNEEFEYNGA
FT                   DGRSARKCDRLDLVSSIITPRIDRILYEIKEVVEKNNYGNEFLSGGIILTGGGSSLYGL
FT                   AEAFEKTFNCSVRNGIPNSDKVKGPDEILLNPSYTAGIGAIAYNFLSSKGYMHNKKSTG
FT                   NGIVSKISRWFEEAF"
FT   CDS_pept        complement(933610..934404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_624"
FT                   /old_locus_tag="TGRD_635"
FT                   /product="putative cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_635"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14118"
FT                   /db_xref="GOA:B1GYM5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM5"
FT                   /protein_id="BAG14118.2"
FT                   /translation="MAKKKRYVYRCVSGVSNYSNSRNKGRKSIKLLLYIVLFVFLVYFG
FT                   GRKLVNLAYESDKIIVKSIEVVGTKNVTKTEIKELLPFETGDNILKINLSKTENEIKRL
FT                   KPELKSIMINRSWQKVKIKLCERTPEAFVMQGDTVFGIDFDDNPFPLRGFMNAEKVPKL
FT                   FYRSDVERKKLLSFIKSFKPMCGDFLSDVSEMKFSGAGDIIFVTHGNTVVFWGDGEPNV
FT                   LSHKFNRFQKIYSDAMSKYKQIECIDMTLYSFGRATVKPVRE"
FT   CDS_pept        complement(934409..935329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_625"
FT                   /old_locus_tag="TGRD_636"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_636"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14119"
FT                   /db_xref="GOA:B1GYM6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM6"
FT                   /protein_id="BAG14119.1"
FT                   /translation="MTDSDILAKLSNKKIGVLYGGLSSEREISIKSGKAVLNVFKKLKL
FT                   NVCGIDVNRSIAEEIKKEKIDVAYIALHGPMGEDGTIQGMLEILGIPYTGSGIFASAAS
FT                   IDKDVSKKIFKYADILTPEWKMLKKFGTVPEIKKYPVVVKPVSQGSTIGVAIVKRPSEF
FT                   AAAVKEVFKYGDEALIEQFIEGKEVTVGVLNGKALPVVEIVPKGKFYDFKAKYQKGGSQ
FT                   HIIPAGISEEAYETVQNYAEKVYEIFKCRAICRVDMIVDRKDRVWVFENNTIPGMTETS
FT                   LVPDESRAVGYSFESLVLKITESAL"
FT   CDS_pept        complement(935326..936198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_626"
FT                   /old_locus_tag="TGRD_637"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_637"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14120"
FT                   /db_xref="GOA:B1GYM7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B1GYM7"
FT                   /protein_id="BAG14120.1"
FT                   /translation="MIEVLSSLGCRVLKDEPLSMHCSFKIGGPADFFIEIPNELALSEF
FT                   LRIISDGRFCILGGGTNILFSDEGYRGTIVRLTGCFKEISVSGDEILCGGGALLSDVLK
FT                   TACENGLTGLECTAGILGTVGGAVYGNVGRGDKWISAVIKSVEVYKNLKKELINREKAI
FT                   FGYRKSGFENSIILKVVFSLKKDMKNDSLKEISKNMQKRLETQPLNIPNAGSIFKNPDG
FT                   FSVGKLIEEAGLKGIYAGKAQISELHGNFIVNTGGAFAEDVLALINLIKEKVKEKFGIS
FT                   LETEIKIIK"
FT   CDS_pept        complement(936195..937547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TGRD_627"
FT                   /old_locus_tag="TGRD_638"
FT                   /product="UDP-N-acetylmuramate-L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TGRD_638"
FT                   /db_xref="EnsemblGenomes-Tr:BAG14121"
FT                   /db_xref="GOA:B1GYM8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1GYM8"
FT                   /func_characterised="identical sequence"
FT                   /protein_id="BAG14121.1"
FT                   /translation="MFLKNQNIHFVGIGGSGMSGIAEVLINLGHRVSGSDLKKTDVTEY
FT                   LKAVGAKIYIGHSCKNIKSAEVVVTSTAISRNNPEVVAALKKRIPIIARIEMLVELARL
FT                   KYAVTITGTHGKTTTTSLTSLVLHNGGLDPTIVIGGRLKNLKTNAKLGRGDYIVVEADE
FT                   SDGSFLRLSPIITVVTNIDNDHLDYYDSMENLKEAFVKHINCIPFYGTAIICSDNEVVR
FT                   KIIPQITRRYITYGLMGNPDIKASNIKVLKNHTSFDVFYMRKKVGSVCMKILGKHNVSN
FT                   SLAAIGVGLRLGISFSSIADTINKFDGVSRRLEIKGEKNGMMVIDDYGHHPTEVAATLR
FT                   AIKLFWPERRLVVLFQPHRYTRTKQLFNEFGRSFSDADFVKVLDIYSAGEQPIDE