(data stored in ACNUC7421 zone)

EMBL: AP009552

ID   AP009552; SV 1; circular; genomic DNA; STD; PRO; 5842795 BP.
XX
AC   AP009552;
XX
PR   Project:PRJDA27835;
XX
DT   25-JAN-2008 (Rel. 94, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 7)
XX
DE   Microcystis aeruginosa NIES-843 DNA, complete genome.
XX
KW   .
XX
OS   Microcystis aeruginosa NIES-843
OC   Bacteria; Cyanobacteria; Oscillatoriophycideae; Chroococcales;
OC   Microcystaceae; Microcystis.
XX
RN   [1]
RP   1-5842795
RA   Sato S., Kaneko T.;
RT   ;
RL   Submitted (22-NOV-2007) to the INSDC.
RL   Contact:Shusei Sato Kazusa DNA Research Institute, Department of Plant
RL   Genome Research; 2-6-7 Kazusa-kamatari, Kisarazu, Chiba 292-0812, Japan URL
RL      :http://www.kazusa.or.jp/rhizobase/
XX
RN   [2]
RX   DOI; 10.1093/dnares/dsm026.
RX   PUBMED; 18192279.
RA   Kaneko T., Nakajima N., Okamoto S., Suzuki I., Tanabe Y., Tamaoki M.,
RA   Nakamura Y., Kasai F., Watanabe A., Kawashima K., Kishida Y., Ono A.,
RA   Shimizu Y., Takahashi C., Minami C., Fujishiro T., Kohara M., Katoh M.,
RA   Nakazaki N., Nakayama S., Yamada M., Tabata S., Watanabe M.M.;
RT   "Complete genomic structure of the bloom-forming toxic cyanobacterium
RT   Microcystis aeruginosa NIES-843";
RL   DNA Res. 14(6):247-256(2007).
XX
DR   MD5; 9754070b481b75ec260063dbd2c9a26b.
DR   BioSample; SAMD00060936.
DR   EnsemblGenomes-Gn; EBG00001181800.
DR   EnsemblGenomes-Gn; EBG00001181801.
DR   EnsemblGenomes-Gn; EBG00001181802.
DR   EnsemblGenomes-Gn; EBG00001181803.
DR   EnsemblGenomes-Gn; EBG00001181804.
DR   EnsemblGenomes-Gn; EBG00001181805.
DR   EnsemblGenomes-Gn; EBG00001181806.
DR   EnsemblGenomes-Gn; EBG00001181807.
DR   EnsemblGenomes-Gn; EBG00001181808.
DR   EnsemblGenomes-Gn; EBG00001181809.
DR   EnsemblGenomes-Gn; EBG00001181810.
DR   EnsemblGenomes-Gn; EBG00001181811.
DR   EnsemblGenomes-Gn; EBG00001181812.
DR   EnsemblGenomes-Gn; EBG00001181813.
DR   EnsemblGenomes-Gn; EBG00001181814.
DR   EnsemblGenomes-Gn; EBG00001181815.
DR   EnsemblGenomes-Gn; EBG00001181816.
DR   EnsemblGenomes-Gn; EBG00001181817.
DR   EnsemblGenomes-Gn; EBG00001181818.
DR   EnsemblGenomes-Gn; EBG00001181819.
DR   EnsemblGenomes-Gn; EBG00001181820.
DR   EnsemblGenomes-Gn; EBG00001181821.
DR   EnsemblGenomes-Gn; EBG00001181822.
DR   EnsemblGenomes-Gn; EBG00001181823.
DR   EnsemblGenomes-Gn; EBG00001181824.
DR   EnsemblGenomes-Gn; EBG00001181825.
DR   EnsemblGenomes-Gn; EBG00001181826.
DR   EnsemblGenomes-Gn; EBG00001181827.
DR   EnsemblGenomes-Gn; EBG00001181828.
DR   EnsemblGenomes-Gn; EBG00001181829.
DR   EnsemblGenomes-Gn; EBG00001181830.
DR   EnsemblGenomes-Gn; EBG00001181831.
DR   EnsemblGenomes-Gn; EBG00001181832.
DR   EnsemblGenomes-Gn; EBG00001181833.
DR   EnsemblGenomes-Gn; EBG00001181834.
DR   EnsemblGenomes-Gn; EBG00001181835.
DR   EnsemblGenomes-Gn; EBG00001181836.
DR   EnsemblGenomes-Gn; EBG00001181837.
DR   EnsemblGenomes-Gn; EBG00001181838.
DR   EnsemblGenomes-Gn; EBG00001181839.
DR   EnsemblGenomes-Gn; EBG00001181840.
DR   EnsemblGenomes-Gn; EBG00001181841.
DR   EnsemblGenomes-Gn; EBG00001181842.
DR   EnsemblGenomes-Gn; EBG00001181843.
DR   EnsemblGenomes-Gn; EBG00001181844.
DR   EnsemblGenomes-Gn; EBG00001181845.
DR   EnsemblGenomes-Gn; EBG00001181846.
DR   EnsemblGenomes-Gn; EBG00001181847.
DR   EnsemblGenomes-Gn; EBG00001181848.
DR   EnsemblGenomes-Gn; EBG00001181849.
DR   EnsemblGenomes-Gn; EBG00001181850.
DR   EnsemblGenomes-Gn; EBG00001181851.
DR   EnsemblGenomes-Gn; EBG00001181852.
DR   EnsemblGenomes-Gn; EBG00001181853.
DR   EnsemblGenomes-Gn; EBG00001181854.
DR   EnsemblGenomes-Gn; EBG00001181855.
DR   EnsemblGenomes-Gn; EBG00001181856.
DR   EnsemblGenomes-Gn; EBG00001181857.
DR   EnsemblGenomes-Gn; EBG00001181858.
DR   EnsemblGenomes-Gn; EBG00001181859.
DR   EnsemblGenomes-Gn; EBG00001181860.
DR   EnsemblGenomes-Gn; EBG00001181861.
DR   EnsemblGenomes-Gn; MAE_r001.
DR   EnsemblGenomes-Gn; MAE_r002.
DR   EnsemblGenomes-Gn; MAE_r003.
DR   EnsemblGenomes-Gn; MAE_r004.
DR   EnsemblGenomes-Gn; MAE_r005.
DR   EnsemblGenomes-Gn; MAE_r006.
DR   EnsemblGenomes-Gn; MAE_r007.
DR   EnsemblGenomes-Gn; MAE_r008.
DR   EnsemblGenomes-Gn; MAE_r009.
DR   EnsemblGenomes-Gn; MAE_r010.
DR   EnsemblGenomes-Gn; MAE_t001.
DR   EnsemblGenomes-Gn; MAE_t002.
DR   EnsemblGenomes-Gn; MAE_t003.
DR   EnsemblGenomes-Gn; MAE_t004.
DR   EnsemblGenomes-Gn; MAE_t005.
DR   EnsemblGenomes-Gn; MAE_t006.
DR   EnsemblGenomes-Gn; MAE_t007.
DR   EnsemblGenomes-Gn; MAE_t008.
DR   EnsemblGenomes-Gn; MAE_t009.
DR   EnsemblGenomes-Gn; MAE_t010.
DR   EnsemblGenomes-Gn; MAE_t011.
DR   EnsemblGenomes-Gn; MAE_t012.
DR   EnsemblGenomes-Gn; MAE_t013.
DR   EnsemblGenomes-Gn; MAE_t014.
DR   EnsemblGenomes-Gn; MAE_t015.
DR   EnsemblGenomes-Gn; MAE_t016.
DR   EnsemblGenomes-Gn; MAE_t017.
DR   EnsemblGenomes-Gn; MAE_t018.
DR   EnsemblGenomes-Gn; MAE_t019.
DR   EnsemblGenomes-Gn; MAE_t020.
DR   EnsemblGenomes-Gn; MAE_t021.
DR   EnsemblGenomes-Gn; MAE_t022.
DR   EnsemblGenomes-Gn; MAE_t023.
DR   EnsemblGenomes-Gn; MAE_t024.
DR   EnsemblGenomes-Gn; MAE_t025.
DR   EnsemblGenomes-Gn; MAE_t026.
DR   EnsemblGenomes-Gn; MAE_t027.
DR   EnsemblGenomes-Gn; MAE_t028.
DR   EnsemblGenomes-Gn; MAE_t029.
DR   EnsemblGenomes-Gn; MAE_t030.
DR   EnsemblGenomes-Gn; MAE_t031.
DR   EnsemblGenomes-Gn; MAE_t032.
DR   EnsemblGenomes-Gn; MAE_t033.
DR   EnsemblGenomes-Gn; MAE_t034.
DR   EnsemblGenomes-Gn; MAE_t035.
DR   EnsemblGenomes-Gn; MAE_t036.
DR   EnsemblGenomes-Gn; MAE_t037.
DR   EnsemblGenomes-Gn; MAE_t038.
DR   EnsemblGenomes-Gn; MAE_t039.
DR   EnsemblGenomes-Gn; MAE_t040.
DR   EnsemblGenomes-Gn; MAE_t041.
DR   EnsemblGenomes-Gn; MAE_t042.
DR   EnsemblGenomes-Tr; EBT00001760196.
DR   EnsemblGenomes-Tr; EBT00001760197.
DR   EnsemblGenomes-Tr; EBT00001760198.
DR   EnsemblGenomes-Tr; EBT00001760199.
DR   EnsemblGenomes-Tr; EBT00001760200.
DR   EnsemblGenomes-Tr; EBT00001760201.
DR   EnsemblGenomes-Tr; EBT00001760202.
DR   EnsemblGenomes-Tr; EBT00001760203.
DR   EnsemblGenomes-Tr; EBT00001760204.
DR   EnsemblGenomes-Tr; EBT00001760205.
DR   EnsemblGenomes-Tr; EBT00001760206.
DR   EnsemblGenomes-Tr; EBT00001760207.
DR   EnsemblGenomes-Tr; EBT00001760208.
DR   EnsemblGenomes-Tr; EBT00001760209.
DR   EnsemblGenomes-Tr; EBT00001760210.
DR   EnsemblGenomes-Tr; EBT00001760211.
DR   EnsemblGenomes-Tr; EBT00001760212.
DR   EnsemblGenomes-Tr; EBT00001760213.
DR   EnsemblGenomes-Tr; EBT00001760214.
DR   EnsemblGenomes-Tr; EBT00001760215.
DR   EnsemblGenomes-Tr; EBT00001760216.
DR   EnsemblGenomes-Tr; EBT00001760217.
DR   EnsemblGenomes-Tr; EBT00001760218.
DR   EnsemblGenomes-Tr; EBT00001760219.
DR   EnsemblGenomes-Tr; EBT00001760220.
DR   EnsemblGenomes-Tr; EBT00001760221.
DR   EnsemblGenomes-Tr; EBT00001760222.
DR   EnsemblGenomes-Tr; EBT00001760223.
DR   EnsemblGenomes-Tr; EBT00001760224.
DR   EnsemblGenomes-Tr; EBT00001760225.
DR   EnsemblGenomes-Tr; EBT00001760226.
DR   EnsemblGenomes-Tr; EBT00001760227.
DR   EnsemblGenomes-Tr; EBT00001760228.
DR   EnsemblGenomes-Tr; EBT00001760229.
DR   EnsemblGenomes-Tr; EBT00001760230.
DR   EnsemblGenomes-Tr; EBT00001760231.
DR   EnsemblGenomes-Tr; EBT00001760232.
DR   EnsemblGenomes-Tr; EBT00001760233.
DR   EnsemblGenomes-Tr; EBT00001760234.
DR   EnsemblGenomes-Tr; EBT00001760235.
DR   EnsemblGenomes-Tr; EBT00001760236.
DR   EnsemblGenomes-Tr; EBT00001760237.
DR   EnsemblGenomes-Tr; EBT00001760238.
DR   EnsemblGenomes-Tr; EBT00001760239.
DR   EnsemblGenomes-Tr; EBT00001760240.
DR   EnsemblGenomes-Tr; EBT00001760241.
DR   EnsemblGenomes-Tr; EBT00001760242.
DR   EnsemblGenomes-Tr; EBT00001760243.
DR   EnsemblGenomes-Tr; EBT00001760244.
DR   EnsemblGenomes-Tr; EBT00001760245.
DR   EnsemblGenomes-Tr; EBT00001760246.
DR   EnsemblGenomes-Tr; EBT00001760247.
DR   EnsemblGenomes-Tr; EBT00001760248.
DR   EnsemblGenomes-Tr; EBT00001760249.
DR   EnsemblGenomes-Tr; EBT00001760250.
DR   EnsemblGenomes-Tr; EBT00001760251.
DR   EnsemblGenomes-Tr; EBT00001760252.
DR   EnsemblGenomes-Tr; EBT00001760253.
DR   EnsemblGenomes-Tr; EBT00001760254.
DR   EnsemblGenomes-Tr; EBT00001760255.
DR   EnsemblGenomes-Tr; EBT00001760256.
DR   EnsemblGenomes-Tr; EBT00001760257.
DR   EnsemblGenomes-Tr; MAE_r001-1.
DR   EnsemblGenomes-Tr; MAE_r002-1.
DR   EnsemblGenomes-Tr; MAE_r003-1.
DR   EnsemblGenomes-Tr; MAE_r004-1.
DR   EnsemblGenomes-Tr; MAE_r005-1.
DR   EnsemblGenomes-Tr; MAE_r006-1.
DR   EnsemblGenomes-Tr; MAE_r007-1.
DR   EnsemblGenomes-Tr; MAE_r008-1.
DR   EnsemblGenomes-Tr; MAE_r009-1.
DR   EnsemblGenomes-Tr; MAE_r010-1.
DR   EnsemblGenomes-Tr; MAE_t001-1.
DR   EnsemblGenomes-Tr; MAE_t002-1.
DR   EnsemblGenomes-Tr; MAE_t003-1.
DR   EnsemblGenomes-Tr; MAE_t004-1.
DR   EnsemblGenomes-Tr; MAE_t005-1.
DR   EnsemblGenomes-Tr; MAE_t006-1.
DR   EnsemblGenomes-Tr; MAE_t007-1.
DR   EnsemblGenomes-Tr; MAE_t008-1.
DR   EnsemblGenomes-Tr; MAE_t009-1.
DR   EnsemblGenomes-Tr; MAE_t010-1.
DR   EnsemblGenomes-Tr; MAE_t011-1.
DR   EnsemblGenomes-Tr; MAE_t012-1.
DR   EnsemblGenomes-Tr; MAE_t013-1.
DR   EnsemblGenomes-Tr; MAE_t014-1.
DR   EnsemblGenomes-Tr; MAE_t015-1.
DR   EnsemblGenomes-Tr; MAE_t016-1.
DR   EnsemblGenomes-Tr; MAE_t017-1.
DR   EnsemblGenomes-Tr; MAE_t018-1.
DR   EnsemblGenomes-Tr; MAE_t019-1.
DR   EnsemblGenomes-Tr; MAE_t020-1.
DR   EnsemblGenomes-Tr; MAE_t021-1.
DR   EnsemblGenomes-Tr; MAE_t022-1.
DR   EnsemblGenomes-Tr; MAE_t023-1.
DR   EnsemblGenomes-Tr; MAE_t024-1.
DR   EnsemblGenomes-Tr; MAE_t025-1.
DR   EnsemblGenomes-Tr; MAE_t026-1.
DR   EnsemblGenomes-Tr; MAE_t027-1.
DR   EnsemblGenomes-Tr; MAE_t028-1.
DR   EnsemblGenomes-Tr; MAE_t029-1.
DR   EnsemblGenomes-Tr; MAE_t030-1.
DR   EnsemblGenomes-Tr; MAE_t031-1.
DR   EnsemblGenomes-Tr; MAE_t032-1.
DR   EnsemblGenomes-Tr; MAE_t033-1.
DR   EnsemblGenomes-Tr; MAE_t034-1.
DR   EnsemblGenomes-Tr; MAE_t035-1.
DR   EnsemblGenomes-Tr; MAE_t036-1.
DR   EnsemblGenomes-Tr; MAE_t037-1.
DR   EnsemblGenomes-Tr; MAE_t038-1.
DR   EnsemblGenomes-Tr; MAE_t039-1.
DR   EnsemblGenomes-Tr; MAE_t040-1.
DR   EnsemblGenomes-Tr; MAE_t041-1.
DR   EnsemblGenomes-Tr; MAE_t042-1.
DR   EuropePMC; PMC2442094; 18534010.
DR   EuropePMC; PMC2779907; 18192279.
DR   EuropePMC; PMC3037368; 21347358.
DR   EuropePMC; PMC3088681; 21573169.
DR   EuropePMC; PMC3150298; 21714912.
DR   EuropePMC; PMC4495218; 26025892.
DR   EuropePMC; PMC5300888; 27411372.
DR   EuropePMC; PMC6297720; 30619416.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01116; Yfr1.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01318; CRISPR-DR5.
DR   RFAM; RF01419; IsrR.
DR   RFAM; RF01701; Cyano-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; AP009552.
DR   SILVA-SSU; AP009552.
DR   StrainInfo; 829363; 1.
XX
CC   strain information:
CC   http://www.grs.nig.ac.jp/algae/strainDetailAction.do?strainId=1020
CC   JSCC Strain Database:
CC   http://www.jscc-home.jp/modules/system/modules/menu/
CC   main.php?page_id=73&op=change_page
CC   (Japanese language)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5842795
FT                   /organism="Microcystis aeruginosa NIES-843"
FT                   /strain="NIES-843"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:449447"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sds"
FT                   /locus_tag="MAE_00010"
FT                   /product="solanesyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99822"
FT                   /db_xref="GOA:B0JFM9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM9"
FT                   /protein_id="BAF99822.1"
FT                   /translation="MIPTTSLFAPVDDDLRLLTNNLKNLVGARHPILAAAAEHLFEAGG
FT                   KRVRPAIVLLVSRATMLDRDITPRHRRLAEITEMIHTASLVHDDVVDEAELRRRVPTVN
FT                   SLFDNRVAVLAGDFLFAQSSWYLANLDNLEVVKLLSEVIRDFAEGEIQQGINRFDTSIS
FT                   LAAYLEKSYYKTASLIANSAKAAGVLSEQSAEVNHHLYNYGRDLGLAFQIVDDILDFTS
FT                   PTEVLGKPSGSDLISGNITAPALFAMEENSYIEVLIEREFSQEGDIEKALDFIHSSQGI
FT                   PRSKELADQYGQSALKHLECLASSPSKDVLIELVDYVLSRIY"
FT   CDS_pept        complement(969..1514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99823"
FT                   /db_xref="GOA:B0JFN0"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN0"
FT                   /protein_id="BAF99823.1"
FT                   /translation="MNETITFRISPVIRVTLLSLYVALTIPLPFLAKVTNSPVNPNFLW
FT                   GGISLGLIALYGALSERVILSETGIQVTYPQWFPAFLRSGWWLNWTDIKELKCRSTGQG
FT                   GLVYYFLDRSSEKAYLLPMRVVGFNRMVKIIAEKTNLDMTDIRPLSQPWMYGILFILTL
FT                   FLLLVDAWTIATARTIIP"
FT   CDS_pept        complement(1616..1951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00030"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99824"
FT                   /db_xref="GOA:B0JFN1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN1"
FT                   /protein_id="BAF99824.1"
FT                   /translation="MPRITVYGQTITCDRGENLRRILLKHDISLYNGASKLINCRGIGS
FT                   CGTCAVAIVGEVSAINWQEKARLSLPPHNPDNNRRLACQVKVFGDIEVTKYDGFWGQGD
FT                   SVISDQF"
FT   CDS_pept        2014..3654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00040"
FT                   /product="uncharacterized AIPM/Hcit synthase family
FT                   transferase"
FT                   /EC_number="2.3.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99825"
FT                   /db_xref="GOA:B0JFN2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN2"
FT                   /protein_id="BAF99825.1"
FT                   /translation="MNNGKRIWVYDTTLRDGAQREGISLSLEDKIKIARELDRMGIPFI
FT                   EGGWPGANPRDGQFFWKLHEEPLKQAELVAFCSTRRPHVEAREDRMLTAILAARTRWVT
FT                   IFGKSWDLHVTEGLKTSLEENLAMIGDTIEYLRCQGRRVIYDAEHWFDGYKNNPEYALL
FT                   TLKTARAAGAEWLVFCDTNGGTLPQEIAPIVEKVRQQLGIDPDEENAPQLGIHAHNDAG
FT                   TAVANSLAAVNEGARMIQGTINGYGERCGNANLCTLIPNLQLKMGFSCLEENQLGRLTG
FT                   TSRKISEMVNLAPDDHAPFVGRSAFAHKGGIHVSAVAKNPLTYEHINPEAIGNQRRIVI
FT                   SDQSGLSNVLAKARSFGIDLNKDDPTCRQILERLKILESEGYQFEAAEASFELLMREAL
FT                   GQRSHLFELKGFQVYCDMLRDSGNAIATIKVRVKEEDLLEVAEGNGPVAALDLALRKAL
FT                   VKFYPEIANFHLTDYKVRILDSGSGTAAKTRVLIESSNGQQRWTTVGVSSNILEASYQA
FT                   VVEGIEYGLYLLQNNKLELSGQFCPLGII"
FT   CDS_pept        complement(3758..4168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99826"
FT                   /db_xref="GOA:B0JFN3"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN3"
FT                   /protein_id="BAF99826.1"
FT                   /translation="MEAYACNFCQHIFTANLEQQVLKMADSQLPLTWYWNGKYWQGLPR
FT                   EGMEMAGFYLIIGLGFVIFPTAIVATGAYLFPPVEGSPLSWVPLFWSILTFVCHAICLL
FT                   WLMIEYYQFPVNMYLRALARRWQNSVVTRLLS"
FT   CDS_pept        complement(4188..4454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00060"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99827"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN4"
FT                   /protein_id="BAF99827.1"
FT                   /translation="MLGCTAFKLRRGIFSTNARTSSTQIWLNYHFWTTSYCSPFPKKKT
FT                   LYLTTKITAVSAMAFFTLTHINHDRSNPIKLSRYLFLSRLSPW"
FT   CDS_pept        complement(4541..5341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00070"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99828"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN5"
FT                   /protein_id="BAF99828.1"
FT                   /translation="MRWITACVLSLLLFFALPIAAYADSPTISEEQIREGEVIAEKALE
FT                   ATEKGDYAQAESYWTQLVAKFPTNPAVWSNRGNARVSLNKLEDAIADFNQAIAIAPDAP
FT                   DPYLNRGTALEGEGKYQEAIADYNKVLELDPNDAFAYNNRGNAEGGLGDWEAAVKDYRQ
FT                   ATQLAPNFAWAQANLALALYELGRYPEAVQKMRNIARKYPMFPDVRAALSAVLWTQGQQ
FT                   GEAESNWVAAVGMDTRYQDLDWVKSVRRWPPNMVLALDKFLNLK"
FT   CDS_pept        complement(5384..5917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="MAE_00080"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99829"
FT                   /db_xref="GOA:B0JFN6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN6"
FT                   /protein_id="BAF99829.1"
FT                   /translation="MVTAAPLVGVIMGSDSDLPTMKEAIAVLEVFQISHEVAIVSAHRT
FT                   PEKMFEYAKNAHRRGIKVIIAGAGGAAHLPGMVASLTPLPVIGVPVVTRTLQGLDSLYS
FT                   IVQMPAGIPVATVAIGNAKNAGLLAVQILATGNADLLEQVIAYRQSLTDSVLEKQSNLQ
FT                   RLGYQDYLEQSSPK"
FT   CDS_pept        complement(5942..6643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99830"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN7"
FT                   /protein_id="BAF99830.1"
FT                   /translation="MTALDMIPDVTYLPTDLWSDEPPLASDLHLQQIIILLSCLELLWR
FT                   ERSDYYASGNLTIYYKAEQLKKRDFWGPDFFVVLDTEKRPRKSWVVWGEQGKYPDVIVE
FT                   ILSDSTANIDRNNKKILYQNTFRTPNYFWFDPNSLELQGFRLIGGQYQAISPNDQGYLW
FT                   SEQLGLYLGIFDRKLRYFTADGQLVPTPQEAELQQRQAKEQALLEKERERQAKEKLAQK
FT                   LRELGIDPDTI"
FT   CDS_pept        6833..8626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00100"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99831"
FT                   /db_xref="GOA:B0JFN8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN8"
FT                   /protein_id="BAF99831.1"
FT                   /translation="MTETLIQPATLVELLRYRATAQPEGHAYTFLIDGKKETPPLTYSE
FT                   LDRQARAIAAYLQKYQAQGERALLLYPQSLEVVAAFCGCLYAGVIAIPVPPPESGRLKR
FT                   TLPRLRAIVKDANATFALVTESILTLIEGVKEEFPEFDQMKWITTESIDISLADQWQDP
FT                   QVDKSALAYLQYTSGSTNIPKGVMLSHFNLMHHCGYLQKACGYEPDSVTLTWMPYFHDY
FT                   GLVEGITVPLYNGTPCYLMSPFAFIKRPMQWLKNITKYKVTHSQAPNFAYDLCTRRIKA
FT                   ADLAELDLSSWQAAGNAAEPINPKVMAKFVDTFADYGFSWQTFAPAYGLAEYTLLISNK
FT                   PKGTTPIITALDATAYERGKIVPVGSDRTTGVRYVPSCGRRVCDTRIAMVNPDTFTLCA
FT                   ADEVGEIWASDPSMAAGYWQREDATKETFQAYLADTGEGPFLRTGDLGFLLDGELHITG
FT                   RIKDLIIVRGSNHYPQDLEWSVQHLNEVFRPDYGAAFSIEDNGEEQLVIVQELERRIGE
FT                   LDTAKLIADIRQEIAEEHEIMTHAIVLAKSGTILKTASGKIQRRAIKQNFLNGNMSVID
FT                   AWSENPQLVSKFDRSNSATEA"
FT   CDS_pept        8642..8953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99832"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFN9"
FT                   /protein_id="BAF99832.1"
FT                   /translation="MLTRSRITNRVRIRLGIKVREKVMLTQLMVKPSSWIEKGIKLSPV
FT                   RENYLFKFTEELQCRLEELRELEKNSQLNSQETAELAGILELNEIFTLLNARIVAESK"
FT   CDS_pept        8950..9396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00120"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99833"
FT                   /db_xref="GOA:B0JFP0"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP0"
FT                   /protein_id="BAF99833.1"
FT                   /translation="MISITTRLQVRARANYLCEYCHSPEEISAALFEVDHIQPKSLGGK
FT                   DELANLALACQRCNRYRYNFIKAIDPKTEQEVEIFNPRQQHWQEHFIWTPDALKIVGLT
FT                   PIARATIERLDLNDDNHNEGFIVKVRRLWIRGGWHPPSTDKKQE"
FT   CDS_pept        9551..9817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99834"
FT                   /db_xref="GOA:B0JFP1"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP1"
FT                   /protein_id="BAF99834.1"
FT                   /translation="MSKQDKLLIKILLGNSDANIPFEQLCQLLRKLGFDQRIGGSHHIF
FT                   TKEGVEEILNLQPKQGKAKVYQVKQIRSLILKYKLGYQDENSL"
FT   CDS_pept        9801..10013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99835"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP2"
FT                   /protein_id="BAF99835.1"
FT                   /translation="MKIRYELIIYWSNEDQLFIVEVPELAGCMADGETYQEAVQNAEII
FT                   IQQWIETAQELGREIPEPKGRLLFA"
FT   CDS_pept        complement(10296..10763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="MAE_00150"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99836"
FT                   /db_xref="GOA:B0JFT3"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFT3"
FT                   /protein_id="BAF99836.1"
FT                   /translation="MFKKNRWFWIVAVIGLILDQVTKYITVQSFEQIGDTFPIIPGVFH
FT                   FTYVINTGAAFSAFRGGVGWLKWLSLLVSLGLMAFAYFGPHLNRWEQLAYGFILAGAFG
FT                   NGIDRFLFGYVVDFLDFRLINFPVFNLADVFINIGIICLLISTFPHKSRVP"
FT   CDS_pept        complement(10775..11428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY"
FT                   /locus_tag="MAE_00160"
FT                   /product="putative biotin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99837"
FT                   /db_xref="GOA:B0JFP3"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP3"
FT                   /protein_id="BAF99837.1"
FT                   /translation="MNTNPNRQPKSRRGRESPPRRASASVPNELIWALIGLLLTIFSTF
FT                   VPVSLASWSATTGLSSQKLGITYQIGAVLLTGCLGGKNAGLLAQVAYIFLGLTWLPVFA
FT                   QGGGMGYLKEPSFGYILGFMPGAWLCGWLAFRWRAKIETLALSAFAGLLVIHLCGLLYM
FT                   LGLSIFQPQAGQITFPDSLPTLFMNYSVWPFLGQLVVICVVVIIAFFFRKLLFY"
FT   CDS_pept        complement(11400..12494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="MAE_00170"
FT                   /product="biotin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99838"
FT                   /db_xref="GOA:B0JFP4"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFP4"
FT                   /protein_id="BAF99838.1"
FT                   /translation="MVQVSTHSATQSIPMEGEALKNWLQTRANQIIAGDRLSKQEALAL
FT                   TAIEGQENIFSLCEAADRIRQACCGNTVDLCSIINIKSGSCSENCSFCSQSVHHPGQDS
FT                   PIYGLKSREEIVTHAKAAADAGAKRFCLVSQGRGLKYNSPKSQEFEEILATVQEIIETA
FT                   KIKPCCALGELTLPQAQALKEAGVTRYNHNLEASENFYPNVVSTHSWQDRVETVKNLKA
FT                   AGIQACTGGIIGMGESWTDRIDLAFSLAELEVESVPINLLNPRSGTPLGHLPKLEPFTA
FT                   LKAIAIFRFILPQQILRYAGGREAVMGELQNLGLKSGINAMLIGHYLTTLGQPPQQDQA
FT                   MLADLSLIGGEAPIPGEYQPQQAT"
FT   CDS_pept        12628..13173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="MAE_00180"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99839"
FT                   /db_xref="GOA:B0JFP5"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP5"
FT                   /protein_id="BAF99839.1"
FT                   /translation="MKVIPTEIPDVLIIEPQVYGDDRGFFLESFNQKDFREKTGVNTTF
FT                   VQDNHSMSLKNVLRGLHYQIPNPQGKLVRVVNGSVFDVAVDARQSSPTFGQWVGCILSA
FT                   ENKRIFWVPEGFAHGFLVLSDRAEFLYKTTNYYYPQYEKTILWNDADLGIDWPLETPPI
FT                   LSPKDQAGQPFKSVEVFP"
FT   CDS_pept        13179..14054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="MAE_00190"
FT                   /product="dTDP-6-deoxy-L-mannose-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99840"
FT                   /db_xref="GOA:B0JFP6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP6"
FT                   /protein_id="BAF99840.1"
FT                   /translation="MKKVLLIGAKGQVGQELQVTLPQLGEVISIGREELDLTNSQKIGQ
FT                   LIREIHPDYLVNASAYTAVDKAETEPDLAYSINAIAPKIMAEAAEKTKAKFLHISTDYV
FT                   FDGRKNTPYLETDLTNPLGVYGQSKLRGEEEINTVNSQAIILRTAWVYGSYGKSNFVKT
FT                   MVRLGKEREELKVVVDQLGSPTWAKDIATAITQLLINADNPAGIYNFTNSGVASWFDLT
FT                   KAIFEEAKTSGIPLKIQRVIPITTAEYPTPAVRPAYSVLSGQKISQQLGYIPPYWRDSL
FT                   KAMLTQLFNL"
FT   CDS_pept        14059..15132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="MAE_00200"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99841"
FT                   /db_xref="GOA:B0JFP7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005908"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP7"
FT                   /protein_id="BAF99841.1"
FT                   /translation="MKALILSGGKGTRLRPLTYTGAKQLVPVANKPILWYGIESIVAAG
FT                   ITDIGIIISPETGEEIRQTTGNGEQFGAKITYIRQDQPAGLAHAVKTAQSFLGDSPFIM
FT                   YLGDNLIEDDLSPFLGSFQKQSLDALILLRKVSNPSAFGVAKVDETGKVLYLVEKPKEP
FT                   PSNLALVGIYFFAPTIHQAIASIQPSGRGELEITDAIQELINQNKAVEANKLLGWWLDT
FT                   GKKDDLLEANRIILDTSLEIALQGEIDANSQVIGRVKIGQGSKIINSTIRGPVIIGENC
FT                   HIENCFIGPYSSVANGVKLIDADVEHSVILKDATIIGIHQRIVDSVIGRRAKLEIAPQR
FT                   PKALRFMIGDDSHVELV"
FT   CDS_pept        15403..16488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="MAE_00210"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99842"
FT                   /db_xref="GOA:B0JFP8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP8"
FT                   /protein_id="BAF99842.1"
FT                   /translation="MTQQYRITLLPGDGIGPEILAVTVEILKVIGKKFDLQFDFQTALI
FT                   GGAAIDETGSPLPEATLSACKNSDAVLLAAIGGYKWDNLPRQQRPETGLLGLRSGLGLF
FT                   ANLRPATIFPQLIDASTLKREIIEGVDIMVVRELTGGVYFGQPKGIFETETGEKCGVNT
FT                   MVYLESEVDRIAKVAFEIAQKRGNKLCSVDKANVLDVSQLWRDRMTKMAANYPDVELSH
FT                   LYVDNAAMQLVRAPKQFDTIVTGNLFGDILSDEAAMLTGSIGMLPSASLGTAGVGVFEP
FT                   VHGSAPDIAGQDKANPIAQILSAAMMLKYGLNQPLAAASLEKAVEKVLALGYRTGDIFS
FT                   EGMTLVGCQAMGQAILKVLES"
FT   CDS_pept        16569..16829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99843"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFP9"
FT                   /protein_id="BAF99843.1"
FT                   /translation="MVALSEKTEQQRVDMEIPILLDPTVLRAARRIYRIYCTLNSRVSK
FT                   RPFGVAINRDNHRGQLIFNNKPILLPGECFVPIKQIESEAY"
FT   CDS_pept        17110..18987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="MAE_00230"
FT                   /product="excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99844"
FT                   /db_xref="GOA:B0JFQ0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFQ0"
FT                   /protein_id="BAF99844.1"
FT                   /translation="MFGNNLNSTLIQDLDRLENRLREIPLEPGVYFLRDQNGEILYIGK
FT                   SKKLRSRVRSYFRPSQPLSPRIALMVRQVTEIEFIVTDTEAESLALEANLIKQHQPHFN
FT                   TLLKDDKKYPYICITWSETYPRIFITRKRRINNQKDRYYGPYVDTRLLRYTLHLIKRTF
FT                   PLRQRPQPLFKDRPCLNYDIGRCPGVCQKLISPQDYRETLQKVAMIFQGRTGELLEKLA
FT                   TKMLAASENLDFEQAATIRDQIRGLQALNTDQKVSLPDDTVSRDAIALAKDEQHCCIQL
FT                   FQVRSGRLVGRLGFFADSQSANEGEILQKVLEEHYLSVEGVEIPSEILLPCELPEGEVL
FT                   AGWLREKKGRKVELTVPQRQSKADLLAMVEKNALYELEKTKRSADRDLQSLQDLAVILD
FT                   LPALPHRIEGYDISHIQGSNAVASGVVFIDGVAANQHYRHYKIKNPEVKIGHSDDFASL
FT                   AEVIRRRFRRYAENPDNIAESDDFPDLVMIDGGKGQLSAVVAVLGEMNLLEQVKVVSLA
FT                   KQREEIFLPGESSPLETDKEQPGVQLLRRVRDEAHRFAVSFHRQQRMQKSRRSRLDEIP
FT                   GLGFKRQKELLAHFHSLDYIREASLEQLQQVTGIGEQLAKEIYNYFHPR"
FT   CDS_pept        complement(19057..19257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00240"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99845"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ1"
FT                   /protein_id="BAF99845.1"
FT                   /translation="MVRWSLTESALGQKGAKKGYFEETSQRLSFEETVDSVQERNLRYS
FT                   EEEIEESINEAIRETRAASRS"
FT   CDS_pept        19487..21079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99846"
FT                   /db_xref="GOA:B0JFQ2"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ2"
FT                   /protein_id="BAF99846.1"
FT                   /translation="MTLTKNPVSRNRRFSPRNLFETCMALLVLCNYILVIFDLTYIPLR
FT                   DFWLQGRLQITLLRFNEPIKLGPISFQELQIPPDKPLEIPFVKGIAKYDVVKGIKPYRS
FT                   TSEYLETVNKLNQLINQKLFNPEFNLQEYRQEIEKVLDNLRQKSINMVDNNPFASAEKT
FT                   GTLEKIKNKMRLRVFKTENVSAKAAFQKFWTWDYLIQNGWEKELKFFNQEIQPLIETNY
FT                   FRPLGEDGRPIDNFEAIDFFFGTIFFWEFMLRTWWIARTHKGLRWREAMLWRWYDIFLF
FT                   VPIWRWLRFIPTVIRLDQVKIINLRLIKEQAVKGLVALISKDITEIIVLRIINKIQEYI
FT                   RQGQVEKLLNRSLNGGYNNLNDTNEVIEIFRLVVNSTVDKVLPQVKPEAEALIKYNIEK
FT                   ILSQTPAYQSLLRLPSMKGLKTDLSNRLSSQLYQSFVNIADKITQEDEVFERLLQQLVQ
FT                   RFGQSLAGELQSRHSLERIEMLLIIFLEEVKLNYVQEFSDEDLETILEQTRLLHSQSAE
FT                   TNPAETMNPRRLP"
FT   CDS_pept        21326..21964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99847"
FT                   /db_xref="GOA:B0JFQ3"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ3"
FT                   /protein_id="BAF99847.1"
FT                   /translation="MLTKIILGLLWLGFGLYAFLLAPPDQPDTVNLIIDLSTGKWQYIN
FT                   PLIIALFNLMGVWPLIYTSLLIIDGRDQKIIAWPFTFASFAVGAFAILPYLTLRQSNSN
FT                   FTGKKNLVIKLLDSPWLGVIALITAAILIAYGLINGNWSDFWHQWQTSRFIHVMSLDFC
FT                   LLTLLCPILLQDDLTRRGLKNPFLLPVISLLPLIGPAIYLIIRPRLGEN"
FT   CDS_pept        22118..22411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99848"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ4"
FT                   /protein_id="BAF99848.1"
FT                   /translation="MLESQKPPRIYCFQADYIASQQFNPQEIPAWLSLEVNWQGYRIHT
FT                   LPWVADVARVLGLLAIEDTPQGWQDHLESLGLAKIRLMDSEEFFEDKSLSGC"
FT   CDS_pept        22459..22932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="MAE_00280"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99849"
FT                   /db_xref="GOA:B0JFQ5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ5"
FT                   /protein_id="BAF99849.1"
FT                   /translation="MPYKLLFVCLGNICRSPAAENIMTYLIEQEGLGNKILCDSAGTAG
FT                   YHIGSPPDSRMNTAAKKRGIPLQGTARQFTREDFENFDLILAMDKANYQDILSLDRTGK
FT                   YQEKVKLMCDYARYHPEKEVPDPYYGGREGFDRVIELLLDSCGSLLEEVKNKI"
FT   CDS_pept        complement(22947..23603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00290"
FT                   /product="two component transcriptional regulator"
FT                   /note="LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99850"
FT                   /db_xref="GOA:B0JFQ6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ6"
FT                   /protein_id="BAF99850.1"
FT                   /translation="MPLLILIADDDPGIRLAVKDYLELAGYSVVAASNGLEALNLLDTY
FT                   HPHLLVSDIKMPRLDGYSLVTKVRQQPEFRLLPVIFLTERGSTEERIRGYQVGCDIYLP
FT                   KPFEMEELKAVIRNLLERSQMVQSERQYQKLKPEESPKTRDVLTSSLQDDFKLTNRERE
FT                   VLEHLARGLSNSEIGQKLHLSSRTIEKYVSSLLRKTTTNNRAELVRFSLEHRLID"
FT   CDS_pept        23775..24890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natC"
FT                   /locus_tag="MAE_00300"
FT                   /product="amino acid transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99851"
FT                   /db_xref="GOA:B0JFQ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ7"
FT                   /protein_id="BAF99851.1"
FT                   /translation="MTDYLVSLTIWAGIYAIFALGLNLQWGFTGLINFGHVAFATLGAY
FT                   ATVLLTLQGVPMIFAAIVGAILGALLGLAIGFSTLRLRADYLAIVTIGVSELIRLLVLN
FT                   EDWLTKGSFGLQRYPLPLDINPSFAVKLLIIALFTLLAIFALWQLGRNLQRQWREAGQI
FT                   SGKSYQPTQKRALIFWGSLGAIILLFLYINGVISLNDYNYKAGLMVVVLVLLALVYTGL
FT                   ELLLRSPWGRILKAIREDEEIPRALGKNVFWYKLQSLMLGGAIAGLAGAFLAWQLTTIY
FT                   PTNFEPLLTFNAWIIIILGGSGSNAGTLLGAVIFWAYDSLTRFILPQLDIFNDSQLGAL
FT                   RIMIIGLLLMVLMIWRPQGILGKKEELTLGK"
FT   CDS_pept        25172..25924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="MAE_00310"
FT                   /product="amino acid transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99852"
FT                   /db_xref="GOA:B0JFQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFQ8"
FT                   /protein_id="BAF99852.1"
FT                   /translation="MLLSAKGLSKSFGGIRAVNNAYLDVPQGSITGLIGPNGAGKTTLF
FT                   NLLSNFIRPDKGEVFLDGQPIHQLPPYQIALKGCVRTFQVARVLSRLTVLENMLLASPG
FT                   QTGENFLKVWFQGAKIRQQEQENRAKALDILDSIGLGEKAQDYAGALSGGQRKLLEIGR
FT                   VLMTKPKLILLDEPAAGVNPTLIAQINDHIIEWNRQGITFLIIEHNMDVIMSLCHHIWV
FT                   LAEGTNLADGIPSEIQKNERVLKAYLGD"
FT   CDS_pept        complement(25913..26551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="MAE_00320"
FT                   /product="imidazole glycerol phosphate synthase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99853"
FT                   /db_xref="GOA:B0JFQ9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFQ9"
FT                   /protein_id="BAF99853.1"
FT                   /translation="MTLIAVIDYDMGNLHSACKGLETVGAVPKITDSPLDLEKADAIVL
FT                   PGVGSFDPAVRQIRSRHLEKPIKAAIANGKPFLGICLGLQILFETSEEGQEAGLGIIPG
FT                   TVRRFRSEPGITIPHMGWNQLDFTQPDHALWQGLPPHPHVYFVHSYYVDPLDSHLTAAT
FT                   VTHGSQTVTAAIARDRLVAVQFHPEKSSTNGLKILANFVQQVQKLALVS"
FT   CDS_pept        26933..27283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99854"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR0"
FT                   /protein_id="BAF99854.1"
FT                   /translation="MLQLPPSISSSLDSVKVRSQSSFVIIGANGSGKTRFGVWIEFSSR
FT                   ARDLVHRIAAQKSLSIPDYFSTSSLNAATNLLRYGYHKENLNDEQTTPYKRRLTCRYTG
FT                   CPEIGKSLTKCR"
FT   CDS_pept        27422..27583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00340"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99855"
FT                   /db_xref="GOA:B0JFR1"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR1"
FT                   /protein_id="BAF99855.1"
FT                   /translation="MSSIISKIISFLAIISNVNSIVYLLVLTCLCLKSLPIWISDTFER
FT                   RRSHRILF"
FT   CDS_pept        27819..28397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99856"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR2"
FT                   /protein_id="BAF99856.1"
FT                   /translation="MITVEPITLNLKSVNLSDEQFYQLCHNNDDWRIEQNAEGELIIMP
FT                   PIGAISGNRKSDLNGFVWLWNRQTKLGKVFSSSTIFTLPKRGKRSPDVAWIANERWEAL
FT                   PLEEQEKIARICPDFVIELRSRTDSLSQLQAKMQEYLDSGLRLGWLIDPISQQVAIYRQ
FT                   NQEVEIVSLPTTLSGESVLPGFTLELPIF"
FT   CDS_pept        28415..29074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99857"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR3"
FT                   /protein_id="BAF99857.1"
FT                   /translation="MIATTTISPQLTIPRLENGDKLTRREFEHRYNAMPNLKKAELIEG
FT                   IVYIMASPLRIKNHGEPHADIIGWLSVYKAFTPNLQLGDNCTVRLDADNEPQPDALLRI
FT                   KNGGQSTISEDGYVEGAPELIVEIAASTVSLDLHQKLKVYRRNQVQEYLVWRVDDGEFD
FT                   WFRLTNEEYIKLEPNSEGIICSQIFPGLWLDRDALLAGDLAKVLEVLQLGMARIKN"
FT   CDS_pept        29158..29970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99858"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR4"
FT                   /protein_id="BAF99858.1"
FT                   /translation="MKTDKIFYTLFQVFPELLFQLLGESPNLAQNYQFKSIEIKELAFR
FT                   LDGVFIPDADHPDYPLYFVEVQFQKDEDFYWRFMTQIFLYLKQYKPERACCPVILWGKR
FT                   RLDIGFPIAYQNLLNLERIQRIYLDEVEAESPPSLGISILQFILISGKKAPEQVQSLIE
FT                   QTRKQIIDPNTQRNVIELIEKIIIYKFPQKSRQELEAMFNLTEWKQTKFYQEAKEEGKL
FT                   EGKLEGKLEGKLETIPLLVKLGLNEEQIARELNLRVEIVRQFIANHNN"
FT   CDS_pept        30127..30327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99859"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR5"
FT                   /protein_id="BAF99859.1"
FT                   /translation="MFNLTEWKQTKFYQEAKEEGKLEGKLEGKLETIPLLVRLGLNEEQ
FT                   IARELNLKVEIVHQFIANQNN"
FT   CDS_pept        complement(30375..30638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99860"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR6"
FT                   /protein_id="BAF99860.1"
FT                   /translation="MPLKRSGEKKMKKLKYRIVIQWSDEDNCYLVGLPDFPGQKWRTHG
FT                   STYAESVKNAEEVLESLMELYQKLGESLPEPEINKKREILQK"
FT   mobile_element  complement(30649..32071)
FT                   /mobile_element_type="insertion sequence:ISMae36_1"
FT   CDS_pept        complement(30676..31890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00400"
FT                   /product="transposase"
FT                   /note="uma4 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99861"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR7"
FT                   /protein_id="BAF99861.1"
FT                   /translation="MILDKFLNLKGTCIQGYLHLENIGIVCRIESKNQKATCPRCGLES
FT                   DKLHQNHRHLVKDLPISGQPVYLQINRRQFKCDNCQRPLSEELDFVAKKRTYTKRLAAN
FT                   ILEQLKEGDILNVSRINDVTEEEIQRMIEDIAEEITEPDLSELKRLGIDEIALVKGQKN
FT                   YCAVLVNLDTGKLIAILEKRTQEELRETLTGWGKEVLEQIEEVSIDLWLPYKNLVKELM
FT                   PSAEVVADRFHVMKQINQELDEQRRAEKRAVEAQKNKKQKAEKEAKLEVLKRSKYSLLK
FT                   NEEDLTEPQKIKLEAIKEKFPNLKKMQELKEEFRKIYETSENPTEGMLSISEWLAKSSS
FT                   VFTKSCQTIRNWFGEIISYFERRTTNGVVEGINNKLKLIKRRGYGFRNFRNFWVRSMLS
FT                   WHLVC"
FT   CDS_pept        complement(32040..32210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99862"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR8"
FT                   /protein_id="BAF99862.1"
FT                   /translation="MLKKAGFIDFPGKGSHNHWLHPLYAGKITLSGKDGADAKRYQEQE
FT                   VRLFGNCYANN"
FT   CDS_pept        32289..32444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00420"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99863"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFR9"
FT                   /protein_id="BAF99863.1"
FT                   /translation="MYNSYYIKISSIERLLEKHREQRRGGAGEQRLFIFWVPLFLDSPE
FT                   NFLPEI"
FT   CDS_pept        32660..32851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00430"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99864"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS0"
FT                   /protein_id="BAF99864.1"
FT                   /translation="MRSFNLIGELFVCKRMGREIVKSGTNCRLRETTQSNLPDSSTNLK
FT                   SGQKSFSPCQGARLLPCN"
FT   CDS_pept        33058..33342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99865"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS1"
FT                   /protein_id="BAF99865.1"
FT                   /translation="MNTIQLTPEIEDLIAQQIKTGKYQDDLAVIQEGLRLLAERDRIYR
FT                   GRFEELKREVMIGVEELRRQEGINAEEVFSELEEDLQQIEAKGFPMSQK"
FT   CDS_pept        33342..33638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99866"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS2"
FT                   /protein_id="BAF99866.1"
FT                   /translation="MSKIIFSPSARLDLKQVNSYLAGKNPQAARILKEKIQQACKKLAK
FT                   FPNLGRRRDELIPRLRSFPVEDYLIFYFPLENGIEIARVVSGYRDLDAMFDVD"
FT   CDS_pept        complement(33794..34015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00460"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99867"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS3"
FT                   /protein_id="BAF99867.1"
FT                   /translation="MLESGGLLCVVSRKRSAPPYQIPKRSDHRNRIAITRDGSGVFPLD
FT                   RSSIAGCQFFGFHGVNAPMMLINLINRP"
FT   CDS_pept        complement(34031..34231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00470"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99868"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS4"
FT                   /protein_id="BAF99868.1"
FT                   /translation="MAGVHLPEPKSSNTRESRKRGTEKRNCFPAPGASSPCPVSETPEL
FT                   TRVVRQFLEANRAPWQGEKDF"
FT   CDS_pept        34346..34738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99869"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS5"
FT                   /protein_id="BAF99869.1"
FT                   /translation="MTQITINLPVSLLESAQCLGKATERELSEVLIDTLEIILPTFNNL
FT                   SAVGNHLEVSNLLDSEVIELANSKMDAVQNQRLGELQAKGKNTGLTEAEGYELLVLISI
FT                   YQMGQLRKSIALAEAVKRGLREPLIP"
FT   CDS_pept        34735..35178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00490"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99870"
FT                   /db_xref="GOA:B0JFS6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS6"
FT                   /protein_id="BAF99870.1"
FT                   /translation="MSFLTETLRQKVKQRAGNRCEYCLSHQDYIMGRLQIDHIQPLAKG
FT                   GANTEDNLCLACELCNQYKWTQTEAIDPKSEVLVSLFNPRLQKWQEHFTWTQEGTEIMG
FT                   VTACGRATIVALRLNSNLAVIVRKNWVKAGWHPPNLQTESHLT"
FT   CDS_pept        35212..36108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99871"
FT                   /db_xref="InterPro:IPR031037"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS7"
FT                   /protein_id="BAF99871.1"
FT                   /translation="MIVADIQKSSLKEQRLQFIRNHQQAFDVEPIYPLRLFEDFVMGVE
FT                   GDCTIQASCKIELDQLIASRFMLFFKDKAQEWQNYLAQSLAFFRQVENRVGVKLDYSLL
FT                   QQFLGLNFNFSKITVFSTGIDLRTNLADSSLKMHIRLKDYPEKINQALLLTSDSDDLIA
FT                   VRDFLSIVGFDFYFDGRSAIKIYPEVAETDFFKPETQDKVWRHLPKFVLEPLKATSLFG
FT                   FGFSKTNNNPVLYYRLKNRQDLTNYFKLNDTAQRVHSFYQHQDILSSVWLGTAQQELEK
FT                   TRIENVRLYYYKLFGKL"
FT   CDS_pept        36188..36520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99872"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS8"
FT                   /protein_id="BAF99872.1"
FT                   /translation="MQSIHALKQLYELDDSQWLGETISLLRNHQFQQLDLEHLIEELED
FT                   LGKEKKNAVASLLEQVIRHLLLLQYWTKETEYNTINWQEEIYNFRTQLKREMTTNLRNY
FT                   LEEIPR"
FT   CDS_pept        36517..37185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99873"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFS9"
FT                   /protein_id="BAF99873.1"
FT                   /translation="MIATTTISPQLTIPRLENGDKLTRREFERRYKAMPNLKKAELIEG
FT                   IVYIMASPLRITNHGNPHARIITWLGNYWSSTPGTELGDNCTVRLDTDNEPQPDALLRI
FT                   KNGGQSTISEDGYVEGAPELIVEIAASTVSLDLHQKLNVYRRNQVQEYLVWRVEDGEFD
FT                   WFRLTNEEYIKLEPNSEGIICSQIFPGLWLDRDALLAGDLAKVLEVLQLGIATLKHQSS
FT                   "
FT   CDS_pept        37228..37674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99874"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFT0"
FT                   /protein_id="BAF99874.1"
FT                   /translation="MLGVHQLKQLYELDDSQWLGETISLLRNHQFQQLDLEHLIEELED
FT                   LGKEKKNAVASLLEQVIRHLLLLQYWTKEAEYNIIHWQEEIYNFRTQLRRKMTANLRNY
FT                   LEEELNYIYEDALGFVKIKTANTVIFPSQCPYSLEQLLDRDWLP"
FT   CDS_pept        37710..38279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99875"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFT1"
FT                   /protein_id="BAF99875.1"
FT                   /translation="MLITKPRFQTFAEYLQYEDNSEESYELFNGELVEMPPESGLNFQI
FT                   ANRLFLVFALMLGTDRVRGHGLELEVRGEPKNRYPDLTIIREEHIQLLSQRNTILLSMS
FT                   PPLLVLEVVSPGEIQRERDYIAKRIQYQDCGIPEYWIVDPQTQTILVLELRGNTYTKIG
FT                   NFSNDDLVKSPGFKELNLKVFDVFNS"
FT   CDS_pept        38311..38682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00550"
FT                   /product="putative peptidase PatA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99876"
FT                   /db_xref="GOA:B0JFT2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFT2"
FT                   /protein_id="BAF99876.1"
FT                   /translation="MNGLTIPGLKELQKQTKGASEITVAILDGVVDTDHPCFNGADLTR
FT                   LPTLVQHQATAGQMSTHGTHIASLIFAQPNSDIQGIAPQCRGLLVPVFSDDNRKLSQLD
FT                   LLDFGQRKTDLRKTYANKI"
FT   mobile_element  complement(38789..40737)
FT                   /mobile_element_type="insertion sequence:ISMae31_1"
FT   CDS_pept        complement(39036..40694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00560"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99877"
FT                   /db_xref="GOA:B0JFJ1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ1"
FT                   /protein_id="BAF99877.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYNKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAKLELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQNFQGIH
FT                   LLRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        complement(40981..42468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99878"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ2"
FT                   /protein_id="BAF99878.1"
FT                   /translation="MKSQEICPDVEELLKWRRQLYNALGSRRETVMELLDSLSSNRQAS
FT                   TVAELSLNPLFRRDYNSLYKGIQEFLPSPTNDNYQKAFDSLLSVVSATIPPPVSRQFYL
FT                   FGVDVTPCPRPYSATLEDKKYIYQPNTIKGNKPINIGHAYSVIAALPERSETGNVPWAI
FT                   PLSGQRVSSGEKDISVASNQVKKILNHSSVPWKDKLSVLVADSLYSQRGFLGEQVKQNN
FT                   LVTLTRGRSNRVFYRQFIPEDYSPKQPGHPRWYGDKFDLKDETTWLEPDEIIQSTFTTK
FT                   RGRELNLKISGWKQMLMRGTSDYEMHSHPFTLLQIIVSDETGKAVWKPMWLILIGSRRY
FT                   ELSLQECYEAYGQRYDLEHLFRFGQQKLLLNAYYTPEVNHEENWVQLTLLAAVNLWATR
FT                   KLALVLPRPWEQYLKKSESVEITPSLVQRDFYRIISEIGTLVKSPKRRGYSAGRIKGYK
FT                   KVPRTRHQVIKKQTKTHIPHPQLSHKLSPARDLSKNT"
FT   CDS_pept        42552..42740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99879"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ3"
FT                   /protein_id="BAF99879.1"
FT                   /translation="MLKYNFLKTNQEAGLRAKQIKATIRKLKQKIQKIEAEGEVAPPPC
FT                   HVIRYQTKLSSKNLLVL"
FT   CDS_pept        43175..44089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00590"
FT                   /product="putative peptidase PatA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99880"
FT                   /db_xref="GOA:B0JFJ4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034056"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ4"
FT                   /protein_id="BAF99880.1"
FT                   /translation="MNGLTIPGLKELQKQTKGASEITVAILDGVVDTDHPCFNGADLTR
FT                   LPTLVQHQATAGQMSTHGTHIASLIFAQPNSDIQGIAPQCRGLLVPVFSDDNRKLSQLD
FT                   LARAIEQAAEKGAKVINISGGTLTDMGEAEDWLIRAVEMCNERNILLVAAAGNDGCECL
FT                   QVPAALPAVLAVGAVDARGHPLDFSNWGETYQSQGILAPGENILGAKPGGGTVQLSGTS
FT                   FAAPIVAGVAALLLSLQVQRGETPNPHAVREAILKSALPCQYADSENEPKCLAGVLNIS
FT                   GAIKQLMGLKRQIKIKSSIIVKE"
FT   CDS_pept        44114..44263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99881"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ5"
FT                   /protein_id="BAF99881.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGSAEKVFP
FT                   RGRV"
FT   CDS_pept        44522..44725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00610"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99882"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAF99882.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   CDS_pept        44899..45060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00620"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99883"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAF99883.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   mobile_element  45221..46403
FT                   /mobile_element_type="insertion sequence:ISMae34_1"
FT   CDS_pept        45270..46385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00630"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99884"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ8"
FT                   /protein_id="BAF99884.1"
FT                   /translation="MANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPR
FT                   GFSLIVDDSGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQP
FT                   ASSLAEGKEDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLK
FT                   YLGGLAKNRKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKI
FT                   SQLEGERNLAIVMNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYREA
FT                   KGWLGLREYQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAF
FT                   RTAMSFRFFEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        46418..47488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00640"
FT                   /product="putative peptidase PatA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99885"
FT                   /db_xref="InterPro:IPR023830"
FT                   /db_xref="InterPro:IPR040483"
FT                   /db_xref="InterPro:IPR040636"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ9"
FT                   /protein_id="BAF99885.1"
FT                   /translation="MSESVETQATVEASGCGCGGTPETPEAERQKLELSAATSAPVIPV
FT                   AQIPNPVITSQGVSMPETTNKSVTPSQAAEPAGGIVYAIGSLGYDFGSEARRDTFKQLM
FT                   PTAVIGGIEVPSNPYDARQMVDYLADNLSEAKSLIWTLNLELTPIYAIEPLGSFSREVY
FT                   AALQELLSGQVQAEDSPEYIQRVSIPGRITGRTVRLFSGQVVPVIEPDSPRGIYGWHVN
FT                   TLVSAAIEAVGAEQTEAQESQMRRTLSSFLNRIYYDLRNLGQTSQDRALNFAATNAFQA
FT                   AQTFSEAVGAGMELDSINVSKSPFCRLDSDCWDVQLKFFDPENSRRARKVFRFTIDVSD
FT                   LIPVTLGEVRSWSSPY"
FT   CDS_pept        47617..47826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99886"
FT                   /db_xref="InterPro:IPR026473"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK0"
FT                   /protein_id="BAF99886.1"
FT                   /translation="MRLPKQSAPVKRPHFIHPHECVDIVHGDGEDLVSILVKLVHGANY
FT                   NDPAQFQYPHYGYLKMSSFGGFRY"
FT   CDS_pept        47950..48909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99887"
FT                   /db_xref="InterPro:IPR031035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK1"
FT                   /protein_id="BAF99887.1"
FT                   /translation="MTAIPVDLVIVIDTSVSVKAEAEGLSQAAETAIANARSHCPSDLR
FT                   VIWLGIEGTWKNTQFERTVRDYLSKTCAIPESALKSRKKGELPSGGAQEDAARVMQDLA
FT                   THFDWRTGAKRAIFYLGDEALDAGGDKTLAKDIEAANQAIQGAKTAQVIIHTYCGQSKS
FT                   RYRHTIEAEYARVAQETGGQSFTAEGSLRDFATVLEQIICGSQSLPQIPLTEPQNNDTP
FT                   TTALATDGDPQPVLQQTHGEHQTMSKSKDSTESAAAAANVTQPTPEKPKTDQPETTEPK
FT                   TKYIPATGLEDYGRWKTMFKDRKANPNDPPFRRGRIWS"
FT   CDS_pept        49054..49209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00670"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99888"
FT                   /db_xref="InterPro:IPR031036"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK2"
FT                   /protein_id="BAF99888.1"
FT                   /translation="MKTPKLTPRITAPVQRDNISTVPSDGNVITPATFCDLATKQCYPF
FT                   AGDDAV"
FT   CDS_pept        complement(49281..50063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99889"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK3"
FT                   /protein_id="BAF99889.1"
FT                   /translation="MTPTAQPSTTIQDPSATVYCDSPLPDHTQLPDKDGSFVKNYQEPP
FT                   QADLLTDTITPILDKLHPDGNYCLGRDCGIYWRLPEYPESLEKGAVAPDWFYVPHVPTT
FT                   IEGQVRRSFVMWKETIEPVIALEFVSGNGEEERDKTPVKGKFWIYERAIQIPFYGIYEV
FT                   NKAQIEMYQLVNGRYQKMTPNQRGHYPIVPLKVELGIWQGEYQNQFFPWLRWWDGEGNL
FT                   LLTSQESTERERQRAEQERQRADRLAEQLRALGIEPED"
FT   CDS_pept        50140..50649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00690"
FT                   /product="putative peptidase PatG homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99890"
FT                   /db_xref="GOA:B0JFK4"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK4"
FT                   /protein_id="BAF99890.1"
FT                   /translation="MPDLNAIPGMTALRSQTKGDPRIKIAVLDGPIDLDCACFQGANIT
FT                   RLDPYWSQEFPIDPQHLQAFLDVEKSAKSDEEKGDMLKEAIPDENILQSLHLRFHANHI
FT                   ISTICGQPDSPVEGIAPNATVINIPIAYSNEDFINPLNLSRAISTAIEQGVNIIHCAAC
FT                   HPTQSG"
FT   CDS_pept        50784..52235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00700"
FT                   /product="putative peptidase PatG homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99891"
FT                   /db_xref="GOA:B0JFK5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023830"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR040483"
FT                   /db_xref="InterPro:IPR040636"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK5"
FT                   /protein_id="BAF99891.1"
FT                   /translation="MKDTGEPFKFSNFGGKYATQGILAPGENILGAQPATDDPIRKKGT
FT                   SCAAPIVTGTAALLMSLQLEQGLSPDAEAVRAALINSAIPCDPNEVEEPERCLLGKINI
FT                   AGAYELLTGEKLQTVEADNNLSNNIIESAVIPMTVTTSVIPSNTTEMATQGITITPPTA
FT                   ATIELAIAPSNASENVSSTGLIQNNQTNKNIVFNSVVPSQRSNLVYVLGTLGYDFGTEA
FT                   RRDTFKQLMPSITIDNLELPSNPYDARQMVDYLESNLSETKSLIWTVNLELTPIYAIKP
FT                   VGAFAADIYQVIQYMLAGQILPESDEDYVERVSIPGMLTEETVKLFSGQIVPVIKVNSP
FT                   RGMYGWKVNTLIESALETVSAEHEIADEARMRRSLTSFLNRIYYDLRNVGQIARDRALN
FT                   FAATNAFQAVQTFSQAVALGMELHSIEVEKSPFCRYGSECWDVKLKFFDPENGLRAKRV
FT                   FRFTIDVSDRTPVTLGEVRSWAVSK"
FT   CDS_pept        52526..53551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00710"
FT                   /product="putative aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99892"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK6"
FT                   /protein_id="BAF99892.1"
FT                   /translation="MRYKLLGNSGLRVSELCLGTMTFGQDWGWGSDKEESRAVFQAFAE
FT                   AGGNFLDTANIYTNGTSETLVGEFVKGDREKWVIATKYSLNTRPGDVNACGNHRKNLFQ
FT                   AVEASLKRLGTDYIDLLWLHIWDSLTPIEEVMRAFDDLVRMGKVLYIGISDSPAWIVSQ
FT                   GNTLATLRGWTPFIGLQIEYSLKERTPERELLPMAKALNIGVTAWSPLGGGVLTGKYNQ
FT                   PNPVDGRLSMTDQPFQILDRDLKIAETALEIAREIGKSPAQVALNWLRNRPNSVIPIIG
FT                   ARKLSQLQDNLACVDFNLTGEQLQRLDNISAISLGFPHELLASQFVCDILLGGVAAQLD
FT                   R"
FT   CDS_pept        53551..53955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99893"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK7"
FT                   /protein_id="BAF99893.1"
FT                   /translation="MEVFVYGTLKPKESNYSAYCAGKVINSKTVYTRGHLYHLTALGYP
FT                   GLTEGEGWVKGILLTFNADYDLGLLDGLEDYQPGRDAEENEYQRRRIPIYNLERELIGE
FT                   AWGYMMTPAKIAFHGGIWLPSGWWTSSDRE"
FT   CDS_pept        54015..54215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99894"
FT                   /db_xref="GOA:B0JFK8"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK8"
FT                   /protein_id="BAF99894.1"
FT                   /translation="MYLLLEVASGKFPVYFVAVYVVGFLAAVTIGSIAWYNSKRPVGWE
FT                   DAQRPDIVPEVKTEVDSDSQS"
FT   mobile_element  54467..55793
FT                   /mobile_element_type="insertion sequence:ISMae10_1"
FT   CDS_pept        54562..55605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00740"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99895"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFK9"
FT                   /protein_id="BAF99895.1"
FT                   /translation="MEKAYSYRFYPTPEQESLLRRTLGCVRLVYNKALHVRTQAWYEKQ
FT                   ERVGYAQTSSMLTDWKKQEELDFLNEVSCVPLQQGLRHLQTAFTNFFAGRTKYPNFKKK
FT                   HQGGSAEFTKSAFKFKDRQVYLAKCTEPLPIRWSRQIPESCEPSTVTVRLHPSGRWHIS
FT                   IRFDDPTIKPLPVTDKAIGIDLGISSLVITSDGDKVSNPKHFNKHYQRLRKAQKSLSRK
FT                   QKGSKNREKARIKVAKIHAQITDSRKDHLHKLTTQLVRENQTIVVENLAVKNMVKNPKL
FT                   SQAISDVSWGEITRQLAYKCRWYGRNYIEIDRWFPSSKRCSNCGYIALENAVKCSRMGL
FT                   SRLWDAP"
FT   CDS_pept        55800..56585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00750"
FT                   /product="cytosine specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99896"
FT                   /db_xref="GOA:B0JFL0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL0"
FT                   /protein_id="BAF99896.1"
FT                   /translation="MENVPEILKAYGGIIRDEIVAHLESWGYQVVTTSLNAAYYGVPQT
FT                   RSRAFFLASLERLPSLPQATHSGDIRSDYKAVKSWTQLTLLEPNIAPVTTVKDAISDLP
FT                   TLEAGQAYDHEIYTREPETIYQQKMREQSQKIVNHIARALTPIQMSRVQILAEGQDARD
FT                   LPAELAPKKHYSGAYGRLSWDKPARTITRWFFHPGSGRFFHPTQNRTITIREAARLHSY
FT                   PDHFHFLGTYTDMASQIGESVPPLLGKVVADSMGQNLEY"
FT   CDS_pept        complement(56560..56991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00760"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99897"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL1"
FT                   /protein_id="BAF99897.1"
FT                   /translation="MNLQSSPAQLGTAIIQHWNEKIRSSQTAQNVINSYEGILLKNREG
FT                   NEYVYCEYPLNPLDPNVFSWAWAIDKKTGGVGAGLQGSIAGKTQLVWYKNQKQLFRSRT
FT                   IPAAAIRLRIERTRLTIDRYVETIFAALQTQTNTQDFVP"
FT   mobile_element  complement(57168..57364)
FT                   /mobile_element_type="MITE:MaeMITEa001"
FT   CDS_pept        complement(57485..57727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99898"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL2"
FT                   /protein_id="BAF99898.1"
FT                   /translation="MLTNDETKRLKQAILAAIASPLIGSIEDYSWEAIFHYIKNIPLSD
FT                   PALGRSKLLYDAVDSKTASGWSLKSLQLNSLTRAG"
FT   mobile_element  57774..59370
FT                   /mobile_element_type="insertion sequence:ISMae28_1"
FT   CDS_pept        57926..58438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00780"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99899"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL3"
FT                   /protein_id="BAF99899.1"
FT                   /translation="MELTDSLKKLLSETALQLKGAAKRRFMAQTVLELGYGGQTLAAQE
FT                   LGWNRTTIRKGIKELKRGIICVDNHSAKGRKKAEEHLPFLLENIKSLVDSQSQTDPSFK
FT                   SQRLYVRLSAAEVRKQLISKYGYSDEDLPSEETIRVKLNNLGYRLKRVAKVLPQKKFQK
FT                   PRQSLRN"
FT   CDS_pept        58474..59148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00790"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99900"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL4"
FT                   /protein_id="BAF99900.1"
FT                   /translation="MLRLSLDAKARVNIGLFDRGGKNRITVETNDHDFNPKTTLTPYGI
FT                   FIPEFDELFLYFTASTVTSDFIVDILEDFWESEKSRFEKIKTLIINQDNGPENNWRRTQ
FT                   FMKRIVEFSQKYQVNIRLAYYPPYHSKYNPIERTWAVLENPWNGSILDEIETALKFAQT
FT                   MTWKGKHPIVKLITETYEKGVKLTKKAMEKIEEKIERLTESTNQDFPDLGQWFIDIYYD
FT                   KT"
FT   CDS_pept        complement(59333..59554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99901"
FT                   /db_xref="GOA:B0JFL5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL5"
FT                   /protein_id="BAF99901.1"
FT                   /translation="MQSGQLEQILGRELQRYRQEKGWSQEYLAEVTGLHRTYISQLERG
FT                   LKSPSVRVLSHITNALGDFQRIKYPTKK"
FT   CDS_pept        59707..61065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="MAE_00810"
FT                   /product="GTP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99902"
FT                   /db_xref="GOA:B0JFL6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFL6"
FT                   /protein_id="BAF99902.1"
FT                   /translation="MKLPVVAIIGRPNVGKSTLVNRIAGDQQAIVFDQPGITRDRTYQP
FT                   AFWCDRDFQIVDTGGLVFNDDSEFLPLIREQALIALAEASVAIFVVDGQGGITAGDREI
FT                   AAWLRQQNVPILLAVNKCESVEQGILQATEFWELAIGEPFPISAIHGSGTGELLDAVIK
FT                   YLPPAAEIPENEEIKVAIIGRPNVGKSSLLNALTGQQRAIVSPISGTTRDSIDTLIERE
FT                   GQVYRLIDTAGIRRKKNVDYGAEFFSINRAFKAIRRSDVVLFVIDVLDGVTEQDLKLAG
FT                   RIIEEGRAVVLVVNKWDAVEKDTYTINTYTKMLQDRLYFMDWAEMIFVSAMTGQRVTKI
FT                   LELVDIAAESHRRRVSTSVINDVIEEAVKWHNPPTTRGGKQGKLYYGTQVSSQPPTIAL
FT                   FVNDPQRFNDNYRRYIEGQFRQQLGFKGTPIRLIWRGKPAREVEKTVNRATKV"
FT   CDS_pept        61069..61944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00820"
FT                   /product="cobalt transport system permease protein CbiQ
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99903"
FT                   /db_xref="GOA:B0JFL7"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL7"
FT                   /protein_id="BAF99903.1"
FT                   /translation="MDLLRSLPIGLYLDQPITRLHQLDARVKFIWLMAFLAAPLLANPW
FT                   WRLALVGLLMFLTLLAPIPPRVWRQQMGWLIFLAIIVFLITAITPDGLAVSIQPRLPDE
FT                   GLNLPPASDYQYVLWDRGRLFVTRRSLELAVRISTLVFTLIYSTNLFLLTTAPEEITEG
FT                   LENLMSPLRRFNVPVTEISLTLTLSLRFIPLVLEEVQNLARAVRTRAIDWQKLGIKKSL
FT                   NVWLTVVEKFLDNLLLRAEQIAIAMEVRGFTSPNQHQVRWHQLQLRWADLIALFLLIPF
FT                   WAARLVWGGL"
FT   mobile_element  62211..62417
FT                   /mobile_element_type="MITE:MaeMITEa002"
FT   CDS_pept        62435..62593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00830"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99904"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL8"
FT                   /protein_id="BAF99904.1"
FT                   /translation="MLPQETPSTESMPLAACHTKWLHTLHNLLPFAYGDSSVRFVPITP
FT                   YWISLST"
FT   CDS_pept        62658..65234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99905"
FT                   /db_xref="GOA:B0JFL9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003995"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL9"
FT                   /protein_id="BAF99905.1"
FT                   /translation="MTLQEGTYIWEYGDTTQALWFTASYNTVTNQWTVDMKKGSMDLNA
FT                   FWWSNGDSNADGNIVLSKADNSLNMNGTGIVWDGYDKISDTGLTGTEHNGSSLLTAGNT
FT                   YTYSYSKDQGVEIEALLAGGVTTLGVRATSVNGTDGIKAVDGQYVFVPYDTTPPTVTVN
FT                   IVDASLNDGDNNSLVTFQFSETVSGFTVGDVSVSGGTLSNFTQVDGNSYQATFTADDAV
FT                   ETTGSVSVAAASYSDVAGNQGGAGTDTVTIDTKNPTLAVDIVDASLNDGDNNSLVSFEF
FT                   SEDVAGFDNSDVSVSGGTLSDFTQVDGNSYQATFTADDAVETTGSVSVAAASYSDVAGN
FT                   DGGAGTDTVTIDTKNPTLAVDIVDASLNDGDNNSLVSFEFSEDVAGFDNSDVSVSGGTL
FT                   SDFTQVDGNSYTAIFTADDAVETTGSVSVAAASYSDVAGNDGGAGTDTVTIDTKNPTLA
FT                   VDIVDASLNDGDNNSLVSFEFSEDVAGFDNSDVSVSGGTLSDFTQVDGNSYQATFTADD
FT                   AVETTGSVSVAADSYSDVAGNNGGAGTDTVTIDTLNPTVGITFDNSPLTGQNFSTTITF
FT                   QFSEAVSGFAASDVTLTNGVLSNFTGSGSSYTATFIATNFQSPTGTVAVSNDYFDTPGN
FT                   QGAANSANIAMTVGGGPDPNDGPSGGGSVIGSGTIGADSITGSTGDDNLSGLDGNDTIN
FT                   GGDGNDTINGGTGADIISGGTGNDNIIGLGGFDLIYGGSGNDTINGSNGIDTIVGGFGN
FT                   DSLTGGGGDTFRFLSIYDQQDVITGFNDTIVFDITGASAFTSLGSGALGTTTYTGAIAG
FT                   GYLTYSGGVLSYDADGSAGSTFSPLAIVTLTGSPTLSNTNVLFQNL"
FT   mobile_element  complement(65350..66657)
FT                   /mobile_element_type="insertion sequence:ISMae9_1"
FT   CDS_pept        complement(65472..65642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00850"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99906"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM0"
FT                   /protein_id="BAF99906.1"
FT                   /translation="MATLVAIRHNPVIRKFYERLLTNGKLKKVALVACMRKLLVILNAM
FT                   IRDNKCWQAPA"
FT   CDS_pept        complement(65707..66408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00860"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99907"
FT                   /db_xref="GOA:B0JFM1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM1"
FT                   /protein_id="BAF99907.1"
FT                   /translation="MTEEKTWVGIDVSKEVLDIYVLPQGLTLQQPNSDVGVQSLIEQLH
FT                   PLSPSLVVVESTGGLERALVSGLQAATIPVAIANPRKVKGFATALGKAKTDKLDAQVIA
FT                   QFARAVQPQPQPVVAPQAQQLSDLVRRRQQLVEMQVAEKNRLSRASETVQLDIKAHIEE
FT                   IQQRIESLNEQIQSLAQQQADWQRKNEILQSVKGIGKVSSALCLAELPEMGTLWRKTDC
FT                   PAGRGRSYQPR"
FT   CDS_pept        66538..66699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00870"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99908"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM2"
FT                   /protein_id="BAF99908.1"
FT                   /translation="MSSTSVELDVHALFQNIGTQATKRYFLPRLGRVAYFSRYKRLYRQ
FT                   FVHRKFWV"
FT   mobile_element  67179..67359
FT                   /mobile_element_type="MITE:MaeMITEg001"
FT   CDS_pept        67539..68150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99909"
FT                   /db_xref="InterPro:IPR021751"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM3"
FT                   /protein_id="BAF99909.1"
FT                   /translation="MNQDNEISHLLDLMPASGRMMTRIVSKPESTKVIETNFPLPWQRG
FT                   VRPIQINFDLWRQLSRPQRDLVLLRAVSVLTAVKWFKPDLDRLIALAGMIGLTVETLQT
FT                   DAVGMAVAGGLTALAINRIWREKRSPQRELDADEAALKVAVRRGYTETEAAKGLLSAIE
FT                   TIAEIEGRSSLNFNELLRCQNLKKLANLSFVGVPDQVRQS"
FT   CDS_pept        68266..70377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="MAE_00890"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99910"
FT                   /db_xref="GOA:B0JFM4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029491"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM4"
FT                   /protein_id="BAF99910.1"
FT                   /translation="MAAIDSLEKALKYHFGYDQFRPNQRQIIEAALNNQDLLVIMPTGG
FT                   GKSLCFQLPALIKKGVTVVVSPLIALMQDQVTALADNGIGATFLNSTLNAKQVRERESL
FT                   ILQGKIKLLYVAPERLLSPSFLDFLAVIDNYLGLACLAVDEAHCVSDWGHDFRPEYRQI
FT                   KQVRQRFPSVPILALTATATQQVREDIIQQLGLRDTSIHIASFNRPNLYYEVQPKTSKS
FT                   YQQLYQYIKGQKGAGIVYCISRKTVDKVAEQLQKDGINALPYHAGMEDRERSNNQTRFI
FT                   RDDVQIMVATIAFGMGINKPDVRFVIHYDLPRNLEGYYQESGRAGRDGEPAKCTLFFSF
FT                   ADARKIEYFINQKTEQNEQQKARQQLRQVLDYAEGTECRRSRVLGYFGESFAGNCGNCD
FT                   NCRNGTNNQDWTIEAQKFLSCVARTGQKFGMMHIINVLRGGKGERITQYQHHLLSTYGI
FT                   GKDKTVEEWKRLSRSLVQQNILVETEDDFRILKLNQHSWEVMRKQRSVFIAVPQKANGQ
FT                   IVGDDNPNMVESDLLFERLRQLRKKIADSQGVPPYVIFHDSSLRLMAQSKPRNLGQFRQ
FT                   ISGVVHSKVQQYGDIFIAAINDFCQDSLPSTQFLTLQYYQDGLNAEEIARKRSLKVSTI
FT                   YEHLAKLLEAGYEIDINQLVSKNKQEYIRLVIKKLGDQSLKTLKENLGDNYSYEEIKLV
FT                   VAWQRRPRQ"
FT   CDS_pept        complement(70534..70674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99911"
FT                   /db_xref="GOA:B0JFM5"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM5"
FT                   /protein_id="BAF99911.1"
FT                   /translation="MNSAKIIAIITGAISILIAVAYLILVQILDFRSEMIPAPLEVIFP
FT                   G"
FT   CDS_pept        70954..71124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00910"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99912"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM6"
FT                   /protein_id="BAF99912.1"
FT                   /translation="MTRDSPCGSMYRLTSMVKLTIICYLNLYNQQNPCYNRQYMVIDQF
FT                   HPRHPHRHPQS"
FT   CDS_pept        71388..72836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="MAE_00920"
FT                   /product="ATP synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99913"
FT                   /db_xref="GOA:B0JFM7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFM7"
FT                   /protein_id="BAF99913.1"
FT                   /translation="MVATTETNVGKIVQIIGPVIDAEFPSGKLPRIYNALTVKGTNSAG
FT                   QNLSVTCEVQQLLGDNQVRAVAMSTTDGLVRGMDIVDTGAAISVPVGKCTLGRIFNVLG
FT                   EPVDEKGPVNVTETSPIHRPAPKLVDLEVTPTVFETGIKVIDLLTPYRQGGKIGLFGGA
FT                   GVGKTVIMMELINNIAIQHGGVSVFGGVGERTREGNDLYNEMIESKVINADNPEDSKIA
FT                   LVYGQMNEPPGARMRVGLSALTMAEYFRDVSKQDVLLFIDNIFRFVQAGSEVSALLGRM
FT                   PSAVGYQPTLGTDVGDLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDGTTV
FT                   LSRGLASKGIYPAVDPLGSTSTMLQADIVGDEHYGTARAVQSTLQRYKELQDIIAILGL
FT                   DELSEEDRLTVDRARKIERFLSQPFFVAEVFTGSPGKYVTLADTIKGFQMILKGELDSL
FT                   PEQAFYMVGSIDEAIAKGEKLKKG"
FT   CDS_pept        72912..73328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="MAE_00930"
FT                   /product="ATP synthase F1 sector epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99914"
FT                   /db_xref="GOA:B0JFM8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFM8"
FT                   /protein_id="BAF99914.1"
FT                   /translation="MSITVRVITPDRIVWDNVAEEVILPSSTGQLGILSGHAPLLTALN
FT                   IGVMRIRPGKDWENIAVLGGFAEVENNEIKVLVNGAELGSKIDKEKARAEYERAQTRLD
FT                   EVSKGDDRRKTIQAQQSWRKARARYQAAGGLVSV"
FT   CDS_pept        complement(73473..73796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf65"
FT                   /locus_tag="MAE_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99915"
FT                   /db_xref="GOA:B0JFF4"
FT                   /db_xref="InterPro:IPR006924"
FT                   /db_xref="InterPro:IPR038447"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFF4"
FT                   /protein_id="BAF99915.1"
FT                   /translation="MTVSSESKFILKVLWLDQNVAIAVDQVVGKGTSPLTAYFFWPRND
FT                   AWQQLQEELEAKHWIDESDRVDVLNKATEVINFWQELRNQGRQIPMADAQLKFPEVVFS
FT                   GSN"
FT   CDS_pept        73900..74304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="MAE_00950"
FT                   /product="mutator protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99916"
FT                   /db_xref="GOA:B0JFF5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFF5"
FT                   /protein_id="BAF99916.1"
FT                   /translation="MIPETDSLPCKQIGVAVIRDDRDLILIDRRLAKGLLGGFWEFPGG
FT                   KIEGNETVQECIKREVLEEIGIEIAVDSHLITIDHTYSHFRVNLQVYNCRYLSGEARAI
FT                   ECEEIRWVTIQELDNYTFPAANQEIIENLG"
FT   CDS_pept        74706..74942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99917"
FT                   /db_xref="InterPro:IPR021481"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFF6"
FT                   /protein_id="BAF99917.1"
FT                   /translation="MLNPSIRQEPRYEPAAVIPLKKDASIVEWLEKNNRMIPRDKIAEP
FT                   DLTLEEDVELSELMDVDDIGYDDDEDELVLDED"
FT   CDS_pept        74988..76055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00970"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99918"
FT                   /db_xref="GOA:B0JFF7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JFF7"
FT                   /protein_id="BAF99918.1"
FT                   /translation="MNANIFSAPIFKKPTGTHLLILLTGLLFLLVVFFQSTNSLLIPLM
FT                   ATTLISAGLGCQVVPMLRRLKMGQIMREDGPQAHLKKAGTPTMGGSFFVPVALIFALIW
FT                   SKFTPNVVAVALLTFVYMGIGWLDDWQILRYKSNKGLSPQMKLILQITGAVLFCLWMLV
FT                   NQVSTDITLWGRLVIPLGFFFWILAGFVLVAESNATNLTDGVDGLAGGTGAIAFLGLGI
FT                   IIAPSHPDLAIFCTCFAGACLGFIFHNRNPAKVFMGDTGSLALGGALAAVGLIAGHLWG
FT                   LFLISGLFFLESLSVIAQVIYYKATKGPDGKGKRLLKMAPFHHHLELSGWTETKIVGAF
FT                   YLVNALLVVLAIWSS"
FT   CDS_pept        complement(76056..76379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99919"
FT                   /db_xref="GOA:B0JFF8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFF8"
FT                   /protein_id="BAF99919.1"
FT                   /translation="MIELSPAAAREIERWSQSRRLTGSYLRLAVKNGGCSGLHYHLELT
FT                   PIAAENDRFYQSQGINIVVDPDSDRYLQILKLDYSEDLMGGGFRFTNANTQNTCGCGLS
FT                   FSA"
FT   CDS_pept        76941..77231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_00990"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99920"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFF9"
FT                   /protein_id="BAF99920.1"
FT                   /translation="MLNLSKDIHSLTEFKRNTTRFLEHLKQTKDPLVLTVDGKAALVVQ
FT                   DAESYQTLLEAAELVETLKGVKRGLEEMKQGKGKKAEEFFSELFDKLDSSP"
FT   CDS_pept        complement(77349..82640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99921"
FT                   /db_xref="GOA:B0JFG0"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG0"
FT                   /protein_id="BAF99921.1"
FT                   /translation="MTSTLLPLLPAVDDVLFDFAQSDGFWANLETAFGTSYDVVKATEL
FT                   RQQWQSRDFSQLPEIEVVNSSVLGSANGAYGISTNKIYLSESFFASASLDALVAVILEE
FT                   IGHYVDAQINRVDTVGDEGELFSHLVRGVNLTEAELTYIQTEDDRSVINLGGQFIGVEQ
FT                   TSPITLIVNTTIDENDGSATIGSGLSLRDAVTIANKSPNTPYIIKLKSGTTYALTYVNN
FT                   TTTGDRSLNTNGTITIETDGTALASIVNNASPISGENDYNSIISNSSQLGVTLNNLYIS
FT                   NKAGRGIDNDYGGTLTLNNSTITGNTATYGGGIDNDGTLTLTNSTISGNTGGGIHNWGR
FT                   GILTLTNSTITGNTATNFGGGIENDGTLTLTNSTITGNTATYSGGGIYNWGRGTLTLTN
FT                   STISGNTATGYYGSGGGIYNSTGTLTITDSAISGNTATGSGGGIENYGTLTLTDSTVSG
FT                   NTAAYDGGGIDNYGGTLTLTNSTISGNTATGSGGGIENYGTLTLTESTVSGNTAAYDGG
FT                   GIDNDGGTLTLTNSTIFGNTATRSGGGIFNSTGTLTITNSTITGNTADAGGGIYNGGTL
FT                   TLTNNILTNNNANLGGGIYNRGTWSSNSIISGHTANQVWYIDSDGDSTTSESSWINGQW
FT                   IANPIDPKYPNIYDDATYTALPPTPNPPPKPTISVSNARFDAPAGKVIFEVKLSSTYDK
FT                   PITVDYYTLDGSANSIDPNQLKDFNNVVKQTLSFFPGQTSKQIEITVLGSAPPTDQTFE
FT                   ILARDTAYRDWTDTDKGKEVDKIYDYSDLGYEGYRINKVFKDSSTGFDAFGLTSDEKFF
FT                   LVLANPLNANEFTSNSNNLLQDIANTSGGNNTAAYTAGQNLINQLTSANQSYTFTDGTI
FT                   YDLAKPPVLAIRGTEFSSGKDLLSDTETEGVGYNQFTNNKAAINQWLSEVSNPVSGLTL
FT                   KPNITGHSLGGALSQWVGGSYTGQLGKIVTFNSPGISQQPGINFNATNNLGVTHYITSA
FT                   DVVSIAGSTYLNGLWNLEKYSKLTSAITFEKHSVPVLNQTITRTNLSKPTDLTRKVANG
FT                   NTTDLSSYWFTYLPDADYFALQMMIRGLGSLPIPGIGLTGTYLAAALTYRGTTEKVRQA
FT                   IGIAIDGLGNISDAVTSAYNAAKSWTSDAWDAIIGQSDKKLGLSPSTANQSNSTQTLAS
FT                   SFLDTNSYQIATTATASQTIDNFWDAIPDWGDNAWQATTKWSGDAWNSIDEWTPQTWQA
FT                   TTTWTAADWDKPFFTISNPTIVENNSGTNNLVFKVTLSTTSTQTITVNYATADDTATAG
FT                   SDYTATTGTLTFTPGQTSQDIIISVNGDTAIEPDETFLINLSNPSNALITDNQGLGTIT
FT                   NDDGDNTSVTLAVSPSSVTEDGTANLVYTFTRTGVTTNALTVNYTLGGTATLNTDYTRT
FT                   GTNNTVTFAAGSDTATVTIDPTADTNVEDDETVTLNLAPGTGYTIGTATAVTGTITNDD
FT                   FSKLSINNVTVVEGKDNNAILTVTVNNPNPQPISVNYTTAPINAIANVDYTSKTGTITI
FT                   APNTSTATITIPILNDNLNEANETFAINLSNPVNATLSNNKGIVTISDTLTANVTTTLP
FT                   ANVENLRLIGSNNINGTGNAGNNKITGNSGNNQINGRAGIDTLTGGLGADTFIFQFGQS
FT                   TISTRDRITDFAINSDKIDLLTQAGNATSAPSNFSRAANSTVTTLQNLINQVFTDANGA
FT                   TTGNQGLGVNSAALVQVTTGAIAGTYLVINDSTAGFQSSNDLLINITGFTGTLPALGNI
FT                   PVGNFFV"
FT   CDS_pept        complement(83219..84229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99922"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG1"
FT                   /protein_id="BAF99922.1"
FT                   /translation="MNPTTANYDEPWKEALTEYFEAFLCFFFPEVHQLIDWTKIPESLE
FT                   KELKRITASAKTKKRFADKLYKAWLLEGQEVWILIHIEIQSQYEENFPQRMYIYNYRAF
FT                   DLYQKPVISLAILGDERVNWRPDSYNYTIAGCEVSLKFPTVKLLDYEESWSELEASSNP
FT                   FAIIVMAHLKTKATTGKLPQREQWKWKLIRGLYEKEFEREQIIKLFEIIDNMMTLSPEL
FT                   QSSLESKIKQFEEEKTMPLMSNMELRGRKIGEEIGELRGIERGKEIGKEIGALENARDF
FT                   VKKVLENRLGDIPGDIGQCLNDASVISVLEEMLKAALIVNSFEECRKSFSIIINK"
FT   CDS_pept        complement(84226..84573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99923"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG2"
FT                   /protein_id="BAF99923.1"
FT                   /translation="MTSTLLPSFPAVDDVLFNFAQSDGLSQANRVDSARNQRLTATVVF
FT                   LDAGVSDYQSLQAGVIPGVATVILSPNQDGIEQISAFLPQNPQITTTNSIIKSVRYAIA
FT                   LHSLRVSKQLK"
FT   CDS_pept        complement(84709..85728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99924"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG3"
FT                   /protein_id="BAF99924.1"
FT                   /translation="MNPTTANYDEPWKEALSEYFEAFLCFFFPEVHQLIDWTKIPESLE
FT                   KELKRITASAKTKKRFADKLYKVWLLRGEEVWILIHIEIQSQYEENFPQRMYIYNYRAF
FT                   DLYQKPVISLAILGDERVNWRPDSYNYTIAGCEVSLKFPTVKLLDYEERWTELETSSNP
FT                   FAIIVMAHLKTKATTGKLPQREQWKWRLIRGLYEKEFEREQIIKLFEIIDNMMTLSPEL
FT                   QSSLESKIKQFEEERTMPLMSNMELRGIERGKEIGKEIGELRGIERGKEIGKEIGALEN
FT                   ARDFVKTVLQARLGEVPLDVEQYLNKVSVLSTLQEIVKLAATANSLAEFKQSLAKINI"
FT   CDS_pept        complement(85782..86072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99925"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG4"
FT                   /protein_id="BAF99925.1"
FT                   /translation="MSSPLLPILPAVDDILFDFAESDGLSQANRVDSARNQRLTATVVF
FT                   LDAGVSDYQSLQAGVIPEVATVILSPNQDGIEQISAFLPQNPQITTIHLYY"
FT   CDS_pept        complement(86227..86724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99926"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG5"
FT                   /protein_id="BAF99926.1"
FT                   /translation="MIIISDTSPLSSLALVGYLSILKDIYTNVIIPQAVANELANLTEE
FT                   DIRIKATLSLEWIQVQQATNLELVACLRNEYNLDLGEAEAIALAWELKADELLIYERLG
FT                   RREAVRLGLSITGILGVLLIAKNRGLVSKVKPIMESLISQANFRISHQLYEEVLQTANE
FT                   LD"
FT   CDS_pept        complement(86721..86942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99927"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG6"
FT                   /protein_id="BAF99927.1"
FT                   /translation="MIKASGLSEDELLKEIVIMLFQQDKISLGKASELLGINQIKFQRL
FT                   LSERGICIHYDVAEFQEDIKHLKNKGWL"
FT   CDS_pept        complement(87226..88146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99928"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG7"
FT                   /protein_id="BAF99928.1"
FT                   /translation="MTNNIDHDRLFKELISIFFVEFIELFFPQLINYLDRDSITFLDKE
FT                   VFTDVTEGERYESDLVAQVKFRGKESFFLIHVEAQESSRKWFNRRMFTYFARFHEKFVL
FT                   PIYPIVIFSYSRPKRAAISQYVVDFPDFKVLEFNYQVVQLNRLNWRDFLNQPNPVASAL
FT                   MAKMNIAEKERAKVKAECLRLLITLRLDAARMQLISGFIDTYLNLNPVEEIQFQQEIST
FT                   FSQPVQEGVMQITTSWMRQGIEQGIEREKTLILRQLKRKLGEINPSLETKIMQLSIDDV
FT                   EVLGEALFDFSTVEDLINWLNTLTA"
FT   CDS_pept        88744..89253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxE"
FT                   /locus_tag="MAE_01080"
FT                   /product="putative bidirectional hydrogenase diaphorase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99929"
FT                   /db_xref="GOA:B0JFG8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG8"
FT                   /protein_id="BAF99929.1"
FT                   /translation="MQTANPRQTEKKEHPSGDKRFKVLDITMKRAGYNQSALIEVLHKA
FT                   QEAFGFLEEDVLLYVARALKLPLSRVYGVATFYHLFSLKPAGKHTCIICMGTACYVKGS
FT                   GKILEDIENAFDVKVGETTADGEISLVSARCIGACGIAPAVVFDGVVAPKQDSETVLAK
FT                   LQSFSQ"
FT   CDS_pept        89282..90889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxF"
FT                   /locus_tag="MAE_01090"
FT                   /product="bidirectional hydrogenase diaphorase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99930"
FT                   /db_xref="GOA:B0JFG9"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFG9"
FT                   /protein_id="BAF99930.1"
FT                   /translation="MDLQELLAVAEKEKTRQKSIRVHCCTSTGCQAANSLQIKKNLATA
FT                   VQEADLEDTVEVVGVGCMGFCGRGPLVEVDPQDLLYEEVTPESAASIIAALNGGKTEVQ
FT                   LGDSKHPFFSHQVKIVRENSGKIDPDRIEEYIAVGGYQSLYKALYEMTPAQVVEEITQS
FT                   GLRGRGGAGYPTGLKWATVAKQPGKQKYVICNADEGDPGAFMDRSVLESDPHLVLEGMA
FT                   IAAYAVGADHGYIYVRAEYPLAIDRLQKAINQAKKFGLMGSQVFESTFDFKVDIRIGAG
FT                   AFVCGEETALIHSIEGGRGTPRTRPPYPAQSGLDGCPTLINNVESYANIAAIIREGAAW
FT                   YANIGTASSKGTKIFALTGKIRNNGLIEVPMGITLREIVEEMGGGVPDGQVKAVQTGGP
FT                   SGGCIPANLLDTPVDYESLAKLGSMMGSGGMVVMDDTTSMVEVAKFYMEFCREESCGKC
FT                   IPCRTGTVQMFELLAKIIARKADIHDLENLEHLCQMVKETSLCGLGQSAPNPILSTLKY
FT                   FKEEYLALLQEIKHPVSV"
FT   mobile_element  complement(90892..92322)
FT                   /mobile_element_type="insertion sequence:ISMae15_1"
FT   CDS_pept        complement(90901..91311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01100"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99931"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH0"
FT                   /protein_id="BAF99931.1"
FT                   /translation="MVKNRKLSRAISDLGWRSFRDMLSAKSDKYGRDFRIISRWEPTSQ
FT                   RCSCCGNIGGKKALNIREWECLFCGTFHDRDVNAAINIKVAGGQSETSKNGRRGKCKTS
FT                   VKEAASREASTQPKIVQLSLFDLPVITVRPRR"
FT   CDS_pept        complement(91472..92146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01110"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99932"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH1"
FT                   /protein_id="BAF99932.1"
FT                   /translation="MKARYQYRIYPTDQQKRLLSQLFGCVRVVWNDTLAYCQELYRQGE
FT                   KKPKYTELSKRLTQVKKTEEKQWLTEVSSIPLQQSLRDLETAYSNFFASCKGERKGKKV
FT                   KPPKFKKRKSKQLARFTDNGFTVNQHCVTLAKIGDLRIVWSRPLPSKPSSVTVIKDASD
FT                   RYFLSFVVEIQSEILPNNGESVGIDLGIATFATLSTGEKIDAPKPLKKRLKRLRRASEK
FT                   PF"
FT   CDS_pept        92196..92627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01120"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99933"
FT                   /db_xref="GOA:B0JFH2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH2"
FT                   /protein_id="BAF99933.1"
FT                   /translation="MSSRLRKERNSVSDLKIHLVCVTKYRRKVFTGKSLTLVEKSFKSL
FT                   TLVEKSFREVAEKMNFQILEFNGESDHVHALIEYPPKLSISVMVNSLKGVSSRRYGQAG
FT                   YPKPYGKDALWSPSYFVSSVGGAPLEVLKCYIKNQEKPS"
FT   CDS_pept        92776..93261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99934"
FT                   /db_xref="GOA:B0JFH3"
FT                   /db_xref="InterPro:IPR005691"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH3"
FT                   /protein_id="BAF99934.1"
FT                   /translation="MTWRGSTDTKDRIFAALVYLLPLYSAFAFGIFIFQQIPFLGAALA
FT                   IALYPLAFLYSSLGSFGSLIIFFVLFFAVVRNPRISHFIRFNTMQAILIEILVYLLGLV
FT                   LGFVARGLGANLVVETLFNVVFLGAFAACVYSIIQSVIGKYADIPTISEAAYSQVGG"
FT   CDS_pept        93335..94708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99935"
FT                   /db_xref="GOA:B0JFH4"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH4"
FT                   /protein_id="BAF99935.1"
FT                   /translation="MSPFKQTLRELNAQKGKIAASVGRKTPKRVNRWFKWLSPGLFVKR
FT                   WLLISLSGVFLTSFGLAIWVKLTPVNRFLEFVSQALETIARLVPNSVSGPLAVLLGVFL
FT                   LFWGQSRTVETITEALQPDASEELVDLLRTHRRLHRGPKIVAIGGGTGLSTLLRGLKQY
FT                   SSNITAIVTVADDGGSSGRLRREMGILPPGDIRNCIAALADEEKLLTELFQYRFHAGDG
FT                   LSGHSFGNLFISAMTEITGDLEQAIDASAKVLAIRGKVLPATLTDVSLWAKLADGRIIE
FT                   GESKITEAMGQIRQIGCHPADPVALPAALAAIKEADYIIIGPGSLYTSIIPNLLVPAIR
FT                   QALAQVTVPRVYVCNIMTQPGETDNYSVADHIRAIEKVCEERVFDAVLAQRTAPSPQSL
FT                   QLYAQEHSHPVFLDREEVGKMGYRIVLANVMAEDEVTAKVSHDPQRLARVLWRWYAKK"
FT   CDS_pept        94882..95190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99936"
FT                   /db_xref="GOA:B0JFH5"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH5"
FT                   /protein_id="BAF99936.1"
FT                   /translation="MHYSTKSNQETGATVYSPSDGSELIPAEVKLDINGQNYQSLNIPL
FT                   PEGYTVDDEGIINNYGSEPKIYLSKSPSLEQQKWYILQGVGAVLLVALVLLITFSVS"
FT   CDS_pept        95443..95655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01160"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99937"
FT                   /db_xref="InterPro:IPR021481"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH6"
FT                   /protein_id="BAF99937.1"
FT                   /translation="MKFNPSLSQEPRYQAIPVMQITSKETLLHWLERTGRLKLRQSDAH
FT                   PDLQILEELDDIIDPDNYAIEEEEE"
FT   CDS_pept        95797..96957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99938"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH7"
FT                   /protein_id="BAF99938.1"
FT                   /translation="MKFQLSNIQEIKKVVSTKKTALIYCENQFGRVDGKTAAGLIRQSE
FT                   IYTIVGVLDSSLAGKDAGEALGDKKNHIPIFANLQTALEKLRDVPNCYIYGKAPLEAFI
FT                   PPLERLLILEAMAQGMEIINGLHQFFSEDLEFREQASQYGVQITDIRKPPQLADLHVFT
FT                   GQISQVNIPVIAFLGTDCACGKMTTAVAVNQTLQGLGIKSVLVATGQTSLMQGARYGVS
FT                   IDALVSQFVIGEIENAVVQAFEQEKPDIILVEGQSSLSHPAFMSSVGILKGSRPDGIIL
FT                   QHPPARKFRCDFPHLAMPKLQEEISLIEAISPTKVIAIAINHENLTAAATERIIAKYER
FT                   DFQLPTTDVLLHGCEKLVQALCDRFPKLNRKIKGEILAAIPAIGSK"
FT   CDS_pept        96962..98047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01180"
FT                   /product="putative amino acid racemase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99939"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH8"
FT                   /protein_id="BAF99939.1"
FT                   /translation="MKDLLPRIEISLPKIRHNARLLCQFYGSKGLSVMGVSKAILGDPS
FT                   IALAMIQGGVNFIADSRIENILKMKQAGIVTTFVLLRTALSQAESVVNIADISLNTELA
FT                   TIQELSYYAQEKQKIHRIIIMTELGDLREGVLPKDLVKFIKKTLAFPFIKIIGLGCNLA
FT                   CYGGIKPDSHNMSKLSVLTDTIEQEFLIKLPIISGGNSANYQWYQKSSEVGRINNLRLG
FT                   ESILLGCETVNRQVIPGLYTDAFRLIAEVIESKDKPSLPSGEIGRDAFGNVPSFIDQGI
FT                   HRRVIIALGRQDILISGLQTSQEIKILGSSSDHLVLDSHNKRLKVGSEVSFNLDYGGLL
FT                   TAMTSPFITKSYALNAVAQLS"
FT   mobile_element  complement(98064..98269)
FT                   /mobile_element_type="MITE:MaeMITEa003"
FT   CDS_pept        98097..98258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01190"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99940"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFH9"
FT                   /protein_id="BAF99940.1"
FT                   /translation="MWGVGCGVWGFTSFEVANYLIFREKVPKFPPDHSQIQYFLIDKRS
FT                   KSLTQQGF"
FT   CDS_pept        complement(98396..99133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01200"
FT                   /product="amino acid transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99941"
FT                   /db_xref="GOA:B0JFI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI0"
FT                   /protein_id="BAF99941.1"
FT                   /translation="MDYLLEVEQVYAGYVQDLYILQGVNFRIAPGELVTVIGPNGAGKS
FT                   TLAKTIFGLLKPSAGTITFKGQNIAGWKSNQIVPLGMGYVPQIANVFPSLSIEENLEMG
FT                   AFTSKKAIKPLKERIYAMFPRLLERRRQKAGTLSGGERQMLAMGRALMLEPDLLILDEP
FT                   SAALSPILVTSVFEQIKAINQTGTAIILVEQNAKKALMMSDRGYVLESGQDRFQGSGQD
FT                   LLNNPKVGELYLGAAYHDAKRDD"
FT   mobile_element  complement(99279..99462)
FT                   /mobile_element_type="MITE:MaeMITEb001"
FT   CDS_pept        complement(99472..99696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01215"
FT                   /product="4Fe-4S type iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01215"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48267"
FT                   /db_xref="GOA:B3DF82"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF82"
FT                   /protein_id="BAG48267.1"
FT                   /translation="MPHSIVTGTCEGVADCVSACPVACIHPGPGKNVKGTDWYWIDFAT
FT                   CIDCGICLQVCPVEGAILPQERPDLQKTP"
FT   CDS_pept        complement(99792..101477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01220"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99943"
FT                   /db_xref="GOA:B0JFI2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI2"
FT                   /protein_id="BAF99943.1"
FT                   /translation="MNPSFNNSIPVQRIKVSVIVSTYKSAEFIWGCLEDLVTQTLYEKG
FT                   EVELIIIDSASPENEGEIIQEFQENYPNIIYQRTRERETLYRAWNRAIKLARGSYITNG
FT                   NTDDRRCFNALEIMANYLDNNREISLVYADQLITTLKNDTFATTPALKHWNWPNYSYQQ
FT                   MRQGCCVGSQPMWRKMLHDKYGYFQENFRCAGDYEFWLRIGIQGEKMALIPEILGLYYL
FT                   NLQGLEHGSNGQALQEHYQVCKIYKIPHPDIKDIEIKPNPVKMEDLGIILQEDEREKLQ
FT                   TIQAISRKRCPIIVIDGVIFQLEQRKLARIWSSILEHWSQLEFSQHIVILDRNNTAPRW
FT                   EEFKYWPAESYDYNCTGKDARKIQAICDRLQANLFISTFYTSPLNTPSLLLLASELQQK
FT                   NGNLTVDLEKHYAILSASRIIAFSSDIAQDLRKSYPKINPEKIDIIELFEVNQKIAEEI
FT                   SNFLWYALSEGNESSQHQVWLELRKLQEAQQTMYLKQQQDYHTMQGMGISLKELDNNHN
FT                   YLQKNNQELREEINYLSSRKGIVKTLSKTSILLLAKIKKKLPIF"
FT   CDS_pept        101675..102892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="MAE_01230"
FT                   /product="tyrosyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99944"
FT                   /db_xref="GOA:B0JFI3"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI3"
FT                   /protein_id="BAF99944.1"
FT                   /translation="MTVSSSLDWLTRGTSDLFPHQPDSQDPRENLTQLLQTTDRPLRIK
FT                   LGIDPTGSDIHLGHSIPFRKLRAFQDAGHVAVVIIGDFTARIGDPTGKSEVRKQLTSEE
FT                   VRANAENYLAQLRPILDFNTPNRLEIRYNSEWLGKLDLSQILELLSTMTVGQMLAKEGF
FT                   SERYDQEKPIFLHEFLYPLMQGYDSVAVEADVELGGTDQKFNIVVGRDLQKYFGKTPQF
FT                   GLLLPILIGTDGSQKMSKSLNNYVGLRESALSMYSKLEKTPDALLKDYYELLTNLPLDA
FT                   MASNPREAQKQLAIEVVAQFHGKEEALKAQKTAQEIVLQGNTAAAASVPEFSLAAVTFP
FT                   LKLFYLLSATGLCKSSGEGRRQIQGGAVRIDSEKITDVDKSFETAEALTGKVLQVGKNK
FT                   FIRFVA"
FT   CDS_pept        complement(102909..103145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftrV"
FT                   /locus_tag="MAE_01240"
FT                   /product="ferredoxin-thioredoxin reductase variable
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99945"
FT                   /db_xref="GOA:B0JFI4"
FT                   /db_xref="InterPro:IPR004207"
FT                   /db_xref="InterPro:IPR008990"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI4"
FT                   /protein_id="BAF99945.1"
FT                   /translation="MKVGDRVRVIESVVVYHHPEHKSDPFDVKGLEGEVKGIVTEWRGR
FT                   PVSANLPVLVEFSKKFKAHFRDFELEILEKAAE"
FT   CDS_pept        103405..104208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99946"
FT                   /db_xref="GOA:B0JFI5"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI5"
FT                   /protein_id="BAF99946.1"
FT                   /translation="MRYFLAGLKPFAQPLFWLPLGIFSLALIGLWVYQQNPEWLGSVLD
FT                   TPGMSLEEREIRANQITDTPLPTAVPLPAIPAHNNTARLNKPASTQPFDPLNTNPDNNQ
FT                   KPSLFTPLMPQPKQNQAPKASKSLQPIQVRPISGDTSNYPLQREIENRSRTNNWNNFPN
FT                   PNPGGSPNQVNPQGNYSPEQQNVQALPSRNNANPNPVPGSSNQSNYYQPPVYQAPVYGS
FT                   QPNVTGYPNQGMPPNNNGTPNQVPPQSINRGFSIQQPINTRSSGY"
FT   mobile_element  104226..104379
FT                   /mobile_element_type="MITE:MaeMITEa004"
FT   CDS_pept        complement(104415..105305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01260"
FT                   /product="alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99947"
FT                   /db_xref="GOA:B0JFI6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI6"
FT                   /protein_id="BAF99947.1"
FT                   /translation="MQQILGLETQPKIWHWRGFKITYQSAGETGPAIVLVHGFGASWGH
FT                   WRKNIPVLGEKCRCFALDLIGFGGSDKPEPKNEIDYTFETWGAQIADFCREVVGGPAFL
FT                   AGNSIGCVAIMQAAVDYPDFVLGVAAINCSLRLLHERKRGELPWYRRLGADFAQIILKN
FT                   KAIGAFFFQQIAKPQTVRKILLQAYRRSEAVTEELVEIILKPARDQGAIEVFLAFTAYS
FT                   GGPLPEDLLPILPCRAILLWGSEDPWEPLALGQELARFPTVKQFIPLAGLGHCPQDEAP
FT                   EIVNPILLDFLQAPI"
FT   CDS_pept        complement(105354..105563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01270"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99948"
FT                   /db_xref="GOA:B0JFI7"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI7"
FT                   /protein_id="BAF99948.1"
FT                   /translation="MVAGCGVWGVGCGVWGFIDFQVVNYLIFREKVQEFSPRSPQWLAL
FT                   FEGKKVQKSYPTRFLDLFSRPYLT"
FT   mobile_element  105369..105587
FT                   /mobile_element_type="MITE:MaeMITEa005"
FT   CDS_pept        105793..107148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01280"
FT                   /product="putative excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI8"
FT                   /protein_id="BAF99949.1"
FT                   /translation="MRIKQITVKHLFGIFDHTINLNMEERITIIHGKNGFGKTSILRLV
FT                   NGFFNLKYSDIRAIPFQKFTIIFDDNSFVDVVKASTSKNKKSNVRPEIDFNFTSSDQKE
FT                   KLTFSPNLLDGRKIPLLTGMIADVIPGLDRVGSEKWLYTPTKEILDLEDIYERFGEYLP
FT                   KQFQQEYPDWLNKIRDSINVRFIESQRLLDISNSAKNGRTIRMPMTLYSVASYSEDLAE
FT                   NIQTKLAEYGQLSQTLDRTFPARVVQKKASLTDDELREKIDQLESERNQLISAGLLKKD
FT                   EDSNFQVKDSIDDSTRKLLSVYIEDVDKKLNVFNDIYPKVELFKNIINKKYSFKSVTID
FT                   QSKGFIFTTQEGEVLSPTDLSSGEQHELVILYELLFKVKPNTLILIDKPEMSLHISWQQ
FT                   EFLKDLQEITKLSGLDILMATHSPDIINDRWDLTVELEKPKQKSKDERTDNT"
FT   CDS_pept        107126..107968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99950"
FT                   /db_xref="InterPro:IPR029492"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFI9"
FT                   /protein_id="BAF99950.1"
FT                   /translation="MREQITPDRIANSIRLLRSDHEGVFLIVEGHSDKLIYERLVNKQE
FT                   VRVTIASGKNNAIKALSILEKENFCRVVAVIDADFSRIEQQISDSNNLFLTDEHDLEMM
FT                   LIKSAAFDKLLKERGSEEKIAAFSKDIRETLLKLGQEIGKLRLLSLRNELDLKFEGLKF
FT                   GKFIDKKNLSIDIDKLIISIKNHSQKLSLDEQQIKQYLSVISDENHDPWQLCCGHDFIS
FT                   ILAIALCKVLGTWNANDVKKEDWERELRLAYELSYFYQTQIYQLMVNWQSNNHPYQIF"
FT   CDS_pept        108332..110500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="MAE_01300"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99951"
FT                   /db_xref="GOA:B0JFJ0"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ0"
FT                   /protein_id="BAF99951.1"
FT                   /translation="MAKASTVTSEIDLKDSQYYFNRELSWLEFNRRVLYEALDPRTPLL
FT                   ERLKFTAIFCANLDEFFMVRVAVLKQQVEANVAVLSADGRTASEQLTEISKRLRPLVQQ
FT                   QDRLFEHTLKNLLVEQGIHLINYVDLHQEQRNYLHDYFEQNIFPVLTPLAVDPSHPFPY
FT                   ISNLSLNLAVVVRDPDTDKELFARVKVPQVFPRFLALPKELRHQDGKASIWTGVPLEQV
FT                   VMHNLEALFPSMIIQECYPFRVTRNADISVEEDEADDLLLAIEEEVRKRRIGKSAVRLE
FT                   IHSSTPSNIKNRIMRDLGLEEIDVYDVDGLLGHKDLFYFMSLPCPELKDPPWNPVTPTV
FT                   LQGLREIVDGNEDGILEQDGEDIFTLIRNNDILVHHPYHSFSASVQQFIAQAAYDAHVL
FT                   AIKMTLYRTSGDSPIVNSLIAAAENGKQVAALVELKARFDEENNITWAKKLEQAGVHVV
FT                   YGLVGLKTHTKVVLVVRKEGDKIRRYFHIGTGNYNPKTAKLYTDLGLLSCREDLGADIT
FT                   DLFNFLTGYSRQQSYRKLLIAPVSLRKRMLAMIDREAKNCKNGGTGRIVAKMNSIVDKP
FT                   IIEALYAASRAGVQIDLIIRGICCLRPGLPEISENIRVISIIGRFLEHSRIFYFYNDGQ
FT                   EEVYIGSADWMTRNLTRRVEAVTPIDEPAIAKELEEILGIMLSDNRQAWELQSDGSYIQ
FT                   RRAANQGQESSTHVILMEKALKSAGISQ"
FT   CDS_pept        complement(110760..112484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01310"
FT                   /product="flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99952"
FT                   /db_xref="GOA:B0JRA8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRA8"
FT                   /protein_id="BAF99952.1"
FT                   /translation="MVATPVKTKRLTVQVADLTADTTAIRSLDWDRDRFDIEFGLQNGT
FT                   TYNSYLIRGEKIALVDTSHEKFRQLYFDSLNGLINPQEIDYLIISHTEPDHSGLVRDIL
FT                   QLAPNITVVGSKVAIQFLENLVHHPFQRQLVKNGDQLDLGNGHILEFVNAPNLHWPDTI
FT                   FTYDHGSGILFTCDAFGMHYCSDDLYDEQLSAIEPDYRFYYECLMAPNARSVLAAMKRM
FT                   EPLGNINLVANGHGPLLKHNVTELLTHYRDWSQAQTKAEKTVAVFYVSDYGYSDRLCQS
FT                   IAKGITKTGVAVETLDLKSADPQEVKELASSAVGIVIGTPPVSGIHAQEITGNLGTILA
FT                   SVNPKQYLGMFESQGDDDEPILPLFNKFREVGLTKAFDPIRSAETPNESLYQRCEEAGT
FT                   DLGQLLTQEVKVKQRKSLDTDLDKAIGRISGGLYIITTKKGDRSGAMVASWVTQASFDP
FT                   PGFTVAVAKDRAIESLLQVGDQFILNILEEGNYQTLMKHFLKRFGPGEDRFAGVDTRTA
FT                   NNGSPILADALAYLECEVVSRMECADHWIVYNKVADGRVSKPDGLTAVHHRKVGNYY"
FT   CDS_pept        complement(112823..113149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99953"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRA9"
FT                   /protein_id="BAF99953.1"
FT                   /translation="MEQSKGKSSRQRGVILTSIGYQKLHRAKVNWEIKQNTRCTLDILS
FT                   QHTGLTANTLSKIFSRSVAVDKRSLWVCFSAFNLDLDGQDYLSTFTLAYKDRQFSHWGI
FT                   NMNC"
FT   CDS_pept        complement(113393..113770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99954"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB0"
FT                   /protein_id="BAF99954.1"
FT                   /translation="MIYLDTHIVVWLYAGLTAKLSDCAKHLINENELYISPIVRLELQY
FT                   LYEIGRITEKSDDIVLELVSCLDLKVCKKDFNLIINQSVIINETRDPFERLIVSNASVD
FT                   NHILLTKDYHILNHYENAVWD"
FT   CDS_pept        complement(113757..113993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01345"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48268"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF83"
FT                   /protein_id="BAG48268.1"
FT                   /translation="MKSVTSSKLQNNLDQLLDEILNTGKPLEIDRNGKRLIISPVETVD
FT                   KLQKLIYRPQAIIGDPDDLVQISWEQEINLDLP"
FT   CDS_pept        complement(114133..114567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99956"
FT                   /db_xref="GOA:B0JRB2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB2"
FT                   /protein_id="BAF99956.1"
FT                   /translation="MKVIFADTFYWIALINPRDNWHTIALDYAQKYADDYLITTDGIID
FT                   ETLNYFATKGAIMRRKALATYLQICQESNMEIISYTPQLRQAGFQLFDERPDKGYSLTD
FT                   CISMIVMKQRGIIEVLTHDKHFTQENLRILFQDSNFNNLT"
FT   CDS_pept        complement(114570..114797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99957"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB3"
FT                   /protein_id="BAF99957.1"
FT                   /translation="MTAKEQLLQEIETASDETIHQLLDFLHQTQTAKPKQPFWQFIEEL
FT                   TADIPPEVLETLPTDGAEQHDHYLYGTPKQ"
FT   CDS_pept        complement(114879..115178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01370"
FT                   /product="plasmid stabilization system protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99958"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB4"
FT                   /protein_id="BAF99958.1"
FT                   /translation="MNQYIISTEAIRDMEQILDYLANTNINAGEKFLEEFSKKCRYLSQ
FT                   FPLMGRSYREIRPYLRGLPMKNYIIFYRLTEQGLEIMPFIKGERDLEAFFFENP"
FT   CDS_pept        complement(115185..115442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99959"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB5"
FT                   /protein_id="BAF99959.1"
FT                   /translation="MKLTLKPEHQKLIEAKLDTGHYANPDEVIAEALQLLSKRDQYQQW
FT                   VEDIGQKIDIAAEQLDRSEGIDGETAIAQLKARLQKNCEA"
FT   CDS_pept        115896..116060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01390"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99960"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB6"
FT                   /protein_id="BAF99960.1"
FT                   /translation="MRFTWVERDGSSSMIMMARTFCALGFSPSHWLRSCEASAYGIALS
FT                   GQVIMFEHG"
FT   mobile_element  116105..117341
FT                   /mobile_element_type="insertion sequence:ISMae23_1"
FT   CDS_pept        116167..116790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01400"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99961"
FT                   /db_xref="GOA:B0JRB7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB7"
FT                   /protein_id="BAF99961.1"
FT                   /translation="MPAKDFLDLEEKKNLQKALKEEERAEVRERILMFLLLNDGKTQRE
FT                   IADFIGCSLKTVAHWCVHGDPNNLESLEDGRKNGNHKKATEEYINLLLKIVDEDPKEFG
FT                   YEFGRWTAARLAEHLEKETGIKLSGSQVRRILRRKKYVYIWAKYSLEDKQDKKLRKAFK
FT                   EKLDEYLRLAKEKPESIQVWFWDGAFKVATQVRHRVPLMNVDLV"
FT   CDS_pept        116916..117326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01410"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99962"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB8"
FT                   /protein_id="BAF99962.1"
FT                   /translation="MSKKGNSETFHEQLKKLHEEIRQEWINLGNLPEDFREKGPKIIII
FT                   LDNASYHKKKDVIEQVEKELPNIRLEFLPAYSPDYNLIELVWHSAKEYIANREFENKEE
FT                   LEKVVNQLLNEGGLIIKWSRKLKNKGNAVNVT"
FT   CDS_pept        117443..118597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01420"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99963"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRB9"
FT                   /protein_id="BAF99963.1"
FT                   /translation="MWINFDQLLDLPNVTVVNYQKIDETIFLKLALLNETIECPNCHQT
FT                   LDRINQTEYNLVRDLSILGNRVYLEVPRRQFHCQKCQKYISERLSFMRLRQHHTIRYES
FT                   MIYERVKNCSIEEISREEGLGWSEVELIFNHCAKELEKEEWEAPERISLDEFSNLKGHK
FT                   DFITTVVDLDKKILLDVIKGHKQEELMEALKAQPEAVREKVKEVSVDMWSGFTAVIKEL
FT                   FPNAKIIYDRFHVMAIINDELNKLRKLMGVHEKGLPHLLWKNKEDLKDEQKQQLEVILK
FT                   EHPCLGIAWEMKEEIRQIYQSSRTFRGAERKLEKWIRIGGILYESGASMIQKHLQGICN
FT                   YFENHTTNGLIEGMNTKIKLIKRMSYGFTNFQHLRLKLFACFNS"
FT   mobile_element  117710..118629
FT                   /mobile_element_type="insertion sequence:ISMae37_1"
FT   CDS_pept        118839..119201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01430"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99964"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC0"
FT                   /protein_id="BAF99964.1"
FT                   /translation="MWINFDQLLDLPNVTVVNYQKIAQTIFLKLALLNETIECPNCHQT
FT                   LDRINQTEYNLVRDLSILGNPVYLEVPRRQFHSQKCQKYISERLSFMRLRQHHTIRYES
FT                   MIYERVKNCSIEEISR"
FT   mobile_element  119106..120026
FT                   /mobile_element_type="insertion sequence:ISMae37_2"
FT   CDS_pept        119406..119993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01440"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99965"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC1"
FT                   /protein_id="BAF99965.1"
FT                   /translation="MEALKAQPDAVREKVKEVSVDMWSGFTAVIKELFPNAKIIYDRFH
FT                   VMAIINDELNKLRKLMGVHEKGLPHLLWKNKEDLKDEQKQQLEVILKEHPCLGIADEMK
FT                   EEIRQIYQGCRTFRGAERKLEKWIRIGGILYQSSASMIQKHLPGICNYFENHTTNGLIE
FT                   GMNTKIKLIKRMSYGFTNFEHLRLKLFACFNS"
FT   mobile_element  120045..122306
FT                   /mobile_element_type="insertion sequence:ISMae29_1"
FT   CDS_pept        120122..120571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01450"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99966"
FT                   /db_xref="GOA:B0JRC2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC2"
FT                   /protein_id="BAF99966.1"
FT                   /translation="MPKKKYIVELTDSERTELEQLTKKGKIAAYKMNHARILLLADVNQ
FT                   QEGGWTDSKISEALNVAQATIERVRQRFVESGIESSLTRKKQEHRRAKIIDGEKEADLI
FT                   AIACSETPTGRAKWTLQMLADKMVELEYVEKISRETIRKTLKKMN"
FT   mobile_element  120654..121692
FT                   /mobile_element_type="insertion sequence:ISMae26_1"
FT   CDS_pept        120726..121169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01460"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99967"
FT                   /db_xref="GOA:B0JJR2"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JJR2"
FT                   /protein_id="BAF99967.1"
FT                   /translation="MRPYSVDFRQKIIDVWKKEKISIRGLAQRFDVAKSFIQKLLKQHK
FT                   ETGDIRPRPQGGSPPTKLNSEQLIILIEIIEANNDATLEELSDLLYEKTQVKVSRATLG
FT                   RLTQKLNYSFKKKHYTRRKKKVTGYSKKEWNTGQKFGKLRHQN"
FT   CDS_pept        complement(121213..121416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01470"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99968"
FT                   /db_xref="GOA:B0JRC4"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC4"
FT                   /protein_id="BAF99968.1"
FT                   /translation="MIRQSPSLIFGSTSFRINPSNVTASTAPYMLTDATTFSKLIALII
FT                   EIFLPLFCGFLPRALRPIKALA"
FT   CDS_pept        121415..121675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01480"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99969"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JME6"
FT                   /protein_id="BAF99969.1"
FT                   /translation="MDNAKIHLGEMVREIIEQEKARLIYLPPYSPEFSPIENFWSKVKA
FT                   TLRKLKARTYKDLIEGIELAMLEVTQKDIRNWFTHCCYCTS"
FT   CDS_pept        121925..122296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01490"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99970"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC6"
FT                   /protein_id="BAF99970.1"
FT                   /translation="MKYLVDERYPDAQKIRVIQDNLNTHVKASLYKAFEPEEAKRILDK
FT                   LEFHYTPKHGSWLNMAEIELSVLNRQCLERRIPDMDSLKQEIKAWEENRNEKSNSVDWR
FT                   FTTADARIKLKKLYPSIQT"
FT   CDS_pept        122392..123021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99971"
FT                   /db_xref="InterPro:IPR024510"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC7"
FT                   /protein_id="BAF99971.1"
FT                   /translation="MAIQDDANKQLGSLPFGNIIGGPLVAAIEAQAKAARSSVDFIQSV
FT                   AYKPLAVGQDGTTDPNAVRELQTVEFVYESGDKNVKLSVPLLSIVPIPYIRIDDMTIQF
FT                   KANISAETASQDTTTTGTNTNVNANVTGRYGWGPAKVEASFNASYSAKKDSTSAANSKY
FT                   SVEYTMDIYIHAVQDDMPGGMVEVLKILKESIKGIPPKTDETTPTS"
FT   CDS_pept        123219..123779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99972"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC8"
FT                   /protein_id="BAF99972.1"
FT                   /translation="MAKLNQVIGAILTEITKAQATSDAYLRDLKASYRENPFLKLLSVP
FT                   RIEVRDVTVDLKFAILTGEALPSGKVVIYADGSYQGASQELAEGNYDINDLTIGNDTLS
FT                   SLKIPQGIKVTVYEHRGFSGRSKVFVEDTPWVGDDFNDLTSSIKVEKISIDSMDIEVNT
FT                   DYLEKLSETAISSISIQLDVAST"
FT   CDS_pept        123822..124133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99973"
FT                   /db_xref="InterPro:IPR024510"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRC9"
FT                   /protein_id="BAF99973.1"
FT                   /translation="MSDITDVPLYQIIGAPLLALVQGETQAAQATARFIQEIGFETSPD
FT                   EPLQFGRLKTLTFRYSKISVGGTITELEVEIPVLSTHIPHPKCHNVSKEEGARVKILI"
FT   mobile_element  complement(124061..126137)
FT                   /mobile_element_type="insertion sequence:ISMae31_2"
FT   CDS_pept        complement(124309..125967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01530"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99974"
FT                   /db_xref="GOA:B0JND7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JND7"
FT                   /protein_id="BAF99974.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYNKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAELELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        126308..126502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99975"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD1"
FT                   /protein_id="BAF99975.1"
FT                   /translation="MVAFRAGLARQDSKSAMKINIKAGQADTPVGLLTIFRLLDQGISS
FT                   REVKDNQTPPSEGSGSSAT"
FT   mobile_element  126567..126750
FT                   /mobile_element_type="MITE:MaeMITEh001"
FT   CDS_pept        complement(126676..126984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01550"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99976"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD2"
FT                   /protein_id="BAF99976.1"
FT                   /translation="MIALRSFGHYLHCCLVSSTSLVASYRLRIKLRLSADFSLSTCKAN
FT                   PHIGQTIGSPESNIGIVVGIVKLHSGQGTPFWLVGLRRFRSAKKAQTITGQRVNLDL"
FT   mobile_element  complement(127420..128842)
FT                   /mobile_element_type="insertion sequence:ISMae36_2"
FT   CDS_pept        complement(127447..128661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01560"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99977"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM72"
FT                   /protein_id="BAF99977.1"
FT                   /translation="MILDKFLNLKGTCIQGYLHLENIGIVCRIESKNQKATCPRCGLES
FT                   DKLHQNHRHLVKDLPISGQPVYLQVNRRQFKCDNCQRPFSEELDFVAKKRTYTKRLAAN
FT                   ILEQLKEGDILNVSRINDVTEEEIQRMIEDIAEEITEPDLSELKRLGIDEIALVKGQKN
FT                   YCAVLVNLDTGKLIAILEKRTQEELRETLTGWGKEVLEQIEEVSIDLWLPYKNLVKELM
FT                   PSAEVVADRFHVMKQINQELDEQRRAEKRAVEAQKNKKQKAEKEAKLEVLKRSKYSLLK
FT                   NEEDLTEPQKIKLEAIKEKFPNLKKMQELKEEFRKIYETSENPTEGMLSISEWLAKSSS
FT                   VFTKSCQTIRNWFGEIISYFERRTTNGVVEGINNKLKLIKRRGYGFRNFRNFWVRSMLS
FT                   WHLVC"
FT   CDS_pept        129011..129658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01570"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99978"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD4"
FT                   /protein_id="BAF99978.1"
FT                   /translation="MIEQKLIVGRFIDLPYPAVAPPGIEVPRGSFVTLPPLRMTIRQST
FT                   GFLKKTSSIVRGTDPKDHRNFRWLHYFPGFITQIPFCRVDILTGEMSGCWIVLYKRDGI
FT                   EYVGHIGTDNGSIDNTNMVKNTWMTFATTAPAGDVIAGFNPFGDWDGAWPAQLPGEGAA
FT                   AIYGLMTASRELYSIWTYKQPSQAGVGSMLRIAGIQRVESASRREIQELRRG"
FT   CDS_pept        129735..129971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01580"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99979"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD5"
FT                   /protein_id="BAF99979.1"
FT                   /translation="MPYIALTSPALFIAHTVRSCYRTQIRSIKTFNNQLIDTEKQGNLG
FT                   ILNKTPTAWDNNEYNHSVKHNLIHLELMVYPAC"
FT   CDS_pept        129968..130126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01590"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99980"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD6"
FT                   /protein_id="BAF99980.1"
FT                   /translation="MKLADKIKKETNQTANHAKNHRRHLSGWTNPLHRTTARYWRSRLG
FT                   SRHLSRS"
FT   CDS_pept        complement(130417..130788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99981"
FT                   /db_xref="GOA:B0JRD7"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD7"
FT                   /protein_id="BAF99981.1"
FT                   /translation="MPQKTKVYMTIIKGGEFWVAKILFTDGTSSKKRPVLILWVDGDDV
FT                   VVTAVTSAMPRTQTDILLKDWANSGLRVPSTVRLSRLDCLEKNLLLAKLGRISNEDAVY
FT                   LLRAWDDYIKPQFYAIEID"
FT   CDS_pept        complement(131554..131880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01610"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99982"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRD8"
FT                   /protein_id="BAF99982.1"
FT                   /translation="MTRSFFCSYLEVEVELTDEREQHIIVRHPGTLPDYEEQLAQTLAD
FT                   PDLIRSSDHDEKALLFSKWFSTIRTGRFLIVVVVSQSNLSRHWIVTIYTARKITGGIMV
FT                   WKKI"
FT   mobile_element  132038..132220
FT                   /mobile_element_type="MITE:MaeMITEc001"
FT   mobile_element  complement(132248..133305)
FT                   /mobile_element_type="insertion sequence:ISMae31_3"
FT   CDS_pept        complement(132496..132753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01620"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99983"
FT                   /db_xref="UniProtKB/TrEMBL:B0JJW2"
FT                   /protein_id="BAF99983.1"
FT                   /translation="MGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQC
FT                   FQGIHLVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        132764..132991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01630"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99984"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE0"
FT                   /protein_id="BAF99984.1"
FT                   /translation="MTSILWGDLRKTLWAKKQGSLRKENPLSGACCPLYFLSISSLLNR
FT                   CFSKSLVAKTNRPARFFSLSMAVKFNSNLA"
FT   CDS_pept        133463..133672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01640"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99985"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLW0"
FT                   /protein_id="BAF99985.1"
FT                   /translation="MLSENEKRIKELCQELGQCLYEQSPINKFNNLGEIEETVRDLMIQ
FT                   YVNPEIGIFLSKQAQEKQLVGQEK"
FT   CDS_pept        133753..134526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99986"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLV9"
FT                   /protein_id="BAF99986.1"
FT                   /translation="MLEKNCLLLSGDESYEKSAQKIKSLTGIAVSHSTQQRLVHRYAFE
FT                   ELPSNPEVEVEEMSLDGGKVRLRTAKGKALIWRDYKAVSFHQLGVAAFFQDNSALLDLV
FT                   NSQVLAKPLICLGDGHDGIWNLFREIGEKQERIEILDWYHLIENLYKVGGSFQRIEEVK
FT                   CFLWKGEVEAAISCCEGWSEPQVENFITYLNKHKHRIVNYGYLQAEGISIGSGSVESKI
FT                   KQIAHRLKITGASWESGNVPQVLRHRCAYLNGCLF"
FT   CDS_pept        complement(134554..135438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01660"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99987"
FT                   /db_xref="GOA:B0JRE3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE3"
FT                   /protein_id="BAF99987.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETGASHLCNK"
FT   mobile_element  complement(134582..135607)
FT                   /mobile_element_type="insertion sequence:ISMae31_4"
FT   CDS_pept        136024..136368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01675"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48269"
FT                   /db_xref="GOA:B3DF84"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF84"
FT                   /protein_id="BAG48269.1"
FT                   /translation="MPDFQTFIGILSTLFVFLTGIILNYDSIQLGNEQIIIPQWFGLLF
FT                   AGITFSLVTLDQILRGLVRLEKTERETRRTRIETRYRTAIIRFQLNPNNFHRNQLADIL
FT                   ALLEEYRDTL"
FT   CDS_pept        complement(136511..136792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99989"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE5"
FT                   /protein_id="BAF99989.1"
FT                   /translation="MLIVISTNINPIMTVEPAAIRAWAEERMIYVELSDGRIIGFPGDR
FT                   FRILKQATNEQLAAVKVEVNGYALRWEELDEDITVPGIVAGHFQLPPF"
FT   CDS_pept        complement(136764..137003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99990"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE6"
FT                   /protein_id="BAF99990.1"
FT                   /translation="MPTVIRIGHFRFHFYSDEGSEPLHIHVRSPDGECKFWLEPIIILA
FT                   SNRGIPSHELREVERLVYKNQDLLRSAYRDFHKH"
FT   mobile_element  complement(137149..138571)
FT                   /mobile_element_type="insertion sequence:ISMae36_3"
FT   CDS_pept        complement(137176..138390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01700"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99991"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM72"
FT                   /protein_id="BAF99991.1"
FT                   /translation="MILDKFLNLKGTCIQGYLHLENIGIVCRIESKNQKATCPRCGLES
FT                   DKLHQNHRHLVKDLPISGQPVYLQVNRRQFKCDNCQRPFSEELDFVAKKRTYTKRLAAN
FT                   ILEQLKEGDILNVSRINDVTEEEIQRMIEDIAEEITEPDLSELKRLGIDEIALVKGQKN
FT                   YCAVLVNLDTGKLIAILEKRTQEELRETLTGWGKEVLEQIEEVSIDLWLPYKNLVKELM
FT                   PSAEVVADRFHVMKQINQELDEQRRAEKRAVEAQKNKKQKAEKEAKLEVLKRSKYSLLK
FT                   NEEDLTEPQKIKLEAIKEKFPNLKKMQELKEEFRKIYETSENPTEGMLSISEWLAKSSS
FT                   VFTKSCQTIRNWFGEIISYFERRTTNGVVEGINNKLKLIKRRGYGFRNFRNFWVRSMLS
FT                   WHLVC"
FT   CDS_pept        139074..139382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99992"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE8"
FT                   /protein_id="BAF99992.1"
FT                   /translation="MVVGASWAKPNIVLAETCNYFAGTAVTGKSVNIDLCSIVPASSRS
FT                   VDFVYYLGNQRLVSQANCDNGTWTTFPERQIHRPRSQATQTMLEVVCSYRFYKLRRI"
FT   CDS_pept        139527..141332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01720"
FT                   /product="virulence factor MviN homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99993"
FT                   /db_xref="GOA:B0JRE9"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRE9"
FT                   /protein_id="BAF99993.1"
FT                   /translation="MAISSVQSENVEPSIFMVRLALGIIRMSVGKWVLYIPVKLNLPTR
FT                   DRFSTGTQKRVESINAVVFFRGVIITKKATRSLAGIAGIVAVATLISKVFGLVREQVIA
FT                   AAYGVGPVVNAYAFAYVIPGFLLILLGGINGPFHSALVSVLAKRDKSESAPIVETITTL
FT                   VSAILLAVTVFLIVFANIFIDVLAPGLDAATRSMAIQQLQIMAPMAVLAGLIGIGFGTL
FT                   NAADQYWLPSLSPLFSSVAVIIGVGLLAWFLGDRIDNPQYIQLGGFVLAGGTLVGALWQ
FT                   WLAQVGAQVKAGLGKLTFRWDWRIPGVSEVLRVMIPATLSSGMLHINVYTDLFFASFIE
FT                   NAAASMRYASFIVLTPLGIMSNMILVPFMPIFSRLTEPENWGELKQRIRQGLLLTALTM
FT                   LPFTAIFIALAFPVVRVIYQRGAFNLAASEQVVPVLMAYGFGMFFYLGRDVLVRVFYAL
FT                   GDGDTPFKVSMVNIFLNGVLDFLLYKPFGTPGIVLATVGVNIISMGIFTVILNRRLGGL
FT                   PLGEWGLSLLGLTVITMLSGVASWGASWGWEKVFGAGNIFLQLLQLGFASTVAVGLFLL
FT                   GAMLLKLPELDLLISRVRQKFLKKS"
FT   mobile_element  complement(141365..141577)
FT                   /mobile_element_type="MITE:MaeMITEa006"
FT   CDS_pept        complement(141578..142228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01730"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99994"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF0"
FT                   /protein_id="BAF99994.1"
FT                   /translation="MEFILQKQGENHGHTISNNSLEIVSGNYRLLARLDSPFAHIEVRI
FT                   DYESPESSERYTHYYRSDAGGWLEIFSYRDLGIGSWKIRCYGDILAELGGQGWQETLTL
FT                   IVTPVKINYLAQLEQLIKTEIEPLLALEYSPEMVKLELADLTNNSAFVFDLCLPEETMT
FT                   AREGVTLELPEPANMKKSLQSLSNRNSAPLPPKISGSNSRRKSPQLPPIPKNK"
FT   CDS_pept        complement(142270..143550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="MAE_01740"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99995"
FT                   /db_xref="GOA:B0JRF1"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JRF1"
FT                   /protein_id="BAF99995.1"
FT                   /translation="MGEIQAIRGTKDILPAEVGYWQWLEETASRILGTALYQEIRTPIF
FT                   EQTQLFERGIGEATDVVGKEMYTFLDRRQRSLTLRPEGTAGVVRAYIEHKLQAAGGVQR
FT                   LWYKGPMFRYERPQAGRQRQFHQIGVELLGSDDPRADVEVITLASEILKAVGLENLKLD
FT                   INSLGNAQDRQNYRQALLDYLTPYKADLDADSQQRLEKNPLRILDSKDEKTKIICENVP
FT                   SILEHLGSDSQKHFERVQSLLTDLGVIYNLNPCLVRGLDYYTHTAFEIQSDDLGAQATV
FT                   CGGGRYDGLIAQLGGLDTPAVGWAIGLERLIILLQQKQSLSFLVPDFYLVSKGEKAEAR
FT                   SVVLAQQLRGLGFSVELDLSGSAFGKQFKRADRAKAVGCIILGDAEAENGTVQLKWMAT
FT                   QEQISLTQADLLTQAGELKAQISRHKS"
FT   CDS_pept        complement(143571..145481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01750"
FT                   /product="cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99996"
FT                   /db_xref="GOA:B0JRF2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF2"
FT                   /protein_id="BAF99996.1"
FT                   /translation="MIQSISSSWLSEYSSAVAAGICAILVFFGWLCLHFNLIGPAFLLL
FT                   AIAYVVGGYESTQAGLTTLWEEKELDVDLLMIVAALGAAILGLWDSNYYLIIDGAVLIL
FT                   IFAISGALEQIAMAKTDRNIRSLMAMTPDTARLITGDREKEVPIKQLRIGDTVLVKPGE
FT                   LIPIDGIIMEGNSPINQAPITGESLPVDKTIGEEVFAGTLNGAGVLRLQVETPPESRLI
FT                   ERVIRLVEKAQNESPPSQQFIEGFERGYAKIIVILGLIFGILPPFFWGWTWETTIYRAL
FT                   IFLVVASPCALMASIMPALLSGIANGAKQGILFKNGARLEMIGRIRAIAFDKTGTLTLG
FT                   KLQVVEIIPIHAVSENEVLAVAASLESCSEHPIGSAITATARERGINFFSANQVQAVSG
FT                   RGITGKIADKSVSVGNFAYIRDHISDLDQNILAIRERLQKEGRTLVWVVQENQIIGAIA
FT                   VADTLRESAVNLVKQLKKIGIEHIVLITGDNQQSADKVAEKLGIEEVYADLLPEDKLTV
FT                   IQNLQEKYHTVAMVGDGINDAPALAMANVGIAMGKAGSDVALETADIILMSDNLAKIPS
FT                   AINLGRRANRIVKQNITFALAFIGILLIANFAGDITLPLGVIGHEGSTVLVTLSGLRLF
FT                   K"
FT   CDS_pept        145488..145796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99997"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF3"
FT                   /protein_id="BAF99997.1"
FT                   /translation="MAITFLPILEKIGSMQKTPRTLSPAANLADNNWNFAEVWIDPLLS
FT                   PPYILLLLAESSGNYRVYDPSEGYQVVFTGASYEEAENWLLEDEFEPVEGRLSPVEI"
FT   CDS_pept        145962..146882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99998"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF4"
FT                   /protein_id="BAF99998.1"
FT                   /translation="MKTDTIFYRLFQTFPDLLFELIDFPRELANFYRFSSVEVKQLSFR
FT                   IDGVFLPERQDLPIYFTEVQFQNDPEFYARFFAEIFLYLKQTQLKNNWRGVVIYPNRRV
FT                   EKDNIERYRELLQETRVQRIYLEELAESPPDSLGLATLELVSLPEAQVINRGRELIARV
FT                   RETGVENRPQELLELIETILIYKLPRINRKEIEAMFSLSELRQTRVFQEALEEGRQEGR
FT                   QEGRQEGRQEGRQEGRQEGRQEGRQEGRQEGRQEGRQEGEIIGKLASVPLLLRAEVNPQ
FT                   EIAASLGLSLEQVLEVARSPGESDR"
FT   CDS_pept        147019..147927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAF99999"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF5"
FT                   /protein_id="BAF99999.1"
FT                   /translation="MKTDTIFYRLFQTFPDLLFELIDFPSELADFYRFSSVEVKQLSFR
FT                   IDGVFLPERQDLPIYFTEVQFQNDPEFYARFFAEIFLYLKQTQLKNNWRGVVIYPNRRV
FT                   EKENIERYRELLQETRVQRIYLEELAESPPDSLGLATLELVSLPEAQVINRGRELIVRV
FT                   RETGVENRQQELLELIETILIYKLPRINRKEIEAMFSLSELRQTRVFQEALEEGRQEGR
FT                   QEGRQEGRQEGRQEGRQEGRQEGRQEGRQEGRQEGEIIGKLASVPLLLRAGVNPKEIAA
FT                   SLGLSLEQVLEVARSLGESER"
FT   CDS_pept        148020..148844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00001"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF6"
FT                   /protein_id="BAG00001.1"
FT                   /translation="MKTDTIFYRLFQTFPDLLFELIDFPRELADFYRFSSVEVKQLSFR
FT                   IDGVFLPERQDLPIYFTEVQFQNDPEFYARFFAEIFLYLKQTQLKNNWRGVVIYPNRRV
FT                   EKENIERYRELLQETRVQRIYLEELAESPPDSLGLATLELVSLPEAQVINQVRELIVRV
FT                   RETGVENRQQELLELIETILIYKLPRINRKEIEAMFSLSELRQTRVFQEALEEGRQEGR
FT                   QEGRQEGEIIGKLASVPLLLRAGVNPQEIAASLGLSLEQVLEVARSLGESER"
FT   CDS_pept        148962..150746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01800"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00002"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF7"
FT                   /protein_id="BAG00002.1"
FT                   /translation="MLSLLKKLWNWLKSLFIASPKAINLKKVENTPPEPSDGEYEGILM
FT                   GLFEQVAAGTTTDGLREWLHSRHCDDKKLAQWLGVKSEEWLQYPEDYQTLGRDLAALGK
FT                   VMTGNLGEVSQRISLQLRDAVRDVSGVEEENLDSKETDLTEVVQDVAFWFEQGYQKLIN
FT                   GDFIGAIASYDKALEIKPDDHEAWYNRGIALGNLGRFAEAIASYDRALEIKPDLHQAWY
FT                   NRGIALGNLGRLEEAIASYDQALEIKPDQHEAWYNRGIALGNLGRFAEAIASYDKALEI
FT                   KPDDHEAWYNRGIALGNLGRFAEAIASYDRALEIKPDLHQAWYNRGIALGNLGRLEEAI
FT                   ASYDQALEIKPDQHEAWYNRGIALGNLGRFAEAIASYDKALEIKPDDHQAWYGRGFALD
FT                   DLGRFAEAIASYDKALEIKPDYHQAWYNRGFALGNLGRFEQAIASYDRALEFKPDLHEA
FT                   WVNRGVALGNLGRLEEALASYDKALEFKPDLHEAWNNRGIALDNLRRFEQALASYDKAL
FT                   EIKPDLHEAWNNRGIALANLRRFEQALASYDRALEIKPDFHQAWTNRGNALRNLGRWAE
FT                   AIASYYQAVAIKSDDHQA"
FT   CDS_pept        151057..151335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00003"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF8"
FT                   /protein_id="BAG00003.1"
FT                   /translation="MKITIDIPDELLQHYNYNNLTREILEALVVQAYRAEKITSAEVGS
FT                   ILGLSSRWVVDAFLKNHDADLHYNEVDLESDRKTLQQLRNKHDHSLL"
FT   CDS_pept        complement(151547..152323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01820"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00004"
FT                   /db_xref="GOA:B0JRF9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRF9"
FT                   /protein_id="BAG00004.1"
FT                   /translation="MLDLTGKNALVTGIANNRSIAWGIAQQLHQAGANIGVTYLPDEKG
FT                   RFEKKVRELADELNPAFYVPCDVQNDQQVEDTFATVAEKWGKLDILIHCLAFADKEGLT
FT                   GDFTAIPREAFTKSLDISTFSLTRLARSAKPLMTAGGSIITLTYLGGVKVIPNYNLMGV
FT                   AKAGLEMSVRYLAAELGGQKIRVNGISAGPIRTLASSAVGGILDMIHHVEEIAPLHRTV
FT                   TQIEVGNTAAFLASDLASGITGQIIYVDSGYEIMGM"
FT   CDS_pept        152538..153215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntcA"
FT                   /locus_tag="MAE_01830"
FT                   /product="global nitrogen regulator Ycf28"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00005"
FT                   /db_xref="GOA:B0JRG0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR022299"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRG0"
FT                   /protein_id="BAG00005.1"
FT                   /translation="MDLSLIQDKPLADVFRRIGSGNFPPVVELFERGKTIFFPGDPAER
FT                   VYFLLKGAVKLSRVYEAGEEITVALLRENSVFGVLSLLTGQRSDRFYHAVAFTPVELLS
FT                   APIDQVERSLRNNPDLSMLMLQGLSSRILQTEMMIETLAHRDMGSRLVSFLLILCRDFG
FT                   VPTTDGIRVDLKLSHQAIAEAIGSTRVTVTRLLGELRDQEMVSIYKKKITVHNPVALSQ
FT                   QFT"
FT   CDS_pept        153223..154710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00006"
FT                   /db_xref="GOA:B0JRG1"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRG1"
FT                   /protein_id="BAG00006.1"
FT                   /translation="MTSAYILVLAIVVLGGLIAAVGDRIGSRIGKKRMRLFNLRPKQTA
FT                   TLMTIVTGILIAGSTLIVLFASSKSLRQGVFELDRLLNERRAAIKDLESQVRKTTEQKN
FT                   QVEKALKTAKSEQIAVQKRLEVLNKNYQASRQRLRLVSGQLEKFRKEVANLNNERVILT
FT                   NQKAQLISQRDQLSQQKSILSSQINQLQTTVQVRDKELANQQKLLTTRQARLQQLETQQ
FT                   KTLQLEIDRRDQRIGELDRSIVDKNLALEQREGKLKDLETQMAFLKREVEVLEQYYQTY
FT                   QELREKQIAIFRGQVLSFGAFRIVDTQAIVAVIDKLLREANMNAIRATQPNQPNFDQRL
FT                   VKITKAQVEQLSQQLQDGKEYVVRILSAGNYVLGESEIRVFADVVPNQRVFEEKQVIAA
FT                   VSIDPQNMTEEDLQKRLDLLLASAQFRARSAGVLGSIQVEDGLLTTVVNFIGQVKKSGN
FT                   SIETLEAIAASKTNTAGPLTLRLVAVKDGKIVFSTSS"
FT   CDS_pept        complement(154724..155308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00007"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JRG2"
FT                   /protein_id="BAG00007.1"
FT                   /translation="MLTRSPTKTRSLEEYRNLETIAEVKHEYHDGEIIEMTGGSINHNR
FT                   LVRNLIRLLDNALRKTIYEVFPSDLRLWIPQYNRGLYPDLMIIAGEPLFSDNRNDEILN
FT                   PCLIIEVLSPSTSGYDRGDKFRYYRSIPQLNQYLLVSQGEILIESYSKTSDNNWLLQEY
FT                   TPARGIISLDSLGISLNLADIYEGIDFNLNS"
FT   CDS_pept        complement(155389..155964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00008"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ1"
FT                   /protein_id="BAG00008.1"
FT                   /translation="MLTSSPPKTISLEEYRNLETIAEVKHEYHDGEIIEMTGGSINHNS
FT                   ILINLIVLLKLALRGTNYRLQSSDLRLWIPQYNRGLYPDLMIIAGEPLFSDNRNDEILN
FT                   PCLIIEVLSPSTSGYDRGDKFRYYRSIPQLNQYLLVSQGEILIESYSKTSENNWLLQEY
FT                   TPARGIISLDSLGISLNLADIYEGIDFN"
FT   CDS_pept        complement(156011..157255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00009"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ2"
FT                   /protein_id="BAG00009.1"
FT                   /translation="MNSEIYKKVSLLVLYQGVFDNAIGQAFITLLSTDNVADFLKAYGK
FT                   LFQALASKNISWNDFLIEQILLDDNPFSQQVQKKSVSELPESLIDGVKQDLSILQSLYN
FT                   SSIYSLSNSTVFEQIKFLIFPAWEVDNKLESFLHSSLDWTELVEDLADYYRECGTGIFA
FT                   RYQALRWQEGRLQGITHPDPVQIQDIVGYEMPKETLIKNTEFLLAGYPALNVLLYGSRG
FT                   SGKSSLVKGLLQKYHSQGLRLIEVAKSQLKDLPLIIEILRDLPQKFIIFVDDLSFEEDD
FT                   EAFKALKVILEGSVTARPKNVVVYATSNRRHLVREFFADRPQPKDSDEVHNWDTVQEKL
FT                   SFSDRFGLTLTFEPANQEKYLEIVRHLAALSKLKISLEDLEFRAKQWATQHNGRSGRTA
FT                   RQFIDFLQGELELNG"
FT   CDS_pept        complement(157542..158864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01880"
FT                   /product="serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00010"
FT                   /db_xref="GOA:B0JLZ3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ3"
FT                   /protein_id="BAG00010.1"
FT                   /translation="MTFTSDSLLAERYQLQQRLGNTAIGRQTWLAIDVLSQESVIIKLL
FT                   AFSPQMEWEELKLFEREAAVLASLYHPRIPRYRDYFSLDKNQGDGIPWFVLVQDYIPGE
FT                   SLSDRLERGQRFTATVIRTIAQEVLEILIYLHELSPPVLHRDIKPSNLIINSENNVYLV
FT                   DFGAVQSRGAVTGVTFTVVGTSGYAPLEQFWGRAVPSSDLYALGMTLIHLLTGIVPIEL
FT                   PHRDSKIQFRQRVTIDDDLIDWLETMTDIAVEKRFKSAREALKFLQHPYYRQASSLIDP
FT                   KKLPKPPHSSIRIAKHRDNLEINLPPKIKLPSDAPTLWSLAIVLTVSIFISPILTFILA
FT                   LIGFICLREMQLILTPQEVLIKYKIFNFIYDKFAFKTQDLWGIFLHSNGTEGNYQIRLR
FT                   TAKNYYLIGQNLREDECLWLGQEIQDWLNFIKYSVSPQDDV"
FT   CDS_pept        complement(159071..159964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01890"
FT                   /product="aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00011"
FT                   /db_xref="GOA:B0JLZ4"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016708"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ4"
FT                   /protein_id="BAG00011.1"
FT                   /translation="MIEQKTTIKNLALIAGVHGNELTPAYLVKYLQKSPNLIARSSFQS
FT                   HSLIANPLALKQRFRYIDTDLNRCFNQKDLVNPDCQQYEQKRAKKIVKEIREKSIDLLI
FT                   DIHSTTSNMMLAIIYSNPHPWLLKLFTYLTKINPDVRLIYHPVSEEENHFLKGICPLAF
FT                   TLEIGPVNHGVICPYLFRQTETLIYQILDYIEQENYLAAHLDTFSESLTVYQRLGSIDY
FT                   PRDEQGEIKAMLHPQILQRDYQAIQPNQPIFLGFDGQEIIYRGESELYPIFVGESSYKE
FT                   KGIALCWTAKKQIDIN"
FT   CDS_pept        complement(160234..161220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsA"
FT                   /locus_tag="MAE_01900"
FT                   /product="c-type cytochrome synthesis protein Ycf5"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00012"
FT                   /db_xref="GOA:B0JLZ5"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JLZ5"
FT                   /protein_id="BAG00012.1"
FT                   /translation="MNLVSLENFLDNTSFLVLFLTMLVYWAGAAFPSIPLLPGLGSTGV
FT                   AIANLCIAALLGARWLEAGYFPISNLYESLFFLAWGVTAVHLIAEYTSRSRLVGVVTTP
FT                   VAMGITAFATLSLPGEMQTSAPLVPALKSNWLMMHVSVMMLSYAALMVGSLMAIAFLIV
FT                   TRGQNIELKGSSVGTGAYRLQNKLSTTLSAPIFMETANGGTTALLTPTLTAMATLSPQR
FT                   LSLAETLDNISYRVIGLGFPLLTIGIIAGAVWANEAWGSYWSWDPKETWALITWLVFAA
FT                   YLHARITRGWQGRKPAILAASGFVVVWVCYLGVNLLGKGLHSYGWFF"
FT   CDS_pept        161353..163317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="MAE_01910"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00013"
FT                   /db_xref="GOA:B0JLZ6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ6"
FT                   /protein_id="BAG00013.1"
FT                   /translation="MTNQEDNQFSWSRLPLLGKILIICSGVAALGYFLIPRPSELSNIP
FT                   LEPYSEFINKVERGDISKVRIGNQVIFYQLKNPLESLPIPGNPPVNPPESSNPFHSDSS
FT                   SLASKPSSNLVSGRVLSTIPVYNPQLPQLLQQKGVIFEAIPVAENSWISTLLAWVVPPL
FT                   ILVAAMQFLFYRNDDTRKSLLFNKNLAKVYGDGEKYPITFSDVAGAEEAKTELKEIVEF
FT                   LKDAERFNKIGARIPKGVLLVGPPGTGKTLLAKAVAGEAGVTFFSISASEFVELFVGTG
FT                   AARVRDLFAQAKKNAPSIIFIDELDAIGKSRSSGSGTSGSNDEREQTLNQLLTEMDGFS
FT                   PKEAVVIVLAATNRPETLDAALLRPGRFDRQVLVDRPDLAGRLAILEIYAQRVQMGEDV
FT                   NLKAIATQTPGFAGADLANLVNEAALLAARNNREKVSQIDFKEAIERVIAGLEKKSRVL
FT                   SEKEKKIVAYHEVGHALVGAVMPGGGRVEKISIVPRGLSALGYTLKIPTEDRFLMTETE
FT                   FKEQITMLLGGRAAEELIFGSVTNGASDDLQRATDIAERMVTMYGMSKSLGPLAYDKTG
FT                   QANFLGNNQGSPRRSIGENTAKAIDEEVKQIIDASYQKALAILSHNRNLLESITANLLT
FT                   TEVIEGEELQEFLNQAQMV"
FT   CDS_pept        complement(163577..165478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00014"
FT                   /db_xref="GOA:B0JLZ7"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ7"
FT                   /protein_id="BAG00014.1"
FT                   /translation="MTIGSRIKYLILAVIIALFTIGLNSLYSVSQNSIYSFPVAEVKPQ
FT                   YLNDWKPELEAEFQQRAKQVINHFAKAESYGNLWGENEKKSYPMAMFDFLAGNRQKALD
FT                   FLQQDDPQKREQAHTDYIDYYFSFTLKGQIRKYFLLGKYLDPVYRQRMYNAAKIWTETD
FT                   PLQRPHPVHGTGQGTGNDWSITRRGLWVDSRNTDNLRAMRETSVYLMAEETGNEATRQI
FT                   YKSKIKRYVSALYNIGMGEWDSEVYHGHTFAPYLNLYDFAQDTEVKQWAKMALDWLSMA
FT                   ASVKYYRGGWGGPVKRDYGDGHGVMRSHAGRTFWLYFGDTPVPNNRPELDSLYLITSGY
FT                   RPPLAVMELARKNFNKPVEILASKPLYENWKPGNNQSPGYWETQFIGASYQMGSLAGTF
FT                   PDGDVAPFKLMAFNQHKGVDFFVANTGKNGVKPGKNPGDEIGQYRNLLIWLRPADQAFF
FT                   WQLPKTAKVEKDDNIWFIQLEKTWLALRLINLSSPEMIEIPNSPYPDDNTYQALPTGNN
FT                   YAGFALEVGEAATQGSYENFKSIFKQKSQVNLTQINQGSLLFKGSQGQSLQLTYNQINL
FT                   LPILIRNGQKHDWSKNFALYNSLSRDNSPVSLPWKKGKLTVKAGKYQFSNALILSSP"
FT   CDS_pept        complement(165462..165815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00015"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLZ8"
FT                   /protein_id="BAG00015.1"
FT                   /translation="MAIIVQHLTTGNEYIFLGVSGGESKNILPAKMLGDFFATETPDKS
FT                   RSLTVCDDQGRILWFPVTEMIVVEVDGQKPEELLPEIIAPEPVPLQLDKENKPESPENQ
FT                   GNIDEFAEDDDWI"
FT   CDS_pept        complement(165930..166481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="MAE_01945"
FT                   /product="thiol:disulfide interchange protein TrxA"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01945"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48270"
FT                   /db_xref="GOA:B3DF85"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF85"
FT                   /protein_id="BAG48270.1"
FT                   /translation="MTATTPTNKIRNLLLAVTAVILSVAIFFGFQTTASSVSLEAQAEK
FT                   ATPFDLALSNGKPTLTEFYANWCTSCQAMAAEIAEIKKQYGNAINFVMLNVDNNKWLPE
FT                   ILRYRVDGIPHFVFLNNQGQPIAQAIGEQPKSILTANLEALLTNSTLPYATTTGQASDF
FT                   NILAGASQTDPRSHGSQVNQ"
FT   CDS_pept        166523..166927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01950"
FT                   /product="iron-sulfur cluster binding protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM00"
FT                   /protein_id="BAG00017.1"
FT                   /translation="MKKRVTLTFPKKAVHMPVTYRLAKDFNVAANIIRAQVAPNQVGTL
FT                   VLELSGDIDELEAAIEWLQLQNIGVSQVSREIVIDEEKCVDCGLCTGVCPTEALTLDPE
FT                   SFRLKFLRSRCVVCEQCIPTCPVVAISTNL"
FT   CDS_pept        complement(167649..167975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01960"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00018"
FT                   /db_xref="GOA:B0JM01"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM01"
FT                   /protein_id="BAG00018.1"
FT                   /translation="MISPSIAEGKSVAIGMTLTQIIETVYQMKRTGRNHVKSVSEDNFA
FT                   KFFGVDRLECIGNSRLKIIGRMNIITTGILVGILSAIARVILDNFEVVDSFFEGVFYFF
FT                   FAGD"
FT   CDS_pept        168000..168572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="MAE_01970"
FT                   /product="salicylate biosynthesis isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00019"
FT                   /db_xref="GOA:B0JM02"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM02"
FT                   /protein_id="BAG00019.1"
FT                   /translation="MLTVHQGQLITDALAGSAPRGENAIEDALLANKLLASEKEQREHR
FT                   AVSDFINQKLRQIGLNPQNSPSRLLKLSNIQHLWTPIHAKLKPSIHPLEIVAQLHPTPA
FT                   VAGVPTEIALAQIRHYETFDRSLYAAPLGWIDCQNNSEFIVGIRSALIKGDRARLYAGA
FT                   GIVAGSDPEKELAEIQLKFQALLKALT"
FT   CDS_pept        complement(168584..169960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01980"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00020"
FT                   /db_xref="GOA:B0JM03"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM03"
FT                   /protein_id="BAG00020.1"
FT                   /translation="MLSNSEKLAKLRQYFASGATRSYQFRRQQLEKLKQAIIKYEAEIY
FT                   RALYSDLKKSPEDCWVTENGFLLVEINTALKNLRSWMQPKTVKTNLLNFPSSSQIIREP
FT                   LGVVLIIGAWNYPLQLLLVPLVGAIAAGNCAVLKPSEFASATEKLVVKIIEEIFPEEYV
FT                   LIVPGDGAEVIPNMLDSFTFDHIFFTGSTRVGKIIYQLAAAKLIPVTLELGGKSPCVIE
FT                   ADANISVATRRIAVTKFSNCGQMCIAADYVLVHQSQQENVIRELVNTIVNFFGKDARLS
FT                   ADYGKIINEKQFDRLIDFLQDGEIVFGGKTDRENLYIQPTLLTNVSLDAPIMQGEIFGP
FT                   ILPIIAFSTFEEALAIIAKNPNPLAFYLFTTKAKTEKKWLESVQFGGGCINNNSFHFTN
FT                   PSLPFGGRGNSGIGSYHGRFSFENFSHQKAIMKTPLWFNPVLKYPPFKGKLNLFKLLVR
FT                   "
FT   CDS_pept        complement(169991..171469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00021"
FT                   /db_xref="GOA:B0JM04"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM04"
FT                   /protein_id="BAG00021.1"
FT                   /translation="MIKTLQLQPIDKLAITLIVSLTLVIGGLIWLGNSCGNQCLLQTGP
FT                   RVKEFSWENREIGSEDQAFIITFDRPMDHASVEKNLVIDPPLPGKLSWAGRRLAYTLTS
FT                   PIPYGEKYHLQIEGAREQFRSGNRLGQTLAIFEREFKSRDRAFAYIGTNGEEQGRLIFY
FT                   NLTEEKKTLLTPANLTVMAFEFYPDGKKILFSAVAKNRGIEGIRELQLYQVDSSQSPLK
FT                   IELVLDNKDYQNNHFDLAKDGETIVVQRIERRNPINFDLWAVKSGEKPQQLNIQGGEFL
FT                   IAPDSKTLAVTQGEGIALLPLKFETKPLDFLPKFGRILNFSADGTAAAMVNFNTDNAKM
FT                   RYIRSLFYVNNQGLQKRLLNLQGSIIDCQFNATGSDLYCLLTELVTNSQEYKEKPYFAK
FT                   IDVKTGQVTPLLELADYRDIHISLSPDGLAIIFDQLRTSYDTNPTNLLTTDSGETIIGG
FT                   RLWMLIPPLQDGVKASKSDLIELPLAGIRPQWMP"
FT   CDS_pept        complement(171516..172307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00022"
FT                   /db_xref="GOA:B0JM05"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM05"
FT                   /protein_id="BAG00022.1"
FT                   /translation="MNSSRLKIIAPQFIDIIALIGWGSLLFKYWITGQLNLLIHPNYFI
FT                   LVIITSIALFVLGIVKLWTLLKQWQKKINLDSNDNRSHITILPQHFGSGLLVITALLGL
FT                   FIAPQPLSSQIALQRGISESLPLTRLQTQSFGTTVKPEEKSLIEWVRTLNAYPEPDAYT
FT                   GQPVKVTGFVVQLPQLPDNYLLISRFILTCCAVDAYPVGLPVKLSGSRGQYPNDTWLEI
FT                   TGEMATESLPVEVGKSTTRRQLVIKAKSVKSIPTPVDPYGY"
FT   CDS_pept        complement(172332..173342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00023"
FT                   /db_xref="GOA:B0JM06"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM06"
FT                   /protein_id="BAG00023.1"
FT                   /translation="MSQLQNAFTLFLSLLVEAMPFLLLGVILSSILLIFVDERRLVALM
FT                   PRNAVLGAFVGGCIGFLFPVCECGNVPVARRLLVQGMPNAVAVSFLLAAPTINPIVIWS
FT                   TWVAFRDQPEIVFYRVIFSLFIATVIGIIFSIQKDPRPLLQTSLAKSLNWQPQTPEKES
FT                   IPLLLQSGSFLIGNSGQTLRLDESFAATAVLPAVQAIPMKRRWLTFVENVVMELRELGG
FT                   VLILGSAIAAGLQVFVPREFVLNLGQDPITSILAMMLLAVIVSICSTVDSFFALSFASS
FT                   FTSSSLLAFLVFGPMIDLKGIGLMLSIFKPRMLIYLFALAAQMTFLLTLAHSYLF"
FT   CDS_pept        complement(173641..174450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00024"
FT                   /db_xref="GOA:B0JM07"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM07"
FT                   /protein_id="BAG00024.1"
FT                   /translation="MDSQLLDKLGQLQNLLKTSEKALIAYSGGVDSTLVAKVAYDLLGS
FT                   QALAITAVSPSLLPEELEEAIAQADYIGIRHELVETEEMNNPNYTSNPVNRCYFCKSEL
FT                   HDTLKPIALARGYSYVIDGVNADDLRDYRPGIQAARERGARSPLAEIGITKSEVRQLSR
FT                   YLNLPWWDKPAQPCLSSRFPYGEEISLEKLQRVGRAEIYLRKLGYRQLRVRSSGDTARI
FT                   ELPAAAIPDFINRTNLSELVADLQKLGFIYVTLDLEGYQSGKLNRVL"
FT   CDS_pept        174684..174998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00025"
FT                   /db_xref="GOA:B0JM08"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM08"
FT                   /protein_id="BAG00025.1"
FT                   /translation="MTTNLTDYKHIAIDHRGVPIIAGSTLKVIDLVMAQIAYGWTPAEI
FT                   HINNRDLSMSQIHSALAYYWEHREELYQAIQADLEFAQKMREKAGYSPFVTRLKAQGIR
FT                   "
FT   CDS_pept        complement(175058..175243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02040"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00026"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM09"
FT                   /protein_id="BAG00026.1"
FT                   /translation="MSYSVTFEPESITDLDLISDFIRLRILNKLRVGDYRVIYEFDRES
FT                   RIIIIVRVGHRSEVYD"
FT   CDS_pept        complement(175244..175459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02050"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00027"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM10"
FT                   /protein_id="BAG00027.1"
FT                   /translation="MQIKDMTPQELQSLIRNTVDDTLDEYFGDPDKGKQVKESFQQKLL
FT                   EIKQKRLQGRATITAAEVDKRYGIEP"
FT   CDS_pept        complement(175582..175944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00028"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM11"
FT                   /protein_id="BAG00028.1"
FT                   /translation="MAISITLTLPDEIFNLAQSLAHSINRDLNDILVEAIAFSISPNYQ
FT                   GEKISSLNSLSDEEIIKLTQLQMASEQDQKLSELLNQQQERDLSTFENRELWSLMQIYQ
FT                   INLLKKAQGLNRLKED"
FT   CDS_pept        complement(176094..176435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02070"
FT                   /product="DNA element excision controlling factor XisI
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00029"
FT                   /db_xref="InterPro:IPR014968"
FT                   /db_xref="InterPro:IPR035943"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM12"
FT                   /protein_id="BAG00029.1"
FT                   /translation="MDRLEKYRNAIKKVLTEYHEWVSGSANLDQESCLVFDEIHDQYFW
FT                   LFMGWEGKKKIRNIQVHIRIKNEKIYIEEDWTEEGIATELLREGISKEDIVLAFYDLET
FT                   RKLTGFAVS"
FT   CDS_pept        complement(176438..176638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02080"
FT                   /product="DNA element excision controlling factor XisI
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00030"
FT                   /db_xref="GOA:B0JM13"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014919"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM13"
FT                   /protein_id="BAG00030.1"
FT                   /translation="MRDFEIALGQYILYRNLISLTEPEYQIYLAIKDSIYENFFQRESI
FT                   QDILKINQLLLLVVEMEKEKI"
FT   CDS_pept        complement(177126..178331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="MAE_02090"
FT                   /product="argininosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00031"
FT                   /db_xref="GOA:B0JM14"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JM14"
FT                   /protein_id="BAG00031.1"
FT                   /translation="MGRAKRVVLAYSGGVDTSVCIPYLKQEWGVEEVITLAADLGQGDE
FT                   LGPIQEKALRCGAIESLVVNAQEEFVKEYAFPSIQANALYENRYPLSTALARPLIAKLL
FT                   VEAAEKYGADAVSHGCTGKGNDQVRFDVGIMALNPSLKVLAPAREWGMSREETIAYGEK
FT                   FGIESPVKKSSPFSIDRNLLGRSIEAGPLEDPMTEPPEEIYLMTKAIADTPNEPEYVDI
FT                   GFNQGIPVSLNGENLAPVTLISQLNDLVGKHGVGRLDMIENRVVGIKSREIYEAPALLV
FT                   LIDAHRDLESLTLTGDVTQYKRGIEDTYGQLIYKGLWYSPLKEAIDAFILKTQEQVTGS
FT                   VRVKLFKGNAKVVGRQSVNSIYSPDLATYGAEDQFDHKAAEGFIYVWGLPSKVWAEKTR
FT                   GK"
FT   CDS_pept        complement(178494..180485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02100"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00032"
FT                   /db_xref="GOA:B0JM15"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR019278"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR033415"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM15"
FT                   /protein_id="BAG00032.1"
FT                   /translation="MSRSTSVLTELLQLLPQWRSQMYFKASLTALSHAMEDQVLAEDDQ
FT                   PLVIASFQRERFYRQEAHRYRRIAHKSGQVYVLSAPETDFKHSSDIYETIAFQPEDSLA
FT                   QEWHLVVIGGHYASCLICRERTHLTAEGENGAAMDNNRRFEGIWTSDRHVSQQAAQILL
FT                   NHILDYRPELAEKIRRAQEEYLICELKDRDHQEEPNPFVQRLVTYLQAGQYKLLKANRS
FT                   LASKEHKERLINSVTASIRRSLDPEAILQVAVQKLGQGLGVCRCVVYRCKEADINATIE
FT                   HEFLNSGISSIKGQKWPLKNNPLFQEALELRESLKIEDAIHDPRLPGDSIQNLVRECSI
FT                   YSWLLVPIFYQSRLLGMLELHHCGPYTTTWKSEDVALVDAVATQIGVALIQAEAYANLQ
FT                   DLNEQLAALDRTRSNLVAITGHELRTPLSTIQVCLESLASEPDMPAEIRQIMLDTALKD
FT                   AERMRKLIQDFLTLSRLESGRVNWNPEALSLSECVELAISHVHARNLDNENPKISNLVP
FT                   PNLPFVLADGEWLVELLSKLLDNACKFTGREGNVSIEVALGKPKTLEVTISDTGRGIEP
FT                   NRLEQVFDRFYQEEGALRRSAGGTGLGLAICRQIVNGWGGEIWAESRGKNNGSQFHFTI
FT                   PIFKDKTNDNPKNTAPKKSSRRPASKRK"
FT   mobile_element  180658..180862
FT                   /mobile_element_type="MITE:MaeMITEa007"
FT   CDS_pept        complement(180869..181003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00033"
FT                   /db_xref="GOA:B0JM16"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM16"
FT                   /protein_id="BAG00033.1"
FT                   /translation="MSDLNRGIMKFEGADKPAVVAISSIIVIGSIIALILWAMKVAYI"
FT   CDS_pept        181086..182024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00034"
FT                   /db_xref="GOA:B0JM17"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM17"
FT                   /protein_id="BAG00034.1"
FT                   /translation="MLLEIGIIRLSLIILGVLFALALFLEAILRIVFGFGNPLIYEADA
FT                   EIGYLLAPNQQIRRFSNLIAVNQYSMRSEPITTQRPPETTRIMLIGDSIANGSWWTDQK
FT                   ETIAALIAKNLGQNLTGSVQVLNASANSWGPRNQSAYLRRFGTFESQVIVLLMNTDDLF
FT                   ALAPSSAVVGREINYPARRPALALIELYDRYFKRYPPLPLVQEGGDRVGNNLTALAQIQ
FT                   ALAQANQARLIIAITPLIREAQKQGRDYELKARQRLADFTSNQQIFYLDFLPIFQAHPN
FT                   PDSLYIDNIHLSGDGNELISQKLTEAIKNVF"
FT   CDS_pept        complement(182315..183442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="MAE_02130"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00035"
FT                   /db_xref="GOA:B0JM18"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM18"
FT                   /protein_id="BAG00035.1"
FT                   /translation="MMQTRVGVIGGGQLAWMMAQEAKKLGISLIVQTPHPDDPAVALAD
FT                   GVVFAEIADVEGTKKLAQHCDLITFENEFVNLDALEELAATGVKFYPSLANLRPLLDKY
FT                   EQRCYLRSLGLPVPDFWAIDNLSPLENYPFPLVLKARRQGYDGQGTFIIRTPEELNAKK
FT                   PQLERLDLMLEAYIPYERELAIVAARGLTGEIVTYPVVETYQEEQVCHWVIAPAALNQS
FT                   LQAQTESIAHHLLSSLSAVGVFGIELFVTPQGEVLINEIAPRTHNSGHYSLSACLTSQF
FT                   ALQLQAVANLPLGATDLKSAGAVMVNLLGFEDSDGDYGEKRAILAAIPDAQVFWYGKKS
FT                   RPGRKLGHVTLLRDTSDRSELLALAKQIEKLWYGC"
FT   CDS_pept        complement(183439..183999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00036"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM19"
FT                   /protein_id="BAG00036.1"
FT                   /translation="MAYCYKIKNAHRWNFPPMKTIFRLAIAFFALLFILSPVNALAASS
FT                   AAVTGANASYENQNLTGKDFSGQNLQSAQFTNVNLQDSNFSSADLRGAVFNGASIIEGN
FT                   FHGADLTNGLAYLSTFKNSDLSDAIFAEAIMLRTIFEGVNINGADFSFAVLDAQQIKNL
FT                   CERAEGVNSKTGISTPESLGCDQ"
FT   CDS_pept        184133..184522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00037"
FT                   /db_xref="InterPro:IPR021866"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR038396"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM20"
FT                   /protein_id="BAG00037.1"
FT                   /translation="MIDYNLDAAHSILYMQPTSALAAEDFIKIAEAVDPHIEATGGLAG
FT                   VIIEVPKFTGWESFGALVAHFRLIRDHHKYVSKVAVVTDSTLVKLIESLASHFVAAEVR
FT                   QFPWGETEVATQWILGDSTLPLVVS"
FT   CDS_pept        184584..186302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02160"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00038"
FT                   /db_xref="GOA:B0JM21"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM21"
FT                   /protein_id="BAG00038.1"
FT                   /translation="MPITSLTNLDYYDRVNPDLLRLLPPDASVIVEVGCGTGALGQYYK
FT                   KINPNANYIGIELNAQAAEIAKTRLDQVIVGNVEALDLGTIILPNSVDCLIYGDVLEHL
FT                   QDPWRVLNQQITWLQPAGQVLACIPNIQHWSILINLLRGVWEYEDEGLLDRTHLRFFTL
FT                   LSIKKWFAEAGLQIYEIQTRGQKNENFQTAQKLLAPTLQSLGINAEQFAIQTGAVQYVV
FT                   RALKSTQPPRPLLIQTMIMAPLACDRVRVLEPDQFSATIPGVRTVSSVKSADLGIARPE
FT                   EGKVFIWQRGSLQLDELAKIQALLAKDYLIIAEMDDDPHRWPEHEQNQFLTYRACHGIQ
FT                   TTTEPLAEFFRTINPNVAVFPNQLAYLPPPREYRQNNTVKLFFGALNRQADWQAILPTL
FT                   NQVLADYGEQIAAQVIHDREFFEALAITNKVFEPFCDYERYQALLRTCDIALLPLNPTA
FT                   FNSMKSDLKFIECAGHGVTVLASPTVYEASIQSGETGLIYNSLTEFSAQLRQLIENPSF
FT                   RQQLANNAYQWVKQNRLLAQHYRRRWDWYCQMRDELPRLTQELWQRVPELRQNLN"
FT   CDS_pept        186510..187373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02170"
FT                   /product="amino acid transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00039"
FT                   /db_xref="GOA:B0JM22"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM22"
FT                   /protein_id="BAG00039.1"
FT                   /translation="MDTPQLLFNGLAVGSIIALAAVGLTLTCGILRLSNFAHGDFMTLG
FT                   AYITWVVNAQGINLWLAMLVGAAVTAIAMLIAERLLWKPMRDRRADSTTLIIISIGLAL
FT                   FLRNGILMIWGGSNQRYDLPVMTATEIFGIKVAFDRLLVIGLAIIVIIALHLLLQKTKI
FT                   GKAMRAVADSTDLARVTGINVEWVVFWTWIITGVLTALAGAMFGLITGGVRPNMGWFLI
FT                   LPMFAAVILGGIGNPYGAIAGALIIGVAQEISVPLIGSDYKLAVALLIMILLLLFRPQG
FT                   LFKGTV"
FT   CDS_pept        complement(187602..187985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00040"
FT                   /db_xref="InterPro:IPR017260"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM23"
FT                   /protein_id="BAG00040.1"
FT                   /translation="MSELKSQITAIDHQLSKRPIALDPAGYFIIYLDREAGLICAKHYS
FT                   NIINEKGLAVDPETGKVIGVRQKLDRNPETIYTARTAKELAVKVIEETQPCPITMFDHA
FT                   AYLGREFTRAEYALITGEEYIQD"
FT   CDS_pept        188015..188293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02190"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00041"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM24"
FT                   /protein_id="BAG00041.1"
FT                   /translation="MKARANYITYHHPFSRAFCRYRPYVFSVSKSDLLSNNTKSCLKSI
FT                   GAWGALEEGETIHNLRVNRTINTKSVEYRLHIRTGKGQEARGKRGNK"
FT   CDS_pept        complement(188416..189810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00042"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM25"
FT                   /protein_id="BAG00042.1"
FT                   /translation="MNHQIETPIRSPSQARFRSREERIQIGKSLRERLPRSRHAIWQPP
FT                   AAGREPIEIIEASNRGRLQELIPIRYGRMLRSPFTFLRGSAALMAYDLATTPKTDIIVQ
FT                   ACGDCHLLNFGFFATPERNLVFDINDFDETLPAPWEWDLKRLVVSFVIAGRDSDLSDRE
FT                   SKAAAIDCARSYREHLREYSRLSPLEVWYTRIGVEQVIEMAPDEKTRKIREQMMTKARE
FT                   RIIEHLYPKIVTQTAGRNRFVDQPPILYHVNEPDWETLVREGLEDYRQSLPEERRVLFD
FT                   RYRLEDFALKVVGIGSVGTRCYIALFFSEDNHPLILQVKEACPSVLEPYTAKSQYENQG
FT                   QRVVTGQRLMQSSSDIFLGWTQGRRGNNFYLRQLRDMKFSLPIEGVSAAQLQRYAEFCG
FT                   WTLARAHAKSGDAATISGYLGKGDQFDLAMGEFAIAYAEQTEQDHAALVEAVKTGRVEA
FT                   LVEEDL"
FT   CDS_pept        complement(190355..192100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02210"
FT                   /product="sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00043"
FT                   /db_xref="GOA:B0JM26"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM26"
FT                   /protein_id="BAG00043.1"
FT                   /translation="MTGEEMRMPTRLNFSRERFSLPGLKRLRSYRSAWLRGDVIAGITV
FT                   AAYLVPQCLAYAELAGVQPIAGLWAILPPLLIYALLGSSPQLSVGPESTTAVMTAAAIM
FT                   PLVAGDSSNYASLCSLLALLVGSVCCVAAFARLGFLADLLSKPILVGYMAGVAVIMIVG
FT                   QLGKISGMSLKAESLFGQIGEFSGHLSEIHPPTLILAAAVLIFLLVVQRRFPNAPGPLL
FT                   AVLLATSAVYLFDLNERGIAVIGEIPAGLPSLKVPRGFSSQQLVYLLSSAIGIALVGYS
FT                   DNVLTARAFGAKNNYRIDGNQELLALGAVNIGNGIMQGFPVSSSGSRTAIGDSLGSRSQ
FT                   LFSLVAFLIVILVLLFLRPLLSLFPKPALGAIVIYAALRLIEISEFNRLRCFKTSEFRL
FT                   ALVTMFGVLATDILVGVGVAVGLSVVDLFTRLMRPHDAVLGEVPNLAGLHDIEDWQGAT
FT                   TIPGLVLYRYDAPLCFANAENFRKRVIAAIEAEKVPVEWFVLNAEAILDIDITAVDMLK
FT                   ELHRELIGSGITFAMARVKQDLYQQLKKGDLSETISTERIYPTLEEAIEAFHHRNPPPS
FT                   SPAQD"
FT   CDS_pept        192150..192353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02220"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM27"
FT                   /protein_id="BAG00044.1"
FT                   /translation="MSGNVFFAGLSLQKRPRPLALAENFPVGERSRFSSPLQRVINKSD
FT                   RYLGLAEKVFPGGRVWGVGCRV"
FT   mobile_element  complement(192299..192501)
FT                   /mobile_element_type="MITE:MaeMITEa008"
FT   CDS_pept        complement(192506..192910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00045"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM28"
FT                   /protein_id="BAG00045.1"
FT                   /translation="MAVVASTKDQATELPKNCQYLKEVATNQTHIRKQIDAIGKNNFNT
FT                   DFAVPSGVKFASFKGVMVPENDGKYGVTINLKYPDNSVNSAFQKNVEMKRGETYSLPFQ
FT                   SPTGRQPYQINFNINGMNNNAYTIAVMACK"
FT   CDS_pept        193100..193324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02240"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00046"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM29"
FT                   /protein_id="BAG00046.1"
FT                   /translation="MVIIARSGASSPVSSGVNFCASTREMFRELLLVFTLRTKHKPLTY
FT                   PRKLGFNIYLKCRFEGTLGFTDEMKNRPV"
FT   CDS_pept        193469..193630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02250"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00047"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM30"
FT                   /protein_id="BAG00047.1"
FT                   /translation="MSSGDQYFFGFVHTDLGYVLPLAWGFQRPSASPYSSSTRCRTFNL
FT                   VCLLEEYL"
FT   CDS_pept        complement(193796..194215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02260"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00048"
FT                   /db_xref="GOA:B0JM31"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM31"
FT                   /protein_id="BAG00048.1"
FT                   /translation="MKANYFKTRRAIFKLTVHIVLVTKYRRKVFQKKHLEFLRIVFQNI
FT                   AEKWKAKVIEINGESDHIHILLTYPPHKLLSSLIANLKSTSCQLMWDNFSDHLKEIYGQ
FT                   DKRILWTGAYFVASCGGVTIDQLKKYVENQDSPEY"
FT   mobile_element  complement(194290..195600)
FT                   /mobile_element_type="insertion sequence:ISMae9_2"
FT   CDS_pept        complement(194412..194582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02270"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00049"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM0"
FT                   /protein_id="BAG00049.1"
FT                   /translation="MATLVAIRHNPVIRKFYERLLTNGKLKKVALVACMRKLLVILNAM
FT                   IRDNKCWQAPA"
FT   CDS_pept        complement(194647..195348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02280"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00050"
FT                   /db_xref="GOA:B0JFM1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFM1"
FT                   /protein_id="BAG00050.1"
FT                   /translation="MTEEKTWVGIDVSKEVLDIYVLPQGLTLQQPNSDVGVQSLIEQLH
FT                   PLSPSLVVVESTGGLERALVSGLQAATIPVAIANPRKVKGFATALGKAKTDKLDAQVIA
FT                   QFARAVQPQPQPVVAPQAQQLSDLVRRRQQLVEMQVAEKNRLSRASETVQLDIKAHIEE
FT                   IQQRIESLNEQIQSLAQQQADWQRKNEILQSVKGIGKVSSALCLAELPEMGTLWRKTDC
FT                   PAGRGRSYQPR"
FT   CDS_pept        195478..195648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02290"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00051"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM34"
FT                   /protein_id="BAG00051.1"
FT                   /translation="MSSTSVELDVHALFQNIGTQATKRYFLPRLGRVAYFSRYKVGLKH
FT                   ETQRLLMLRYR"
FT   CDS_pept        195703..196884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02300"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00052"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM35"
FT                   /protein_id="BAG00052.1"
FT                   /translation="MRVIEFKLKTNSHQKIAIQEAIRVGQFIRNKCLRFWMDSTKEDQV
FT                   NYGTLCKLTTELANSSEFSFVGKLNSMARQASAERAWFSISRFYDNCQRGLAKKGYPKF
FT                   KKFSRSVEYKTSGWKLTEDKKFIHITDKTGIGKLKLIGTFNREILDKSTIKRVRLIKRA
FT                   DGFYCQFVLDIERVETFDSTGKEVGIDLGLNHFLTDSNGDKIDNPRFLRKSEKRLKKAQ
FT                   RKLSKKKKGSQKRLKQKSKVARLHLKVSRQRKDFAVKTAKALIQSNDLVVYEDLKVSNM
FT                   VKNPKLAKSISDASWSMFTDWLDYFGKIHGKFVVAVNPQYTSQQCSSCGNIVKKTLSVR
FT                   THVCSCGCVLDRDENAAINILARANTVGRTEIQALGQTTHCLLSESLVDQVTG"
FT   CDS_pept        197035..197679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02310"
FT                   /product="putative ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00053"
FT                   /db_xref="GOA:B0JM36"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM36"
FT                   /protein_id="BAG00053.1"
FT                   /translation="MRATENKYNRLLANLVLLYIIYPFLVYLPLGDLLVFFFFSLSVII
FT                   AVYQIDRSKLALRCNIGLFLIALILRVFGTIIPINRDLTGWFDLSSTLISLAFISLCVY
FT                   SILQELILAEQVTSDIIKGGICVYFLLGFFWASAYSIVQIFEPDSFSSAAKTVNQADLL
FT                   HFSFTTLATVGYGDIVPTSKVARVLANLEGMTGVLYPAVFIARLVSLHNGR"
FT   CDS_pept        197731..198489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00054"
FT                   /db_xref="InterPro:IPR019207"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM37"
FT                   /protein_id="BAG00054.1"
FT                   /translation="MPILSLLLPWVTAAGVLAEIPTLSQEIRPKTAEQVIEQLCANLTK
FT                   QRSFTVNMDVTYDDVLDSGAKVQYSAYQNIWVEKPDRLRSDYTGDERVTRFFYDGKTFT
FT                   LADLERDLYVTKPAANTLDEALDQVEQRYGITIPMSNLAANDPCADLMADVGQIIFIGN
FT                   NMVNGEQMYHLLLIGSDRDYQIWVTQDATPLLRKAIITYKTLPGSPQYTAILSDWNFNP
FT                   STPADTFTFQPGSESIPIELLPPRDNQSQP"
FT   CDS_pept        198581..198823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02330"
FT                   /product="PemI-like suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00055"
FT                   /db_xref="GOA:B0JM38"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039052"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM38"
FT                   /protein_id="BAG00055.1"
FT                   /translation="MKSQIGRWGNSLAIRIPKYAVEALNLNPNDVVECSVENGKLVIEL
FT                   IQALPELSLEELLAEVVESPEPEVDWGRPMGEEVW"
FT   CDS_pept        complement(198832..199014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02340"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00056"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM39"
FT                   /protein_id="BAG00056.1"
FT                   /translation="MIFLSSQIIFCKRSTVSGAKKRALLNQGMNANFASDAKVSLALGF
FT                   KNTRKEDSYLKSATP"
FT   CDS_pept        199027..199920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00057"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM40"
FT                   /protein_id="BAG00057.1"
FT                   /translation="MKRSLCQNLCVLAALLLGTSLLVTDYVDARGGGGGGSRGGGGGSR
FT                   GGGGASPRVNRSSDLQNRGNFSNRSQPSRDFSGRQGERQTGQQNRQGERTERQGERQTG
FT                   QQNRQGERSERTDTRQGERSERQGERQTGQQNRQGERSERTDIRQGERTERQGERQQQV
FT                   SDRQQNRQNFIDDNRNGYWRGGGWYGGGYYVPPGWGWVGLTTGLVIGSAIATLPPYYDT
FT                   VYMGSTSYIYSDGIYLQPSGSSYTVVAPPIGAIVTYIPDGCTTITADNTLYYNCSGIYY
FT                   RPLFENGSTVYQVVRF"
FT   CDS_pept        complement(199917..202979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02360"
FT                   /product="SNF2 helicase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00058"
FT                   /db_xref="GOA:B0JM41"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM41"
FT                   /protein_id="BAG00058.1"
FT                   /translation="MTTLHGNWLIRSQDSVFFLWGEQWQGKELSETQENHPFCLESGAL
FT                   AQFIEKFSPQLDRYSPESIKLSLPSYSPPRKKYFLPLLSGQILEPTAKSLSWQPWQVSG
FT                   LTFSAGMIVRLWEKLPLAKAEFIGNDLRFWLYLHRWSLDLLARGKFLAGINQGESCWYP
FT                   LLDSTIDRTRLAKFIQTIPPVCLAYQENSEPQTIILDCLKNIVDARLRQKIDSSVNISP
FT                   SLMVKPWLQSLSGDHHEIALEAKNLQRLENAYHNWVFPIQESLVNGNNRQLIENQYRVC
FT                   LSLQPPSLGTVWKLTYYLQALDAPEFLISAKLIWLEGKESYHSYQRVVNNPQEILLKGL
FT                   GLAARLYEPIRISLEQRHPEECSLDSLEVYQFIRSIAWQLQDQGLGVILPTGLTAGSNE
FT                   QRLGIKIAASVTPKKGERLSLTSLLNFQLKLVVGEQEISKKDFDKLLEKKSPVVEVGGK
FT                   WLILQPTDVKAAQAILNNTIAPLNLSVEDALRLSSGDNNLIAKLPVVNFQAEGALKELI
FT                   DNLNNNQGIQLINPPREFRGELRPYQIKGVSWLAFLEKWGLGACLADDMGLGKTPQLIA
FT                   FLLALKEQDMLVNPVLVVAPTSVVNNWEHELRKFAPTLAVFVHHGEKRLKGQAFAQEVK
FT                   NKSVVITSYPLIYRDLSTLEAVQWQGLVLDEAQNIKNSTAKQSQAVRKIPAGFRIALTG
FT                   TPVENRLTELWSILDFLNPNFLGTQTFFQRRFALPIEKYGDQESLHNLRSLVRPFILRR
FT                   LKTDKNIIEDLPEKQEMNIFCGLSKEQGQLYQQLVETTLQKIEEIQGIQKHGLILTLLM
FT                   QLKQICNHPAHFLKENSLETSQRSGKLLRLEAMVEEVIAEGDRALIFTQFAEWGKLLQT
FT                   HLQKKLAEEILFLSGSTKAKDRVEMIERFQNDPQGPKIFILSLKAGGTGLNLTRANHVF
FT                   HIDRWWNPAVENQATDRAFRIGQKRNVQVHKFICTGTLEERINEMIESKKQLAEQTVDA
FT                   GENWLTELDTDRLRDLLLLDRSAIIDEEETD"
FT   CDS_pept        203181..203969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02370"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00059"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM42"
FT                   /protein_id="BAG00059.1"
FT                   /translation="MYKSIALTLVLSLPLNFSLVGYGEDLNHLQQLLSTRKCPQCDLSG
FT                   SGLVQSNLVGAKLNGANLVGANLSQANLSGADLSGANLTGASLFGANLTGANLTGAILT
FT                   GADLRGTYLNNANLDNTKLDTAYVQGAVGIPSSAGTPELFYGLGMVEGKQGRTSAAIEN
FT                   FNKALTINSEYAPAYLARAMAHYRLGQNALAAQDAQMASTLFERQGNTPGYEAAENFIK
FT                   GMEIALKPREQGGGNAQLDQMVQGIGSLLLQFVLPALGLF"
FT   CDS_pept        complement(203966..204400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02380"
FT                   /product="transcriptional regulator"
FT                   /note="ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00060"
FT                   /db_xref="GOA:B0JM43"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM43"
FT                   /protein_id="BAG00060.1"
FT                   /translation="MEDLIDTSLSQLSLNNRSGKNMAIEKIAPVCGESHHQEGKFQNLQ
FT                   GLELEKAQKMAEFFSLLGDANRLRILSLLAKQELCVCDLADDLGMSESAVSHQLRTLRA
FT                   LRLVKYQKQGRRVFYRLADHHVLDLYYAVSEHLEEPADED"
FT   CDS_pept        complement(204357..204542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02390"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00061"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM44"
FT                   /protein_id="BAG00061.1"
FT                   /translation="MPSKKTINTTVPKLVPMVTLTRTRKAVDTRAVVAFKFSYWGEGDK
FT                   YRHGRFDRYLPFSTFP"
FT   CDS_pept        204920..205564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00062"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM45"
FT                   /protein_id="BAG00062.1"
FT                   /translation="MLLALKQLTVTPGDRLLLTSLTWQDYEKILDELGERRSIRLSYSQ
FT                   GTLEAMTPLFIDENTKVLIGDLVKVLLDELELDYEPAGSTTFKNQQMDQGIEPDESFYI
FT                   ENCAAVRGKKRLDLAIDPPPDLAIEIDITKRTRFNNYERLGVPELWRYNGERLEINVLQ
FT                   GSEYVESSQSRLFSQFNLIEKIPETLQNSQKIGSAMALKQFRIWVKQTLNP"
FT   CDS_pept        205809..206042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02410"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM46"
FT                   /protein_id="BAG00063.1"
FT                   /translation="MISVARLFVSFCKKLTNLGSEKLIIVPNGVLVGLKENNPRKVVWL
FT                   ESIVLPPPLAGALFQVIVDSFQFSPAFPSFNP"
FT   CDS_pept        206127..206294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02420"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00064"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM47"
FT                   /protein_id="BAG00064.1"
FT                   /translation="MEFRSNLRYPFLMTVESPLIATVGSTALKFVSGLILTTKVSAPLP
FT                   KAVVRLTVAA"
FT   CDS_pept        complement(206550..206897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00065"
FT                   /db_xref="GOA:B0JM48"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM48"
FT                   /protein_id="BAG00065.1"
FT                   /translation="MSNPKAAEIWLVRFPFSDLSTTKLRPALVLAVHREEQIILGIFSK
FT                   IPPGEWWETWILVREGHPNFSQTGLKKTSVIRTDKIATVNQSVFQQKLGILPSDILNQV
FT                   QTALKKSLNIP"
FT   CDS_pept        complement(206884..207069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00066"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM49"
FT                   /protein_id="BAG00066.1"
FT                   /translation="MISTLTLEEIKTLVYQLPLSEQISLLEDLEDKLETLTLMKLAETG
FT                   FPEWNDPEEDIYNVQP"
FT   CDS_pept        complement(207177..207941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00067"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM50"
FT                   /protein_id="BAG00067.1"
FT                   /translation="MRFYGYDISNKNCLSKIAITSSVLAVSTFVIVPVNASNVTLNFNT
FT                   LPSSQGGTYLVDGNTATETDVFSISNGVLTQNTLGSGDGVNGYRLANVVDTTQPFTLSW
FT                   RSRVLQDEFVLNPQNFFGLGLSINSSSQRFTVGFGTDAIGISAFQILPGSFNNTVFHNY
FT                   RLEGSFNSGNAQLYIDDLPIATLALLSGVTPNASDGLFFGDATGYTNALAEISSYSFIQ
FT                   GTLPGSVPEPLSILGLLSLGVLGIGAALNRKL"
FT   CDS_pept        complement(208189..208368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02460"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00068"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM51"
FT                   /protein_id="BAG00068.1"
FT                   /translation="MPSKKTINTTVAKLVPMVTLKGKAVDTRAVVAVKFSYWGEGDKYR
FT                   HGRFDRYLPFSTFP"
FT   CDS_pept        complement(208614..209186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00069"
FT                   /db_xref="InterPro:IPR021256"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM52"
FT                   /protein_id="BAG00069.1"
FT                   /translation="MKIPFLPLKQTESLSKLALIAILAFDDSVSLAGQFPDGRVFFESS
FT                   PTLVNFSATFQSVRAWGAKYYLTIALPPSLGVPLGKVTIQQQPNIQTIAFLLDQTFAFL
FT                   GDRNQRGEKLTLKSTTFDPKTQTITVIFDPPVPPGNTVSIGLKPVRNPDYGGVYQFGIT
FT                   AYPPGENSPGLALGVGRLTIYDAGDRW"
FT   CDS_pept        209338..210465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="MAE_02480"
FT                   /product="DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00070"
FT                   /db_xref="GOA:B0JM53"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JM53"
FT                   /protein_id="BAG00070.1"
FT                   /translation="MYLEHLHLHSFRNYAEQVLKFESKKTILLGNNAQGKSNLLEAIEL
FT                   LATLKSHRVSKDRDLVLESDSEARIFARVNRLYGASELSLILRSSGRRTVIRDRQPLRR
FT                   HLDFLGVINAVQFSSLDLDLVRGGPEARRDWLDTLLIQLEPLYVHILQQYNQVLRQRNA
FT                   LLKEIRKQELEGKVYGDLSQLKLWDLQLAETGSRVTRRRARVLQRLIPLAQKWHESISG
FT                   KTELLELQYIPNVPWVEDDVNGVQRAFLDKIETRRLAEKQLGTSVVGPHRDEVDFLINQ
FT                   NPAKSYGSQGQQRTLVLALKLAELQLLEQIIGEPPLLLLDDVLAELDIERQNQLLDAIE
FT                   DRFQTLITTTHLSSFESRWLQSSQVFSVKKGHIFY"
FT   CDS_pept        complement(210812..211114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00071"
FT                   /db_xref="GOA:B0JM54"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM54"
FT                   /protein_id="BAG00071.1"
FT                   /translation="MEPSGELPPKAFGYLFAALGATTVLLGEALAISAIFSGRFLSRHK
FT                   KYWFSFVIACILCLFTPLGTILGVFTIIVLSRQSVKELYGLSNSNNLASNQDDRD"
FT   CDS_pept        complement(211891..212601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="MAE_02500"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00072"
FT                   /db_xref="GOA:B0JM55"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM55"
FT                   /protein_id="BAG00072.1"
FT                   /translation="MTAIDPVIIMKQEVGKAAANLVQSNSVVGLGTGSTTAYAIEYLGA
FT                   RLQSGEISNIVGVPTSFQAQVLARKYGIPLTTLDVIAKMDIAIDGADEVDPQKNLIKGG
FT                   GAAHTQEKIVDSLADIFVVVVDGNKLVDKLGSTFLLPVEVLPMAMTPVMRKLEALGGKP
FT                   SLRMGVKKAGPVVTDQGNLVIDVKFDSIDDPADLERTINNMPGVLENGLFVGVADLILV
FT                   GEIIDGKPVVREIR"
FT   CDS_pept        complement(212674..213201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02510"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00073"
FT                   /db_xref="GOA:B0JM56"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM56"
FT                   /protein_id="BAG00073.1"
FT                   /translation="MSVRLYVGNLPKESVEREKLQALFADEGDTITTKVIKDRKTGKCR
FT                   GFAFVTVPSDELADQFIEKYNGQSFMENPIKIEKALPRSKGGKEEGEEAEGPEASVETP
FT                   EKVERPTPKPTTAAPRKSSGGGGGGKKRKAERGGNNAPKVTSDGDALQPDPRWANELAK
FT                   LKEMLAAQATNP"
FT   CDS_pept        213775..213975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nblA"
FT                   /locus_tag="MAE_02520"
FT                   /product="phycobilisome degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00074"
FT                   /db_xref="InterPro:IPR007574"
FT                   /db_xref="InterPro:IPR036904"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM57"
FT                   /protein_id="BAG00074.1"
FT                   /translation="MSQPIELSLEQQFNIRSFQTQVEKMSQEQAQDFLIKLYEQMMVRE
FT                   NMYKAFLKHQWGLDSNPWAPQ"
FT   CDS_pept        214424..214990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00075"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM58"
FT                   /protein_id="BAG00075.1"
FT                   /translation="MRGAVQEKLFGSTSLAIAGITDIPLLIFRPQLLSVYTRDELALRC
FT                   QHLWKHLLIPYDGSPDAIYLIEQMEKYAQTRAPGSFEQCLLVRVVENISRDPGVTESRL
FT                   NDARRELESVQVRLEKLGLQVQSEVRQGTPVLEVLTAAEEDDISAIAVATCHRSNMLEW
FT                   LAVRRINEDILHQLWFPLLFFSPKG"
FT   CDS_pept        complement(215225..215623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="MAE_02540"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00076"
FT                   /db_xref="GOA:B0JM59"
FT                   /db_xref="InterPro:IPR014062"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM59"
FT                   /protein_id="BAG00076.1"
FT                   /translation="MKKVMFACRKNSCRSQIAEGFAKTLGAGKIAVTSSGLEAAKVHPG
FT                   AIEVMQEIGIDITDQTSKSIRDFNPEDYDAVISLCGCGVNLPEGWVLQEIFEDWLIDDP
FT                   DGQPIETFRRVRDEIKAKVIGLIEQLSR"
FT   CDS_pept        complement(215647..216294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02550"
FT                   /product="arsenical resistance protein ArsH homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00077"
FT                   /db_xref="GOA:B0JM60"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM60"
FT                   /protein_id="BAG00077.1"
FT                   /translation="MLQSTHKPRILFLYGSLRERSYSRLLAEEAARIITEYGAEVRFFD
FT                   PRELPIYGSVPDTHAKVQELRELSQWSEGQVWSSPELHGNISGIIKNQIDWIPLSIGAI
FT                   RPTQGRTLAVMQVSGGSQSFNAVNTLRILGRWMRMFTIPNQSSVAKAYQEFHEDGTMKD
FT                   SPYRDRVIDVMEELYKFTILLRDQVDYLTDRYSERKEKAAQEIATIAHKAIN"
FT   CDS_pept        complement(216304..217449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02560"
FT                   /product="ACR3 family arsenite transporter"
FT                   /note="ArsB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00078"
FT                   /db_xref="GOA:B0JM61"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM61"
FT                   /protein_id="BAG00078.1"
FT                   /translation="MTNQINPKAAKAGGSLSIFEKYLTLWVIFCILAGIALGRSFPDVA
FT                   QTLDAMSIYNVSIPIAICLFFMMYPIMVKIDFSQALRAARTPKPVILTLVVNWLIKPFT
FT                   MVALAQFFLGWLFLPWLSQTEIIRGQTVSLASSYTAGAILLGIAPCTAMVLMWGYLSYS
FT                   NQGHTLIMVAVNSLAMLFLYAPLGKWLLAANNFVVPWQTIVFSVLIYVGLPLIAGIYSR
FT                   HWIFKHKGRAWFESRFLHYLSPVAITALLLTLILLFAFKGDLIVSNPLHIFLIAIPLFI
FT                   QTNLIFLLSYVAALKLNLVYEDAAPAALIGASNHFEVAIATAVMLFGLNSGAALATVVG
FT                   VLIEVPVMLMLVEFCKKTAFWFPRDPEKATLLDPRCLSSYK"
FT   CDS_pept        complement(217575..217913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02570"
FT                   /product="transcriptional regulator"
FT                   /note="ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00079"
FT                   /db_xref="GOA:B0JM62"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM62"
FT                   /protein_id="BAG00079.1"
FT                   /translation="MFNSLTTSPDSLTQIYTGFQALSDPLRLQILQLLRHQELCVCELR
FT                   DHLDIAQSKLSFHLKTLKEANLVRSRQEGRWIYYSLNLSQFLLLEEYLSEYRRFAALVP
FT                   ARFCEENQ"
FT   CDS_pept        218035..218208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00080"
FT                   /db_xref="GOA:B0JM63"
FT                   /db_xref="InterPro:IPR010284"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JM63"
FT                   /protein_id="BAG00080.1"
FT                   /translation="MVLTRLALKIIVNRLGDIMELFAALNLEPIFQLTFVALIMLAGPF
FT                   VIFLLAFRGGDL"
FT   CDS_pept        218491..220047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02590"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00081"
FT                   /db_xref="GOA:B0JM64"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM64"
FT                   /protein_id="BAG00081.1"
FT                   /translation="MIIKNNPYYRAVIGFWVAFLVFWGFGSFSPLLAQAKEQSADVQSI
FT                   TPYLKQFQQKITEFRLDNGLKFIILENRDAPVISFVTYADVGGADEPDGKTGVAHFLEH
FT                   LAFKGTKTIGTSDYLSEKKVLDRLEAIDKELQAAKKAGKSAEVTKLTEEFQKTKAESEK
FT                   FVQRNEYGQIVETQGGVGLNATTSSDATSYFYSFPSNKLELWMSLESERFLEPVFQREF
FT                   YKEKDVILEERRMRTDNSPLGLLIEAFLDQAYTVHPYKRPVIGYDRDIRNLEPSDIQNF
FT                   FDKFYAASNLTIAIAGDVDPEQVKQLAKVYFGRFPAKPKPPQVTVVEPDQTKTKEITLK
FT                   LASQPWYLEGYHRPALNHPDHAVYEVIATLMSEGRTSRLYKALVEDKQLALAAQGFNGF
FT                   PGDKYPNLLLFYALTAPNASVEEVAQGLNLELERLKNEPVSEQELERVKNQLRAALLRG
FT                   LDSNMGMARSLIEYEVKTGDWRNLFAQLDAYNAVTAADIQRVAKETFTPENRTIGRILP
FT                   K"
FT   CDS_pept        220255..221703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02600"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00082"
FT                   /db_xref="GOA:B0JM65"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM65"
FT                   /protein_id="BAG00082.1"
FT                   /translation="MKKRLQWLGLILITLIGVLAFRSPAIAQTPRHFTDLTFPPLPEVT
FT                   VPQYERYQLDNGMVVYLVEDRSLPLVSGTAMIRTGGRLESGEKVGLADITGTVLRSGGT
FT                   EKHPSNVLNQLLEQRAALVETSIDLNAGTASFSALSEDLEAVFNLFAEVLRSPAFESQR
FT                   VELAKVQEKGAIARRNDDPDDIASREFKKLVYGDNSPYARTVEYSTLANIDRQDLIDFY
FT                   RTYVRPDQIILGIVGDFDSQSMKALINKTFGDWKNPATATKIVTPSATQKNLQGVFVVN
FT                   QPQLTQSSVLLGHLGGRLDSPDYPALTVLNEILSGFGGRLFNEVRSRQGLAYSVYGIWN
FT                   SRYDYPGLFIAGGQTRTDATVPFIKAILGEIERLRNQPVTAKELEDAKNAILNSFVFKF
FT                   EKPAQNLSRLMTYEYYGYPQDFIFRYQQAVKGVTIADIQRVAQQYLQPNQIVTLVVGNE
FT                   QEIQPPLSSLGTTVKTVDVTITQI"
FT   CDS_pept        221777..222031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00083"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM66"
FT                   /protein_id="BAG00083.1"
FT                   /translation="MTLQLTINYPEKLPDFLQKTREEFEREATWAMVVKLFEMKRISSG
FT                   MAANLLGVDRVNFLLRLTDFGVGMIDLTEEELLSDLENA"
FT   CDS_pept        222382..224823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02620"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00084"
FT                   /db_xref="GOA:B0JM67"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM67"
FT                   /protein_id="BAG00084.1"
FT                   /translation="MMLLQDVARTSREQALILWFEEVDSKDVGLVGGKNSSLGEMIQQL
FT                   TPKGINVPTGFATTAYAYRHFVEKAGLDAQLRQIFQDLDENDVQNLQEKGKQARTLILN
FT                   TPFPDDLSHAIAIAYRRLCERYGDDLYHSIDVAVRSSATAEDLPEASFAGQQETYLNVQ
FT                   GVRGVLEACHKCFASLFTDRAISYRHHNGFDHFAVALSVGVQKMVRSDLATSGVMFSID
FT                   TETGFKNATLITAAYGLGENVVQGAVNPDEYLVFKPTLKNGYKPILDKRLGSKAIKMIY
FT                   DDGGSRLTKNIRVNKLEQDQFCISDQEILTLARWTTQIEEHYSQVRGTYTPMDIEWAKD
FT                   GITGELFIVQARPETVQSQKAANILKSYEIKQRSQVLAVGRSVGAAIGQGKARVILSVD
FT                   KINNFKPGEVLVTNRTDPDWEPIMKQASAIVTNQGGRTCHAAIIAREMGIPAIVGCNNA
FT                   TETIKTGQEVTVCCAEGDEGKVYLGLLPFEIIETPLDNLPQTRTKILMNIGNPEKAFAF
FT                   ADIPAQGVGLARLEFIIANHIQAHPSALLKFHELEEGDVKDQIAELTKHYEDKPQFFVD
FT                   KLARGIAMIAAAFYPKDVIVRMSDFKSNEYANLLGGKPFEPKEENPMIGWRGASRYTDP
FT                   NYREAFALECRALKMVREEMGLTNVIPMIPFCRTPEEGMRVLEEMAKNGLERGVNGLQV
FT                   YVMCELPSNVILADQFAQVFDGFSIGSNDLTQLTLGLDRDSALVAHLFDERNEGVKRMV
FT                   KMAIETAKAQNRKIGICGQAPSDYPEFAQFLVELGIDSISLNPDSVLKTLLMVAAVEQG
FT                   Q"
FT   mobile_element  225157..226798
FT                   /mobile_element_type="insertion sequence:ISMae5_1"
FT   CDS_pept        225279..226688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02630"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00085"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:B0JGQ5"
FT                   /protein_id="BAG00085.1"
FT                   /translation="MEKWAAQELQYADLGDTRRKKRLISIVENLASQPSTSVPQASGNL
FT                   AAASATYDFWNSPYFHPSDIIAAQAKSTVERIKEHPIVLAVQDTTSLDFTTQKAKKGMG
FT                   YLDYKKSFGLKVHTTLGVSPVGIPLGLINQYVWAREEKNLGIAKQRKKRETQEKESQRW
FT                   LDSLSETQQQIPEDIQVVTIGDCEADIFDLFAQSRSPNSHLLIRGTHNRKVNYLEDKQR
FT                   SGHSEPKYLHQSIREIKACGTLDVQVKRNPNHEARLAKLTVRFASFEIQVPSHHSKATP
FT                   RQPVKLQVILAEEENPHSGVNPISWLLLTSLDISSFESAITCVRWYSYRWLIERYHFVL
FT                   KSGCGLEKLQLETGRRIEMALATYSIVAWRLLWLTYQARLHGEESCESFLEEHEWQSLC
FT                   ATIHKKSPPPEKPPSFREAVRMIASLGGFLGRKGDGEPGVKTIWLGLRRLHDISQTWKL
FT                   SHQISPPIEPP"
FT   CDS_pept        226863..227126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02640"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00086"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM69"
FT                   /protein_id="BAG00086.1"
FT                   /translation="MDDKTTKPEASESEEKKESDFEQESKQAEVWTGKITAFVAHQLRT
FT                   SAPSLPIVGGSITGILTWLSQHDTVKAIIVGGVTFIVTGFFT"
FT   CDS_pept        227754..229241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00087"
FT                   /db_xref="InterPro:IPR008629"
FT                   /db_xref="InterPro:IPR037215"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM70"
FT                   /protein_id="BAG00087.1"
FT                   /translation="MFDGFDEVKPEYAEKVSQWIGKQWHDFRQNYFILTSRPKGYQAFR
FT                   SEHKPRQKVFINEFTDKNIRDFVYKWYFWQEQETRVSRSLKAKQEAADNKAKDLINQLF
FT                   ALDDSEESSTLLALARNPLNLNMIVQLHRANFGSGQKLPQQRVDLFRRIFDLQLITRPQ
FT                   ARGIDMILDNNEENHRQRVLQQLALKMGNTTTIEYSELLSSIQNFIQELGYPESTSAKD
FT                   FVERLIHVSELILKRDEYYEFAHNFFQSYLIALEVKRLKQENLLWENWEQNLWYEACIM
FT                   YATLLINPTDFIVYFYNKEDNPKAQGLAERCYRELPVKKRRGLEFLEQKRQTSLFTQLE
FT                   TYLKNGQWREADEETARLMLLIAKREDEGWLDEESINNFPCEELRTIDKLWVDNSGGKF
FT                   GFSVQKKVWLDCGGVPGKYDYEVYEKFADEVGWRRGGDWLSYDQLTFLLDGSKHAHLPH
FT                   LIYGWDIKEWVDRGVEVRISFLAQRLVTCNISQTYTS"
FT   CDS_pept        229430..229864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00088"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM71"
FT                   /protein_id="BAG00088.1"
FT                   /translation="MQLTNHHHLPYNPKLVERAKELRKNMTKAERKLWYEYLKNFQYRV
FT                   HRQRPIDQFIVDFYCPELKLVIEIDGDSHNREDAQNYDLERTQILSGYGLTVIRFTNQE
FT                   VLSNFEGVCGVIGSLIPPTPLDKGGFDPSLLRGFDPPNPP"
FT   mobile_element  229952..231374
FT                   /mobile_element_type="insertion sequence:ISMae36_4"
FT   CDS_pept        230134..231348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02670"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00089"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM72"
FT                   /protein_id="BAG00089.1"
FT                   /translation="MILDKFLNLKGTCIQGYLHLENIGIVCRIESKNQKATCPRCGLES
FT                   DKLHQNHRHLVKDLPISGQPVYLQVNRRQFKCDNCQRPFSEELDFVAKKRTYTKRLAAN
FT                   ILEQLKEGDILNVSRINDVTEEEIQRMIEDIAEEITEPDLSELKRLGIDEIALVKGQKN
FT                   YCAVLVNLDTGKLIAILEKRTQEELRETLTGWGKEVLEQIEEVSIDLWLPYKNLVKELM
FT                   PSAEVVADRFHVMKQINQELDEQRRAEKRAVEAQKNKKQKAEKEAKLEVLKRSKYSLLK
FT                   NEEDLTEPQKIKLEAIKEKFPNLKKMQELKEEFRKIYETSENPTEGMLSISEWLAKSSS
FT                   VFTKSCQTIRNWFGEIISYFERRTTNGVVEGINNKLKLIKRRGYGFRNFRNFWVRSMLS
FT                   WHLVC"
FT   CDS_pept        complement(231430..232662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02680"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00090"
FT                   /db_xref="GOA:B0JM73"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM73"
FT                   /protein_id="BAG00090.1"
FT                   /translation="MADRNCQSKWLSIIGIGEDGLEGLSSVGRSLLSLASVIVGGERHL
FT                   AMLPSEDQRQKLLWTSPIQDSVNEIIRRRGQSVCVLASGDPMCYGIGVTLTRQIPLEEM
FT                   TIIPSPSAFSLACSRLGWPLSEVETLSLCGRPPAWLNGVLYPGAKLLVLSADAQTPAIA
FT                   ARLLREGGFGESRITVLEHLGGTLERHIEGIANDWQFTYLADLNVIAISCISSHPPTLA
FT                   PRLPGLPDSAYHHDGQLTKREVRAITLSTLAPLPGQLLWDVGAGCGSIAIEWLRSDRRC
FT                   QAIAIEHHPTRLQYIADNAAALGTPHLQIVAGIAPSALEDLPQPDAIFIGGGITTPHLL
FT                   ETCWLALRPGGRLVANTVTIESELVLLQWHSKLGGELLRIGIEKAEPVGKFLGWKAMAP
FT                   VTQWTVQKPRL"
FT   CDS_pept        232762..233283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00091"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM74"
FT                   /protein_id="BAG00091.1"
FT                   /translation="MTTTADDVWRLLAELVEAQKETERCFQETERRFQETERILKEQSL
FT                   ETERRFQETERILKEQSLKTDRQITRVSQEIGNLGGKWGRFVENMVAPACETLFLNRQI
FT                   PVHQVSQRVRKRLDGKTLEIDVLVTNENHVLVVEVKSSLSVDDVKELIKNLTEFRQFFQ
FT                   NITTNNYMGQ"
FT   CDS_pept        233466..234080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00092"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM75"
FT                   /protein_id="BAG00092.1"
FT                   /translation="MTTTADDVWKLLAELVEAQKETERCFQETERRFQETERRFQETER
FT                   ILKEQSLKTDRQITRVSQEIGNLGGKWGRFVENMVAPACETLFLNRQIPVHQVSQRVRK
FT                   RLDGKTLEIDVLVTNENHVLVVEVKSSLSVDDVKELIKNLTEFRQFFPEYNHKQLYGAV
FT                   AGIEIEEGADKYAYRQGLFVLAQRGENVAILNDTEFQPKTW"
FT   CDS_pept        234138..234707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00093"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM76"
FT                   /protein_id="BAG00093.1"
FT                   /translation="MTTTADDVWKLLAELVEAQKETERCFQETERRFQETDRQITRLSQ
FT                   EIGNLGGKWGRFVENMVAPACETLFLNRQIPVHQVSQRVRKRLDGKTLEIDVLVTNENH
FT                   VLVVEVKSSLSVDDVKELIKNLTEFRQFFPEYNHKQLYGAVAGIEIEEGADKYAYRQGL
FT                   FVLAQRGENVAILNDTEFQPKTWYNI"
FT   CDS_pept        235352..236317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirA"
FT                   /locus_tag="MAE_02720"
FT                   /product="ferredoxin--nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00094"
FT                   /db_xref="GOA:B0JM77"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM77"
FT                   /protein_id="BAG00094.1"
FT                   /translation="MDWQHRYNEIQLSAITVNNPTNLTSLVCFRLALGGDKQFYDTDLL
FT                   IEPENCLAVVKALVKVYIDYVQQNPNIKGKKPRMKHLLKDWGLAKYLEQVNSQLHRTST
FT                   GIIKGQEYRQAAHSTQPYFHLGIHPQKQPGLSYIGLSLRLGQLTANQLWGLATLSETFG
FT                   SGQLRLTPWQTVILPDIPDEKVSELLPKLAFLGLSASLGWDAGIVACSGKPGCAAAATA
FT                   TQIHASLLADYLKERLTCNSPVNIHLTGCAKSCAQPGPAEITLLGTTIEENGQILEAYQ
FT                   VYVGDSQKFLETPIFEGEFTKIPPLIAQILSSQNSKILDK"
FT   CDS_pept        236319..236945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="MAE_02730"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="precorrin isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00095"
FT                   /db_xref="GOA:B0JM78"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM78"
FT                   /protein_id="BAG00095.1"
FT                   /translation="MEYIKNGEEIYRKSFAIIRAETNWENLPDDLAPVAVRLIHSCGMT
FT                   DITKDLEASPDAVKIGRNALAGGAAILCDSQMVANGITKARLPKDNPIICTLNHPEVTE
FT                   LARQINNTRSAAALELWRPHLAGAVVAIGNAPTALFRLLELLDQNVDKPALILGFPVGF
FT                   VGAAESKIELATNSRGVPFITLHGRRGGSAIAAAAVNALAKENEL"
FT   CDS_pept        236942..237646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="MAE_02740"
FT                   /product="precorrin-2 methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00096"
FT                   /db_xref="GOA:B0JM79"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B0JM79"
FT                   /protein_id="BAG00096.1"
FT                   /translation="MNKLGKLYGLGIGPGDPELLTLKAHRILTTVPVIAYPTLESGKVL
FT                   ARAIVSDFIRPEQIEIPMPLPFSVERSSQPHYDIAAENIAEQLKLGLDVAVLCVGDPML
FT                   YGTFMYIFNRLCDRFSIEVVPGISSVMASAAMLGVPITYRNDVFSIMPATLEAEILRDR
FT                   LAFIDAAAIIKLGRHFAKVRNILEELGLLERALYIERATLPNQQIIPITEVDPEAATYW
FT                   SLILIPSKTKPQ"
FT   CDS_pept        237984..240641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00097"
FT                   /db_xref="GOA:B0JMT3"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT3"
FT                   /protein_id="BAG00097.1"
FT                   /translation="MSDSPESIRNTSVSDQATNNDALGFEPYVIAIAEFLLHQQTQPPL
FT                   TLSVEGEWGSGKSSFMKMLEEYLRKKGGRTVWFNAWRHDKAESVWAAFALSFIKQISTP
FT                   KNWRDLPRIILVHFKLQLLRFNLEKGLFELIKALPVIIFVICASIAIPFILIGYGVEGI
FT                   NELIRATTSQDVFWSKINSVFKLLFTAVGVTLSGAGIFAGIKSLLRNFQRLLQNPKNNL
FT                   IKYIEAPDYKKQSAFVEEFHEDFAKIVDAYVGNDRVYVFIDDLDRCEHPKSADLMQAIN
FT                   LMIADDPSVVFILGMDREKVAASLAVKYENILKYLPSETTEIDPDILARRSANKGLAYG
FT                   YTFIEKFVQLPFLVPQPSRSDFERFLIQLATSTPPNLQPAKPRFTFFQSFWGKFKLALP
FT                   WRNNSQKHLTSATSNQTSDLKNLSLDNPSIESEQTEKEKARASVIKRLEAIQVNKSDNR
FT                   DSQTVRNIIMMVAPALDYNPRRIKHFINVFRLKVYIANETGLFFEERDENDNLLDPSLT
FT                   FEQLGKFTAISLKWPLLLSDLENDKRILAKLEEFALDEEKTKEYEESLRYWGSHIKLKA
FT                   LMAYGHDKLAANSKFSLAEVNVDKLLQVSPKVIRLDNEPIQQKQISDIEIIQKITSLPH
FT                   IKISQNITSLPPDFHLEMVDIPAGKFNMGSNQYEDEKPIHEVIVPAFQIGKYPVTQAQY
FT                   QAVMGYNPSIAAYYPLKFSGNPQNPVESISWFNAQAFCENLSQLTGKNYRLPTETEWEY
FT                   ACRAGTETLFSFGDDKDKLGDYAWFRANSNNTTHPVGEKQPNPWGIYDMHGNVWEWCAD
FT                   EYHESYVNKPENIKENGSIPWYGGYLSTKPSLRGGACDSYPGLCRSAYRGDSDVHGQGH
FT                   GFRVVCDLPQSVNS"
FT   CDS_pept        240969..241208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00098"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT4"
FT                   /protein_id="BAG00098.1"
FT                   /translation="MRAIETTGILNTQGQIQLDHPIPQEKDRFVRVILLMSEDELNEKN
FT                   WLDAVSHNPSFAFLQDTEEDIYTLNDGQPVTNEG"
FT   mobile_element  complement(241320..241534)
FT                   /mobile_element_type="MITE:MaeMITEa009"
FT   CDS_pept        241473..241646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00099"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT5"
FT                   /protein_id="BAG00099.1"
FT                   /translation="MIDKNSKSLNQQGFYHYSASPNYQSYSRKSPSYRYYSETRKSRFY
FT                   DQWSSPIVSHQT"
FT   CDS_pept        242145..243293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02780"
FT                   /product="SMF family DNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00100"
FT                   /db_xref="GOA:B0JMT6"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT6"
FT                   /protein_id="BAG00100.1"
FT                   /translation="MTDDRVYWLAWSSIAGVGSISLKRLYQHFGSVAVAWNATDTAIAE
FT                   VAGFGKKLMVAVREGRSQIDPEALFAEHIQKNPLFWTPSDPEYPRFLWEIPSPPPLLYY
FT                   QGKVNLEENQGNIPTVAIVGTRNPTDHGRRWARRLSTLLAQQGFTIVSGMAEGIDGEAH
FT                   QSCLKAGGRTIAVLGTGVDVVYPSRHRQLHADIQKQGLVISEHPAATQPNKAHFPSRNR
FT                   IIAGLSRATIVIEAPERSGSLITANYANEFGGDIYALPNSPDIAAARGCLQLIHQGAEI
FT                   IVSEEKLLEMLGAIPTTNQSAPVNLSPSLPLETSPAFNPAPPVNLEPRLAQVYQLFDRD
FT                   ALLFDIIVEKMQIPTSEVAGILLELELMGLVTQLPGMRYQKT"
FT   CDS_pept        complement(243290..243622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="MAE_02790"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00101"
FT                   /db_xref="GOA:B0JMT7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT7"
FT                   /protein_id="BAG00101.1"
FT                   /translation="MSEVPAVTDANFKVEVLDSADLVLVDFWAPWCGPCRMVAPVVEEI
FT                   AKQFEGQVKVVKLNTDENPIIASQYGIRSIPTLMIFKEGQKVDMVVGAVPRTTLANTLN
FT                   KLLGVN"
FT   CDS_pept        244000..245205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02800"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00102"
FT                   /db_xref="GOA:B0JMT8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JMT8"
FT                   /protein_id="BAG00102.1"
FT                   /translation="MKILVLNAGSSSQKSCLYDLEFLPGHPPQPIWQAGIDWTVNPDYA
FT                   VLTVKAQGIKQEINLSSQDRPAGIARMLDTLVTGETKVVANLADISIVGHRVVHGGTEY
FT                   SQATMITPQVKETIKKLIPLAPSHNPAHLEGIEAIEQVLGDVPQVAVFDTAFHRSIPPE
FT                   SSLYPIPYQWSELGIRRYGFHGTSHQYCSQRAAELLGKPLESLKMVICHLGNGASLSAV
FT                   KGGKSIDTTMGFTPLEGLMMGTRSGSIDPGILIYLEREYQYNPDSLNSLLNKESGLKGI
FT                   SGISGDMRAITTAMAEGNERAKLAFEMYIHRLKSLIGSMIASLEGLDVLVFTAGIGENS
FT                   ALVREKASQGWSFFGLELDLAKNAARPRDEDIASETSKVRVMVIATAEDWAIARECWHL
FT                   SP"
FT   CDS_pept        complement(245209..245760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00103"
FT                   /db_xref="GOA:B0JMT9"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMT9"
FT                   /protein_id="BAG00103.1"
FT                   /translation="MNNYQPEDVQWIKSLLRHDDSDSNSATEDILFLDEDNEEAHRFDL
FT                   ISAYIDNEVTVEERKLVQHWLDHDAAAKKLYQQLLGLQTNLKQIPVPATMASDRLAEQV
FT                   FRKVDGQRRRQYYVYGGAIFTAMAIAVGSYFVSGRNDPLSQMASSPSSISQEGDHLMIA
FT                   LNHPIMEIPATEQPKENGQR"
FT   CDS_pept        complement(245874..246530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02820"
FT                   /product="RNA polymerase ECF-type sigma-E factor"
FT                   /note="group 3"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00104"
FT                   /db_xref="GOA:B0JMU0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU0"
FT                   /protein_id="BAG00104.1"
FT                   /translation="MSQSIPASWSLEAKKSQNPVSPDKLSNYDLIARCQEGCQPDRAAF
FT                   AELLRRYQAHIDKLLYHLAPDWQDRADLAQEVWIRVYRNINRLHEPLKFRGWLSRIATN
FT                   LFYDELRKRKRVNHPISLDAPRRVEDGEIDWDIESDYPSPDEHLTTHEFYDQLQAAIAD
FT                   LPEAFRTTIILREIEGMAYEEIAEMTGVSLGTVKSRIARARAKLQSVLQPYFTEG"
FT   CDS_pept        complement(246562..246723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02830"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00105"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU1"
FT                   /protein_id="BAG00105.1"
FT                   /translation="MYSPHYPTTPLPHLLLPCSLAPPDECPDRLESKYGKKIIYFREPL
FT                   LNSPVLKL"
FT   CDS_pept        complement(246769..247359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02840"
FT                   /product="fibrillin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00106"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU2"
FT                   /protein_id="BAG00106.1"
FT                   /translation="MDAKAKLLELIAGRNRGLLATESDRVRILAAIEQLEDHNPHPHPL
FT                   EVKQLLGGNWRLLFTSSRNILGIDRLPFLQLGQIYQYLDLNKAKLYNIAEIIGVPWLEG
FT                   AVIVSATFEPTSERRVMVKFERSILGLQRLLNYHSPQEFIEAIESGKKFPPLDFSFNNR
FT                   QQTGWLDITYLDEDLRIGRGSEGSVFILAKEKT"
FT   CDS_pept        complement(247661..247966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02850"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00107"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU3"
FT                   /protein_id="BAG00107.1"
FT                   /translation="MTDIHARMLAKPVFVVTRIKKNGVMLILSSITPVRLSSANFLPFF
FT                   NPGAIFIHPTAPKLVGVISGTFYAVLPTVSSDNRFPIPVPRDWKICVFFTKNCKYH"
FT   CDS_pept        248343..249434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02860"
FT                   /product="putative zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00108"
FT                   /db_xref="GOA:B0JMU4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU4"
FT                   /protein_id="BAG00108.1"
FT                   /translation="MSVLIAIGVLALLIVVHEFGHFAAARWQSIHVNRFSIGFGPALAK
FT                   YQGKETEYALRAIPLGGYVGFPDDDPDSQIPNNDPDLLRNRPVFDRAIVISAGVIANLI
FT                   FAYFLLVTQVATVGFPQINYQEGVIIPEVFTAENSVAKQAGMKAGDIVLAINDQPLGAS
FT                   QNAIIDFRDIIQSSPDQPLKLTIKRPTETINLIVTPELGSDGQGKIGVRLAPNGEETRL
FT                   KADNFGQAFSLGAGEFQRLTLLTVQGFGQLVSNFKDSVQQVAGPVKIVEYGAAIARNDA
FT                   GNLFQFAALISINLAVINILPLPALDGGQLVFLLIEALVGKPLPTKLQDNIMQTGLVLL
FT                   LGLGVFLIVRDTANLAVFQDLFQ"
FT   CDS_pept        249434..250090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02870"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00109"
FT                   /db_xref="GOA:B0JMU5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU5"
FT                   /protein_id="BAG00109.1"
FT                   /translation="MDSRKKTEPQLRALEILSNLKRLYPEATCSLNYQTPVQLLVAVIL
FT                   SAQCTDERVNKVTPALFARFPDAKSLAFAEREELETLIRSTGFYRNKAKNIQGACQKIL
FT                   KDFQGEVPKTMGELLTLPGVARKTANVVLAHAYGIIEGVTVDTHVKRLSNRLGLTTNND
FT                   PVKIERDLMALLPQPDWETFSISIIYHGRAVCKARNPACFSCQLASLCPAANSNQ"
FT   CDS_pept        250247..250825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02880"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00110"
FT                   /db_xref="GOA:B0JMU6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU6"
FT                   /protein_id="BAG00110.1"
FT                   /translation="MSQGSRQEIKTQAIILATFVAIFWLLEILDQFVFRGSLDIFGIIP
FT                   HQVIGLRGILFAPFLHGDFPHLIANTVPFLILGWLVMLQETSDFFIVTGLTMLVGGLGV
FT                   WLFATPGSIHIGASILIFGYLGFLLLRGYFQRNIPSILLSILVFLLYGGTIWGVLPSRP
FT                   GISWQGHLFGFLGGVLAAKLIATEKKHYP"
FT   CDS_pept        complement(250822..251148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00111"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU7"
FT                   /protein_id="BAG00111.1"
FT                   /translation="MPEFLDFLKHKYAYVAIGEFKPGCFSEAQKLYEKAVSTYSTGFQG
FT                   AFLLQKPGTDEGIAVIIWDKIDDMEANKSEAHELLLKSMAPLFAKPPVTDFYEVCSEIE
FT                   GSPI"
FT   CDS_pept        251309..251851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02900"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00112"
FT                   /db_xref="GOA:B0JMU8"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU8"
FT                   /protein_id="BAG00112.1"
FT                   /translation="MIKIVGINGSLRPGSYSAMALEVAISRVQGLGVETEIIDLRKLSL
FT                   PFCNGGDDYSDYPDVAKMQQTVKSAAGLILATPEYHGSVSGVMKNALDLMSFEELSGKV
FT                   AGLISVLGGQSNSNALNDLRIILRWVHAWVIPEQIGLGQAWKVFNEEGEILDEKLSQRF
FT                   DAFARSLVDNTRKLNEI"
FT   CDS_pept        complement(251838..252194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02910"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00113"
FT                   /db_xref="GOA:B0JMU9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMU9"
FT                   /protein_id="BAG00113.1"
FT                   /translation="MDTIHFTGIRAYGYTGYLAEEQVLGQWFEVDLSLELDISIAGKSD
FT                   AIEDTLDYRQAIKIVKHQIETSKFALVEKLATVIAEDILQLDRVRQVRVQLSKPAAPIP
FT                   HFTGKITIDITRSR"
FT   CDS_pept        complement(252478..252633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02920"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00114"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV0"
FT                   /protein_id="BAG00114.1"
FT                   /translation="MYLAKVFDVPYHLLHSELGIAVMLTAKINSERFCAISEINPNVKN
FT                   CTTLLS"
FT   CDS_pept        complement(252646..252930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02930"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00115"
FT                   /db_xref="GOA:B0JMV1"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV1"
FT                   /protein_id="BAG00115.1"
FT                   /translation="MQVVAVQSIEHNFGHGKQHLASFLLTLNLLAFLFHTVLHLVDERY
FT                   QRTRLQRGTRRGFFQDVICLTKYLLFESWHHLLDFMLDDAVPIALVNSS"
FT   mobile_element  252903..254045
FT                   /mobile_element_type="insertion sequence:ISMae22_1"
FT   CDS_pept        252996..253454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02940"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00116"
FT                   /db_xref="GOA:B0JMV2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV2"
FT                   /protein_id="BAG00116.1"
FT                   /translation="MINLEFTEEEKNSLYYERFHHPHPRVQLKMEVLWLKSQKIPHQKI
FT                   CQLAGISPNTLLTYLRDYQEGGIEKLKEINFYRPKSELESQKETLKKYFEKNPPATINE
FT                   AVYRIEELTGIKRSPTQVRKFLKSMGMKCLKVGSLPSKADQDEQEDYK"
FT   CDS_pept        253533..253784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02950"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00117"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV3"
FT                   /protein_id="BAG00117.1"
FT                   /translation="MGAFLGFVWCFERLFVKSPSGRKRFNVLGALNAITHEVIMVTYDT
FT                   YITATQVCELWSKIAALGLIITITLVLDNARYQKCKSC"
FT   CDS_pept        253800..254039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02960"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00118"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV4"
FT                   /protein_id="BAG00118.1"
FT                   /translation="MSIELLYLPSYSPNLNLIERLWKLVKKKCLYGKYYENFSDFSSAI
FT                   YECLNDAHMKHKKELDSLLTLRFQKFNKSQIMNV"
FT   mobile_element  254097..254300
FT                   /mobile_element_type="MITE:MaeMITEa010"
FT   CDS_pept        complement(254359..254814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00119"
FT                   /db_xref="GOA:B0JMV5"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV5"
FT                   /protein_id="BAG00119.1"
FT                   /translation="MNNFKILLIGYGNTLRNDDGVGVRIAEIIAEENLPNVQVIATHQL
FT                   TPELAADIADASLVIFVDAVLSNQTDIRIEKLAAVTEWNNLGHAESPASLLALTQAIYQ
FT                   QTPRAWGIFIPAINFEFGEELSTITQKGLTNAIKAIRKIILNLVIKD"
FT   mobile_element  complement(255110..255317)
FT                   /mobile_element_type="MITE:MaeMITEa011"
FT   CDS_pept        complement(255319..255798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00120"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV6"
FT                   /protein_id="BAG00120.1"
FT                   /translation="MFALVSLDKIELPAGSLVRLPATWLDYQTLSRQRGDNSQPKIKYH
FT                   NGEVLLMSPLPKHGRDAHLIANIIITLLDYLGREYEAFTPVTMELPETSGIEPDYSFYI
FT                   DHWPAIAGKARIDWVNDPPPDLVLEIDVTSYSNVDDYLPYQVPEIWLYRQKNLYI"
FT   CDS_pept        255954..256637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00121"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV7"
FT                   /protein_id="BAG00121.1"
FT                   /translation="MLSTNTVSPHIIPPLKNGDRLTRPEFERRYQAMTQLKKAELIAGV
FT                   VYMAAAVRAKNHGKPHANIIGWLTAYEVATPGVETLDNTTVRLDGDNQPQPDALLRIET
FT                   GGQSSISEDDYVEGAPELIVEIAASTASYDLHEKLKVYRRQGVQEYIIWRVYDVQLDWF
FT                   GLTDGEYLPLESNQNNIFCSQVFPGLWLNKNALLSGNLAEVLAVLQQGIASEQHQNFCQ
FT                   TLANK"
FT   CDS_pept        complement(256661..258073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03000"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00122"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV8"
FT                   /protein_id="BAG00122.1"
FT                   /translation="MVNKRKSRLKSGKSSKLAAKPVKKRRLSGKWFLTALGLTGCALVS
FT                   ATAGAMLAVSLSSTPLRQAALSPQEAAAFNNQQAISYQNLQLPALNRPVNILVVGAKVL
FT                   TSDVKEAQTPDLGYHAPVNSLDGLTDTMLLLRFDPQRQKLTMLSIPRDTRTDIEGYGEK
FT                   KINEANALGGPALTAETVSHLLDGVAIDRYIRINVQGVEKLIDALGGVTVYVPKDMKYK
FT                   DFSQHLYIDLKKGEQHLNGEKFLQFARFRYDANGDIGRIQRQQQLMRSLVEQTLKPATL
FT                   LKIPDIIEVIRNHIDTNLSLEELLALAGFASKTQRADVQMLLLPGDFNGDGRQGISYWL
FT                   PNQSKIQELVAQHFNHGSFMADIEETTQPTRIAVEDSIDNPEAVQALVRYLRSFGYENV
FT                   FVSKSSSPILETTKIIAQKGDNSLAAALHNSLGVGEVLVESTGNLASDVTIKIGQDWQE
FT                   KSANLSEPSLGN"
FT   CDS_pept        complement(258190..258381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03010"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00123"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMV9"
FT                   /protein_id="BAG00123.1"
FT                   /translation="MGFWGFSSISPLPHFPLPTSHFPLPHFPLPHFPIPHSHETNPRYF
FT                   DKIAMQKNYKEKFCYIIC"
FT   CDS_pept        complement(258446..259030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03020"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00124"
FT                   /db_xref="GOA:B0JMW0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW0"
FT                   /protein_id="BAG00124.1"
FT                   /translation="MSNPSDSEATGDNAAITVEVRLAQSQDLKSLAEILTDSFFPTANY
FT                   WSFLRPIFKLGIYEDLRGRLRADTPYYHCLVVSQTSVTVTGPQEIIVATAEIALKSSSF
FT                   LAVPIPYISNLAVSPDRRRAGLARRLLLKCEQIAREWGFEELSLHVLDNNLAAQSLYSS
FT                   SGYRLQKTDGWLINWLFNRPQKLFLHKKISQ"
FT   CDS_pept        259373..260614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03030"
FT                   /product="signal transducer AmpG homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00125"
FT                   /db_xref="GOA:B0JMW1"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW1"
FT                   /protein_id="BAG00125.1"
FT                   /translation="MIKEISAYLQVFRSQKMAALLFLGFASGLPLLLTSRTLQAWMTTE
FT                   EVPLESIGLFSLFALPYSLKFLWSPLLDRYVPPFLGRRRGWILIAQICLTLAIGFMAFQ
FT                   QPKQSLELLAINALLIAFFSASQDIAYDAYRTDILEKWEMGAGVAIGVLGYRLALILTG
FT                   SIALILADHFPWPLVYLFLAGLMALTIIWSFFAPATPPRDDTPQTLLEAVWLPFQEFFQ
FT                   RYRLGQGIGILAFIVLYRLGDALVNNMVTPFLLKTGFSQTDIGAIQGGMGMIATMVGVL
FT                   LGGSLLSRWGINRSLWIFGGLQAISNLAYFTLANLGQNYPFMVLAINIENFCGGLVTAA
FT                   FVAFLMSLCNARFTATQYALLSSLMAFSRDILVAPAGVLAEAIGWQWFFLITVIAALPG
FT                   LALLPLFAPWQEDN"
FT   CDS_pept        complement(260628..262052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03040"
FT                   /product="serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00126"
FT                   /db_xref="GOA:B0JMW2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW2"
FT                   /protein_id="BAG00126.1"
FT                   /translation="MLSEPEPSDTLTTPTVNMGDHSTDIKPILALKELVASLYREQNKV
FT                   QNLLSSLGFALRSFNNLNQFLDLTPLMAARVADAEGGALILSKNNGQVALDQLHCQDNQ
FT                   INGELRRQLEAIIRQLNQEPALENKNNRSLLDSLDHKIRQTLGQGTQVYSTPVLVKNSE
FT                   RGRLYVFSRDPDYGWTPTRRKLLQLVADQTAVAIANNELTIELRSKERQDRELEIAAEI
FT                   QNRLLPRQCPKIQGVELAAHCQTANRVGGDYYDFIPCNYDQFKPATEAEREASAAPWSI
FT                   VIGDVMGKGVPAGLLMTMTRGMLRAEVLNRHSPAQILRHLNRVMYADLDNSHRFVTLFY
FT                   SEYDPLTRRLGYSNAAHYPTLWWRAKTGELESLDTEGTLVGLEADSIYDDAQVQLEAGD
FT                   TLIYYTDGFTDAVNSKGERFDQKNWLSAVKEACQQYTDPEQILEYLFGKVAAFTGLGND
FT                   SSDDMTLVVMRVKSEE"
FT   mobile_element  complement(262185..262782)
FT                   /mobile_element_type="insertion sequence:ISMae14_1"
FT   CDS_pept        complement(262200..262850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03050"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00127"
FT                   /db_xref="GOA:B0JMW3"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW3"
FT                   /protein_id="BAG00127.1"
FT                   /translation="MSFYIRVSPLITPVHCITQTEEPKQLNRLNKKKSKKYRKGKKQSR
FT                   NYHKARKRYARKHLRVSRQREEFVKSVALRLVKSNDLIVYENLNIKGMVKNRHLAKSIT
FT                   DAGWSVFRQWLEYFGDKYGKLTIAVSPHNTSQNCSNCGQKVQKSLSTRTHVCPHCGYTD
FT                   CRDRNAALNILQKGLSSVGRTQTLNASGEIPSWLVGEILLANGDSMNEESPSL"
FT   mobile_element  262787..262967
FT                   /mobile_element_type="MITE:MaeMITEb002"
FT   CDS_pept        complement(262894..263619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03060"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00128"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW4"
FT                   /protein_id="BAG00128.1"
FT                   /translation="MFVLEYKVKPKPNQIEAINEAIRTTQFVRNKVLRYWMDNRGVGKT
FT                   ELFRYNTALRKEFKFVDDLNSHACQTAVERTLRAITRFYDNCQNKVKGKKGYPKFKKHS
FT                   RSVEYKVSGWKLSANKRHITFTDKKGIGTLKLIGSRDINYYQPDQIKRVRILNRADGYY
FT                   VQFCLKLDPRDRVKPLTPSQKATGIDVGLKFFLVDSEGHQIDCPNYYRKAEKQRLFVTC
FT                   YGSIGGHKSTKSLYGKRLN"
FT   mobile_element  complement(262971..263744)
FT                   /mobile_element_type="insertion sequence:ISMae14_2"
FT   CDS_pept        263814..264464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03070"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00129"
FT                   /db_xref="GOA:B0JMW5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW5"
FT                   /protein_id="BAG00129.1"
FT                   /translation="MTLPLDVPTAINQRRSIKNFTTAPIAPELLKTLVELTVAAPSSFN
FT                   IQDWRIILVQDEAQKAALAEAAWGQKQIIQAPVTFVFAADAAAGGGELTPIYEQALSTG
FT                   AWSEGTVKYFQQAIPGFQKNLGEKTREYAIKDAMIAATHLVLAAESLGLSSCFLNGWIE
FT                   DKVKAVIGAADHPHLAIAVVVPIGYAAEPRLNPGRLPLDYNVFVDRLGNPYQI"
FT   CDS_pept        264474..264767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03080"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00130"
FT                   /db_xref="GOA:B0JMW6"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW6"
FT                   /protein_id="BAG00130.1"
FT                   /translation="MTFSPSAWLTPFFNTPLWRAGGVSITLGWTIGILVLFILVTCLTI
FT                   AFKSLLKNRLLKSIGFGKISLLFSGMRRCGLPNPLILPVKPKFKLYFIYFSF"
FT   CDS_pept        complement(264788..265570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03090"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00131"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW7"
FT                   /protein_id="BAG00131.1"
FT                   /translation="MRRFLLIAVSLVVSFTNPVFANDHNNLDSGRPLSFDDAESIGFGE
FT                   QSIEFGGSLVFPENSNLGGEFDIEYLNGIIRNGHIIIGIDPQVGGRVNSDDTDFDVGNL
FT                   SVGFFYNFNREYDNVPAFAIRTDLGLPTGNNARGLDFRLRGIASKTVGQFDRVHLNLDL
FT                   NINTDPDNGDRAFSPAAILGYSRPIGYPKRFDRTFLAELGVITGDNSNGGVLIRTGMGI
FT                   RQQINRQGVIDWGIEGDIATNGNDQSQLKLKIGYSFGF"
FT   CDS_pept        complement(265567..266787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03100"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00132"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW8"
FT                   /protein_id="BAG00132.1"
FT                   /translation="MKKLIVLVTVALISTPVIAQHLHLDSPQTQTLQAIPDNIPAWMYN
FT                   KQRNHIYPQRGVYNNAIYNVRDLALDLNAIAVGHAFAYEDIVTGKAKDLETKTYQTINW
FT                   VLKNPPKFMPDEGNISPTFGRKYGVLEQVFDWAHIFHAQTVDVLASSKLTNKEKEAEIE
FT                   KLYQFYLTKVPYAITGLPMNMGYLDSQPYSKAFRQKYPKVNGLFWGYHWLQGTMYDLLY
FT                   EKTLEEQKQAYKQVGKQYHSQELYRTDRAFMPMFAELSPKFARRFPQISNTFDNLHMLH
FT                   DMVNDILASDWLTPQQKDEQITRAIWLVMAANHQEMAAGKNYGGEGLHDHRFQSGIPGM
FT                   GLMPADISHEGHNHDNPHNSEKKPDNSQGDEGGDHQHHNHENHSPENPPNTEKKPDDSN
FT                   HQEEPKK"
FT   CDS_pept        complement(266793..267185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03110"
FT                   /product="transcriptional regulator"
FT                   /note="MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00133"
FT                   /db_xref="GOA:B0JMW9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMW9"
FT                   /protein_id="BAG00133.1"
FT                   /translation="MLRIGQLSLESGVSIKTIRYYEELGLIQSPERTEGQFRLFTPDTV
FT                   HRLLFVKRLQSLGLSLQEIRECLVIHDHGELPCGDIQEKLIKHIAEIDQQVEQLLLLRQ
FT                   QLTETLQEWTDTPVKDDQFICPNLKV"
FT   CDS_pept        complement(267273..267827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00134"
FT                   /db_xref="GOA:B0JMX0"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR018536"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX0"
FT                   /protein_id="BAG00134.1"
FT                   /translation="MNTEVFQQFFVYCVGSWQTERTYHYLADQEVERSRTEFLIQPLTR
FT                   EIKQKVLTDNNYPDIADLESIPGFNLGFYTISEKGEEVRQNLNLLFVVKAENNGYLEGD
FT                   YLRDRAYEEARPIISAFRFDSTTRELLMTTNYTRSVSVDSITLINPDLRIRKIINYQRP
FT                   KEGEPLEKVLLVGFGVECKVS"
FT   CDS_pept        complement(267855..268838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03130"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00135"
FT                   /db_xref="GOA:B0JMX1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX1"
FT                   /protein_id="BAG00135.1"
FT                   /translation="MLSNQIPVKISVVVPLYNEEENIDALFGRLLAVLETINTSYEVVC
FT                   VNDGSRDNTLKNLVEYHQRYPQIKVVNLSRNFGKDIAMSAGIDYSQGMAVIPIDADLQD
FT                   PPELIAEMIEKWQQGYDVVYASRRVRIGESWLKRFTAEGFYQVINKLSRVPIPPNTGDF
FT                   RLIDRRVVESIKKMPERQRFMKGIFAWVGYKQTSILFDREPRYQGQTKWNYWKLWNFAI
FT                   DGITSFSFLPLKVWTYVGFIISLVSLVYASFLMLRTIILGIDVPGYASLMVAILFLGGI
FT                   QLLTLGIIGEYIGRVYEEVKGRPLYLVRDCYGFENREQVTDKITQN"
FT   CDS_pept        complement(268868..270085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03140"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00136"
FT                   /db_xref="GOA:B0JMX2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX2"
FT                   /protein_id="BAG00136.1"
FT                   /translation="MKILILSSTFPYPPTRGGTQVRTFNLLKHLSKNHEITIMTRPNSD
FT                   VSRTDIEALERLVKEVKIFPYSNSANPSILGKINRFYDFIMQGTPPNVRQVYSADIQLW
FT                   LDRAIDSQKFDVITCEHSVNEIFVRPHWQKKLKTIINIHSLAYKTCKNQLEIGVSPNPI
FT                   RDTLYLPLLERYERRFCQKFNPIVVTTSEDKEQMKELNINRPVIVIPNGVDLELFPYRE
FT                   TDPSGYQIIMTAGLDYSSNIDAVRFFSLEVFPILQQKYPEVTLILVGSNPAPSVIELTK
FT                   NSKITVTGRVPSMAEYLHHATICVVAMRSGFGIKNKTLESMAAGVPVVASDRGLEGLTV
FT                   EGNHVPLAALRANSIEEYCTAISSLFESAELREKLSRNARKLIEDNYTWQQAATKYEQV
FT                   LTADIC"
FT   CDS_pept        complement(270099..271727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00137"
FT                   /db_xref="GOA:B0JMX3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX3"
FT                   /protein_id="BAG00137.1"
FT                   /translation="MLMELKAGFLKIPNWLKALVLISLILGIFLRFYNLDGKLYSNDEA
FT                   FSTTYIYGQNIANIIDVKIVSASELQNYQRYNTDEGIFDSFKRLLERPYVFPPLYAFMV
FT                   QIWSRFWSLFLTEPAIITRSCSAFISLFSLPFMYWLCWELFQSASIAWLGTAIFAISPL
FT                   QLQYSQIVRTYSLITAFTLLSSATLLHSLRVPKKINWLLYTFTVAFGLYSNILFAFVII
FT                   SHALYIIIDSRGRITKNVKNYILSSLLGISLFMPWFYLFLTKPGLFGYSVEQPAEQNIP
FT                   ITGLIKDWMRGVLRIFIDLNDGWIKDTDSFLLLQRTSWIFLLVFLLTSVVFLIFNAGKN
FT                   KNWMILALLIGGGGILMIKDAISGTGFSVRLRYMLPYAIGWQLAATALIAYLFYSRLSW
FT                   QRQLSKIIISSLLLLGLLSSWIIASSPSWWAFGAPDYPAIAQKLNKLEKPVVLYDDFAD
FT                   ALTMSYLVNHNVYSHLTKRAEFHLETNPNQPNDIYRGYTDIIIFRPSSTLVEKLQSTEN
FT                   FVLEPLFKSQENYPSKPNAWKVIKR"
FT   CDS_pept        complement(271760..272713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03160"
FT                   /product="GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00138"
FT                   /db_xref="GOA:B0JMX4"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX4"
FT                   /protein_id="BAG00138.1"
FT                   /translation="MSKKALICGISGQDGAYLAELLLKAGYTVCGTSRDAQMSSFSNLK
FT                   RLGIKEQVKLESMALNDFRSVLQVLIKIQPDEVYNLAGQSSVGLSFEQPVETLESIATG
FT                   TLNLLEAIRFTGAKIKLYNAGSSECFGDIGDNSADENTPFRPRSPYAVAKSAAFWEVAN
FT                   YREAYGIFACSGILFNHESPLRPERFVTQKIIAAVARIAQGSPDTLHLGNMDIQRDWGW
FT                   APEYVEAMYLMLQQEQPDDYVIATGESSKLEDFVATAFATVGLNWQDHVVSDQSLLRPT
FT                   DLAISRGNPNKAKEKLGWQAQYKMTDIVRMMVEKNQ"
FT   CDS_pept        complement(272728..273648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03170"
FT                   /product="probable glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00139"
FT                   /db_xref="GOA:B0JMX5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX5"
FT                   /protein_id="BAG00139.1"
FT                   /translation="MAPKIAGIICTHNRDHYLAGAIDSLLGQTCPDCEILVVDNASTDK
FT                   TRQVAESRLGDGRLKYVYEPILGLSTARNRGAKETRAPILAYLDDDAIASTQWLQILLN
FT                   AYENNEKLAVAGGKVTLIWPQGYSQPNWLSDELAGGLGAFDLGDNVVYISQANLTPRGV
FT                   NYSIRRDFLEKIGGFDPNLGRIGKKLLSNEELYTTELALAQGWQVGYFPAALVEHNVAP
FT                   ERINRQWFMRRSWWQGISEHYREEVAGRTGLAQFRRGGERLVRGLVKYVKFINDPAKSF
FT                   DNLLYAYGQIGYLSEAAKAMLNPQK"
FT   CDS_pept        273915..274067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03180"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00140"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX6"
FT                   /protein_id="BAG00140.1"
FT                   /translation="MYLGFAAKSLLVGLGVSSRSSVAGRREFQALLPSLFCTNLCTKLR
FT                   IMPGF"
FT   mobile_element  complement(273921..274157)
FT                   /mobile_element_type="MITE:MaeMITEd001"
FT   mobile_element  complement(274173..274783)
FT                   /mobile_element_type="insertion sequence:ISMae1_1"
FT   CDS_pept        complement(274872..276485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03190"
FT                   /product="mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00141"
FT                   /db_xref="GOA:B0JMX7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX7"
FT                   /protein_id="BAG00141.1"
FT                   /translation="MIAAQNNPAKQGQETPLETLGEVFPVMLDNQELFTIRQGIGSFSA
FT                   QERAKSITTRIEKIADDDALSPEDLTIKIDPEDKNPSIILGDTVIATITSKDAKLHSVS
FT                   QEVLAERALAKIKAAIVRYRQERQPDNLLKDATLTVSATLATVLIFWVIIFISSRVFPQ
FT                   IQRLITSLVPGVVFQNFEIISSQTIGICCLRVLQFIRTLIILTILYFYLTFVLRLFPWT
FT                   RKFGDGFLQYFFSALEVISQEIAKYLPNIFIILLIVFITHYLLRAIKPFFTGLERENLV
FT                   IHGFYPDWAKPTYNLLSLLIIALAIVIAFPYLPGFNSPAFQGVSVFLGVLFSLGSTSAI
FT                   ANVVGGIILIYTRSFQLGDKISIGDVIGDVIEKGLLVTRIRTPANRIITIPNSSLLNTN
FT                   VINFSVSQREFKQPLILQTTVTLGYDLPWRKVHTTLKEAALATKFIVSEPAPFVLQTSL
FT                   DDFYVSYQLNAYTDHPSKMVYIYSELHQNIQDKCNEVGIEIMSPHYKALRDGNHSTIPE
FT                   NYLPEDYQSPAFGIQSNPQK"
FT   CDS_pept        complement(276558..277655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03200"
FT                   /product="saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00142"
FT                   /db_xref="GOA:B0JMX8"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX8"
FT                   /protein_id="BAG00142.1"
FT                   /translation="MEKTVLILGGTGRIGQSVALDIINHTAAKIIVTGRKEKAIKLLPR
FT                   MQFLALDLEEIDKLRQAIKKSDLVIHCAGPFHYRDGRVVKICIEEKVNYIDVSDHRSFY
FT                   QKLIPYRELAIKAGITAVVNTGIFPGISNSIVREGVEQLDRVETICLNYAVAGSGGAGL
FT                   TVMQTTFLGLKKPFLAWIEGQWQEIKPYTAREVIDFPAPLGKTGVYWFDMPETYTFAES
FT                   FQVQNVITKFGSIPDFYNHLTWITAHIFPDAWVESSRGIEFFSQVSYRMTEVTDKFSGI
FT                   GVAMLAKVAGWQGQQKAVYQATMLHENTAQAAGWGTGSVAELILAAKLQKAGIYPVEQV
FT                   LSTELFHATMKKRGIKLDRSCAIVA"
FT   CDS_pept        complement(277748..279199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03210"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00143"
FT                   /db_xref="GOA:B0JMX9"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMX9"
FT                   /protein_id="BAG00143.1"
FT                   /translation="MKTMLKGSLPKLSDIFPPTDHQDRETFTPNAFYPNLSEWLKRSQL
FT                   KAESEWFAAIAALENILLQNQNNAAAGRGLILSGPTALVRESKALTGFEFGVFTVKALK
FT                   HLQWPGFQLPSQEKSAADVSPTEIHELPLLPTDPIANERFCLVFSESFALLLVLGEDQW
FT                   GLSSFQFSFDPVLTQQAWQQLRQRLVNLRYPQIGTLEAIIEANGSPSPDYRLVSQFSRQ
FT                   LLQNLPNQPNLDLKKTKSPINAEITPPKEDNSNLESGCDLELLRALTHEIRTPLTTIRT
FT                   ITRLLLKRAKVTEDVQKYLETIDLECSEQIQRMELIFRAAELGINPLGDKPIQLIPIAL
FT                   EKVFQDSIPRWQKQAKRRNVNLEVNVPKKLPSVISDPNLLDQMLNGVVEKCTRSMASGG
FT                   LLQVHISTAGNQLKMQFQTQVKSPNLTLKALGKVLMFQPETGSLSLNMKVTKNLFQALG
FT                   GKLIVREKPEEGEILTIFLPLGRIK"
FT   CDS_pept        279458..279613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03220"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00144"
FT                   /db_xref="GOA:B0JMY0"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY0"
FT                   /protein_id="BAG00144.1"
FT                   /translation="MWGSWLNSTSISLIFNYTCRLMCFFVTFKYFFCLSMVIIEQVKLF
FT                   PNYFPN"
FT   CDS_pept        279841..280593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03230"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00145"
FT                   /db_xref="GOA:B0JMY1"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY1"
FT                   /protein_id="BAG00145.1"
FT                   /translation="MKFGIDMGHNCPPHDIGASGVRQEDVVIKEVGTRLIAKLAAAGHS
FT                   VINCTPTSAVSLNDSLRKRANKANSNNVDIFVSIHFNAFNKKAVGAEVYGISQTSQAIA
FT                   KSVLTEIVKLGFKNRGVKNTRFSVLVNTSMPAILIECCFVDSQADMDLFDAEKMAEAIK
FT                   VGLIGDADDNSTPEPATLRITQKTVLKPSTEQSSELEASTLVEIEPGDYAVLDVRLEER
FT                   HFWVKWPDKSQANRDEHFIFEEFAEIVQ"
FT   CDS_pept        280679..282229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00146"
FT                   /db_xref="GOA:B0JMY2"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY2"
FT                   /protein_id="BAG00146.1"
FT                   /translation="MALLDDLVQRYAQADLSIIFREVDATDNRQVNLTAIPPDHFSHLK
FT                   EVSLAQWLLESARATSKLAEEQKNFAGLKWRNEMTPFATPKSIKVPSESEAMDFCLFTD
FT                   IDKFLRGYWKFLTREPYKGLEENTQTPENFIGFIQSKGFAADISYISKVLKLVPEARTL
FT                   LAKANGIVIPPPPDTLQVTSFPKEVEVGQSFRIEGTAAAADKGKKLTVLIDNQFPLDDI
FT                   KIEEGGEWKAEFVFLQAGNRIVKIAIDNQSVEIKIKASPPKATGAVTLNLTGSVGLGGI
FT                   NRTADKIAVKQRLHSLGYTFVGDPNSAALNTGFILAIKLFQSIIAGRETLGGDGRIDVD
FT                   NTTQKWLEAANAPRWQTMPDSNPSISLINHEKNQTNDDHDFGTSWLADAILEIAADYHN
FT                   TFRVSNPSSAAFSINDVSKPTGGDTPQHAGHETGLMCDVRLPRTDGQHGGITWESDNFD
FT                   RTAARALIKAMRRQKLVSQVFFNDATLRDETFLGQKLCNFAPGHDHHIHFAIRPPVRA"
FT   CDS_pept        282594..283181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00147"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY3"
FT                   /protein_id="BAG00147.1"
FT                   /translation="MAQVVAELCDFYDIEVTAKTVLGHGEVEREFPNKPQRGKWDPMVL
FT                   PWDTSLSKRQVGDQFRTLVKTKLTGVSGLVETPASITAVIQGKPFREAQIFNEKSIVKI
FT                   RPLLDTFNWKIITANDQEVMELKFADGEEAKSLGFLLIEHSNNPMDIPEGTSQGEIIKK
FT                   IEQFGFVKVVDLAQALNLSVTWDGTTRTVTIE"
FT   CDS_pept        283209..283799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00148"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY4"
FT                   /protein_id="BAG00148.1"
FT                   /translation="MQNYTIKSGDTLRGIALKFYGDASKFVVIQEANDIANPNQISVGQ
FT                   VLEIPELADDNDNNPLENFHRAFPNSVRWRLAEDGVEIEGSGIERTSGQPATATKIWNN
FT                   FSDEINQWSKHFNVPAVIIIATIATESNGKADAIRKEPGYVSDSITPHLISVGLMQTLI
FT                   STARGTLHNSTIDRDDLKNASISIPHSAPSTVT"
FT   mobile_element  283767..285842
FT                   /mobile_element_type="insertion sequence:ISMae31_5"
FT   CDS_pept        283937..285595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03270"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00149"
FT                   /db_xref="GOA:B0JMY5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY5"
FT                   /protein_id="BAG00149.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEAKHLNDDKIGRVMDKLYQL
FT                   DVSGIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMREMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETSSNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAELELNLAAI
FT                   ERLKKRAGRFVLATNDLEKKRLSSEDILKKYKGQQAPERGFSFLKDPCFFADSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        286272..287153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03280"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00150"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY6"
FT                   /protein_id="BAG00150.1"
FT                   /translation="MIFGFTLVIILFFQAKIQAQTVCQIVPTSQISSIDQAKCLLRQPK
FT                   IFGNVGPTLTSLPAPFDQLLTRPTIDISKEQLRRYLQAQGINEADIGGSLDKPVSRTNN
FT                   NNPRAELARYFIIHDTSTPNLGNDTFPNNINEASWEFNNFNKYGSGDNSPAHIIINRVG
FT                   QSVTRKDFNTPWRSTRRESEQFCGVNKCKGLFLAVELVQPRKCQPNSGQTQCSPPRKND
FT                   AKSPDPGFTKAQLDRLAVVYIAASVRRGKWLIPAFHVVLDQIVPGGHDDPQNFNLDQWS
FT                   KQLNDILTEIRS"
FT   CDS_pept        287220..288323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03290"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00151"
FT                   /db_xref="GOA:B0JMY7"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY7"
FT                   /protein_id="BAG00151.1"
FT                   /translation="MSSFLSPAFAQVSYTPPAQSASVLRDIPFNQAVPVDEAYRKEFEN
FT                   CDQKDTFRGFSLPIIRRCKNDPNNVKALLKLSDGTIFIESKLSLDIDGSWLACKGQGAP
FT                   TSQCPTSFSWPTETQEPNKFVDPDNFAYIVNPVSNFQKSNDPGGNQLFEKKTGVKLGDL
FT                   GVVVYKNKVVPVFVADSGPYNKLGEGSSLLHQLIGEDKCKPGKRRTDGKTRTDKRWTSD
FT                   VHCTEYKNVSVEDKVLFFIFPNSKIPNLSPANATNKINTEALKRFENLKDNRQGVIQLN
FT                   QPQSGQSFAVNTAVTFSGTANPEVSRIKVSIGLGGLFEIADLKNIKKNWTFEQVFNTKG
FT                   IDRPVTIQPFNATDKPLKPLNFTITIQ"
FT   CDS_pept        288367..289215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00152"
FT                   /db_xref="InterPro:IPR019262"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY8"
FT                   /protein_id="BAG00152.1"
FT                   /translation="MANKTLKALTNTVIKSLPQDSIGLSDSQKITLPEDATLEILQYRS
FT                   APNNHWEIQLVTPQNGLVTWFAFISHVEIFSDPNFKKTLVETATEEWEFFEKGTKKERE
FT                   DGFWQRVVKYWKEALNIHHIDTPDEVGDGIRNPWSAAFISWIMTKAGAADKFKRDASHS
FT                   VYIHDAVQKRKNRVFDAPFIAFKVDEITPEVGDLVCAPRASSVDFVKYDTSPPYASHCD
FT                   LVVAKRTNEIDMIGGNVEDSVSKTTIELNAEGKVIPNGKILVNGNPATKRPWFVVIKNL
FT                   L"
FT   CDS_pept        289259..290737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00153"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMY9"
FT                   /protein_id="BAG00153.1"
FT                   /translation="MATLQDIINESKTLTRSQLKTDKGLVIEIQTKLANLGFYPGGGWI
FT                   DGDLGESSSFSWTGLIDFCKKIGSLPIPSDTLAINKEIAQKLLTTKQVDSVLKAATQNS
FT                   ILTRLQQIQTRSPIINKNTPPSAFVSRSIEQSPFKPFIINYPNFLTQKPDGTSLISSGD
FT                   TLVLSDGRTVNFNDYPNCGSQPNIDNNGLSFLPSNISHACLCIGSFKDSNSPIKARWLG
FT                   KDALTPVTLWWSTTKFIGVLNTVCQINQNSINTDIDDCVIASHRFNDLVRDMVSYQGLS
FT                   SNRIGALFKSFSKREVLSNWIETQTGSVSLNFTGSYGEDSLIFPARIKDTTTGNIVLSS
FT                   GDVGAATSTNSLSAYDLVRLISMLGWHLHLPNNAKLPSAQWKSLESIVRAMGHDTARYV
FT                   DVAFETLGVMNIISEPVIISKVGWGNISATSGSMTYTVFVKFVDRRFTPAKLRTFALSL
FT                   RCLSPVSSDFDGRDTNLAAAVTEIVRRILTEELP"
FT   CDS_pept        290796..291797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00154"
FT                   /db_xref="GOA:B0JMZ0"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ0"
FT                   /protein_id="BAG00154.1"
FT                   /translation="MNLGTLLEIIVALIFIYLASSLIISELQEQLAALLEFRARNLKKA
FT                   LEIFLGKNTVESLYNNGSLLSSFNQYTNFGKSVGPSYVEPKVLAESLISLVNSQLSDNE
FT                   KLLKADFLGNNLDQQKTGIFKKLASISDFSKIDKTAIDRLIQIGYSTKLKYDNPTLENF
FT                   VDEIANTFTQIMERTSGVYKRNAKGVSFAFGFLAAALLNIDSFYVIEQLSKNSNLRQGI
FT                   NQVATEVFQTNESCFKDAKDDPNKVAECTEKLQASVKDLEKINQPLPLGWDEKGWFNGE
FT                   QIKEQNGLLQAIFGWLMTGVAVAMGAPFWFDILGKLINVRNTGKPIFPNTQK"
FT   CDS_pept        291947..292924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00155"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ1"
FT                   /protein_id="BAG00155.1"
FT                   /translation="MQPLNFSIIQEIKHQGICDASAATALGENKFVVGNDEADPKLGNF
FT                   LWIYSSQESGKALKTIDINSWVKNNLKNKEIDLEGVTVLNDIIYWITSHGRNKNAEQKL
FT                   PRHQFFASKITDDGSSIVQVGESYTQLVLRDIIEDSQLAEIFDFKTAETKAPKAEGGLN
FT                   IEGLTATQDGNILIGFRNPIPSNKALLLTLKNPYSLVNNSSNARADFGDPILLDLGGLG
FT                   IRSIEFWPALEVYLIIAGEFHGGDQFVFYTWSGKKEDAPEKIESLQFPDGFRPEALLFY
FT                   PHFPDRFQILSDDGTIERVGNTPCKNTDKNNPEKYFRSIWVKVN"
FT   CDS_pept        complement(293698..293868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03340"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00156"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ2"
FT                   /protein_id="BAG00156.1"
FT                   /translation="MRKSLGKRYHCRSFRDVQLDYNTYRLICQPITIMNFALFIDLPLT
FT                   SYSSSNTDHCY"
FT   mobile_element  complement(293853..295087)
FT                   /mobile_element_type="insertion sequence:ISMae23_2"
FT   CDS_pept        complement(293869..295026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03350"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00157"
FT                   /db_xref="GOA:B0JMZ3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ3"
FT                   /protein_id="BAG00157.1"
FT                   /translation="MPAKDFLDLEEKKNLQKALKEEERAEVRERILMFLLLNDGKTQRE
FT                   IAEFIGCSLKTVAPWCVHGDPNNIESLEDGRKNGNHKKATEEYINLLLKIVDEDPKELG
FT                   YEFGRWTAARLAEHLEKETGIKLSGSQVRRILRRKKYVYIWAKYSLEDKQDKKLRKAFK
FT                   EKLDEYLKLAKEKPESIQVWFWDGAFKVATQVRHTAPHECGFSLRVIRRRAWTKKGKRK
FT                   KVNGQRKRGRVNVMGALRYNDKKRVCFMIKKGNSETFHEQLKKLHEEIRQEWINLGNLP
FT                   EDFREKGPKIIIILDNASYHKKKDVIEQVEKELPNIRLEFLPAYSPDYNLIELVWHSAK
FT                   EYIANREFENKEELEKVVNQLLNEGGLIIKWSRKLKNKGNAVNVT"
FT   mobile_element  295086..296346
FT                   /mobile_element_type="insertion sequence:ISMae12_1"
FT   CDS_pept        295434..296285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03360"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00158"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ4"
FT                   /protein_id="BAG00158.1"
FT                   /translation="MRSLVFPALSKNFLGDGCLNFPQLGKIRIRKSREYPSGFEPKQAR
FT                   IIRKASGFYVSVSFQSTELVPDMTVGKTCLGIDAGIESFVATSRGDLIKAPRFLLKVQS
FT                   KLKLLQRRLKRKTKGSSNWLKLQEKISRLHEKVSNTRRDWHFKLSHYLCDLADNIFVED
FT                   INFVSWSRGIVRKQSLDSGIGSFINEILPFVAWKRGKYYLKVDKNGTSQECPNCGAITG
FT                   KKALSERVHRCDSCGHIEPRDTASAKVIENRGKNAVGLTVLENARGGDLTGIDRVKPGR
FT                   SS"
FT   CDS_pept        296485..299607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03370"
FT                   /product="putative SNF2 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00159"
FT                   /db_xref="GOA:B0JMZ5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ5"
FT                   /protein_id="BAG00159.1"
FT                   /translation="MKILHGTWIPQSTDEFIQKGSFYLWGETSTPKKSRTTADNYHPFQ
FT                   LSKEELTSFLTGELGIVQSNYNPLSRQFAPRYFLLPSHDNQPLPSLELLRYLEKEPPEN
FT                   SQWQSWHIDCYPLNPVLKLLNDLHFICLYNSSEIQLGADLLFWYHYSQAFKEIILKDNY
FT                   IPAFKYRELATKNKKNANFAIYPLWEIISATYEPNLDRYLEYLPRICLAGAENPHASPQ
FT                   LYDPKTLLRHFSECLLNEIVTNTAIPASFDKKIGETIIGDCLSVTKAAGFLQTAAALEK
FT                   YQQWQTWRQQLLGDQNISSFSLGFKLTEAPENNIEQWQITFILISKQDPSLRLELDEYW
FT                   YAVPENRTSIRAHFGQDLDKNILLSLGYAARIYPPIWQGLETDKPTGFSLNLTEAFTFL
FT                   KETAWVLEDAGYKVIIPAWWTPQGRQRAKVRLKTTSKSGKSTPVSKGIFSLENIIEYQY
FT                   ELAIGEETITQEEWQQLINTKTPLVKFRGQWVELEQNKMQQMLDFWEKYQQENPEMNLI
FT                   ELMKKAAESPEEIIVETDEFLGSMLEKLQNPSQLEPIENPPQLQGTLREYQKRGVAWIQ
FT                   YLEQLGLNGCLADDMGLGKTLQVIARLVGEREGDNNVLPTLLVAPTSVVGNWAKEIEKF
FT                   APHLQVLIHHGSKRYQDESEFQTVASQKDIVITSFTLVRKDLKLFNSQSWQRLVIDEAQ
FT                   NIKNPKAAQTKAILSLSAQHRLALTGTPVENRLLDLWSIFNFLNPGYLGKETQFRKAFE
FT                   VPIQKQNDRLQSTVLKKLVEPFILRRVKTDKQIIKDLPDKVENKQYCNLTKEQASLYEV
FT                   VIKEVEKQLEEAEGIKRKGLILSTLMRLKQICNHPRQFLQDNSAFTPERSHKLERLGEM
FT                   LEEVILEGDSLLIFTQFTEIGDSLQKYLKQTFRYNTYYLHGGTSQPKREQMIEEFQHPE
FT                   TEPSVFILSLKAGGVGITLTKANHVFHFDRWWNPAVENQATDRAFRIGQQKNVFVHKFV
FT                   TLGTLEERIDEMIEEKKKVANAIVSNDESWLTELDNESFRQLIALNKQTII"
FT   CDS_pept        299621..300460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00160"
FT                   /db_xref="GOA:B0JMZ6"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ6"
FT                   /protein_id="BAG00160.1"
FT                   /translation="MNKFSKTWWGQRFIEALEEFTDSARLSRGRSYAKNDKVKNYTIDG
FT                   NLITAQVRGSINPYFGVYKEPLYKVSIEIKPITKAEWSQALYNLGSRASMISKLLLKEV
FT                   PDNIDEAFSDLNLHLLPHNQKDFITNCSCPDWENPCKHIAGVYYLVASQLDQDPFLLFE
FT                   LRGISRQKLLQELAKTPLGKLLSSSIQEEKIPLNPVTSYHTKPETILAAETIDLKEFWH
FT                   SHHRLPENPQLVKSATIPAIVIKKAGDYPAFWDKDTSFIEVMEEMYQRVRNKNAGML"
FT   CDS_pept        300482..302506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00161"
FT                   /db_xref="GOA:B0JMZ7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ7"
FT                   /protein_id="BAG00161.1"
FT                   /translation="MNQESLSFVHGNVKSADRFLVCGLGSLGQHCVKSLKEFGVSVVGI
FT                   ELIQPPSWEINDFPDLLEEIIIGDCRQKNILARAGIDRCRAALIVTSDERINATTALII
FT                   RQLNPLTRLVVRSSKDNLNQLLKERLGNFIAYEPTQLPANAFALATLGTETLGFLHLDG
FT                   QKLRIIQRQISPEDGLLDRFLGDLNTPTRRLLAHTAPDEPLRAGFYQWSPTTTIRAGDT
FT                   ITTIETTYQNIDSTRQKPSNSPQKLRDFWQKFLKEIQQFWQLSFQQQIHRVAFLSVFII
FT                   ILLVIIGTFLFHLYAPRASFISSLSGTAILLLGGYGDVFGGSNPEDLNAVPWWMQLFSL
FT                   FLTLAGTAFIGVLYAILTETLLSSRFQFIPNRPPVPQQNHIVIVGLGRVGREVANLLLE
FT                   MQQAIVGVSLNRDFDGTMLPKMPLMTGNIEESLKNVNLDRAKSIAIVTDDEILNLEVAL
FT                   TTRKLNPQSYLVIRTTDDNLSQQLSQILPRSHILGTNTVAAEAFTGAAFGENIIYLFRW
FT                   AQKTILVTEYEIEAGDTLNGSSIGDIAYGYRVVPILHQRERQAPKLMPEDYLNLRIGDR
FT                   IVVLATINGLRRVEQGRRTPKTWRVRVEKAFNRNIAAEAPTVISRFSNCPLKTASDLME
FT                   NLPATLGAPLYEQQAIRLVSELKKIQVQALAIPINPKSG"
FT   CDS_pept        complement(302557..304335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03400"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00162"
FT                   /db_xref="GOA:B0JMZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ8"
FT                   /protein_id="BAG00162.1"
FT                   /translation="MINPNPAIEQKINQFILETQNKFSQDKSATLASYQTEAKTITQET
FT                   NNLRDELIQKLGELTFSDPLPSREELEKQIIAHIDQLVETINLLSTGKISEIPLDTLSQ
FT                   EIDSLVATITIVFDANANDANLPKLKEKLTAWQTKVKDTLVKFSTTVELQQKNESLIAE
FT                   LKDKLDKYSSIPEVDEPFEKLVKEFKDNSAQLQVQEASVLFQTLDDLINEIKARDEVIK
FT                   LNQRIDTLLGKTKEQVAGFPPELDREVQGELAKLIIILGIAQVELINSSKAWDIMQVKS
FT                   VVDAGEIAIKSLTGQPNIILAQKLRYAAETGLRKTQMGFWNGLAEFRGNLFHSIKIPTK
FT                   VLIGLVLALPLNWGIMNSPPVKNLLMPLPPISNSSNQNTEDKDENFRLLILILMTGTLG
FT                   GAVSLLTRLQDFDNPKNQKYDDDFLPLSIGLTKPILGGSFAFFILLILNSSISPLQIRT
FT                   DNGNKGNDTYLYGLLTMAFVAGFSERLIPDLINQVEKKVTVEASSTGQGLPPTILIAPS
FT                   SAALALNGIQEFSINPVGNYTITISPPESGKIDKNTTDAKFTYTAPPQGNAGDTITITA
FT                   TSDSGQTAKATVTLTA"
FT   CDS_pept        304584..306257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL2"
FT                   /locus_tag="MAE_03410"
FT                   /product="60 kDa molecular chaperonin 2"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00163"
FT                   /db_xref="GOA:B0JMZ9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMZ9"
FT                   /protein_id="BAG00163.1"
FT                   /translation="MSKIIAFKDESRRALERGVNALADAVKITLGPKGRNVLLEKKYGA
FT                   PQIVNDGITVAKEIELSDPLENTGARLIQEVAAKTKDLAGDGTTTATIIAQALIKEGLK
FT                   NVTAGANPVALRRGLDKTIAYLVEEIAAVAKPIAGDAIAQVATVSSGNDEEVGQMIATA
FT                   MEKVTTDGVITVEESKSLTTELEVVEGMQIDRGYISPYFITDQERQIVEYDNPLILITD
FT                   KKISAIAELVPVLEAVARQGRPLLIIAEDVDGEALATLVVNKARGVLNVVAIKAPSFGE
FT                   RRKAVLQDIAILTGGRLISEEVGLSLDTVSLDLLGQAAKITLEKDNTIIVASGDSRNKA
FT                   DVQKRLAQLKKQLEETDSEFDKEKLQERIAKLAGGVAVIKVGAATETELKDRKLRIEDA
FT                   LNATKAAVEEGIVPGGGTTLIHLASKVKAFKASLTNDEEKVAADIVAKALEAPLRQLAN
FT                   NAGVEGDVIVEGVRETAFSVGYNVLTGKYEDLIAAGIIDPAKVVRSAVQNAASIAGMVL
FT                   TTEALVVEKPVKEAAAPDMGGMGGMGGMGGMGGMGGMGMM"
FT   CDS_pept        306448..308337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03420"
FT                   /product="ABC-transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00164"
FT                   /db_xref="GOA:B0JN00"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN00"
FT                   /protein_id="BAG00164.1"
FT                   /translation="MTLLTVRSLKKDFGIKEILKDASFSLDDRDKVGLIGTNGSGKSTL
FT                   LKMIAGLEAIDGGEIQINSGMKIVYLPQQPDLDDDKTVLEQVFADSGESMTLIKEYEEL
FT                   SDRLVHEPENLDTIMERLSRVSQQIDKLAAWDLETNAKVILSKLGIDNFNARVGDLSGG
FT                   YRKRIAIATALLADPDCLLMDEPTNHLDALSVEWLQSYLSRFRGGLLLITHDRYFLDRV
FT                   TNRIIEIDRGDLSTYSGNYAYYLEKKALAEESIASSQRKHAGVLRRELEWLSRGPKARS
FT                   TKQKARIDRIQAMGTKEFKQVEGKVDIATAGRRIGKKVIEVEKISKAYGDHTLIKDFTY
FT                   IFTPEDRIGIIGSNGVGKSTLMDIITGKTLPDSGTVDIGSTIHIGYFDQQSDDLNINEN
FT                   QRVIEYLKSVAELVKTLDGSVITASQMLEKFLFPPDQQYAPIYKLSGGERRRLFLLRVL
FT                   MSAPNVLILDEPTNDLDVQTLAILEEYLEDFNGCVIVVSHDRYFLDRVVDTIFSFETGG
FT                   NIRQYPGNYSLYLDQKKEEEEPKEKKVTPKTVKASPSPVNKKISFKEKKEYEDIEKQIP
FT                   ILEAKKAEIEQVLYGEPLEDFTKITALTEELAQLSQKIDNLTDRWLELAEKLG"
FT   CDS_pept        complement(308367..308837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN01"
FT                   /protein_id="BAG00165.1"
FT                   /translation="MKKIILTLLLAWLLVANMNSQGVLAVTLDFQWLGNQGYTAKGSFS
FT                   YDEKTAPTIFSEKGSGKMRVLENFQVSFYDNGGQEIAKYDNVSEGISSANYFQFNFNTK
FT                   TGQVFGSIDLGGEGMGEIYLQGVVNDNLALLRVESVDLVMDEDDSPEIITQF"
FT   CDS_pept        complement(309105..309296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00166"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN02"
FT                   /protein_id="BAG00166.1"
FT                   /translation="MNQTTANYDEPWKEALTEYFEAFLYFFFPEVNLENGFLGETRFLD
FT                   FKTKKRFADKLYSVISYQ"
FT   CDS_pept        309357..309803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03450"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00167"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN03"
FT                   /protein_id="BAG00167.1"
FT                   /translation="MDNAYPTARFSYWILAKDCLNSARELAVAANFSSSSKIVGLVILP
FT                   IISSISEEICPNRTVKTVFMASRLFCNAPISLPISLPISLPISLPRSIPRNSILLTKGM
FT                   VLSSSNCLILLSKLDCNSGDKVIILSMISNSLLSKVGITHPTYL"
FT   CDS_pept        complement(309790..310848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00168"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN04"
FT                   /protein_id="BAG00168.1"
FT                   /translation="MNQTTANYDEPWKEALTEYFEAFLYFFFPEVHQLIDWTKIPESLE
FT                   KELKRITASAKTKKRFADKLYKVWLLRGEEVWILIHIEIQSQYEENFPQRMYIYNYRAF
FT                   DLYQKPVISLAILGDERVNWRPDSYNYTIAGCEVSLKFPTVKLLDYEERWSELEASSNP
FT                   FAIIVMAHLKTKATTGKLPQREQWKWKLIRGLYEKEFEREQIIKLFEIIDNMMTLSPEL
FT                   QSSLESKIKQFEEERTMPLMSNMELRGIERGKEIGEEIGELRGIERGKEIGKEIGKEIG
FT                   KEIGKEIGALENARDFVKKVLENRLGDIPGDIGQCLNDASVISVLEEMLKAALIVNSFE
FT                   ECRKSFSIIINK"
FT   CDS_pept        complement(310994..313504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03470"
FT                   /product="putative calcium binding hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00169"
FT                   /db_xref="GOA:B0JN05"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN05"
FT                   /protein_id="BAG00169.1"
FT                   /translation="MTSSLLPILPAVDDVLFNFAQSDGFWANLAIAFGASYDVVKATEL
FT                   RQQWKSRNFSQLPPIEVLSGEVLGTANGAYSSSTNKIYLSASFLNTASSAAIINVILEE
FT                   IGHYVDAQVNQVDSAGDEGAIFAELVQGNSLDVATLEALRAENDQTTIIVNGEIIQVEQ
FT                   ADFTGTNGNDNITGTSGDDNIYGLGGNDTLSGLAGNDRLEGGSGNNTLYGGTGNDVFNF
FT                   AYPLNTNTSDVAMDFVQGQDKIDVSSLNLSDWATLQLLISNDGKNNALITTFFDGVQSQ
FT                   LKLNGINPTLLQASDFIFNTINLNQSIDGDDFYTYNDQLFGGLGNDTLRGFKGNDTLFG
FT                   EQGDDRLDGGSGSDTLYGGLGDDTAVYTGNRSQYSWTSNQGVFTITDSVANRDGIDTLY
FT                   GIQKLQFSDQIVTIAPEEDFPSITLAVSPSSVTEDGTANLVYTFTRSGSTTNPLTVNYS
FT                   IGGTATNGTDYASIPTGVIFAANSATVTVIVDPTADTIVESNETVILTLASGTGYTVGT
FT                   PNAATGTITDDDTSVTSQLSINDITVVEGKDNHAILTVTVDNPNPQPITFNYTTAPINA
FT                   TANVDYTSKTGTITIAANTATATISIPILNDNLNEPDEAFTVTLSNPVNATINPEGGIG
FT                   EVIITDTWQSTLTRTLPNNVENLRLIGSNNINGTGNAGNNKITGNSGINQINGRAGIDT
FT                   LTGGLGADTFIFQFGQSTISTRDRITDFAINSDKIDLLTQGGTATSAPSNFSRAANSTV
FT                   TTLQNLINQVFTDANGATTGNQGLGVNSAALVQVTTGAIAGTYLVINDSAAGFQSSNDL
FT                   LINITGFTGALPALGNIPVGNFFV"
FT   CDS_pept        313760..314005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03480"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00170"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN06"
FT                   /protein_id="BAG00170.1"
FT                   /translation="MNATAIRQQIIESLANLSGEQLLQIRELIEQNFLPQIKPKSEEER
FT                   QQLIKSLQGKYAHAPTSSEDFAQQKQAEIDWEERNR"
FT   CDS_pept        314104..314406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03490"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00171"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN07"
FT                   /protein_id="BAG00171.1"
FT                   /translation="MIHVVNLCEVYYNFYCDIGESETEKLIQELSDINIKTRFDLSSKF
FT                   WRQVSQYKALIKRISLADCFALTLANQEKGILLTSDRKEFEPIIPLNICQINFIR"
FT   CDS_pept        complement(314494..314994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00172"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN08"
FT                   /protein_id="BAG00172.1"
FT                   /translation="MAHLKTKATIGKLPQREQWKWKLIRGLYEKEFEREQIIKLFEIID
FT                   NMMTLSPELQSSLESKIKQFEEERTMPLMSNMELRGIERGKEIGKEIGELRGIERGKEI
FT                   GVLEKSRDAIKTVLTVRFGEISSEIEEIIGKMTNPTILEELLKLAATANSLAEFKQSLA
FT                   RIQ"
FT   CDS_pept        complement(315227..315457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00173"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN09"
FT                   /protein_id="BAG00173.1"
FT                   /translation="MSQANQVDSVRNQGLTAPELNTVVFLDAGVTDYQSLQAGVIPEVA
FT                   TVILSPNQDGIEQISAFLPQNPQITTIHPYY"
FT   CDS_pept        315677..316441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00174"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN10"
FT                   /protein_id="BAG00174.1"
FT                   /translation="MPKIYRLAQGHLNLLETCPPRFQKVYLEELNTPADPEQLQRQEWG
FT                   SQFHLLLQQRELGLPIASLLRENEQLEHCLTALLKAAPAIAQNPGETNREAEHCRSLTV
FT                   GNYLLTVIYDLILLESDRAVIFDWKTYLKPIDADQLAKNWQTRLYLYVLAETSAYPLDS
FT                   LSMTYWFVQLPRSPEQITFNYNRKLHQQTGRDLRRLLKDLDRYLSAYQNDLVDFPHRPD
FT                   CQLHCPYYLRQERSDPIDLPSIEDIPEINPFV"
FT   CDS_pept        316842..317531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="MAE_03530"
FT                   /product="molecular chaperone"
FT                   /note="heat shock protein 40"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00175"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN11"
FT                   /protein_id="BAG00175.1"
FT                   /translation="MTGNHYQTLEISHKSTPDEIKRAYRRLARQFHPDSQNDSASHDKI
FT                   VAINAAYEILSDPRLRKDYDNQLIANFPEKRGQRTATAQANYHRYKEAVQEDEALVKQW
FT                   YNQTYSPINRLIGQIIRPLKGQIDHLSADPFDDQLMAVFQDYLETCRQNLDRAKTLFCQ
FT                   RPNPAKMAKVAASLYYCLNHLTDGLEELETFTLNYDDRSLHTGQEMFRMAQRLQVEAKQ
FT                   IASQCQN"
FT   CDS_pept        317605..318216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00176"
FT                   /db_xref="GOA:B0JN12"
FT                   /db_xref="InterPro:IPR022051"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN12"
FT                   /protein_id="BAG00176.1"
FT                   /translation="MRDKQSEITNISTPRDSDLYSLPPAVQRAANILLRQGRIGFWTQI
FT                   VLGVISGVLLLIATASLLGTRQRTSGIEIGVLCAIGGAGFLVVAIFFSSRYMKIARQML
FT                   RGDQDSRPKKSDTIQLIRQGLIANIIGMFLTILGAQALAGIVLIKSLNVPQGTFNVASN
FT                   PSQFVNSVDLLIVQANTNTILAHFTGIVTSLWLLNRITSK"
FT   CDS_pept        318225..318560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf20"
FT                   /locus_tag="MAE_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00177"
FT                   /db_xref="GOA:B0JN13"
FT                   /db_xref="InterPro:IPR007572"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN13"
FT                   /protein_id="BAG00177.1"
FT                   /translation="MQRTRLSTLANVTSSRFNSFFGNPWRRISLQIICVLFGIFSGQAI
FT                   VTTAGQTAQWDVTAAGLLVLFTEAISRIVYRKSSQAKPAPILRESFNLLKIGITYSLFL
FT                   EAFKIGS"
FT   CDS_pept        319200..321350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03560"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00178"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN14"
FT                   /protein_id="BAG00178.1"
FT                   /translation="MAREKINDQNGAIDDFSQYIWYSNYNAPAFKDRQLLAQAYYQRGV
FT                   LKLAMVIEGEKTPIAAEEIPVIEEKTPIVEEIPVIEEETPLIERESRIKDQHQLKLLEA
FT                   ARSDFQQAFKYNPNKSEVYFNLAIIASLLNHQSLALDYYQRFIGYETEDYRGYYHRGQL
FT                   YSQWGNYAEAIKDYDLAILYKPDLIEGYYNRAIALEKIGGKREAFKDYKIVLKCSPKLF
FT                   LAKNAPSSYQNRARVQIEMADEEVELANLSSNSPQGYQTAIEYYNGAIKDLALVIRINP
FT                   NYDKIPHSRAFLKRGYAHLRLNNNQGAIQDYNQAIYLQPQDAKAYVYRGLMRANKYQEY
FT                   AGALEDFTAAVARNRHDAAANYHRGLVLYKLGRYQEAVDNYNIALAQDDGINTPSFTSR
FT                   SVCSENIRESAEKNYFYDSRETDFRPNYNVSCHALARGDAYFALKNFAAAERDYTTYIV
FT                   AYPNDPEGYHKRANARFEKGDKQGAIEDYNVFLQKVRDARIFYSRGNSSADVGDDQGAI
FT                   TDYLQSLSINPIDVTAYSNRGNARTDTATIPDNVQVTPRISENPIAYNNRGIIRRQTGD
FT                   KEGALEDLDKAVSLNSNNPIAYNNRGVIRFDLGDNASALEDLNMAISLQSNYAEAYYNR
FT                   GLVKEKMGDKKAAIADYQLAITYQPNYGEAYYNLALATYDDKNPSSRVASLNYLQKAAN
FT                   ALIKTGNLELYERAVEWMLKMQ"
FT   CDS_pept        321394..321765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00179"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN15"
FT                   /protein_id="BAG00179.1"
FT                   /translation="MAISSLQRAGESLIADQLAANHHALAQELQQVLGKQRLKQIPENG
FT                   LRLLPRYRHSGEDLVILEESSIDSTQIVFNQETEAKIERVLDEHRQRQKLAKYGYLPKT
FT                   KLLFWGPPGCGNKIKCCYF"
FT   CDS_pept        complement(321904..322347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00180"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN16"
FT                   /protein_id="BAG00180.1"
FT                   /translation="MIIVDTGFWVALFNNKDQYHLIAQQTLAQYSSQPLITTWCVLTES
FT                   CHLLLQRSPNLYTGVEKQIKLMNVFERHPQKFLLFHLENTHLERIQDLMKQYQSLPMDL
FT                   ADASLVILAEELGNGRILSIDNRDFNTYRWKNKKPFINLFPNF"
FT   CDS_pept        complement(322334..322606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00181"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN17"
FT                   /protein_id="BAG00181.1"
FT                   /translation="MINLEQIQEDINQLPEEAQNLLIDFIELLKKRYSLAKKPEIAAKI
FT                   NPEAQSTLDILKESGLIGCISAESDLSTNYKSVLKEGLKAKYDHR"
FT   CDS_pept        complement(322824..323000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03600"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00182"
FT                   /db_xref="GOA:B0JN18"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN18"
FT                   /protein_id="BAG00182.1"
FT                   /translation="MLKKTSQFSGKAKPNTQHLNPSESFCWVSLGVLLGFLGCIVGFRA
FT                   STQPTLARVRRLG"
FT   CDS_pept        complement(323030..326569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03610"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00183"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN19"
FT                   /protein_id="BAG00183.1"
FT                   /translation="MLKPFPLLLSLLLLPVVPVKALSPFSAPAIVAEDSPNAQIERSIR
FT                   QVTVKITSEINRGSGIIIGKKGSIYLVLTNAHVIRGAKTLQIQTHDGQTRTASIVPNSL
FT                   LKDKDLALVEFSDTRNYPIAKISAIPLEAGLDITVTGYSAETGQYTTDNGKIEQTSDRP
FT                   LREGYSVGYSGDIVQGMSGGGIFFEDELIGLNGRSAHPILSNYIYEDGTKPTDAEIQQM
FT                   RAVNWGIPINTLLTYIRPEILSAYNLPLPQVNPDIETTAYTGYIAELETKAKGFTVRID
FT                   SSSKANGSGVIIAKKGNIYTVLTAAHVLCEKIAEEKTCVNFTYTVVTRDGKTRNIEKST
FT                   IIRQEGVDLAVFQFESQDNYPVAEIANYNPNSGDFVFAAGFPKIGNNPSKWLFSGGIIG
FT                   GKEQGLLQTRQSDLSTQQSGTLQSVASLTGGYELVYTSITFGGMSGGAVLDSQGRVIGI
FT                   HGRSEGAGGGKIQLGFSLGIPISTFMGLQERLKVKPQLLTTAQPQVSQQQKLEIIQAID
FT                   SIIVPNTNATADIWIERGGQLWRLARHEEAIKAFDEAIKQNDPKNVYLAWYGKGLALGA
FT                   LDKDQPAIEALQQAINTLPKGEDLKNFHSSILQRQSGVYRSLGDFSTSAGREREARENY
FT                   EQALTVINQAISLLPNNPNYYNEKWAVLDKLKRYDEGLAAITQAIDLAPRAAWYSNRGN
FT                   LYIDLQKYELALSDWNKAIELNPNFADAYNNRGNLYKNLQKYELALSDYSKAIDINPKF
FT                   AEAYVNRGNLYKNLQKYELALSDYTKAIDINPNYAMAYNNRGNLYSDLQKYDLALSDYS
FT                   KAIDINPNYAMAYNNRGVLYSDLQKYDLALSDYTKAIDINPNYAEAYVNRGVLYSDLQK
FT                   YDLALSDYSKAIDINPNYAEAYVNRGNLYKNLQKYELALSDYSKAIDINPNYAEAYVNR
FT                   GNLYKNLQKYELALSDYSKAIDINPNDAKVYYNRGNLYYNQQKYDLALSDYSKAIEINP
FT                   NYAKAYYNRGNLYKNLQKYELALSDYSKAIDINPKFAEAYYNRGLLYYNQQKYDLALSD
FT                   FSKAIDINPNDAGAYNNRGNLYSDLQKYELALSDYSKAIDINPNYANAYYNRGLLYYNQ
FT                   QKYDLALSDFSKAIDINPNDAGAYVSRSILYAILGQPEKVKIDLQQAAILFLQQNNMAA
FT                   YEKVMQILQQLGG"
FT   CDS_pept        complement(326791..327114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03620"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00184"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN20"
FT                   /protein_id="BAG00184.1"
FT                   /translation="MASPSSVKRCSIAHREEKSPPPWLGFPKGAAMCGLSAGNRNISPN
FT                   VPRFVARKSRKNSRKPIIKGVLTISPPAGRRDTRSSAAFHDPAIPAMVIANFLPLNPTI
FT                   IQI"
FT   CDS_pept        complement(327277..328377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03630"
FT                   /product="serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00185"
FT                   /db_xref="GOA:B0JN21"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN21"
FT                   /protein_id="BAG00185.1"
FT                   /translation="MKPITFTLSVLLATTGLLVQPGGFLMENIPPILAQEQTASRVYQK
FT                   ASPAVVTVKNGSGHGSGFLVSPDGIIITNAHVVADGPRVVTVKFSNGQQASADVIGFAK
FT                   NGVDLAVLRIYNRQNLPYLPLARPNSAKVGESVFAIGTPLNEDYQNTLTQGIISRLDPE
FT                   KGIVQHNANINKGNSGGPLLNSRGEVVGVNVAGDIGSYVYDGAGNPIGLTQSGINFAVS
FT                   LDRLQAFLTAVKTGDVSTVSTLGQDDRIQLLALPLNGQTVQGNLTKDQNEQYYGFEGRA
FT                   GQKIVLDMNSNEIAPYLVLYRVLQSSEGTKYPQVARSNQRVDRAPGDFNARLVTELPAD
FT                   GVYILVATSREGGESGRYTLNAAANP"
FT   CDS_pept        complement(328521..328943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03640"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00186"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN22"
FT                   /protein_id="BAG00186.1"
FT                   /translation="MALESRQPAETLITQANYKEAIAHFNRGINYIQQEKYDLALAQFT
FT                   RAIELDPDYTEAYLGRGMIYTIREQWRPAFQDLNTAIRLNPRAAYAYHFRGYVHLAFNQ
FT                   RQNAIADLTTAAELFRQQGNTEMYNSAIEALRQIGA"
FT   CDS_pept        329194..329751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00187"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN23"
FT                   /protein_id="BAG00187.1"
FT                   /translation="MVSKSPTITDAELIRLSCQNPELGFERNADGTLVTMPPIGSISAN
FT                   RELKAGARLLYWVEQNGLGEVFSSSGGFKLANSAVRSPDVAFVARERLPSGWQEREDEF
FT                   LDLAPDFVIEIRSKTDSLSKLKRKMEEYRENGVKLGWLIDRHNKQAFVYRQDGTITCYP
FT                   ENAILSGEDVVPGFTLALEILL"
FT   CDS_pept        complement(329797..329991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03660"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00188"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN24"
FT                   /protein_id="BAG00188.1"
FT                   /translation="MYCWVSLGLLLGFLGSIVGFPYVYRLDKEKAIEDFRQAAELFRQQ
FT                   GNAPAREKALQFLRQLGAV"
FT   CDS_pept        330279..330449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00189"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN25"
FT                   /protein_id="BAG00189.1"
FT                   /translation="MHVHVRRGGGYAKFWLEPLELDYAKGLKTKEIVRAEVIITENIEI
FT                   IRRKWHDVFGT"
FT   CDS_pept        330433..330681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00190"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN26"
FT                   /protein_id="BAG00190.1"
FT                   /translation="MYLVHESIVKAQKVWVEDKWICIRLEDDREIRFPAYKNKRLSKAT
FT                   FEQLAEVELICDGTGLHWETLDEDLSIIGILEGRLGA"
FT   mobile_element  complement(330912..332331)
FT                   /mobile_element_type="insertion sequence:ISMae35_1"
FT   CDS_pept        complement(331150..332241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03690"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00191"
FT                   /db_xref="GOA:B0JN27"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN27"
FT                   /protein_id="BAG00191.1"
FT                   /translation="MLSLIEKLKQVKDFRKDKGKRHPLWIVLVVIILGTMLGYSGYREL
FT                   GEFAKNNRHRLSKEFNIIPERVPSYSTIRRVMMGVDWQSLLKMFNEWALEEYGQRDDIN
FT                   WLGMDGKSLKNTLKNPNNEQQNFIMFVSLFSQESGLVLHLKRMENKKGSEIDEGQAIIE
FT                   DCSLQNKVFTGDALHCQKKTISLIAKTKNDYVITVKGNQKNLYKRIQDLSNSSKPESCF
FT                   LEQDNSHGRKISRKIEVFKVRKNERQGFENLRRVIKVERKGSRGDKTYEETAYYISSLT
FT                   ESAQVFAKIIRGHWKIENQLHWVKDVIFEEDKSEISDFQAASNWSILTTIGLNLFRGLG
FT                   FLSITEGQRWLAERWEKLIVLST"
FT   CDS_pept        complement(332417..332758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00192"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN28"
FT                   /protein_id="BAG00192.1"
FT                   /translation="MNEDRVYLEYILDCIDKIKDYSQGGKQEFFANSMISDAIIRRLQT
FT                   LAESTQRLSEELKANIPNVDWRNISGFRNILVHDYLGGIDLNTVWEVVENYLDDLRKQI
FT                   LRHLESVNT"
FT   CDS_pept        complement(332755..333084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00193"
FT                   /db_xref="GOA:B0JN29"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN29"
FT                   /protein_id="BAG00193.1"
FT                   /translation="MFIKNLRDGCYFMTLKQLIQDKREDILKIATKHGAFNVRVFGSVA
FT                   RGEETENSDIDFLIDYDLAKTSPWFPGGLLVDLEALLGCKVDVVTEKSLHHLIKQRILK
FT                   EAIKL"
FT   CDS_pept        complement(333327..333671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03720"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00194"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN30"
FT                   /protein_id="BAG00194.1"
FT                   /translation="MKTLSFKDIQFIIEALESLLKNYSDRIQQIEALENYEDEISDLSN
FT                   DSLFLQELITDLQNQQTQELALLVPEFDLKKMPLQTLIKQGKNLSIEEKLILLESLTSS
FT                   IREEYNLMRT"
FT   CDS_pept        complement(333680..334027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00195"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN31"
FT                   /protein_id="BAG00195.1"
FT                   /translation="MIKTPVDLYRRGNATSPRMDYVRPNKDIAIYENNGQIWVKETLVD
FT                   GQTPGGISTFSVQGIGNNWWKLDRGISIPSELELINDRGNHWLWKPLFPMSIETYQHAL
FT                   RVIGEFFYRVS"
FT   CDS_pept        334152..334355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03740"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00196"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN32"
FT                   /protein_id="BAG00196.1"
FT                   /translation="MAYKRPRLRIIVIIAIIVDWVDPRKPNKKIQTDLDFGCWVSLFLR
FT                   IERFSLTYLFAQPNLRNYETLK"
FT   CDS_pept        complement(334512..334808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03750"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00197"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN33"
FT                   /protein_id="BAG00197.1"
FT                   /translation="MITYLATVHKDNHSDYGVQFYDFPGCISAGETIEEAKKMATEALK
FT                   GHISFMLADGDEIPTPSTLETILTDADHQDAIAFLLIEVSEAILNHQELCVKN"
FT   CDS_pept        complement(334820..335008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00198"
FT                   /db_xref="GOA:B0JN34"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN34"
FT                   /protein_id="BAG00198.1"
FT                   /translation="MESREIIKKLKDEGWYQVGTTGSHHHFKHPHKKGKVTVPHPKKDI
FT                   PLKTLISIEKQAGIKLR"
FT   CDS_pept        335099..335434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00199"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN35"
FT                   /protein_id="BAG00199.1"
FT                   /translation="MAACCRSIFTFSDCPNMAYKTPRLRIIVIIAIIVDWVDPRKPNKK
FT                   IQTDLGVGCWVSTVGWVEARNPTIHPRKPNKKIQTDLGFGCWVSLFLRIERFSLTYLFA
FT                   QTNLRNY"
FT   CDS_pept        complement(335428..339567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03780"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00200"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN36"
FT                   /protein_id="BAG00200.1"
FT                   /translation="MIKPSIALILLFSLLPQPGLTLITPAAGNISNHPILTAQGDRELT
FT                   EEQILQRVTVRITSETNRGSGTIIAKKGDNYLVLTNAHVTRNTKTLQVQTYDGHSRAAR
FT                   IVPNSLSENQDLALLEFSDTRDYSIATIAKFTINQNRIGLEVVAAGYVAETGQYRTTKG
FT                   TLEQVSDRPLRDGYSVGYSGDIVQGMSGGGIFVDGELIGINGRSAHPILSNYTYEDGTK
FT                   PTDEEIQQMRAVNWGISLHTLLTYIRPEILSAYNLPLPQVNPDIETTAPTVYIAQLETK
FT                   AKGFTVRIDSSSKANGSGVIANGSGVIIAKKGNIYTVLTAAHVLCEKIAEEKTCVNFTY
FT                   TVVTRDGKTRKIEKSTIIRQEGVDLAVFQFESRDNYPVAEIANYNPNTGDFVFAAGFPK
FT                   IGDNPSKWLFSGGTIHDKEGGLLQTRQSDLSNEQGGTLQSVASLTGGYELVYTSITFGG
FT                   MSGGAVLDSQGRVIGIHGSSETAGVGKIQLGFSLGIPISTFIGLQERLKVKPQLLTTAQ
FT                   PQVSPQQQQEIIQAITGVIVPNTNAKADIWIQRGGQLWRLERYEEAIKAFDEAIKQNDP
FT                   KNVYLAWYGKGLALGYLGKYQTAIEALQQAINTLPKREDLKNFHSSILQKQSVVYRYLE
FT                   NYEQALTVINQAISLFPNNPNHYNEKYVVLSQLKRYDEGLAAITQAIDLAPRAAWYGNR
FT                   GNLYYNLQKYDLALSDWNKAIKINPNYANAYNNRGNLYSDQKKYELALADYSKAIDINP
FT                   NDAVAYYNRGNLYYNLQKYDLALSDYSKAIDINPNDAKAYYNRGNLYSDLQKYDLALSD
FT                   YSKAIDINPNYAETYNNRGNLYKDLQKYDLALSDYTKAIDILALSDYTKAIDINPNYAV
FT                   AYNNRGLLYFNQKKYDLALSDYSKAIDINPNYAETYNNRGNLYKDLQKYDLALSDYSKA
FT                   IDINPNYAVAYNNRGLLYLLQQKYELALADWNKAIELNRNLALAYLGRGGIYSLQQKYE
FT                   LALADYSKALEINPNLAEAYLGRGSIYSLQQKYELALADYSKALEINPNLAEAYLGRGG
FT                   IYLLQQKYELALADFNKALEINPNYAMAYFGRGELYYYQKKYELALADYNKAIDINPNY
FT                   ANAYNNRGSIYYNQQKYELALADWNKAIELDSKLAMAYSNRGNIYNDQQKYELALADFN
FT                   KAIELDSKLAMAYSNRGNLYYLQQKYELALADYNKALDINPNLAEAYLGRGGIYYYQQK
FT                   DELALADFNKAIEINPNLVEAYNNRGNLYYLQQKYELALSDYNKAIKINKNAWFAMMGI
FT                   GLVKYEQGSISEAIKQWEKALIINNQSAEIQLALAVAFYHQGEKDKALKLAESALSINS
FT                   QLANIDFLKKILRTNKIFADVQKLLAHPELKNYVNQ"
FT   CDS_pept        complement(339633..342101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03790"
FT                   /product="hypothetical protein"
FT                   /note="similar to adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00201"
FT                   /db_xref="GOA:B0JN37"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN37"
FT                   /protein_id="BAG00201.1"
FT                   /translation="MIKLLTLELDGTFDRGFKVKLEIRPDLNSRPQTVIKARLPANLEL
FT                   LTLYRQWQRHYSELEGFFKVLKDSNPQQITNSSQQSLVFKNCQEKAKLFEDNLNKWLNN
FT                   SPEFEPIKTAILRSGNNFRIWLQTDNIWLQRFPWEKWEILQNTGADIAIIVSEYDTLTR
FT                   QLKNHEKIRILAILGYATDLRFLEEDRKTLDDIAGKAGAEIIWEKAPHPQKLNQLLRQE
FT                   TWNILFFSGHSASTEDGQDCEIQLTETHKLKIADFSFSLGEATKNGLKLAIFNSCDGIG
FT                   LAQQLSREKGMALPHLIFMREKLPDPVSPKFLQYFLTAFTNNKSLYSAVHEAQKNLHDD
FT                   WEKDYPCASWLPVVCPNPTEEPPTWHSFSNSPQKQQNWRRFALTFGLGLAVTMTVLAIR
FT                   ETGILEPLELNIYDRLMQLKPKDKPDERLLIITIDRQDWEYQDRMGMKRPTIPGSDRKR
FT                   SLAGEALSQLLNKLLPYEPQIIALDILRPIAASQDYPPLAKQLQNTPNFISICKFNNYP
FT                   QPDGFPPPPELPKNQSGFSNIVPDETIAGVPRIRRFLYQAKLDRTSPCLPPDSLATVDS
FT                   MSCNFKDYAPSFSLLIAKRYLESQNQDFDCNKLQRGILEINIGDTHLGDWLQSNRGPYR
FT                   TSQSDTRSGRQVMLAYRRIADNGSDAITKIAPKKSLQQVLDPGFNSESVRGKIVLIGVT
FT                   EPGIDDFLTPFSRNPSEAIPGVYLHAHAVSQILDTMEGKRTSIAFWNPLQEAFWVLGWS
FT                   LVGGLLTWRFLRVKTVLLTVAITVISLTGIGWLLFSYFGLWVPIIPPAIALLTTSGIFF
FT                   FLRSYTKSVE"
FT   CDS_pept        complement(342117..343244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00202"
FT                   /db_xref="InterPro:IPR014951"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN38"
FT                   /protein_id="BAG00202.1"
FT                   /translation="MVNDWLELTPDSIWLEIPADIQEISWAKSASFTDASIRQRFYVNY
FT                   LCQQVIFNYLQSGMPGVSLVENQEDFWQLGVNGFTVKLGEKSVIVIASETLDLEAIEIP
FT                   QEWVDIPQLIGDYYLAVQVNTAESYLRIWGYTTHKDIKEKGQYIKRNLNYSLPRNQLQS
FT                   GSDSLNLWGECQLQPVKIEPEKMEEKLSLDRLTTLLDILANPQLIFPRKAVTFQEWAAV
FT                   IVNSNWRKILITRRQKSPVKLTNWFADNFPIDWQSILDFSSLSLVPAFKNTEIKRIKDL
FT                   GIELLGNSLALMITIAKIEEVFSLQATVYPTGETSTLPPHLKLTILTENGQVFREVIAT
FT                   DNDEFIRYRFDAELGDKFFIEVALESARVTEYLQV"
FT   CDS_pept        complement(343247..344494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03810"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00203"
FT                   /db_xref="GOA:B0JN39"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN39"
FT                   /protein_id="BAG00203.1"
FT                   /translation="MKKRETLLEKFCCFLVLRQNRTEWNCDRRLRRNMESYGPIDPNVE
FT                   SEDYWSLFFHQQYQNHGSKNHLFRGHLYAYLQEPCYWAAAEIYQKYQAKLDYQIEDYFN
FT                   EGILGFEAILADFKPLFSTRFDNFATQRIKYRLIDRIRQISQAFGHNTWSLLLNSTGAR
FT                   LSQALLARGLVGETLENYLLAWDYYKEIYAQAKIKTDGKIQEPSPEIWQKIAAAYNSDS
FT                   HSTIKISSATITRWLKDAGQAISDYLFPQGKTISLQQPFGDGESSTREEMIEDTLHNNP
FT                   WQQLEAAENFLDSQQNHQKILAWLGAEIEQICQQPQQAKLHPQIQLILEMTYGSGLGQV
FT                   AIAAKITEITTVVIKQYQVSRELDKVYRHLAKKFLPWASENLHIPSQSHDREVISKAIE
FT                   PWLTYYYQTSATTQED"
FT   CDS_pept        344768..346621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="MAE_03820"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00204"
FT                   /db_xref="GOA:B0JN40"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN40"
FT                   /protein_id="BAG00204.1"
FT                   /translation="MNKNGNNKKWRNAGLYALLLIVVLALASAFFDRQPAVQQTWKYSE
FT                   FLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISVLPQR
FT                   EEGVWVRAFSSLFFPILLLVGLFFLLRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGD
FT                   VAGIEGAKLELNEVVDFLKNADRFTAIGAKIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSEFVEMFVGVGASRVRDLFEQAKANAPCIVFIDEIDAVGRQRGAGLGGGNDER
FT                   EQTLNQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVVVDRPDYAGRKEI
FT                   LNVHSRGKTLAQDVDLDKIARRTPGFTGADLANLLNEAAILAARRNLTEISMDEINDAI
FT                   DRVLAGPEKKNRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWF
FT                   TPSEDRMESGLYSRAYLQNQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMV
FT                   TRFGMSDRLGPVALGRQNGNVFLGRDIASDRDFSDETAAAIDEEVRNLVEQAYRRAKEV
FT                   LVNNRVILDQLAQMLVEKETVDAEELQNILAHNDVKMAALA"
FT   CDS_pept        346672..346827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03830"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00205"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN41"
FT                   /protein_id="BAG00205.1"
FT                   /translation="MIAVNRVHLNFCQSHTEKTGFSEKPVFYSCNFGFLSGNFLLKLIQ
FT                   GRVDSR"
FT   CDS_pept        347169..348116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03840"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="IPP transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00206"
FT                   /db_xref="GOA:B0JN42"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JN42"
FT                   /protein_id="BAG00206.1"
FT                   /translation="MTTSSLPILIVICGATATGKSSLALQLAEKFNSVILSADSRQIYR
FT                   EFNIGTAKPSLEECQRIPHYLIDICDPQDNFTLAQYQEQAEDLINNLHYSPLFLVGGTG
FT                   LYIKSIVKGLKIPRVSPQADLRRQLQALGQSYLYQILTQVDEEAAKKIHPHDQVRTLRA
FT                   LEVFYLTGKPISSQQGENPPTYPILQIGLDCSPESLGKRITVRTDQMIARGLVAEVQNL
FT                   GDKYGWDLPLLQTLGYAEIKQYLLGEISLEQAIDLIILHTRQFAKRQRTWFRADADIIW
FT                   FPVDKENLLESVEREIILFLEGLSRPDIKTHHPD"
FT   CDS_pept        complement(348058..349464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00207"
FT                   /db_xref="GOA:B0JN43"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN43"
FT                   /protein_id="BAG00207.1"
FT                   /translation="MHKKNYLFWLVICGTIILFICSSIRHILFQSNALDLGWFDQGVYL
FT                   ISQGKPPIISFVDYHILGDHIAFILYPIALLYKIYPSVYWLLFLQAFSLSLGAFPLWQL
FT                   AIQAGLKEKQAYTLALVYLLYPLIFNVNLFDFHPEVIAVPAIFWTILAARLNNLWGFCL
FT                   GIIIILGCKAILSLTLLGMGIWLLLWEKKKISGIIAIITGILWFIIATKLLIPLLTGKS
FT                   AVIEMADSRYSYLGDSLPAIIFNLFLKPDLVLGKIFTGNNLEYLILLIIPLVWGLSWRY
FT                   SAPIIAAIPALALNLLADHAPQKNLTTQYSLPILPFLFLAVIATLAHNSSWLKQPKWII
FT                   TWAIIAFFALAKYGYFWSLYLNSLDTWSATQKALTQITTSESVLTTSRIAPHLTHREMI
FT                   KLAIEGSQSLDLNQFNYILLDRRHPGWSSSSELIDDHLNKLNQNDNFQLIVNQDDVFLY
FT                   RALTTPQETK"
FT   CDS_pept        complement(349477..350334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03860"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00208"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN44"
FT                   /protein_id="BAG00208.1"
FT                   /translation="MKLIILTLVILSNVFAALPAKSETVLEKIKRTGLLEVAMREDAIP
FT                   FGYRDSNNNLQGLCLDFIQLLRGELKHKLNLRIISVKIYKSTLFNRFQLLENKTVDFEC
FT                   GPNSIRKNIPNAVSFSRPFFVTGTQFLVRSDNQNNFNFSSSLEGISIGVLRDTSTQELL
FT                   RQKYPLATYQEFQGVTGRLRGIQSLRRNGIDAFASDGILLIGEAVILGLSLEKDYQLIP
FT                   RNPLNCDYYGFILPANDPQWQEFINGVIVTSENRNIFKTWFTEVASYFIHTWQYCRNNP
FT                   EESR"
FT   CDS_pept        complement(350353..351390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00209"
FT                   /db_xref="GOA:B0JN45"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN45"
FT                   /protein_id="BAG00209.1"
FT                   /translation="MKFGQWLGFICLIMALYVLWQIRQLLLLIFMAIVFTVALNRCVKG
FT                   LQRLGIKRGLAILITLLTSLAIVILFFIIIVPPFIEQFQKLIELLPQAWDLVRNNSIQW
FT                   RQQFQFDWLPSLPNLTDLFQQLQPLGTFVFSNFFTFFSNSVAAILQLLFVLVLAMMMLA
FT                   NPQPYRQAFLKLFPNFYRRRAEEILTLSEAGLGNWLLGIAISSTMVGLFSGFGLWLLQI
FT                   NLVLVHAILAGLLNFIPNIGPTASVIFPILIAVIDAPWKIVAILILYFIIQNVESYWLT
FT                   PTVMAKQVSLLPAITLIAQIFFAQMFGILGLLLALPLTVVVKTWLDELLFKDILDKWDH
FT                   GHNKS"
FT   mobile_element  complement(351491..351670)
FT                   /mobile_element_type="MITE:MaeMITEb003"
FT   CDS_pept        351699..351962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03880"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00210"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN46"
FT                   /protein_id="BAG00210.1"
FT                   /translation="MDDNNSAVFSLITVYCSLITDQISPLPHFPNSINQVLYQKFANFA
FT                   VMCYTITPQNRIEKRDFLNYQTFSQILWQLSQSQIILKEILS"
FT   CDS_pept        352030..352827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00211"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN47"
FT                   /protein_id="BAG00211.1"
FT                   /translation="MKELERYYKVLGLDHGASLDEINQAYKDLVFIWHPDRIPKDNQRL
FT                   LEKATAKLQEINHAREQLRQIHQNSPKRSNYPPKTEKQPAHAYKTASPYQPHPSQPGQN
FT                   SQTHSHKTHSQQTHSQQTHSQHSHSQNNHQVHNHAAWRPHYRDLNGADLQGANLKEKDF
FT                   SSRSLIGADLSHADLSDSFLHKVNLEKANLYKANLFRANLLEANLKGANLQEANLIGAD
FT                   LSGADLSAADLRGAKIGFGKRIMVKLTGAILTGTILPDGSIHQ"
FT   CDS_pept        352915..353328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00212"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN48"
FT                   /protein_id="BAG00212.1"
FT                   /translation="MQLAGGENLSAANSDFLLLQKALEKHNFIVKISPPPVRGAYGLFD
FT                   SKTRIIWIHPLVFDLGIARPTLIHEAVHAAQLCHGGKTVKALNLAIEPPAMTRRFFMNY
FT                   QGFSRQIEAEAYTVQVQPDGLDLVISLLQKYCP"
FT   CDS_pept        complement(353346..353996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03910"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00213"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN49"
FT                   /protein_id="BAG00213.1"
FT                   /translation="MTSQLKPNSPKILAVVNGKGGVGKTTTAVNLAAIWGQNQRVLLVD
FT                   ADPQGSSTWWVERNQAGMVFDLAKQINTEKLGELRQIIEYDLIVIDTPPALRSELLTAV
FT                   IAESDYLILPTPPAPMDLMALIDTVRTAVKPLGIAYRVLLTKVDSRSLKETLEAQNTLL
FT                   ELGIPACHAFVRNYKAHEKAVLDGVAITNWRGKNAQEASADYRRVAEELERDW"
FT   CDS_pept        354053..354232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03920"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00214"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN50"
FT                   /protein_id="BAG00214.1"
FT                   /translation="MPLLLRGDPPAYRHPPYQGGQGGSNLKSIFNLIITSYLSVISYQL
FT                   PVISYQLPVIRFEF"
FT   CDS_pept        complement(354329..355801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03930"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00215"
FT                   /db_xref="GOA:B0JN51"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN51"
FT                   /protein_id="BAG00215.1"
FT                   /translation="MSATEYEAIIGLETHCQLNTRSKIFCSCPTNFDSPPNTNVCPVCL
FT                   GYPGVLPVLNQEVLASAVKLGLAIDGKITPHSKFDRKQYFYPDLPKNYQISQYDLPIVE
FT                   QGQLEIEIVDKKTKEVSRKIIGITRLHMEEDAGKLVHAGSERLSGSTHSLVDFNRTGVP
FT                   LLEIVSEPDLRTGAEAAEYAQELRRLVRYLGISDGNMQEGSLRCDVNISVRKKGTEKFG
FT                   TKVEIKNMNSFSAIQKAIEYEIDRQIEAIKNGELIVQETRLWEEASQRTISMRKKEGSS
FT                   DYRYFPEPDLPPLEVSPEQLKAWAEELPELPARKRRRYEEEFGLSAYDARVLTDDRTVA
FT                   EYFETAVIAGANAKLVANWISQDIAAYLNNNKLTITEIALQASDLAELVKLIEMGTISG
FT                   KIAKEILPELLTEGGSPKTLVEKKGLIQISDTSAIKKLIEEIIASHPSELEKFRAGKTN
FT                   LKGFFVGQVMKKSGGKADPKLTSQILDQKLSG"
FT   CDS_pept        356524..358053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03940"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00216"
FT                   /db_xref="GOA:B0JN52"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN52"
FT                   /protein_id="BAG00216.1"
FT                   /translation="MSLTLSEQLKREQLSYPQTLLHHLQRLRHFVTVEGEEKLQQWKNL
FT                   IEKENFQPSTRNLAYYLALRQEDIRDLQLALMPWGLSSLGRIESKVLPTLDAVIATLGA
FT                   VCHQEASLLPKHPPLEAFFQGDQLLASHSAEVFGLPSPRRRVRIMVTMPTEAATDPDFI
FT                   AQLLRCGMDCIRINCAHDGPKEWQGMIENLREAVKNPENLVNGHTCKVYMDLAGPKIRL
FT                   EEILAPQSQTRLYQGDFLLLTTQPPHTAHPQYFQANCSQPEIIPQIPVGAKVWIDDGHI
FT                   GAEVIAIMPEGLLLKITHAREKGEKLKADKGLNFPDTVLNIDPLTAKDRQDLDFIAENA
FT                   DIIGYSFVQKASDIETLQLELQSRLGDAWRQKAIVAKIETPLAVKNLPELIIHAAGKQP
FT                   FGVMIARGDLAVEIGYQRLAEIQEEILWLCEAAHIPVIWATQVLENLVKKSIPSRAEIT
FT                   DAAMAERAECVMLNKGEYIREAVTILDDVLQRMQSHQAKKTPQLRALHSWV"
FT   CDS_pept        complement(358155..358841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN53"
FT                   /protein_id="BAG00217.1"
FT                   /translation="MLKRRFERLNALADINSASKYLEIGVSSGGTFIRVKVPQKIAVDP
FT                   CFKDDVHKKYANENSIFYEITSDSFFSTLAPQHGEFDLIYLDGLHTFEQTFRDFCNSLR
FT                   YSHSRTIWLIDDTCPISWFASLPNFRLFRILRKLLKIKDPSWMGDVYKVIFAIHDFFPQ
FT                   FSYATFPGHGQTVLWLETRKDFIPTWDSLEKISRLSYWDFEKFKDTHLLIRDPETILDQ
FT                   IKNSLS"
FT   CDS_pept        358886..359065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03960"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00218"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN54"
FT                   /protein_id="BAG00218.1"
FT                   /translation="MIGQNIFVNQHYYWHNIALFTLLRYRQVLPTKGLSPLPMPHSDEN
FT                   CYNIFSWYRQRIYP"
FT   CDS_pept        complement(359320..359514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03975"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48271"
FT                   /db_xref="GOA:B3DF86"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF86"
FT                   /protein_id="BAG48271.1"
FT                   /translation="MLANHQNQTFVRNYLIAVISVVMMGVGVADLVNNPSRIAQQNRLD
FT                   GYGRYVSAGLVSGAVNNMR"
FT   CDS_pept        359772..360326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03980"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00220"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN56"
FT                   /protein_id="BAG00220.1"
FT                   /translation="MTIKFFWPLVLGLSIVIIDNGQYLRAETVTLSASQRQQLRSLDAK
FT                   IILPNYIPPGFRASEIKILAEEGNGYAVLFENAENSCFLVEGIENARGDDGLELEGTLA
FT                   LNSPLFGEGYWLNYGTPKDSELRQQFPEPDLYSDWMKMGEYFYRLSGALIAREEYDYPN
FT                   CRQDISPSEAVKIIESFGDNN"
FT   CDS_pept        360487..362007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00221"
FT                   /db_xref="GOA:B0JN57"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN57"
FT                   /protein_id="BAG00221.1"
FT                   /translation="MVFSIGNNYQIVPLNQIISLDTLLAPLQSNHQATIADVIKLVIQE
FT                   DNHPPLYFIFAYLWNKLFFDRGEYVSLEGMRLLAVFWGVISIPLIYFISKLVFKSGLIA
FT                   FLSAILMAVSPYAVFISQEARHYTLAVVFVLISLGCFLRASSKIIDHKRISHTLVFFWL
FT                   IVNCLGLLVHYFFSLTILAEAITLLLILFKQIQQKNFWITNWWRLSLVFLGNLSFIIIW
FT                   FISFVPKDYGNQMTGWIQRDNDSFLAVISPFFQLLGTLITMLSLLPVESESLIIILISG
FT                   AIMIGFFLWIIPQLKTAWLDSYKSELGILSAFFLSSIAIFFVITYLLLIDITRGARYSF
FT                   VYFPSVILILAILLDNCWQRKQKRIVIIVIIMALVSSLSVTFNLGYRKYYRPDKLVTTI
FT                   ENNSRYPLVIATSYRSLVQVGEMMGIAWEFNQKFPDKNPKFILVNPEQKPNFNLSSSLA
FT                   FELWLINFHSSIDLSDCQPSELSSNYVTGYEYQKFLCGRSMDYNSKVK"
FT   CDS_pept        362019..362228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04000"
FT                   /product="glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00222"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN58"
FT                   /protein_id="BAG00222.1"
FT                   /translation="MIIWVNEQIDPCGLVQACIACQDEQAAKDCHQSWLTSLTDEQKQA
FT                   GWVAVLRTVESWDDVPVNALKLSY"
FT   CDS_pept        complement(362428..362922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04010"
FT                   /product="single-stranded nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00223"
FT                   /db_xref="GOA:B0JN59"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN59"
FT                   /protein_id="BAG00223.1"
FT                   /translation="MSIWEQNSEKAKQWLEKLLKLMAMPTDVQIGVQELGTGPSSCWLI
FT                   IDSSQLSPQQVELLLANKGEGLDAIQSLANTILNIGVEAAEHQFYIVEINGYRQQKQAE
FT                   LFDWVNQAATQVRQTGQEIELKALSSAERRQIHAFFQEENDLTTESRGVEPDRRLVIRL
FT                   K"
FT   CDS_pept        complement(362922..364070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="MAE_04020"
FT                   /product="inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00224"
FT                   /db_xref="GOA:B0JN60"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN60"
FT                   /protein_id="BAG00224.1"
FT                   /translation="MDFGVGFISTNIMLPILDFFFRIVHSYGFAIIALTLVVRFAVFPL
FT                   SAGQIRNMRKMRITQPLMKERQTEIQQRYKNDPQKQQEEMGKLMQELGNPLAGCLPLLL
FT                   QMPILLALFATLRGSPFSDINYTVDLQVLPSEQIAMVQRQLYATKPQNVYIDESLHYPI
FT                   TAFLPQGNKIAPGEQVKIDLQNDQGKSLSQLATEAPENNLKPTYEVVKGQELVQVNEDG
FT                   SIVALAPGDASIKVIVPGIAANTGFLFIEALGRIGATGPDGEIHWDILAMVIAFGISIY
FT                   VNQELSGAGAPSGGAAQQQQTVNKITPIIFSMMFLFFPLPAGVLMYILTANIFQTIQTV
FT                   ILMREPLPENLQKLVAEQEKTEKSRDALPFEKRSSKKKEKTS"
FT   CDS_pept        complement(364155..364550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00225"
FT                   /db_xref="GOA:B0JN61"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN61"
FT                   /protein_id="BAG00225.1"
FT                   /translation="MGIKEETFYEGGPHIGDLIINILLGFTVICLPLTVGAVVRAIWLR
FT                   YKITDRRISITGGWMGRDRTDIIYSEVAKVAKMPRGIGLWGDIVVTLKDRSRLEMRAMP
FT                   KFREIHDYIAERVADKTGRPLESIISQ"
FT   CDS_pept        complement(364540..364902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="MAE_04040"
FT                   /product="protein subunit of ribonuclease P"
FT                   /note="RNase P"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00226"
FT                   /db_xref="GOA:B0JN62"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JN62"
FT                   /protein_id="BAG00226.1"
FT                   /translation="MGLPQIHRLKHRQDFQAVYGTGKRYHGSHLTLISLEDSCPDAPGP
FT                   SRFGISISKKVSKKAVVRNRLKRQIRAVIRELLPEIAAGWRGIIIIRPGAIECNYEHFL
FT                   RELKQLLVKANIIHGH"
FT   CDS_pept        complement(364929..365066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl34"
FT                   /locus_tag="MAE_04050"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00227"
FT                   /db_xref="GOA:B0JN63"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JN63"
FT                   /protein_id="BAG00227.1"
FT                   /translation="MSKRTLEGTTRKQKRTSGFRARMRSVNGRKVIKARRKRGRYRLSV
FT                   "
FT   CDS_pept        365157..367121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04060"
FT                   /product="glycogen debranching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00228"
FT                   /db_xref="GOA:B0JN64"
FT                   /db_xref="InterPro:IPR006451"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN64"
FT                   /protein_id="BAG00228.1"
FT                   /translation="MVKLRFGRDICNCLPVAEKREWLVTNGIGGFAAGTVAGLLTRCYH
FT                   GLLIAALAPPTQRTLLVTKIDESIQYNQKIYHLASNRWLGATIEPQGYINIESFHLEGT
FT                   IPVWTFTCGDALLEKRIWMEQGENTTYTHYTYRRGNSPLTLNLTAFVNYRDFHGNTQGF
FT                   NWQMAISPLEKGVRVIAYDNAVPFYLLISQGEVFPAHIWYYRFDLAVERYRGLIDRENH
FT                   LHAASFSATLKVGESVTIAASTRPDPSLDGQSSLESRYRYENSLINPQQPEWIQQLTLA
FT                   ADQFIVSRPLRDQPEGKTIIAGYPWFGDWGRDTMISLRGLTLTTGRPAIARQILLTFSR
FT                   YLDRGLLPNLLPDGGEMPEYNAVDAILWYFEAIRSYFNQSQDFEFLRTIYPALKEVIAW
FT                   FRRGTRYNIHLDDDGLIYAGEAGVQLTWMDAKVDDLVITPRIGKPVEINALWFNALKIM
FT                   VQFAHYLGMDATDYEKMRKMTLKGFSRFWDDSLGYCYDVLDTDKGNDASLRPNQLFAVS
FT                   LSVEELLNSPQKKAIVDICALKLLTSRGLRSLDADHPDYRGVYSGDRLKRDSAYHQGTV
FT                   WGWLLGAFIEAHLKVYRDPILAESFLTPMIDHLRDSCIGNLSEIFDGNAPFTPRGAFAQ
FT                   AWTVAEVLRVWQAIREFSP"
FT   CDS_pept        367469..368137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04070"
FT                   /product="HAD-superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00229"
FT                   /db_xref="GOA:B0JN65"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN65"
FT                   /protein_id="BAG00229.1"
FT                   /translation="MEKPQVIFLDAVGTLFGVKGSVGAIYSQIAADFGVEVAAESLEQS
FT                   FLAIFPTSPPLAFPKVEPAQIPELEYRWWRSLTGAVFHNLGYLERFPDFEAFFGELYRH
FT                   FATAEPWVLYEDVIPALRLWQIQGIELGIISNFDSRIYQVLAELGLEYFFRSITISSHA
FT                   GAAKPDAEIFQIALQKHDCSPAQAWHIGDSKKEDYQGAKALGMEAFLIKRSIGQERKSL
FT                   "
FT   CDS_pept        complement(368227..368949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="MAE_04080"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00230"
FT                   /db_xref="GOA:B0JN66"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN66"
FT                   /protein_id="BAG00230.1"
FT                   /translation="MIAEPNNSVIFDENQESFPNSPESLTTESEATVTDEAKTVTNQAA
FT                   SSEEFSLLGGMTIDALQEEIDTLKQQLEEQTQQVDAYKKLYITLAAEFDNFRKRTAKEK
FT                   EELETKIKGKTLMEILGVVDNFERARTQIKPANDGEMGIHKSYQGVYKILVESLKRLGV
FT                   SPMRPEGQPFDPTYHEAMMREYTDEHPEGTVVEQLVRGYTLGEDVLRHALVKVAAPKET
FT                   DPNADQSESSYIPSQELV"
FT   CDS_pept        369190..371205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="MAE_04090"
FT                   /product="pilus biogenesis protein"
FT                   /note="homologous to general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00231"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN67"
FT                   /protein_id="BAG00231.1"
FT                   /translation="MTFSSKKTRAVALRNYFSPFGNKLVQSGYIGADQMQRALVETRKS
FT                   GRSLVEILQQLTGRPLPPDLQRQYKKNQLFELKILYGVESIDPELTDVDGLEIARLIDS
FT                   LIPIDLCRRYRLIPLSRIEGEPAAILIAMVDPDNLEATDDINRILRPRELGLQRLVITS
FT                   EDYERLLEKFHSVQSELEQEKARLQKEKELAKLSDLTGIVSNIEVASGAANDEVADDLG
FT                   EGEANQAPVINLVNKILAKALQEGTSDIHIEPQEEFLKIRFRKDGVLHQAFEPLPKKIT
FT                   PAVTARFKIMADLDIAERRLPQDGKIRRLYQGRTVDFRVNTLPSRYGEKVCLRILDNSA
FT                   TQLGLDKLITDQKTLQIVRDLASHPFGLLLVTGPTGSGKSTTLYSVLAERNHPGVNIST
FT                   AEDPIEYSLPGITQVQVIREKGMDFASILRAFMRQDPDVILVGETRDKETAKTAIEAAL
FT                   TGHLVLTTLHTNDAAGAIARLDKMGVEPFMISGSLLGVLAQRLVRRVCSQCRVAYNPSQ
FT                   GELARFGLAAANEREVTFYKANTLTLEEIQQARKQGNLCLKCSGSGYKGRIGVYEVMQN
FT                   SERLQQLIYQGATTDRIKEAAVDEGMVTLLAYSLNLVREGYTTLEEVERVTFTDSGLEA
FT                   ELKAKRKSGLICRGCRAELQPEWLDCPYCMTPRFSD"
FT   CDS_pept        371351..372451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="MAE_04100"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00232"
FT                   /db_xref="GOA:B0JN68"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN68"
FT                   /protein_id="BAG00232.1"
FT                   /translation="MELMIEDLMEQLVEMGGSDMHIQSGAPVYFRISGKLSPINEESLT
FT                   PQDCQKLIFSMLNNTQRKELEQNWELDCSYGVKGLARFRVNVYKERGAYAACLRALSSK
FT                   IPNFEQLNLPRVVRELSERPRGLILVTGQTGSGKTTTLAAILDLINRTRSEHILTVEDP
FT                   IEYVFPNIKSLFHQRQKGEDTKSFANALRASLREDPDIILVGEMRDLETISLAITAAET
FT                   GHLVFGTLHTSSAAGTVDRIIDVFPANQQAQIRAMLSNSLLAVFSQNLVKKKNPKPGEF
FT                   GRAMVQEIMVVTPAIANLIREGKAPQVYSAIQTGMKLGMQTMEQGLANLVVRGVVSLEE
FT                   AISKSGKPDELQRLIAGAGANAKARI"
FT   CDS_pept        372618..373832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="MAE_04110"
FT                   /product="pilin biogenesis protein"
FT                   /note="required for twitching motility"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00233"
FT                   /db_xref="GOA:B0JN69"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN69"
FT                   /protein_id="BAG00233.1"
FT                   /translation="MPNFVAQVKNGSGKVFQEKVEAMSPEQARTMLKAKYAAVGKVKKV
FT                   GGEIDLSGLKLMFTSISIKDKAVFSRQFSVMINAGVAIVRCLGVLGDQCGNLKMKKALQ
FT                   AISAEVQQGTPLSEAMAKHPECFDELYVSMVEAGETGGVLDEVLNRLSKLLEDMARLKN
FT                   QIKSAMTYPVAVGILAVIVFFGMTIFLIPVFAKIFTDLNVPLPALTQFMLFLSSVMRSW
FT                   LILIPIVTIVATVFLLRRYYKTPMGRLQIDHFFLKMPLFGDLNEKSAVARFCRVFGTLT
FT                   RSGVPILSSLDIVCNTVGNQVIANAIAGAKAEIQQGGMMSLALQKANVFPPLAIQMISI
FT                   GEETGELDAMMMKVADFYEDEVEQAVKALTSIIEPLMMIGVAGMVGIILLSMYLPMFKI
FT                   FDALG"
FT   CDS_pept        373928..374137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04120"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00234"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN70"
FT                   /protein_id="BAG00234.1"
FT                   /translation="MSYETLLAEYSCRERAIELLRQYRPYLGSAEKVFPGGRVWGVGCG
FT                   VWGFTGFEVANYLIFREKVPEFSP"
FT   mobile_element  complement(374011..374216)
FT                   /mobile_element_type="MITE:MaeMITEa012"
FT   CDS_pept        374243..374683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00235"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN71"
FT                   /protein_id="BAG00235.1"
FT                   /translation="MRRPEESLITIPLPLVRIRPSSALESRKTVQLACDLAILMCDPEW
FT                   KIKLGSEILIFIHRPGEDFSDLLKRWRETQICLDKEYEWLMPPREQHMFSEGAETIHPL
FT                   FVVFDQTAERIKKGLRGAFLPMVVQSYRPALIDDCLELVDQD"
FT   CDS_pept        complement(374726..377296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00236"
FT                   /db_xref="GOA:B0JN72"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR018768"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023862"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN72"
FT                   /protein_id="BAG00236.1"
FT                   /translation="MTIALDQLLTPDIFRPARYLGNELGAKHKEWASAVVRWVLTYPEV
FT                   YEVGASNLGHIILYNILNAQPRQLCDRTYLPAPDLAQKLKQTKTPLFALESRRCLTDFD
FT                   ILGFSLSYELGATNILEMLDLAAIPLTWRARDSGNYPLIFAGGQTATSNPEPYADFFDF
FT                   IALGDGEELLPEIGLILEEGKLANLSKEELLLDLAQIPGVYVPRFYDVTPIGAVIPNRD
FT                   DVPKRILRRVATPIPAYSIGLVPFVETVHDRLVVEIRRGCTRGCRFCQPGMLTRPARDV
FT                   QPEAVIESIEKGMRATGYNEFSLLSLSCSDYLALPAVGMEIKNRLQNENISLSLPSQRV
FT                   DRFDENIANIIGGNRQSGLTFAPEAGTQRMRDVINKGLTNEELLRGIKTAVEQGWDKVK
FT                   LYFMIGLPGETDVDVIGIAETVRWLRRECRLPKRKPLDFTLTISNFTPKPHTPFQWHSV
FT                   STAEFIRKQELLRQEFQGMRGVKVNYTDVRISAMEDFIGRGDRSLGKVVLRAWQLGAGM
FT                   DAWWDNTEKAYQAWSQAIEESGLTWKYRRIEQGEWHIFADADKDILERPLPWDHLDTGI
FT                   DKKWLQEDLKRALDAATVPDCSFEGCSHCGVCSLDFGHNIVIEAPAIPAFAGHFQPNQE
FT                   RAQRIRVWFGKIGEMALVSHLDLVRLFDRVVRRAAIPISFTGGFHPGPRISIANALSLG
FT                   ATSSGEIVDFELTKVIDLERFKQQLSAQLPADLPVYQVEEIPLNAPAATRLLEKAEYLL
FT                   TFNSEGIDCQQWQNWIEAIKQATVMEREKTTKSGKKVTINLREQLYELELKTVDKEAVL
FT                   CYVGSCRNDGTLLQPDHLVEMLERVSGQEISLLNCHRQCLILGT"
FT   CDS_pept        377476..377952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04150"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00237"
FT                   /db_xref="GOA:B0JN73"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN73"
FT                   /protein_id="BAG00237.1"
FT                   /translation="MPAKKYIVSLTEKERQELEELTQKGKSAARKINHARILLKADINQ
FT                   INGGWNDQMISQTLDISTRTIERVRQRFVEEGLEQSLNPRPKNLSKLRKIDGEAEAHLI
FT                   ALACSEAPTGYSRWTLRLLAEQMVVLEYVETISHESVRQVLKKTKLNLGYKNVG"
FT   CDS_pept        378254..378625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04160"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00238"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN74"
FT                   /protein_id="BAG00238.1"
FT                   /translation="MKYLVDERYPEAQKIRGVQDNLNTHVKASLYKAFPPREARRILDK
FT                   LEFYYTPKHGSWLNMAEIELSVLNRQCLNRRIPSQEILIQEVEAWEQQRNQTSSPVDWQ
FT                   FTTEDARIKLTQLYLSILT"
FT   CDS_pept        378793..379200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00239"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN75"
FT                   /protein_id="BAG00239.1"
FT                   /translation="MLHFNKSLYFSPQPAIEILGFLGSSRAWNCTIKLYKSPLKIMLSK
FT                   ETTYSQARMNLASILDQVCDESQIIVIKRRNQKNVALIAEDELSSLLECVYLLRSPENA
FT                   QRLFRSLAWTQTEDATPQTLAELKEELGIES"
FT   CDS_pept        379190..379510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04180"
FT                   /product="Txe/YoeB family addiction module toxin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00240"
FT                   /db_xref="GOA:B0JN76"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN76"
FT                   /protein_id="BAG00240.1"
FT                   /translation="MSPKRENKPDKPKNNPIHSYLPVFSPDFKADLAWWYRNEPKKGDK
FT                   ILDLVADILDADPFTGLGRPEPLKYIAADTWSRRIDLVGLRRFRSAKKAQTITGQRVNL
FT                   DL"
FT   mobile_element  complement(379434..379619)
FT                   /mobile_element_type="MITE:MaeMITEh002"
FT   CDS_pept        379971..380276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00241"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN77"
FT                   /protein_id="BAG00241.1"
FT                   /translation="MSENEGIKTIRWSQEKNRQLQQERGLTFEMVVTAIQQGNVLEDLV
FT                   HPNVTKYPNQRMMVVRIGSYAFLVPYIDSPSELFLKTIIPSRKATKKYLGLQKNND"
FT   CDS_pept        380269..380550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00242"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN78"
FT                   /protein_id="BAG00242.1"
FT                   /translation="MTKLNQEEQEILDSYEKDEWLSVTTPERITEIQSYGKATLNKDKK
FT                   VTLRLSSLDLDALQSKAIEEGIPYQTLISSILHKYITGELVESNFKKG"
FT   CDS_pept        380728..381012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00243"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN79"
FT                   /protein_id="BAG00243.1"
FT                   /translation="MLSKETTYSQARMNLASLLDQVCDESQIIVIKRRNQKNVALIAED
FT                   ELSSLLECVYLLRSPENAQRLFRSLAWAQTEDATPQTLAELKEELGIES"
FT   CDS_pept        381062..381235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04220"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00244"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN80"
FT                   /protein_id="BAG00244.1"
FT                   /translation="MPVFSPDFKADLAWWYRNEPKKGDKILDLVSLDAFKFPTRIPIYK
FT                   AFQDIKVQCKCV"
FT   CDS_pept        381250..381414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04230"
FT                   /product="Txe/YoeB family addiction module toxin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00245"
FT                   /db_xref="GOA:B0JN81"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN81"
FT                   /protein_id="BAG00245.1"
FT                   /translation="MDADPFTGLGRPEPLKYIAADTWSRRIDLEHRLVYKVTGNKVYFL
FT                   QARYHYQSG"
FT   CDS_pept        complement(381507..382007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00246"
FT                   /db_xref="GOA:B0JN82"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN82"
FT                   /protein_id="BAG00246.1"
FT                   /translation="MIVVSNTSPITSLAAIGYLNLLPDIYGTIIIPVAVYEEMTGLGYS
FT                   VPGTIEVQTLSWIEKRELKDRLLLKDLQKELHRGESETIALAISLNADRVIIDENPGRK
FT                   KAMSLGLNVMGILGILLIAKRRRLIAAIQPLMDDLILKAGFLVNQRLYLYLLRSAQEID
FT                   ENQ"
FT   mobile_element  complement(382533..382746)
FT                   /mobile_element_type="MITE:MaeMITEa013"
FT   CDS_pept        382997..383407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00247"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN83"
FT                   /protein_id="BAG00247.1"
FT                   /translation="MNPNRVVIDTNVFISALLNPLGTPKKVINIAVSQFTILQSEATYQ
FT                   ELATRISKKKFDKYLEKDDRLDFLSSLKNRSLFVDILHETRVCSDLDDNKFLELAVSGM
FT                   AQYIITGDKDLLILNTYQGIPIITPAEFLAIF"
FT   CDS_pept        383726..383971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00248"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN84"
FT                   /protein_id="BAG00248.1"
FT                   /translation="MSIDISDEILSATRMTEAEMRQEIAVMLFQKEKLTLAQASRFAGM
FT                   NRIAFQHLLASRQIPVHYDVEDFEQDIKNLREMGRL"
FT   CDS_pept        383968..384477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00249"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN85"
FT                   /protein_id="BAG00249.1"
FT                   /translation="MIVVSDTSPINNLAAINQLHLLQQLYEIVFIPEAVYRELTEPDFP
FT                   VAGSIEVQTLDWIQTRTVTNRTVIKALADELDKGEAEAIALALELGADQVLIDERRGRR
FT                   IAARLNLRYTGILGILVEAKNRGLISEVKPLLDALIDRAGFWVAAPLYSSVLQIVDEEK
FT                   NKPPQD"
FT   CDS_pept        384549..384887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00250"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN86"
FT                   /protein_id="BAG00250.1"
FT                   /translation="MKLPPLNETSMSLILPSELLQTVQMTEAQMLTEIAIMLYQQQRLQ
FT                   FEQAAELTGMAIDDFYQLLVSRNILTPPTDPDDEPKELILTSLRISLQQVKEGKVHPIS
FT                   ELWDGIDD"
FT   CDS_pept        384880..385233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00251"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN87"
FT                   /protein_id="BAG00251.1"
FT                   /translation="MTEGIPSIKILFSDEFKDRLRILAKRYRSIRTDIQPLIDDLQIGK
FT                   FIGDKIPGIGYTVFKVRLKNSDIQKGKSSGYRVIYQLKDNSYVLMLLIYAKSDQTDIPA
FT                   QQIQDIINKFDSF"
FT   CDS_pept        complement(385310..386029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00252"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN88"
FT                   /protein_id="BAG00252.1"
FT                   /translation="MLKNLAAVSTLVIPFLFFPTQAQAITINLATGLDASNTLITTGAQ
FT                   SDAHWTVDNPQGSSTTTPAQTVYPGNPNWFGGWLANGPNSTWIARDANTPANGLGTYTR
FT                   AFDLTGVDLSTVSITGSWAVDDTGILALNGQQIASLSAGAWGSLTPFSLAAGSSTAALL
FT                   NQGQNQLTIRIIDPTDNFLEGVRLQGTLTGSNAPTSVPEPTSTLSLLALGTLGAASTLK
FT                   RKLKSSQSTEKETTEIG"
FT   CDS_pept        386276..386560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00253"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN89"
FT                   /protein_id="BAG00253.1"
FT                   /translation="MLSKETTYSQARMNLASILDQVCDESQIIVIKRRNQKNVALIAED
FT                   ELSSLLECVYLLRSPENAQRLFRSLAWTQTEDATPQTLAELKEELGIES"
FT   CDS_pept        complement(386584..386748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00254"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN90"
FT                   /protein_id="BAG00254.1"
FT                   /translation="MIVVSNTSPITSLAAIGYLNLLHDIYGTIIIPVAVYEEMTGLGYS
FT                   VPGTIEDCF"
FT   CDS_pept        complement(386745..386990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00255"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN91"
FT                   /protein_id="BAG00255.1"
FT                   /translation="MTIVIPNEIIQATGKNEQLLRLELAIIMFRDYHISSAKAADFANL
FT                   SLIEFRQEIAKRNICVNYDSVDWQQELETLKTLGDL"
FT   CDS_pept        complement(387190..387429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00256"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN92"
FT                   /protein_id="BAG00256.1"
FT                   /translation="MKIESSPTNKFAVCLNNEGYEASLEVGKIYRVVPDETAEINGLIR
FT                   VIDESGEDYAFSVNRFHPIELPKPIEEALLSMAN"
FT   CDS_pept        complement(387432..387668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00257"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN93"
FT                   /protein_id="BAG00257.1"
FT                   /translation="MDFEIISDITNIEIIAIGTGIRNRERLQKQYGKGKWRKLKGIAQV
FT                   QLPNGIVRLAEVHWYEAHGIGKKEFKLKLPFLD"
FT   mobile_element  complement(388177..389217)
FT                   /mobile_element_type="insertion sequence:ISMae26_2"
FT   CDS_pept        complement(388195..388746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04360"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00258"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JGR0"
FT                   /protein_id="BAG00258.1"
FT                   /translation="MEYWSEVREIEASKLIFIDESGVNLALLRLYARALIGRRARGRKP
FT                   QKRGRNISIISAISLEKVVASVNIYGAVDAVTFEGFILKEVLPKIKEGDCLIMDNAKIH
FT                   LGEMVREIIEQEKARLIYLPPYSPEFSPIENFWSKVKATLRKLKARTYKDLIEGIELAM
FT                   LEVTQKDIRNWFTHCCYCTS"
FT   CDS_pept        complement(388701..389144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04370"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00259"
FT                   /db_xref="GOA:B0JJR2"
FT                   /db_xref="InterPro:IPR001523"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JJR2"
FT                   /protein_id="BAG00259.1"
FT                   /translation="MRPYSVDFRQKIIDVWKKEKISIRGLAQRFDVAKSFIQKLLKQHK
FT                   ETGDIRPRPQGGSPPTKLNSEQLIILIEIIEANNDATLEELSDLLYEKTQVKVSRATLG
FT                   RLTQKLNYSFKKKHYTRRKKKVTGYSKKEWNTGQKFGKLRHQN"
FT   CDS_pept        complement(389211..389645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04380"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00260"
FT                   /db_xref="GOA:B0JN96"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN96"
FT                   /protein_id="BAG00260.1"
FT                   /translation="MCIVLLSALCLGLGCCSIYCVFVTLTYKFEAYFMNRRNVFVGSLL
FT                   GTVSFALLAQPASALKLGPFPDFKGFVFESKKVTLETFLGVDLGKFGLCFKCGIKDSRD
FT                   FTIKIPVPVFASTYIDIKVTLGNVDPNSQVVLTDVWSLDL"
FT   CDS_pept        389794..390078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00261"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN97"
FT                   /protein_id="BAG00261.1"
FT                   /translation="MARSVGFAFAFISVSKLLKQILYFVIISVIRSVLGGKNIPTLAQL
FT                   LQCYTLSCWATRFYLPINLIRLDERTKNIFMLIGEGIEIEIKPNGQWIK"
FT   CDS_pept        390102..390311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04400"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00262"
FT                   /db_xref="UniProtKB/TrEMBL:B0JN98"
FT                   /protein_id="BAG00262.1"
FT                   /translation="MTSQELKSYVLSHREDDEAFYAYVDKVNERKDRVVYPPLNSLEEL
FT                   EKYPEVIEQMRQDSRHNFQQNELT"
FT   CDS_pept        complement(390478..391842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="MAE_04410"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00263"
FT                   /db_xref="GOA:B0JN99"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JN99"
FT                   /protein_id="BAG00263.1"
FT                   /translation="MTTRIKEIFQTGQPDQSVTVQGWVRTKRELKEFTFLEVNDGSSLA
FT                   NLQVILEPTLPDYENVLKTISTGAAIAVSGNLVPSPGKGQNIELKAAEITLYGDCPPDY
FT                   PLQKKRHSFEFLRTIAHLRARTNTLGAVMRVRNACATAIHSFFQEKGFIWVHTPIITAN
FT                   DCEGAGELFTVTSLDLKKPANFAEDFFGKRAYLTVSGQLQAEVMAMALSNVYTFGPTFR
FT                   AENSNTSRHLAEFWMVEPEMAFCDLEGDQDLAEAFLKYIFKFVLENCPEDLQFFNERID
FT                   KTVLSTAENIVNSEFGRITYSEAIELLEKADRQFEFPVEWGVDLQSEHERYLAEELFKK
FT                   PVIVTNYPKTIKAFYMRLDDNNKTVSAMDILAPKIGEIIGGSQREERLDVLIQRMQEQG
FT                   MNPDDLWWYLDLRRYGSVPHAGFGLGFERLVQFMTGMTNIRDVIPFPRTPLSADF"
FT   CDS_pept        391985..393220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04420"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00264"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA0"
FT                   /protein_id="BAG00264.1"
FT                   /translation="MYKAYKFRLKPNTEQEIALAKSFGCCRWFWNYSLNLCQETYKTTG
FT                   KGLTRNYIQGLLPSLKKEYEWLTDAYSQCLQVVALNLSQAYQNFFEKRARLPRFKSKHG
FT                   KQSISYPANVKFEGDYLKLPGKVGLVYCVRHREFAGTIKTVTISKNPDGKYYASILVDD
FT                   GQSPLPPLIRGVPKAGGSTLDKGDDEGGGIDGKAIGIDLGLNHFAITSNGSKYDNPRHL
FT                   AKHQRNLKRKQQKLSRKKKGSNNRQKARCKVAKVHSKISRCREDFLHKLSRKIVNENQV
FT                   IAVENLNVKGMVRNHNLAKAISDCSWGMFCTMLKYKAEWEGKTYIEVDRFFPSSKTCHV
FT                   CLNQVGSLSLDVRIWTCVHCKTIHDRDINAAINIRDESLRILSLGTSDTAYRGDIRPKA
FT                   GRKSVLRQSPVK"
FT   CDS_pept        393297..393692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00265"
FT                   /db_xref="GOA:B0JNA1"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA1"
FT                   /protein_id="BAG00265.1"
FT                   /translation="MLLVEKLLSKPKSRKLAIFLAFIGSILALPFPIAGIHKFYLGQPL
FT                   WGIIYLLLWQTPIPRVACAIDAVWYLIQDNQFFANYFPTATAAATVPSLEPKQVEAIGA
FT                   ALRELERLRQEGLISEYEFEEKRRQLL"
FT   CDS_pept        393692..394222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00266"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA2"
FT                   /protein_id="BAG00266.1"
FT                   /translation="MTPQNWLGRTFNPLKAKISNDPYYRFRSLDEIAMAAQLGIKINVS
FT                   QAGVDDWLRLPGISIHQARMLVELSGMGVELLCLEDLAAALSVPVARLKAWEPILEFAY
FT                   YSRESHLAPPKINPNTASIEQLTTLPLISDNLAAAIIKNREEQGLFKNIVDFKGRLSLD
FT                   AQEISQLMHFFQF"
FT   CDS_pept        complement(394553..397105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MAE_04450"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00267"
FT                   /db_xref="GOA:B0JNA3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA3"
FT                   /protein_id="BAG00267.1"
FT                   /translation="MTAAQDHVVPTDLSNEMSRSYLEYAMSVIVGRALPDARDGLKPVH
FT                   RRILYAMYELGLTPDRPFRKCARVVGEVLGKYHPHGDTAVYDALVRMAQDFSMRDPLIN
FT                   GHGNFGSIDNDPPAAMRYTECRLHTLATNALLQDIESETVDFADNFDGSQQEPVVLPSR
FT                   VPQLLINGSSGIAVGMATNIPPHNLAEIIDGTVALIHNPDLTDTELQRYIPGPDFPTGG
FT                   HILGRDGIQEAYTTGRGSITLRGVATIETIEQRGRPDRDAIIITELPYQTNKAALIEKI
FT                   ADLVNDRKIDGISDVRDESDRDGIRVVIELKRDAYPRVVLNNLYKQTPLQSNFGANMLA
FT                   LVDNEPRLLTLREFLRVFLDFRVEVITRRTRYELRKAEERDHILQGLLIALASLDAVIA
FT                   LIRSAADTASAKEGLVQNFGLSEVQADAILQMQLRRLTALESEKIQQEHGELLAKIGDL
FT                   QDILAKKERIDSIIEEELQQIKTIHATPRRTHIEQREGEIAETDLIANEQALILVTEQG
FT                   YIKRMPVNTFESQNRATRGKAGAKMKEDDGIDHFITCRDHDSVLFFTDRGVVYSLNAYH
FT                   IPTGSRTARGVPIVQLLEIPKGEKITSVVAVSEFSEDNYLIMLTQKGFIKKTALAAFSN
FT                   IRSNGLIAISLEDGDQLRWVRLAKEEDSVIIGSRQGMAIHFKADSQQLRSLGRATKGVK
FT                   SMKLRSGDELISMDILPSQIVAQIAESNEEETEDESEEINPEVANNGPWVLAITMAGLG
FT                   KRVPVTLLRLQNRAGLGVRVIKFRKKNDKLAALHVVNPHEEFMIITERGIIIRQSVDAI
FT                   TPQSRSAGGIRVQKLDEDDAIAAVALVPPSDAEESEDI"
FT   CDS_pept        397186..397341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04460"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00268"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA4"
FT                   /protein_id="BAG00268.1"
FT                   /translation="MCRICPFVRLFYHKIPLFWGLRRHSNFCRKSLPSFQPDLDTLWTI
FT                   CHNIVM"
FT   CDS_pept        397361..398524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04470"
FT                   /product="cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00269"
FT                   /db_xref="GOA:B0JNA5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA5"
FT                   /protein_id="BAG00269.1"
FT                   /translation="MDLQLSLFPDNQPSQAVSKQKKAKLGRYERIQRELATVKRDPYQV
FT                   LVDVNVPLQPLNSYNFIDLFSGAGGITQGLLQAGFNPVASAEISPIASATHQKNFPNCH
FT                   HFCGDIHDFNTQEWLAKIGNPFIHLVVGGPPCQGFSVAGKRDANDPRNHLFQEFIRLVS
FT                   EIQPWYVVMENVPGILTIKKGEIKQNILEAFQSIGYGNISIAILESAAYGVPQIRPRAI
FT                   FIANRFGLPNPYPSPQLVPEKYQPIEAAICDLPAYEPLPSINHEWTRHSPEYMARIAQV
FT                   PPGGSLYESYVDAFKRQYRGKPSMTIKENHGGTHIHPYLNRVISAREMARLQTFPDSFI
FT                   FEGTMKKAMWQIGNAVPPRLAECIGYALIPYLNLIATGNKNIGEVAR"
FT   CDS_pept        complement(398526..399251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04480"
FT                   /product="putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00270"
FT                   /db_xref="GOA:B0JNA6"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA6"
FT                   /protein_id="BAG00270.1"
FT                   /translation="MSSDLVEAIKAKFKQGSSQYKVFELLSDRAWHCRTCEGKKIASEQ
FT                   YAGGGGIQGLERGNRSGRQGLVIETKREYCPICQKTTTWDRWTGEMRAANASANIPPQL
FT                   VARILEFYRYKDVIENRIRQSHELVIDHRFPMERWGISEPSHDVNMSVAEMRNKFQLLK
FT                   KDSAGNHNLLKSRSCEKCIKTGKRGTPMDIRFWYSSGENWPENIPQSGAEAEQGCVGCG
FT                   WYDLETWRNSLNIKLTEER"
FT   CDS_pept        complement(399248..399496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04490"
FT                   /product="hypothetical protein"
FT                   /note="similar to transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00271"
FT                   /db_xref="GOA:B0JNA7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA7"
FT                   /protein_id="BAG00271.1"
FT                   /translation="MEKSKAVILRALGLMIREHRAALGISQEELGLRCHLDRTYISGLE
FT                   RGVRNPSLTALVTLAKGLNITVSQLLENLEIEIEKPE"
FT   CDS_pept        399810..400334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00272"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNA8"
FT                   /protein_id="BAG00272.1"
FT                   /translation="MLTPLLWQSANPHPDNLENFQIISQWWQDLNLKEVFWQQRLIPDT
FT                   GSLEDINWERQGFDEKFSIQMPQIRGITLYWHKSTFADERSMTPKQLILDREREQLDIY
FT                   PQSQASLVIRVTKPRLVYQKFELKNPLMVGKKAESEYILLIRDKEQQIEVKINLSPENY
FT                   RQFLETMTEDQ"
FT   CDS_pept        400334..401146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="MAE_04510"
FT                   /product="urease accessory protein D"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00273"
FT                   /db_xref="GOA:B0JNA9"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JNA9"
FT                   /protein_id="BAG00273.1"
FT                   /translation="MWQGNLELIYKQKNLATEINHVYATAPLKVQRPFYPEGKNLCHTV
FT                   ILHTAGGIVGGDVLQQKIHLQAATNALITTASAGKVYQSNGQMAQQLIEIKIDDNASLE
FT                   WLPQETIIFNGAAFRQHLRVDLGENSSWLGWEITRFGRSARGEKFLAGEWHSNWEIWRS
FT                   GQPLWLDRSCLLGGKMIEGFSGLNDSALIGTLVYIGQPVGRNLIEKVRDFSLEGERGVT
FT                   NTLGDGLLCRYRGNSSGEVRQWFQQVWQILRREMSDQEAIIPRVWLSW"
FT   mobile_element  complement(401162..401334)
FT                   /mobile_element_type="MITE:MaeMITEg002"
FT   CDS_pept        complement(401351..402292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04520"
FT                   /product="isopentenyl monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00274"
FT                   /db_xref="GOA:B0JNB0"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JNB0"
FT                   /protein_id="BAG00274.1"
FT                   /translation="MHSYTLLAPAKINLYLEIVGDRPDGFHELVMVMQTVALCDRITLR
FT                   PNGLQEFRLFCHHPLVPQDSSNLAHRAATLMAKEFPRLFANYGGIDITIEKYIPVAAGL
FT                   AGGSTNAAAVLVGIDLIWELGLTRPELETLAARLGSDTSFCVTGGTVICTGRGEILDPI
FT                   APLTGLWVILAKYDHLSVSTPWAYQSYRQKFQDTYLSSPEDFHHRRQQVSSGALVQAIA
FT                   QKKPAAIGKFIHNDLEKVVLPEFPLVAELRQVLGDLGGLGTMMSGSGPTVFTLCSSQEV
FT                   AETIVKEAREILVAPDLQFWIAPITDTGIQVT"
FT   CDS_pept        complement(402310..403116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04530"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00275"
FT                   /db_xref="GOA:B0JNB1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB1"
FT                   /protein_id="BAG00275.1"
FT                   /translation="MKIQPRKRFGQHWLKDESILDRIIGAANLQSEDRVLEIGPGTGIL
FT                   TRRLLDGAQLVVAVEIDRDLWTILNKKFGQQDNFHLIPGDFLSLKPEQLPPVNKVVANI
FT                   PYNITGPILEKLLGSIAHPFTPPYQSITLLVQKEVAERLVAVPSTKAYSALSVRIQYLA
FT                   DCQWICDVPWRAFSPPPRVDSAVIQLLPRVLPNNVSNAAFLSTLISWGFANRRKMLRNN
FT                   LKNCLDSDRLSQILTQLEINPLARAEDLSLSQWIDLAEKLGQLPKF"
FT   CDS_pept        403241..403630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04540"
FT                   /product="camphor resistance protein CrcB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00276"
FT                   /db_xref="GOA:B0JNB2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB2"
FT                   /protein_id="BAG00276.1"
FT                   /translation="MSDLNDVFAIVAGAVPGALSRYHITEWTKAKFGLRFPYGTFIINL
FT                   TGCLAIGFFWAILPSFTFYSHQLDLMVRTGFLGAYTTFSTYSLDILILWRNQQNFLSLF
FT                   FAFASIIFGLIAVRIGAAIAQVFLG"
FT   CDS_pept        403776..404180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04550"
FT                   /product="camphor resistance protein CrcB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00277"
FT                   /db_xref="GOA:B0JNB3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB3"
FT                   /protein_id="BAG00277.1"
FT                   /translation="MNFFRGRYSLSVAIGAIFGALSRFYIAKLVESIFGQEWQFLGTFF
FT                   VNISGCLIIAYIFTIVRENIRIIAPELGLMIATGFCGSYTTFSTYSLEVNKFLEQGNMT
FT                   FGLIYWLGSVLGGMMALKIGVILARTGFPR"
FT   CDS_pept        404476..404628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04560"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00278"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB4"
FT                   /protein_id="BAG00278.1"
FT                   /translation="MDCFDIFRPSRGIEGDFPEIIAPIKPVPPVTKAPIIQTFPCFRFL
FT                   SVTEI"
FT   CDS_pept        404749..405105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04570"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00279"
FT                   /db_xref="GOA:B0JNB5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB5"
FT                   /protein_id="BAG00279.1"
FT                   /translation="MNPSPESTFVCPIIIEDDRTGLDTETIRRALRDNLLYIQGKLPEL
FT                   ASKNDLYMALAYTIRDRLLQRWLTTQQTYLKKDVRTVCYLSAEFLVGPHLANNLGSSVI
FT                   VMQWTGVIRDGTLI"
FT   mobile_element  405046..405229
FT                   /mobile_element_type="MITE:MaeMITEb004"
FT   mobile_element  complement(406349..407714)
FT                   /mobile_element_type="insertion sequence:ISMae34_2"
FT   CDS_pept        complement(406368..407636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04580"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00280"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JKH4"
FT                   /protein_id="BAG00280.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQIANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIVMNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        407874..408845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04590"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00281"
FT                   /db_xref="GOA:B0JNB7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB7"
FT                   /protein_id="BAG00281.1"
FT                   /translation="MDDGVFRDYWRRIKYDIKADLANYIDKKVGIKVDPSTLFDVQVKR
FT                   IHEYKRQHLNVLHIVTLYHRLKNNPNLDITPRTFIFGGKAAPGYFMAKLIIKLINSVAE
FT                   VIDNDPTIGGRLKVVFLPDYNVTFGQRVYPAADLSEQISTAGKEASGTGNMKFSMNGAL
FT                   TIGTLDGANIEIREEVGAENFFLFGLTTEEVYAKKAAGYNPQEYYYHNEELRAVLDLIG
FT                   SGFFSRGDSSLFRPLVDNLIYNDPYMLLADYQSYIDCQEGVGHAYKDQEHWSRLAILNV
FT                   ARMGKFSSDRSIREYCEKIWRVQPVKIELPDYTQANAGLSVN"
FT   tRNA            complement(408931..409004)
FT                   /locus_tag="MAE_t001"
FT                   /product="tRNA-Asp"
FT                   /note="codon recognized: GAC"
FT   CDS_pept        409226..409441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00282"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB8"
FT                   /protein_id="BAG00282.1"
FT                   /translation="MTNPNSIEQLSQELLDLDQVDADTGADLRQKAQEILAETTIDLPI
FT                   REAIADSLSQGNQLLTLKTVGREESY"
FT   CDS_pept        409465..409977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00283"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNB9"
FT                   /protein_id="BAG00283.1"
FT                   /translation="MKEKNFFVWLGRFLASFGLLSGISGCNSPLLITPQVPAGGLNSFA
FT                   PDQFPSYSADGRYLAFASDRSGRRSIYLFDLQEKRLVNLPNLNRGDSSQDQPSLNADGR
FT                   LIAYISSERGKSDVMVYDRSQSRATLLTANLRGSVRNPTISGDGRQIAFETNQDGQWNI
FT                   AIVNGQF"
FT   CDS_pept        complement(409985..411313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00284"
FT                   /db_xref="InterPro:IPR021801"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC0"
FT                   /protein_id="BAG00284.1"
FT                   /translation="MLPFLLPIAQTPPIVEIIRPVQVRPLPNQLDQVPVFNSNSPELLL
FT                   GEGILLSTFPPQEKSFPSAHLNYAFQGRFDIFAHHVARGSFPDNLRSLYLGILLHNPSS
FT                   NPVTVKILQGASYLSQPDAAFIDLPAQVENNQGTVFAGPGSRVMGDILMGQRQDIFPDR
FT                   IIIPAGESFMVLNAAIPVRDLTPPLNGRSTYLRLESDGLLYAASLALYAPLDENGQERP
FT                   PNLTEWQNLLEKGDLSTPRDRAPTPPHSQGQIIYGRVAGVSQGSAWPARLVDRASLWLN
FT                   IPDSGQSIAYGISTLPGGKLGTEQNQSASMLVRYPDTAYQAHGNYGVEYRLSLPLFNRS
FT                   NEAKTVTIALETPIKEDIIGQGLRFLDPAAPQVFFRGTVAVNYSDDQGQAQSRFFHLVQ
FT                   RRGQEGQPLVTLTIPPGDWHIVQVNFLYPPDATPPQVLTIKTE"
FT   CDS_pept        complement(411370..411522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04630"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00285"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC1"
FT                   /protein_id="BAG00285.1"
FT                   /translation="MIHESTLPYQGGQGGSNLKSIFNLIITSYLTPARNINQSSRYRQT
FT                   EYYLN"
FT   CDS_pept        411747..412736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="MAE_04640"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00286"
FT                   /db_xref="GOA:B0JNC2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JNC2"
FT                   /protein_id="BAG00286.1"
FT                   /translation="MNQIDYLRISLIDRCNFRCQYCLPEDAELAYVRPQDLLTREEILT
FT                   LVKNVFIPLGFRKFRLTGGEPLLHPEVVEIVRDIASLSATSDLALTTNGYLLDNLAEML
FT                   YEAGLRRINISLDSLDPDTFDKIIGNRGRSRWQKTWAGIQAAQRVGFDPLKLNVVVIPG
FT                   INEAEVEDLAALTIEKRWHVRFIEFMPIGNGDLFQEKAWIANEELRGRIRAKWGLNEGQ
FT                   VRGNGPADVFQIPGAKGTIGFISQMSECFCDRCNRLRLSADGWLRPCLLNETGQIDLKT
FT                   ALRQGISPAEIRERVRELIELKAEINFKLRDSGTSSGIYTRTMSQIGG"
FT   CDS_pept        complement(412741..412926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00287"
FT                   /db_xref="GOA:B0JNC3"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC3"
FT                   /protein_id="BAG00287.1"
FT                   /translation="MEALDFSDQLQWTAEAKAKLKNIPYFVRSQARQRIEELARHAGSD
FT                   RVTVEMVEQARIEFGQ"
FT   CDS_pept        complement(413067..413654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00288"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC4"
FT                   /protein_id="BAG00288.1"
FT                   /translation="MLSATETKYYTPEEYLALEETSEDKNEYRQGEIIPMVGATTNHNQ
FT                   IAGNFYRRFPLTINNQDYYTYMETVRLWLSDYSIYTYPDVMVIKGQPLYQGNSQSNVIN
FT                   PLIIVEVLSNSTQAYDRGDKFKFYRSLPTFQEYILIEQSSYSVELYYKQKDDQWLIDFV
FT                   TGENAVLQLVSVDWQISFQDLYQRVNFDLAET"
FT   CDS_pept        complement(413989..414576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00289"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC5"
FT                   /protein_id="BAG00289.1"
FT                   /translation="MLSATETKYYTPEEYLALEETSEDKNEYRQGEIIPMVGATTNHNQ
FT                   ICLNFCRNFPLNINNQDYYTYMETVRLWLSDYSIYTYPDVMVIQGQPLYQGNSQSNVIN
FT                   PLIIVEILSNSTQAYDRGDKFKFYRSLPTFQEYILIEQSSYSVERYYKQKDDQWLIDFV
FT                   TGENAVLQLVSVDWQISFQDLYQRVNFDLAET"
FT   CDS_pept        414802..416157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="MAE_04680"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00290"
FT                   /db_xref="GOA:B0JNC6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC6"
FT                   /protein_id="BAG00290.1"
FT                   /translation="MFNWFRRQKVQPEQEQTPPAPVEDTPSEATPTTSEATSQEEYLDW
FT                   AKKAFKNIQEKKATAEAVVSETPETSIAETEPPQEQEPVKEEETEDNTPAWLKKSDRLE
FT                   ILKETAIETPTEPDEDFIWSAKVLANQGRQAEDVSEEEITWLKKLRQGLGKTRRSLVNQ
FT                   LKAVVGQGPLNQDAVEEIEALLLQADVGVDATDYIITTLQNKLKQEALPPEKAIEYLKE
FT                   IIREILDAPLANYSNPGFEPEKGKLNIWMLTGVNGVGKTTTIGKLAHLSKQSGYSCMIA
FT                   AADTFRAAAVEQVKVWGERSQVEVIANPGKNTDPAAVVYDGIEAAKSREIELLLVDTAG
FT                   RLQNKKNLMAELSKIRRIIDKKAESAVVESLLVLDATLGQNGLRQAEVFSEAAQLSGVI
FT                   LTKIDGTAKGGVALAVARQLNLPIRFVGAGEGIEDLRPFSSYEFVEALLSGD"
FT   CDS_pept        416252..417052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04690"
FT                   /product="manganese transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00291"
FT                   /db_xref="GOA:B0JNC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC7"
FT                   /protein_id="BAG00291.1"
FT                   /translation="MQTTITVSHLGVYYRGVEALRDITLKIHPGRLTGIIGPNGAGKST
FT                   LIKAMLGLIPVQQGTVNYQGQSLQQQLDKVAYVPQRSQIDWTYPVTAWDVVMMGRVRKT
FT                   GWFRPFSHISRQQALNALERVEMADLRHRPLGQLSGGQQQRVFLARSLAQEAEIFCFDE
FT                   PFVGVDQKTEGVLFNIFGELAQENKIVMVVNHDLGESISHFADLILLNKELILADQRSK
FT                   VLTDFNLRRAYGGKVSFYDAMTPPDHRRSSLDYLDRFSKNNAIN"
FT   CDS_pept        417092..417508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00292"
FT                   /db_xref="GOA:B0JNC8"
FT                   /db_xref="InterPro:IPR021467"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC8"
FT                   /protein_id="BAG00292.1"
FT                   /translation="MTTISPQEVTGTIELAPNYRIPLFLVILSLPLLFLQVWLGIIFSL
FT                   LGLFLMFQTTRIRLQFTPTSLDVYLSGQQIRSFPYQEWQNWRIFSNKVPILFYFKEINS
FT                   IHFLPIIFDSATLRLCLEKYYPLAASQAIDSEAN"
FT   CDS_pept        417707..418987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00293"
FT                   /db_xref="InterPro:IPR021437"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNC9"
FT                   /protein_id="BAG00293.1"
FT                   /translation="MNSEDFNVLPLDKMTDLPNESVEEFSFDDLWNDRPVENPLPSAIA
FT                   PEGELVPAAQAQPLRAEIEALERQKQSLAAEISALKAEKERLIAEELGDIKAQIERMLK
FT                   EGVKDLEQRKQALELAIEQLERRRERIRQEMRSNFAGVSQDIAVRVQGFKDYLVGSLQD
FT                   LAAAAEQLELPRFETPEKSPRSVEPPLRTEREENPRPSRGSQGRDDREESPRPSRTSNQ
FT                   GRDNWQEPRRSNRSGYESEPVGQSTPRQGFSDQNQRIQALLDRYRSRPDYYGPPWQLRR
FT                   TFEPIHAERVQQWFFKQGGRGTVRGMGSRLQNILVASAIISIMAELQGDRFRSLVLANS
FT                   PERLGEWRRGLQDCLGISRADFGPDRGIVLFESPEALIQKAERLIEDKYSPLIIIDDTE
FT                   ERLNFALLQFPYWLAFAPEPQQSSSYW"
FT   CDS_pept        419478..419681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04720"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00294"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAG00294.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   CDS_pept        419944..420105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04730"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00295"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAG00295.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   mobile_element  complement(420620..420801)
FT                   /mobile_element_type="MITE:MaeMITEb005"
FT   mobile_element  complement(420862..421044)
FT                   /mobile_element_type="MITE:MaeMITEc002"
FT   CDS_pept        421251..421613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00296"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JND2"
FT                   /protein_id="BAG00296.1"
FT                   /translation="MTELKNHSCFVDSNIWLYAFSTDKREESKRILAKQLIKEKSIIIS
FT                   TQIINEVSCNLLKKHKLDEKQLFKLIVSFYSKYQVISFNLDIFESAYNLRTQYHLSFWD
FT                   SLVIACASFSDANIGT"
FT   CDS_pept        complement(421618..421785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04750"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00297"
FT                   /db_xref="UniProtKB/TrEMBL:B0JND3"
FT                   /protein_id="BAG00297.1"
FT                   /translation="MSEAVFLRFVFEAIVKPPTPSVKAGRHRSWGCLFHRRSFNVKCLF
FT                   YNNYTLLYSC"
FT   CDS_pept        422089..422292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04760"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00298"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAG00298.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   CDS_pept        422466..422627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00299"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAG00299.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   CDS_pept        422976..423179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04780"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00300"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAG00300.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   mobile_element  complement(423267..425342)
FT                   /mobile_element_type="insertion sequence:ISMae31_6"
FT   CDS_pept        complement(423515..425173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04790"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00301"
FT                   /db_xref="GOA:B0JND7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JND7"
FT                   /protein_id="BAG00301.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYNKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAELELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   mobile_element  complement(427228..427378)
FT                   /mobile_element_type="MITE:MaeMITEa014"
FT   mobile_element  427383..428099
FT                   /mobile_element_type="insertion sequence:ISMae34_3"
FT   CDS_pept        427533..428129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04800"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00302"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ1"
FT                   /protein_id="BAG00302.1"
FT                   /translation="MNQCRQTQIPRGFSLIVDDSGHRKSGNLTAGVGRQYLGEIGKTDN
FT                   GIVAVTTHLYDGKKSVPLDREIYQPASSLAEGKEDKEFKKKPEIAIDLIDRSLTRGYRP
FT                   KIVLIDAGYGNNTNFLKALEERKLKYLGGLAKNRKVIIEKEGGVEETIQLEQLAKSLSE
FT                   KDWEKITLNLDKEKTVWVAVFRAKISGSSLLGMVR"
FT   mobile_element  complement(428102..428284)
FT                   /mobile_element_type="MITE:MaeMITEb006"
FT   CDS_pept        428328..428603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04810"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00303"
FT                   /db_xref="GOA:B0JNZ2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ2"
FT                   /protein_id="BAG00303.1"
FT                   /translation="MNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYR
FT                   EAKGWLGLREYQVRDKRSLLRHFILVFCAYWDLNKFQAQTKPKLAL"
FT   mobile_element  complement(428551..429915)
FT                   /mobile_element_type="insertion sequence:ISMae34_4"
FT   CDS_pept        complement(428570..429838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04820"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00304"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ3"
FT                   /protein_id="BAG00304.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQMANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIVMNASSMEKATEVDYFITNVVEADTVTASWIVKTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   mobile_element  430314..431374
FT                   /mobile_element_type="insertion sequence:ISMae8_1"
FT   CDS_pept        430411..431406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04830"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00305"
FT                   /db_xref="GOA:B0JNZ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ4"
FT                   /protein_id="BAG00305.1"
FT                   /translation="MSHQHLNIEQRNLLYQLSQEGNLSQRQMAVWLGCHQSTISRELKR
FT                   NQSSLGCYLPDTAQAQSETRRKNAKQPFKNVSESALELVKEGLKDYHSPEQIAGRLKRA
FT                   SQESLSHETIYQMIYQNYHGCGEYQKYLRRGLCQRKSRGGAKSKRGGIPGRVDISERPV
FT                   IADQKTEIGHWESDTMIGGNHLGVLVTHVDKASKFLGAGLAKNKTASEINRVTEKLFQE
FT                   IHPDKRKTFTCDNGKEFCGHQELSQKLGADFYFATPYHSWERGLNEHTKGLLRQFFPKG
FT                   TNFKIVKPEEVERAVNLINNRPRKCLDYRTPNEVFYKGRSEDLLHNFFMV"
FT   mobile_element  431375..432593
FT                   /mobile_element_type="insertion sequence:ISMae4_1"
FT   CDS_pept        431565..432356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04840"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00306"
FT                   /db_xref="GOA:B0JNZ5"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ5"
FT                   /protein_id="BAG00306.1"
FT                   /translation="MYKQTYRKMVESVKSVEADSNSPSKRGPKPKLSIEEQVLVTLEYW
FT                   REYRTYFHIGTSWELSESTICRIVNKTEKMLLQSGNFRLKGKKALLNQAEIPVVTVMDV
FT                   TETPIERPKKKQKDFLGGKRGYHTLKSQLVADQNTEEIICVFCGKGRGHDFSLFKKSRV
FT                   RFHPLTTSIEDSGYQGIAAYHSNSYTPKKKSKNRKLTELEKEYNKALAKERIIIEPINR
FT                   KLKIFKILSCKYRNRRRRYSLRVNLLAAIYNGELGIGIAAS"
FT   CDS_pept        433373..434521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04850"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00307"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ6"
FT                   /protein_id="BAG00307.1"
FT                   /translation="MKSSKGKDNASSLFGIKKIPGDNQIRNLLDPIPAATIFGSFQQVY
FT                   QWLKKPGVIKKFFYLDEEILIALDGTEYFSSKKISCPHCNCRNPRNGTTTYFHGCVTPI
FT                   VVSPEQKQVINLEPEFIKKQDGQQKQDCENAAVKRWLDKNHQKKYGYPVTLLGDDLYSR
FT                   QPICELALKQGYNFIFVCLETSHKTLYEWREFLEKSGEVKTVEKKQWDGRKNLIYRYRY
FT                   VSRVPLREVESSLEVNWCEVTVINEKTQKIIYQNNWITNHQITENNVEKIVKAGRSRWK
FT                   VENEGNNVLKNHGYNLEHNFGHGQSHLCEFLLSLNLLAFLFHTVLDLVNHTYQKIRELL
FT                   VTRTSFFNDIRTLLKYFWFKNWSEFFLFILTEYVPLKKINSS"
FT   CDS_pept        complement(434692..434907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04860"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00308"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ7"
FT                   /protein_id="BAG00308.1"
FT                   /translation="MLRVKLKVPLGSANVPSAKPIWEGSKVTVRLELSRVPTTLKRSRL
FT                   KRFNSAILILKTKEDKVLYVNKRTSV"
FT   CDS_pept        complement(435199..435573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04870"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00309"
FT                   /db_xref="GOA:B0JNZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ8"
FT                   /protein_id="BAG00309.1"
FT                   /translation="MTKPLAKLKFSCAALGVYAKAIRRVCPGFSSMSPLAKLASVVTFC
FT                   ALIVIPAIASTSLVPTAVLVISMYWVLSAKLGRTNRLSVAPCRYWESFVPKVTAVLSTT
FT                   IVPSLTLVILTLNVFSAEVL"
FT   CDS_pept        complement(435914..436132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00310"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ9"
FT                   /protein_id="BAG00310.1"
FT                   /translation="MAQIKYPMVIQWSDEDNCFLVALPDFPWQYWRTHGDTYEEAVANG
FT                   KEAIESLMIAYQADNDSLPEPLFCRMV"
FT   mobile_element  436235..436419
FT                   /mobile_element_type="MITE:MaeMITEh003"
FT   CDS_pept        436515..437135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00311"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP00"
FT                   /protein_id="BAG00311.1"
FT                   /translation="MSSLTTQFNLKTDNSGLVGTIINSPLRVGDRFFVEILMENSDINP
FT                   VGITSSAINLSFDPRSIQNIDNPFNPSDINSPLVTSSFPFGRTGILDNTNGSITNLVGG
FT                   SLPFLGIGSPLGINQLDTFSLLYFQVIGNGNSGLVLNIDLSQTGFSDGSVASYSGNQSQ
FT                   FIKIVQVGSSTAIPEPSTILAIVILGLGVLLSKKRNQDSSNDG"
FT   mobile_element  complement(437141..437323)
FT                   /mobile_element_type="MITE:MaeMITEb007"
FT   CDS_pept        complement(437381..437710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00312"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP01"
FT                   /protein_id="BAG00312.1"
FT                   /translation="MSEKICRQIKNSNNEVFLSVVSVWECVIKYQLGKLNFPERPDLYL
FT                   PKKRKQHLINSLVIDEKSLVHLKDLPLLHKDPFDRLLICQALQHNLVVATEDNAILAYP
FT                   NLQFF"
FT   mobile_element  complement(437730..437937)
FT                   /mobile_element_type="MITE:MaeMITEa015"
FT   CDS_pept        complement(437821..437982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04910"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00313"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP02"
FT                   /protein_id="BAG00313.1"
FT                   /translation="MLLDTHIFLWLISVCSINLKTLLGKTFRLFSHQKVPDIGVIGGGK
FT                   FRHFFPEN"
FT   CDS_pept        complement(437985..438341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00314"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP03"
FT                   /protein_id="BAG00314.1"
FT                   /translation="MNDVELRQLLTEKLAILSADNLNLVGQFIDKLTHQEAANKSDNYL
FT                   TEKALQKWQFLVKNNQEMDNTNPLSENEIKIIWQFLSQSHRSRPVGLARGEFTISDDFN
FT                   EPLPEEVLDLFYPQ"
FT   CDS_pept        complement(438410..438904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04930"
FT                   /product="SixA type phosphohistidine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00315"
FT                   /db_xref="GOA:B0JP04"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP04"
FT                   /protein_id="BAG00315.1"
FT                   /translation="MKLYFVRHGLAGQSGDYLNDGERPLTEEGKAKTAKIAQRLGQLGV
FT                   KFDLILTSPLVRAVQTAEILQKAGLSRKIEQFNPLSPNGNIQDWVQWWQKSDYQREENA
FT                   IAMVGHEPDLGYWTEMLVWGKFQGKLSVKKAGIIGLEVPNQENPLGKCELFWLTAPKLL
FT                   L"
FT   CDS_pept        complement(438957..440177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00316"
FT                   /db_xref="GOA:B0JP05"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP05"
FT                   /protein_id="BAG00316.1"
FT                   /translation="MAELLSLVPAKSLETDVVVGEASAVCPLPPVTVSNDTLLISLIDR
FT                   LRRTLENHRGENQIVVMQDFPDPDALSSAWAYQIIAEQYDIHCDIVYAGTLSHQENVAL
FT                   VKLTGLPAKRWGVHTLKDRDLSVYHGCVFVDGQGTNSQLTTLVKQAKIPIIVVIDHHTR
FT                   QGDLDAEFVDIRPQIRATATMLTQYIQKGLISFNSSDTIHVKCATALMHGLRSDTNNLM
FT                   QAQECEFIAAGYLSRFYDAQLLNAVLQSARSRRVMDVIERALKNRIIKNNYSIAGVGYL
FT                   RYDDRDAIPQAADFLVTEENVHTALVYGIVHDEDEDIELVIGSMRTSKITLDPDEFLKE
FT                   AFGQDNQGRFFGGGRYMAGGFEIPIGFLGGFNNNAEYAKLKWELYDTQIKQKLSHLVNP
FT                   DEKVIRT"
FT   mobile_element  complement(440397..442472)
FT                   /mobile_element_type="insertion sequence:ISMae31_7"
FT   CDS_pept        complement(440645..442303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04950"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00317"
FT                   /db_xref="GOA:B0JP06"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP06"
FT                   /protein_id="BAG00317.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVWDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETSSNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAELELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        complement(442341..442697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00318"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP07"
FT                   /protein_id="BAG00318.1"
FT                   /translation="MELLDSLSSNRQASTVAELSLNPLFRRDYNSLYKGIQEFLPSPTN
FT                   DNYQKAVDSLLSVVSATIPPPVSRQFYLFGAHIPHPQLSHKLSPARDLSKNTYLVKVFS
FT                   VAVRGSLRPLIMKK"
FT   CDS_pept        443212..443979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00319"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP08"
FT                   /protein_id="BAG00319.1"
FT                   /translation="MSPMLEKNCLLLSGDESYEKSAQKIKSLTGIAVSHSTQQRLVHRY
FT                   AFEELPSNPEVEVEEMSIDGGKVRLRTAKGKALIWRDYKAVSFHQLGVAAFFQNNSALL
FT                   DLVNSQVLAEPLICLGDGHDGIWNLFGQIGEKQERIEILDWYHLIENLYKVGGSFQRID
FT                   EVKCFLWKGEVDAAISCFEGWSEPQVENFIIYLNKHKHRIVNYGYLQAEGISIGSGSVE
FT                   SKIKQIAHRLKTHIPHPQLSHKLSPARDLSKNT"
FT   mobile_element  443910..445969
FT                   /mobile_element_type="insertion sequence:ISMae31_8"
FT   CDS_pept        444081..445739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04980"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00320"
FT                   /db_xref="GOA:B0JP09"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP09"
FT                   /protein_id="BAG00320.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYNKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQQSKLKSKDDLPSQSYQVQAELELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   mobile_element  446359..446786
FT                   /mobile_element_type="MITE:MaeMITEf001"
FT   CDS_pept        complement(446868..447023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_04990"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00321"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP10"
FT                   /protein_id="BAG00321.1"
FT                   /translation="MAEIVNYPHPPPTPPLTGVGILQVRGRGVVKSVNGGGRERTPTMK
FT                   VNRQTF"
FT   CDS_pept        447147..448025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05000"
FT                   /product="type I restriction-modification system DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00322"
FT                   /db_xref="GOA:B0JP11"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP11"
FT                   /protein_id="BAG00322.1"
FT                   /translation="MAQLDNIEAIEKKLWKAADTLRANSNYASNEYFLPVMGLIFLRHA
FT                   YSRFLKVKREVEADLPKRGGKTRSLTKEDFLCKGAIYLQEKAQFDFLVALPDSVNRSTS
FT                   LMEAMLSIEGDYPPLGGILPKTEYQELDNVVLGNLLRILNPEELKKADGDIFGRIYEYF
FT                   LTQFANLKAHDNGEFFTPVSLVSLIANVLEPDHGLVFDPACGSGGMFVQSAHFVERQRI
FT                   NPQMLTFKGLEKNPTTIRLAKMNLAVHGLEGDIQKAITYYEDPLALAGKVDYVMANPPF
FT                   NVDEVDKLRRI"
FT   CDS_pept        448235..449293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05010"
FT                   /product="type I restriction-modification system DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00323"
FT                   /db_xref="GOA:B0JP12"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP12"
FT                   /protein_id="BAG00323.1"
FT                   /translation="MSSQASSAGRDEGKVRQKLIETGTVDIMIAIRSNFFYTRSVPCEL
FT                   WFLNRGKPAELQDKILMIDARNIYRKVNRTINDFSPEQLQNILSIVWLYRSESKRFIDL
FT                   VVGYCQSIDREYQGSIALLQNYCEHLDKLTEALEKFYNLIDEKDGTWLELRTASELFKD
FT                   DIDKYAGFAPISYNADDLETLHEAVRCYHEYGEFSRDLGKQADLVNKLLGRAIERAEKD
FT                   LGARDSKLWWNSRELNTLRKEADTSRQNAIEQLKSLRGFYRHAHWLLERFPDAKLRDVE
FT                   GLVKVVDREELQANDWSLTPGRYVGVSPEEEDEDFDFEETLREIHLELNDLNSEAIRLA
FT                   DEIAKNFEGLGI"
FT   CDS_pept        449329..449748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00324"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP13"
FT                   /protein_id="BAG00324.1"
FT                   /translation="MEIAIVSKLKYGVYFLPYNPDLVPRAKEMRKNPTPTEKKLWAFLR
FT                   QFPLKMWRQRPIDHFIVDFYCPKLKLVIEVDGEVHLTPEAMAYDARRTKVLEGYGLTVI
FT                   RFTNDEVKYDFEAVCEKISGFISSLPVCTELGDPP"
FT   CDS_pept        complement(449857..450027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05030"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00325"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP14"
FT                   /protein_id="BAG00325.1"
FT                   /translation="MRSIEKHRESLVGSGTFYPPKSPFSRGTYAAIAPVSPPAPLPRSD
FT                   SDSGSPLEKGG"
FT   CDS_pept        450156..450509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05040"
FT                   /product="putative restriction modification system protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00326"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP15"
FT                   /protein_id="BAG00326.1"
FT                   /translation="MGELFGYDFIADQPMKRISMTDSEIDRFCLQNGDLLFGRRSLVES
FT                   GAGKCSLIDNMIEKTTFESSIIRVRLDPNLALPKFYYYWFKSLRGSGAIRAIVTGTNVK
FT                   GIKGSDLKNMALR"
FT   mobile_element  450496..450681
FT                   /mobile_element_type="MITE:MaeMITEb008"
FT   mobile_element  complement(451028..451210)
FT                   /mobile_element_type="MITE:MaeMITEh004"
FT   CDS_pept        451244..451651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05050"
FT                   /product="putative restriction modification system protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00327"
FT                   /db_xref="GOA:B0JP16"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP16"
FT                   /protein_id="BAG00327.1"
FT                   /translation="MQRSRPETGDIIFSNIGTLGSTVLVDNEFEFSIKNVALFKPFDKN
FT                   YSSFIFLYFSDPATLRKMEIQSSGTSQKFFSLKFLRGLHILTPNKTLLRLFNDVVEPAL
FT                   KQRSLLHKYNQKLKQARDILLPKLMNGEIEV"
FT   CDS_pept        451737..452939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05060"
FT                   /product="type I site-specific deoxyribonuclease"
FT                   /note="HsdR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00328"
FT                   /db_xref="GOA:B0JP17"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP17"
FT                   /protein_id="BAG00328.1"
FT                   /translation="MTTEDKVQQLTANCLRDQLGWQSVYAYNQEDYGENSLLGRQNQKE
FT                   VILKRYLKQKLREFNPNLPEEAYKSAILQIEEINSSQTLLATNQEKHQLLLDGVQVSYR
FT                   NAKGELIRQTLKILDFDQPSNNHFLAVRELWIQGEIYLRRTDLVGFVNGIPLLFLEAKN
FT                   LNRDLKAAYDENLSDYLDTIPHLFAYNAFAILVNGIDAKIGSFCGKYEHFHPWKRLAES
FT                   DPGIVDMETMLKGVCDKNNFIDLLENYVLFDNSTGKTCKIIARNHQFLGVNQAIDSVKR
FT                   WREGAIKDNKLGVFWHTQGSGKSYSMVFFTRKIRRKLGANYTFVICTDREDLDKQIYYT
FT                   FAGSGLTNNEQELCQASSNEHLQSLLGDHKAYIFTLIQKFNQTVNPDQPYNSRNDKLNG
FT                   A"
FT   mobile_element  453012..454375
FT                   /mobile_element_type="insertion sequence:ISMae34_5"
FT   CDS_pept        453090..454358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05070"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00329"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ3"
FT                   /protein_id="BAG00329.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQMANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIVMNASSMEKATEVDYFITNVVEADTVTASWIVKTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        complement(454486..454752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05080"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00330"
FT                   /db_xref="GOA:B0JP19"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP19"
FT                   /protein_id="BAG00330.1"
FT                   /translation="MLYSKKLGSIRVCAAYFFGKIGCNGRLFVFLDKNNYFFKKTLFYF
FT                   FVGYFILWKSLEGNGGFILDRSLEVVGGDIIPEIAFSDLVVAD"
FT   mobile_element  complement(454586..456181)
FT                   /mobile_element_type="insertion sequence:ISMae28_2"
FT   CDS_pept        complement(454809..455483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05090"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00331"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:B0JG59"
FT                   /protein_id="BAG00331.1"
FT                   /translation="MLRLSLDAKARVNIGLFDRGGKNRITVETNDHDFNPKTTLTPYGI
FT                   FIPEFDELFLYFTASTVTSDFIVDILEDFWESEKSRFEKIKTLIINQDNGPENNSRRTQ
FT                   FMKRIVEFSQKYQVNIRLAYYPPYHSKYNPIERTWAVLENPWNGSILDEIETALKFAQT
FT                   MTWKGKHPIVKLITETYEKGVKLTKKAMEKIEEKIERLTESTNQDFPDLGQWFIDIYYD
FT                   KT"
FT   CDS_pept        complement(455519..456031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05100"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00332"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFL3"
FT                   /protein_id="BAG00332.1"
FT                   /translation="MELTDSLKKLLSETALQLKGAAKRRFMAQTVLELGYGGQTLAAQE
FT                   LGWNRTTIRKGIKELKRGIICVDNHSAKGRKKAEEHLPFLLENIKSLVDSQSQTDPSFK
FT                   SQRLYVRLSAAEVRKQLISKYGYSDEDLPSEETIRVKLNNLGYRLKRVAKVLPQKKFQK
FT                   PRQSLRN"
FT   CDS_pept        456171..456329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05110"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00333"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP22"
FT                   /protein_id="BAG00333.1"
FT                   /translation="MEVPYYDARGDKLSIAVNDLNEQIAAKIEELEIENVEIYFARLQL
FT                   AFFTQGQ"
FT   mobile_element  456282..457424
FT                   /mobile_element_type="insertion sequence:ISMae22_2"
FT   CDS_pept        456375..457418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05120"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00334"
FT                   /db_xref="GOA:B0JP23"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP23"
FT                   /protein_id="BAG00334.1"
FT                   /translation="MINLEFTEEEKNSLYYERFHHPHPRVQLKMEVLWLKSQKIPHQKI
FT                   CQLAGISPNTLLTYLRDYQEGGIEKLKEINFYRPKSELESQRETLKKYFEKNPPATINE
FT                   AVYRREELTGIKRSPTQVRKFLKSLGMKCLKVGSLPSKADPDEQEEYKEKKLEPRLNEA
FT                   KEGKRAVFFVDAAHFVMGAFLGFVWCFERLFVKSPSGRKRFNVLGALNAITHEVILVTN
FT                   DTYITATQVCELRSKIAALGLMIPITLVLDNARYQKCKIVEELALYLSIELLYLPSYSP
FT                   NLNLIERLWKLVKKKCLYGKYYENFSDFSSAIYECLNDAHLKHKKELDSLLTLRFQKFN
FT                   KSQIMNV"
FT   CDS_pept        457485..457640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05130"
FT                   /product="type I site-specific deoxyribonuclease"
FT                   /note="HsdR family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP24"
FT                   /protein_id="BAG00335.1"
FT                   /translation="MDALARDFVEHYSTAWETGKAMVICIDKLTCVKLHNLIDRYPHFS
FT                   QTELRT"
FT   mobile_element  complement(457606..459595)
FT                   /mobile_element_type="insertion sequence:ISMae30_1"
FT   CDS_pept        complement(457842..459326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05140"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00336"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0JHE8"
FT                   /protein_id="BAG00336.1"
FT                   /translation="MTPSSDQSRLNQLNFGNLNGRQVIANFEGGKITSDAGIILMAELD
FT                   QKLKITARFAECFRDYRNSSYLDYSVHELLAQRVYGIVLGYEDVNDHDKLRHAPALAIA
FT                   LKKLNFIDSAQANLAGKSTINRLEYCPETVINQENSRYHKIEPNPKEIEKAFVDIFLES
FT                   YKKPPKPIILDMDVTDDQVHGNQEGAFFNTYYKGVCYAPLYIFCEHHLLVAKLRSSHVD
FT                   TAGGALEELQRIIGIIREKWSDTQILVRGDSAYSREDIMKFCESQAGVDYVLAMATNSQ
FT                   LKLRATDVIEKAKADYEQRLQPVTELMETLFSPDEELGELAKLVPESTWYRSLCYQTQK
FT                   SWSRSRRVVTKVCPGSEGVKIRHVVTSLPASKIPPSKLYTEKYCPRGERSNRIKEQQLD
FT                   LFADRNSTQTFESNQLRLWLSSMAYVLMQAFRQNCLAKTSFAKATVGTIRLNFLKLGAR
FT                   ITVSVRRILIAIASSCPYQDILAIAYSRIQAIAGTG"
FT   CDS_pept        459399..459551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05150"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00337"
FT                   /db_xref="UniProtKB/TrEMBL:B0JHE7"
FT                   /protein_id="BAG00337.1"
FT                   /translation="MRLYQLINLKIRILNLFFFQGLIDDELKLNPNNTLSFLLQGDHPV
FT                   KTQIL"
FT   CDS_pept        459602..460015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00338"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP27"
FT                   /protein_id="BAG00338.1"
FT                   /translation="MVRQLDDSPKTTIVYPDSDGKPMADNTRQFRWITTIKANLDWLFA
FT                   NDADVFVAGDLLWYPVEGDNKTRQAPDVMVAFGRPKGERGSYQQWKENNIPPQVVFEIL
FT                   SPGNTQTEMTRKLLFYDRYGVEEYYIYNPHSAP"
FT   mobile_element  complement(460101..460283)
FT                   /mobile_element_type="MITE:MaeMITEh005"
FT   CDS_pept        complement(460170..460352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05170"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00339"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP28"
FT                   /protein_id="BAG00339.1"
FT                   /translation="MPSHSQQALFIENDRGNSEIFGLVGLRQKTNREKLQLQSPLGIYF
FT                   EKPKIAETQIYQGKS"
FT   mobile_element  complement(460282..462346)
FT                   /mobile_element_type="insertion sequence:ISMae31_9"
FT   CDS_pept        complement(460428..462086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05180"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00340"
FT                   /db_xref="GOA:B0JP29"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP29"
FT                   /protein_id="BAG00340.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETSSNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKLKDDLPSQSYQVQAKLELNLTAI
FT                   ERLKKRAGRFVLATNDLEKKRLSSEDILKKYKGQQAPERGFSFLKDPCFFADSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQCFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        462296..462634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00341"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP30"
FT                   /protein_id="BAG00341.1"
FT                   /translation="MDLEIWYYVTVEGAECGIYNPDKNDLGGCIRRENRLESLENLDNW
FT                   ISPRLGIRFQLAQPELLLYYPDGQPFTSYNQERQRAEAERQRAETERQRAERLAAKLRE
FT                   LNINPEEI"
FT   mobile_element  462645..462827
FT                   /mobile_element_type="MITE:MaeMITEb009"
FT   CDS_pept        462655..462816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05200"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00342"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP31"
FT                   /protein_id="BAG00342.1"
FT                   /translation="MCYATYRVIRNETLIEKDIWRFLLIVFDLERTNQLNLLPDKDLVD
FT                   LCPPIEPY"
FT   CDS_pept        463052..463705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00343"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP32"
FT                   /protein_id="BAG00343.1"
FT                   /translation="MVRQLDDSPKTAIVYPDSDGKPMADNTRQFRWITTIKSNLDWLFA
FT                   NNADVFVAGDLLWYPVEGDNKTRQAPDVMVAFGRPKGERGSYQQWKENNIPPQVVFEIL
FT                   SPGNTQTEMTRKLLFYDRYGVEEYYIYNPDKNDLGGCIRQENRLESLENLDNWISPRLG
FT                   IRFQLAQPELLLYYPDGQPFTSYNQERQRAEVERQRAERLAAKLRELNINPEEI"
FT   CDS_pept        463958..464695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00344"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP33"
FT                   /protein_id="BAG00344.1"
FT                   /translation="MVRQLDDSPKTTIVYPDSDGKPMADNTRQFRWITTIKSNLDWLFA
FT                   NNADVFVAGDLLWYPVEGDNKTRQAPDVMVAFGRPKGERGSYQQWKENNIPPQVVFEIL
FT                   SPGNTPTEMTRKLLFYDRYGVEEYYIYNPDKNDLGGCIRRENRLESLENLDNWVSPRLG
FT                   IRFQLAQPELLLYYPDGQPFTSYNQERQRAEAERQRAETESQRAEAERQRAETESQRAE
FT                   AERQRAERLAAKLRELNINPEET"
FT   CDS_pept        464984..466123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05230"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00345"
FT                   /db_xref="GOA:B0JP34"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP34"
FT                   /protein_id="BAG00345.1"
FT                   /translation="MTVCEYRPGLEGIPAAQSSISFVDGQKGILEYRGIRIEELAEKST
FT                   FLETAYLLIWGVLPTGAELDEFADEIRYHRRIKYRIEDMMKCFPEKGHPMDALQTSAAA
FT                   LGLYYARRALDNPEYIRQAVVRLLAKIPTMVAAFQLIRKGNHPIQPNDSLDYAANFLYM
FT                   LTERRPTDLAAKVFDVCLTLHAEHTMNASTFSAMVTASTLTDPYGVIASAVGTLAGPLH
FT                   GGANEEVLLMLEEIGSVANVRPYVEKCIANKQKVMGFGHRVYKVKDPRATILQNLAEQL
FT                   FAELGSDEYYDIALELEQAVVDIYGEKGIYANVDFYSGLVYRKLGIPSDLFTPIFAISR
FT                   VAGWLAHWKEQLNANRIFRPTQIYTGEHEVPYTPIEQRS"
FT   CDS_pept        466322..468064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05240"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00346"
FT                   /db_xref="GOA:B0JP35"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP35"
FT                   /protein_id="BAG00346.1"
FT                   /translation="MVKFWQGLTVFLISCLLLISLTACGNQVRRNQVVISVLSDPKTFN
FT                   AVLSAESPNIFGLTYEGLLTENPITGKKEPVLAESWTISDDNLNIIFTMREGLKWSDGQ
FT                   PLTVDDVVFTYKDLYLNPDIPNNYRDSLRIGLKKEFPVITKLDNRRIEFKLPEPFAPFL
FT                   DAVSSPILPKHALEKTIQKKSPDGRLEFLSTWGLDTPPDQIVFNGAYKLKEYITGQRII
FT                   FENNPYYWKKDDRGQQLPHITSVIWAIVESQDTTLLQFRSGSLDSIGVTPEFFSLLKTE
FT                   EERGNFTIFNGGPAYGTQFIGFNLNQGKRDGKPLVDPIKSRWFNNLNFRQAIAYGINRQ
FT                   RMIDDIYRGLGQEQNSFLSIQSPFYDKTLKGYDYNPEKAKELLLEAGFKYNSDNLLVDA
FT                   DNNPVRFNLITNAGNKIREAIGAQIKNDLAAIGIQVDFQAIAFSNLVDKLSNSLDWEAH
FT                   ILGFTGDNEPHAPNIWYVDGNLHAFNQQPQPGSPPIQGWQAADWEKKIADLYVKGSQEL
FT                   DFEKRKVIYNEIQQLQQEYVPFIYLVNPLALGAVRNCFEGIQFSALGGAFWNLEELKKT
FT                   CGGV"
FT   CDS_pept        468064..469332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05250"
FT                   /product="glycosyl transferase"
FT                   /note="MGT family"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00347"
FT                   /db_xref="GOA:B0JP36"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006326"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP36"
FT                   /protein_id="BAG00347.1"
FT                   /translation="MTHFGILCPTASGHINPLLPLGKELQKRGHKVTCFLTLDGEEMVQ
FT                   AAGLDFQAIAPDQYPKGTSAKNLAEIGQLQGTAAVRRTVQSVTNSTAALFETIPQEMRR
FT                   LGIDALIVDQVSPSGGTIAEKLAIPFVSFAGALVLNRDPLIPPFMTIWDYNPSFIGVIR
FT                   NKIGYKLLDSLTRPLNELINRQRQEWGLIPYQNINQRYSPIAQISQQPAEFEFPRQNLP
FT                   AHFHFTGPFHDSSTRKTIPFPYEKLTGQPLIYASLGTIQNRLQSAFNAIAEACADLPVQ
FT                   LVLSLGNTDSNIQITTKNALVVPYAPQLELLTRASLTITHAGLNTTLESLAQAVPMVAI
FT                   PITNDQPGVSARIKWSGTGEVIPISRLEVPRLRKAIEKVLSFPSYRENALRMQKALQKT
FT                   GGVKMAADIVEKAISTGQPVLSV"
FT   CDS_pept        complement(469346..469510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05260"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00348"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP37"
FT                   /protein_id="BAG00348.1"
FT                   /translation="MLLDRNHRNVQSNLYSSSVCVRPWTGYKGRFLSIVFDNVFKTRHP
FT                   TPCPQEKLF"
FT   CDS_pept        complement(469595..469939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00349"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP38"
FT                   /protein_id="BAG00349.1"
FT                   /translation="MSIFASLYMDEDMSALVATLLRSRGLDVTTVPEQSTLGKTDSEQL
FT                   EFAASLGRCLVTHNRVDFERLHLQFIEEGREHCGIIVVPQKTAYEVVQRVSVLVNTLTV
FT                   DSINNQLLYA"
FT   CDS_pept        complement(469936..470229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00350"
FT                   /db_xref="GOA:B0JP39"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP39"
FT                   /protein_id="BAG00350.1"
FT                   /translation="MTIITLSRYVTRNNEILGGEPIIEGTRTSIRAIVGLWRLGVMPEE
FT                   IPTHLPHLTLAQVFDALSFYLDHQAEINEYIERNQVPDELVHPSVKAALGKL"
FT   CDS_pept        470607..470828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05290"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00351"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP40"
FT                   /protein_id="BAG00351.1"
FT                   /translation="MLTTTQFAPLLKQLSYSDKLLLLNFLVAELLKDSGIAPMSIQDDL
FT                   PRQGLHDSFEAAAILAQALKEKQELTHG"
FT   mobile_element  470921..472299
FT                   /mobile_element_type="insertion sequence:ISMae16_1"
FT   CDS_pept        471056..472243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05300"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00352"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP41"
FT                   /protein_id="BAG00352.1"
FT                   /translation="MFVLEYKLRGKPSQYQAIDEAIRTVQFVRNKCLRYWEDNKGVGQK
FT                   DVYKYVTQLRSEYPFVQDLNSTACQQACERTWTAILRFYNNCKNKIAGKKGYPKYSKRT
FT                   HSVEFKKSGWKLNRNSKRITFTDGKNIGELKLIGSRDLFDFQEWQIQRIRIVKRADGYY
FT                   CQLMLKLDARDITPQLESTGHCLGLDMGLKYLYADSNGNTVEPPKYYRKAEKRLHKLNR
FT                   RKSKKFKRGQKQSNNYKKASQKYAKGHLKVSRQREEFAKKLALRLIQSNDLIAYEDLKV
FT                   KNLVRNRKLAKSINDAGWSQLRKWIEYFGIKYGRLTIAVNPAYTSQECFNCGRLIQKSL
FT                   SVRTHVCSCGYVEDRDKMAALNILKKATIGHIGSWSLDLNAWGDLSSILVGRNTC"
FT   CDS_pept        472386..472637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00353"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP42"
FT                   /protein_id="BAG00353.1"
FT                   /translation="MGLALGAVWENQRLSLPLGGNLARFEAGALVVKATVEQFPTVDLA
FT                   FAWTQDKYAPLILGQMNFFLAFDVCFYRYDLAFEISQK"
FT   CDS_pept        472795..473049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05320"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00354"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP43"
FT                   /protein_id="BAG00354.1"
FT                   /translation="MWWQSSRLDRIEASLEASQQRIERIESNIDRLAAISEATNRRIDR
FT                   FVEATAQQMEESKARIDQLQQGMEQLQRAVGYFLSQDGN"
FT   CDS_pept        complement(473266..473568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00355"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP44"
FT                   /protein_id="BAG00355.1"
FT                   /translation="MYATIEKVDIMSYASGEWTAFSFAITESAKNVFDAALKGFVGVGY
FT                   TPLAFATQVVAGMNYCFLCKGKVVYPNAPDLVVLVYIYKPPQGAPHITKISQINP"
FT   CDS_pept        complement(474077..475072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05340"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00356"
FT                   /db_xref="GOA:B0JP45"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP45"
FT                   /protein_id="BAG00356.1"
FT                   /translation="MLDKIFTPNPYAEKPAPLRPRKGVIIGVGQVGMACAYSMLIQDCF
FT                   DELILQDIATDKVEGEVMDLRHGMPFIEPTDLKMGTVADVGQNADVVIITAGAAQKEGE
FT                   TRLHLLERNVAIFRRILEDVAVYCPSALILVVSNPVDIMTYVTLKITNFPPSRVIGSGT
FT                   VLDSGRLRSLLSTQLHVDARNVHAYIIGEHGDSELAVWSSANIGGARLLEGDWQDLSAA
FT                   DQESLTEIFLQVKNAAYEIIKRKGYTSYAIGLATTDIVKAILRSQERILTISTLLDGQY
FT                   GLKDVCLSIPSVVNEKGVIKTLNLALSPREMEQLHNSAKIMRDLIDQLKI"
FT   CDS_pept        475456..475797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00357"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP46"
FT                   /protein_id="BAG00357.1"
FT                   /translation="MIYHITTERGWQIAREMGEYRAYSLKNEGFIHCSTLEQIPKVVAA
FT                   FYQNQPDLLVLAISPEQLQSPVKWEQPQHPNPENATLELEKETFPHIYGAINLESVVFV
FT                   KPLQDLINS"
FT   CDS_pept        complement(475774..477087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05360"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00358"
FT                   /db_xref="GOA:B0JP47"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP47"
FT                   /protein_id="BAG00358.1"
FT                   /translation="MIPSSERYWLKNAHIPVSLLENESFSPQTSEGLTLVNLEINDGNI
FT                   NRITSTIPPEDNIPVIDLKKKIVFPCFVDMHTHLDKGHSWQRCPNHDGTFDSALKMALE
FT                   DSRREWRLEDVYRRMEFGVKCSYAHGTAAIRTHIDSFGQQAQISLTALAELQRQWAGKI
FT                   TLQAVSLVSLDYYQTSEGAALADKIAEFGGILGGVAYTNPDLQAQIDITFKLAQERGLN
FT                   LDFHLDENGDPDSTCLAAIARTAIKEQFDGQIICGHCCSLAVQSPEIIQETLNLVKNAG
FT                   IAIVSLPMCNLYLQDRQEEKTPFWRGTTKVKEMKKAGIPVAFASDNCRDPFYGFGDHDG
FT                   LEVFTQAVRIAHLDTPYADWVNSVTLTPANLLGLPHLGRIKTGLEANLLIFKARYFSEL
FT                   LSRPQWDRLVIRRGLSIDTTLPDYQELDDLVLGIDQIL"
FT   CDS_pept        complement(477646..478533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05370"
FT                   /product="FO synthase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00359"
FT                   /db_xref="GOA:B0JP48"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR019939"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP48"
FT                   /protein_id="BAG00359.1"
FT                   /translation="MSRIVTYSPSHTLVPTYECFNRCSYCNFRRDLGTDGWLSLDKAKE
FT                   ILTALQGSEITEILILSGEVHPLAANRESWFRHIYNLAALALNMGFYPHTNAGILTFAE
FT                   MEKLKNVNLSMGIMLEQMTVTLLNTVHRHAPSKVPSLRLEQLQWAGELGIPFTTGLLLG
FT                   IGETECDRLVTLETIAAIHQRWGHIQEVILQPYNPGKREQWQNNPFDLQKLPDLVRQAR
FT                   EILPPDIVIQIPPNLVPDPLFLLDCLAAGARDLGGIGLIDEVNPDYLHLHPDKLKEFLA
FT                   IYGWELKPRLPVYQ"
FT   CDS_pept        478646..480310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00360"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP49"
FT                   /protein_id="BAG00360.1"
FT                   /translation="MIFDPASLPSHRQTIRPISATALHGIVFQDNKLIAIDAKNGYLYQ
FT                   IALDTGHTTVINSHRWQEFVGTTGLAIDDQNHLWFTTRENLYCCTLEDFTPKFFTRLPY
FT                   TANGVAVTGNTIYVTCQRSGQIFIFDRQSGQEITRLYAPGIGIENITIRGEELWLTDTL
FT                   EQTVYCLDRATGEQLFSMITPFESPTGLAFYRNANSGKDILYVAYAFQEPFIRDNPNSE
FT                   QVYELSYRPRTFVHPLYFHYDPAKKYALSNGYLIELSYVEELEPLYNIELKDVEWRIAL
FT                   PLETPRQKIRSVEAVGLPFTEEIQDGQRVAVFKFKQITAKQRHIFGWKVVLEVWGIKYQ
FT                   ITPQDCEDLPPLPADFPDRYLIDNDDLAMNTEIILNAAEEAIGRETNLLRKVYSIRNYV
FT                   YDQLSYGIKPNIDTPDIALRRGVGSCGEYVGLLLALCRLNGIACRTVGRYKCPPHPLER
FT                   NLPLEPDYNHVWMEFYLPSIGWVPMESNPDDIFEGGPYPNRFFMGLAWYHTEIAKDIPF
FT                   ERMLSEGQPVLKTQVPIGDLAINHVQFIILEELAPKD"
FT   CDS_pept        complement(480327..480509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05390"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00361"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP50"
FT                   /protein_id="BAG00361.1"
FT                   /translation="MALAALNAIPAKSTIEIPITIKSSIDVILPVPGQPWASVWVRVCK
FT                   WSKNSKKKEIEKWAS"
FT   CDS_pept        complement(480712..481107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00362"
FT                   /db_xref="GOA:B0JP51"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP51"
FT                   /protein_id="BAG00362.1"
FT                   /translation="MLTFNSKTYGELLAHYQPKAITTEAENERAIAIAQELEHRSELSL
FT                   EEEALLELLISLIERFEADNYPIPDINPLATLQHLIEANDIEYAELITILGSPDAVEQI
FT                   INGQRSINQSEARSLGAYFRVDASLFT"
FT   CDS_pept        complement(481094..481354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00363"
FT                   /db_xref="GOA:B0JP52"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP52"
FT                   /protein_id="BAG00363.1"
FT                   /translation="MTNANSCESLYDWYRVASKAAWQNLIDVQATYKSAESVGNFTVFN
FT                   IKGNHYRLIVDLVYNRQTIYIKYILTHAEYDKENWKNDAYF"
FT   CDS_pept        481788..482498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX"
FT                   /locus_tag="MAE_05420"
FT                   /product="cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00364"
FT                   /db_xref="GOA:B0JP53"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP53"
FT                   /protein_id="BAG00364.1"
FT                   /translation="MAVTRLAALVQEKISQPAERLASKSEFSPSIAVLEADNRVLVGTA
FT                   ALELAITPLHQEIEAFAQQAQSQGCNRLQIIPLFLLSGVHVKEDIPAAVAKVRSPIELE
FT                   LKPHLGSYQGIKSLLSRQFADLSPQDRILLSHGSRRPGGNREVENLAAFSGAITAYWSI
FT                   EPSLSQQIESLIAQGSPTIAILPYFLFTGAITDAIEAQVFELSQKHPNVNISLGKSLGA
FT                   TGELAEIIVEEGCG"
FT   CDS_pept        482489..482959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="MAE_05430"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00365"
FT                   /db_xref="GOA:B0JP54"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP54"
FT                   /protein_id="BAG00365.1"
FT                   /translation="MWMKRAAIALGGNLGDSATILGQALGELERVKGITLEAHSQWYQT
FT                   AAVGPPQPDYLNGCAIVQVDLSPLDLLHKLLEIEQLFGRVRRERWGPRTLDLDLIFYDD
FT                   LILETPELKIPHPRCRERAFVLLPLAEIAPDWRDPVTGKTILQLLGQLGLAE"
FT   CDS_pept        483146..484510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05440"
FT                   /product="small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00366"
FT                   /db_xref="GOA:B0JP55"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP55"
FT                   /protein_id="BAG00366.1"
FT                   /translation="MTKTPSLEETHYNQAKASLQQALTWYASFRRHWNYPPDPQLQAAV
FT                   KQDLQSLKSALAKLDETVIRVAAFGLVSRGKSSVVNALVGQKVLATGPLHGVTRWPRSV
FT                   RWTPATGKIQIELIDTPGLDEIEGEARANMAREVAKSADLILFIVAGDITRTEYEALGE
FT                   LRRAKKPIILVFNKIDLYPEADRRQIFQQLQRLGTNRDEKTLEDLLTSDEIVMVAAEPQ
FT                   PIPVRVEYPDGRVVTEWETPPPQIEELQDKLLTILNREGRSLLALNALVQGQEAEENIA
FT                   RKTLELRDSQAEEIIWQYAKYKALAIAANPIAILDLLGASIVDLTLVRALARLYGLPIT
FT                   SHQAGQLWRTLLLSSAGLLLGEILGTVIIGLGKTAAAAASIFENPTSLTLYGSTALLQG
FT                   AIAAYGTYIIGKAAKIYLERGCSWGASGPSTVINQILAQVHPQTILYRLRLELEQ"
FT   CDS_pept        484804..485361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00367"
FT                   /db_xref="GOA:B0JP56"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP56"
FT                   /protein_id="BAG00367.1"
FT                   /translation="MSAAHKSYIPVPVSRQKSQGSQRRPQSRVTSPNPTTKPVTQSSPT
FT                   PTVKPTTKSVARVPVAPTQKQLASRQLRSLCLLERIVAVITFCLLGSTLGIYAWTVYIP
FT                   KVWDKEFGKLETLQRHERNLLATNETLKHQLAQQAEKPETGLTHPQPFQTIFLQRKSAP
FT                   NLKPANASQPQSTVNSRPRSAY"
FT   CDS_pept        485711..487564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05460"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00368"
FT                   /db_xref="GOA:B0JP57"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP57"
FT                   /protein_id="BAG00368.1"
FT                   /translation="MTDTKRPRFRGKKTRSPSGRIQDRKSYLNAKKRQKKLKNLPLSNG
FT                   RLVAVWLILVMGIVGLAWRLYQLQIVQGQELQKRARQQQTTSIRPYIPRRAIVDSNGNV
FT                   LATDRLIYTLYVHPKLFAIPPAEVADKLAPLLNIPSNQLIQKFKEKETGIRLANQLTES
FT                   VARGLKQLSLDGVELEEKYARYYPQDDVAADVIGYVDKEHRGQAGLERGSSQLLERDPF
FT                   SVNTRRMGDGRILPAFVPHGIFQFDELQLEVTLDLKLQRAARTALREQLKKFNAKRGAV
FT                   IVMDSLDGSLLALVCEPTFNPNEYYKANVALFKNWTVADQYEPGSTFKPIIVAMAMEAG
FT                   AIKANTVVNDPGAITVGPWTIKNASKQGYGALDMARVLQTSSNVAMVQIAQKMGRVDFY
FT                   KSLLGLDINQRVGVDLPGEVSGYLKPEQEFLDNAIESATASFGQGLSLTPLKLVQLHGA
FT                   LANGGTLVTPHVIKGLADDRGRLHWQPDYPSKKVFSPTVARQVVEMMETVVSKGTGVAA
FT                   QIPGYRIGGKTGTAQKASPTGGYLPNAKITSFVAILPIESPRYVVLVVVDEPKGANTFG
FT                   STVAAPVAKTVMNTLISLKGIPPTSKVVPAGSATNKPPRHD"
FT   mobile_element  complement(487592..487828)
FT                   /mobile_element_type="MITE:MaeMITEd002"
FT   CDS_pept        487599..487778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05470"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00369"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP58"
FT                   /protein_id="BAG00369.1"
FT                   /translation="MLKKFVGGVRSQESVVSSRSSGVSGFVALSFLYQPMYYNKDNARF
FT                   LMVPIRFFGTNIGF"
FT   CDS_pept        complement(487814..488236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00370"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP59"
FT                   /protein_id="BAG00370.1"
FT                   /translation="MPKIETKKLLVEGAEELRVIPQLMAANGVTWNRGEEPLNIINCDG
FT                   VENLLKPKYISTQLKTPNGLTHLGIIIDADEEPDNRWKSLYNACLPNIPSLPQNLPAAG
FT                   LIMTLESGIKFGVWMMPDNQSRGMLETFLAYLGLAE"
FT   CDS_pept        complement(488239..489390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00371"
FT                   /db_xref="GOA:B0JP60"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP60"
FT                   /protein_id="BAG00371.1"
FT                   /translation="MLQSLKIEGFRGFQNFEMANLGRINLLVGKNNSGKTSILEAIQFL
FT                   YAQNNIDIFLETISYRGEFAWLENKLAGRTKVFEICHLFPGHEIVPSQEIIIIGSRESH
FT                   QESVTISVKSIPIQLSLFSDKNDDLNNDNIFDDEEWNKLLLSIRWSQSQKPIEMELLAN
FT                   GTLARDSIRRIASLSRISHKIGIDNQIELKFLTPFSLTSSDMAALFDNIVLSPLEDLII
FT                   ESLKIIEPKIERIASVVSGKYLTSNNLGVRGGFLIKIKNHDQPIPIGSLGDGFWRMLGL
FT                   VLAMVNLKNGILLVDEIDSGLHFTVMTDMWKVVWETAKKLNIQVFATTHSRDCWQSLAE
FT                   LITEEKITDNEITIQRIDREKSQSVIFDPEEIVIAATSNLEVR"
FT   CDS_pept        complement(489608..489787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00372"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP61"
FT                   /protein_id="BAG00372.1"
FT                   /translation="MELCLELEEKERRIAEGNYTISDFNQKTQQAIQNIEEQKTLTVCK
FT                   DEVELYRQLGIYCH"
FT   CDS_pept        489987..490175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05510"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00373"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP62"
FT                   /protein_id="BAG00373.1"
FT                   /translation="MGFLRGKLSAKIGRYLRFYHSIQAFGGFYPPNPPLGSWRRPQTPR
FT                   ALAFRWDAYRQLLAHLW"
FT   CDS_pept        complement(490255..490749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00374"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP63"
FT                   /protein_id="BAG00374.1"
FT                   /translation="MNSFDIQSFIITIDELVFSHTGEHLDDLQHEILEGVVNHQKYAEI
FT                   AQKNHRSQKYIKETAGKLWKTLSEILGQEVSKANIKSSLQRYCYSNFSNSSNIKDVIQI
FT                   NSGNFCTGKENSELPSSKIYQQAKLETIPELIKEGLTIEQIARVLKLPLELVRSQIEEF
FT                   E"
FT   CDS_pept        490912..491529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05530"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00375"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP64"
FT                   /protein_id="BAG00375.1"
FT                   /translation="MKFLRFCAQFSVPIATAGITTCIVSLPSQAVELVFSSPGVIKGIN
FT                   GVSFTLPSTGISRTYNVILERGTVNDIYGTPPLFDVFTEEDALAAMNASAQGINFYITN
FT                   LSENLSFESLGTDVFYIPYFTDSVNVIASSSKRKEESPGLIEVGFIDLPVDVEVVYTRL
FT                   IQVPEPTSTLGLFSLGILGAGATIKRQVKRHHSIEKETTKIG"
FT   CDS_pept        complement(491874..492827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05540"
FT                   /product="L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00376"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP65"
FT                   /protein_id="BAG00376.1"
FT                   /translation="MNRVKRSPTHRLEIHLLREGIIESVHNVEAAICDDRGRVLSTAGS
FT                   AETSAFIRSALKPFQALAVISTGTLERYDLNDKDLAIICSSHQGTVEHARQVFNILWRA
FT                   DIDPNALQCPLPEGKPSRLQYNCSGKHAGMLAVCQQRGWPLNSYLRRSSPIQKLILSKI
FT                   AELLGMPGDELISAHDDCGAPTYSMQLGQMAHLYAQLASGNRLDLERIVRAMTYHPRMV
FT                   AGEGAFDTELMRASQGEIVSKAGAEGIQCIGRVGEGLGLAIKALDGSKRAKYAAALQIL
FT                   KQLGWITPNVAESLSEKFLKIGSYTRLEVVGEMALL"
FT   CDS_pept        complement(492850..493353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf36"
FT                   /locus_tag="MAE_05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00377"
FT                   /db_xref="GOA:B0JP66"
FT                   /db_xref="InterPro:IPR009631"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP66"
FT                   /protein_id="BAG00377.1"
FT                   /translation="MKSSLDFCPVPEEQQPVNEYEQLKESWFFRWATLDVASYTKKIVW
FT                   LWLWTWLIVGPIAAASFPLKKAPFLFFCAGIFGSTILVGLVLLRLYLGWIYVYDRLQSE
FT                   KVFYEESGWYDGQIWTKTAAILTRDRLIVSYQIQPILQRLQKTALILGAIVAISGLFWL
FT                   FFTH"
FT   CDS_pept        complement(493359..493763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05560"
FT                   /product="iojap-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00378"
FT                   /db_xref="GOA:B0JP67"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP67"
FT                   /protein_id="BAG00378.1"
FT                   /translation="MTNPTGIITSVAENLKTEKFLETIVTAAEDKKAGDIAILKVADIC
FT                   YLTDYFLIITGYSTTQVRAIEDAIEAAMELEWQQSPRQVEGKSEGSWILMDYGDIIVHI
FT                   FLPKEREFYNLEAFWGHAQRIPLPSDHLEE"
FT   CDS_pept        complement(493819..494415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00379"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP68"
FT                   /protein_id="BAG00379.1"
FT                   /translation="MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQA
FT                   GLLHDLAKFFKPKKLLKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILE
FT                   AIRNHTLGKPNMSDLSCIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLK
FT                   YLLSSHCPIHPRTVLTRNWALQIVKEQPTETKTID"
FT   CDS_pept        complement(494496..496064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05580"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00380"
FT                   /db_xref="GOA:B0JP69"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP69"
FT                   /protein_id="BAG00380.1"
FT                   /translation="MKLPRLATLIIGLSFIFGLMLWLVNSIYRLYIQIAFTAPILANIL
FT                   LLLIIGLLGLLIYVLLYYFYLLPQHQKSRRGLRSSSRPPLKLPVEKTEAAGETLKAIRQ
FT                   QVEQIQDKVTQQVFINRSQEIERSLARKEVKIIVFGTGSAGKTSLINALIGQMVGNVEA
FT                   TMGTTEKGETYSLKMKGVNREIQITDTPGILEIGAAGGQREQLARQLATEADLLLFVID
FT                   NDIRQSEYGPLLRLIDIGKRSLLVFNKIDLYSDEDRDIILKQLRERLKGVILSADIIAV
FT                   AANPQPVQLTGGQMITPEPDILALIKRLASVLRAEGEDLVADNILLQSQRLGEEARKII
FT                   DRQRRRQADKIIDRYQWIGAGVIAVTPLPVFDMLATAAVNAQMVREIGQVYGCEINSDR
FT                   GKELALSLGKTLVSLGVVKGAVELLARILQLNFTTYIVGKAIQGVSAAYLTRIAGKSFI
FT                   EYFRQDQDWGDGGMTEVVQRQFQLSRKEEFIKSFVADAIGKVVQPFQDDWQQEEVLEAS
FT                   CEDDW"
FT   mobile_element  496061..497385
FT                   /mobile_element_type="insertion sequence:ISMae10_2"
FT   CDS_pept        496320..497342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05590"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00381"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP70"
FT                   /protein_id="BAG00381.1"
FT                   /translation="MLTDWKKQEELDFLNEVSCVPLQQGLRHLQTAFTNFFAGRTKYPN
FT                   FKKKHQGGSAEFTKSAFKFKDKQIYLAKCTEPLPIRWSRQIPESCEPSTVTVRLHPSGR
FT                   WHISIRFDDPTIKPLPVTDKAIGIDLGISSLVITSDGDKVSNPKHFKKHYRRLRRASKN
FT                   LSRKQKNSKNREKARIKVARIHAQITDSRKDHLHKLTTQLVRENQTIVVENLAVKNMVK
FT                   NPKLSQAISDVSWGEITRQLAYKCRWYGRNYIEIDRWFPSSKRCSNCGYIAEKMPLNVR
FT                   EWDCPSCGTHHDRDINASKNILAAGLAVSVCRATIRPEQSKSVKAGAKNPSGKKQKLKS
FT                   "
FT   CDS_pept        497346..497498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05600"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00382"
FT                   /db_xref="GOA:B0JP71"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP71"
FT                   /protein_id="BAG00382.1"
FT                   /translation="MGIAVRFTAVRMSTALTVGDSLILILVLCRPIVGNQNRLLSIVII
FT                   SFIHQ"
FT   CDS_pept        497543..497707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05610"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00383"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP72"
FT                   /protein_id="BAG00383.1"
FT                   /translation="MRALGFMLQPNLRSPPTFIYSPHFPTSPPPHFPTSPLPIPWDQKR
FT                   GKIISLVIR"
FT   CDS_pept        497732..498715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoB"
FT                   /locus_tag="MAE_05620"
FT                   /product="pyruvate dehydrogenase E1 component beta subunit"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00384"
FT                   /db_xref="GOA:B0JP73"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP73"
FT                   /protein_id="BAG00384.1"
FT                   /translation="MAETLLFNALRQAIDEEMGRDQTVFVLGEDVGHYGGSYKVTKDLY
FT                   KKYGDLRVLDTPIAENSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYT
FT                   SGGNFKIPMVIRGPGGVGRQLGAEHSQRLEAYFHAVPGLKIVACSTPYNAKGLLKSAIR
FT                   DNNPVLFFEHVLLYNLKENLPDTEYLLPLDKAEIVRKGEDITILTYSRMRHHCLQALKQ
FT                   LEKDGYDPEIIDLISLKPFDMETIAASIRKTHRVIIVEECMKTAGIASELIALINEQLF
FT                   DELDAPVLRLSSQDIPTPYNGNLERLTIIQPNQIVEAVQKMVGDRI"
FT   CDS_pept        498742..500148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="MAE_05630"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00385"
FT                   /db_xref="GOA:B0JP74"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP74"
FT                   /protein_id="BAG00385.1"
FT                   /translation="MQRQNWLLLLIIGLVVASIIVLIKLPLQLGLDLRGGSQLTIQVKP
FT                   TETVKTIQPNDLKAVQNVIENRVNALGVSESLVQTVDSKNQVIVQLPGVTNPKEAERNL
FT                   NVQAQLEFRQQKQGTEGEFRAEYSIFQQKKAELAALKAENKPENAAKIAELEQSLQKSK
FT                   EAILNLFESVDLTGKNLQNATISSTQGTNWEVAITFDSEGGNKFAELTKAIAGTGRSIG
FT                   IFLDNELISAPVVDVQFAQTGITGGRAVITGNFTAETANDLAIQLRGGSLPFPVKVEEI
FT                   RTVGATLGQDSIRRSIYAGLVGLLLVLIFMAVYYRLPGIIADVSLIIYTILSLGAFALV
FT                   GVTMTLPGIAGFILSIGMAVDANVLIFERTREELRAGKSLFRAVESGFYRAFSSILDSN
FT                   VTTLIACAALFWLGSGLVKGFALTLAIGVAVSMFTALTCSRTLLLITVLNVPSVRQKPQ
FT                   LFCPNLPVNQ"
FT   CDS_pept        complement(500198..500380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05640"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00386"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP75"
FT                   /protein_id="BAG00386.1"
FT                   /translation="MGSGEIFQLSVSSNQWGSGEVGKWGSGEVGKWGSGEVVSSPYHPK
FT                   TLSPYHPITLSPPES"
FT   CDS_pept        500424..501356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="MAE_05650"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00387"
FT                   /db_xref="GOA:B0JP76"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP76"
FT                   /protein_id="BAG00387.1"
FT                   /translation="MAFNVTKQRNFWWTVSALLTIGSILAMVISWFTIQAPLRPSLDFV
FT                   GGTRIQIELACAKKNNCEKPLTTAEVQVILDEEGLGNSSVQVLDKYTLSVRTKTLAEEQ
FT                   RTKLLDTLNQKIGAFDPETSQIDTVGPTIGQELFRSGFLALLVSFFGIAVYLSFRFQRD
FT                   YAFFAIVALLHDVLITLGVFAVLGLIAGVEVDSLFLVSLLTIVGFSVNDTVVIYDRVRE
FT                   NFVNTPELSVDEIVDNAVSQTLTRSINTTLTTLLPLVAIFLFGGTTLKYFALALIIGFV
FT                   AGAYSSIFIASTLLAWWRSRSHRPTLNYS"
FT   CDS_pept        complement(501353..501676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00388"
FT                   /db_xref="GOA:B0JP77"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP77"
FT                   /protein_id="BAG00388.1"
FT                   /translation="MSEEQFELVQGSGNVYRDFGDVDADVRQAKALLAAEIIKVLEKED
FT                   LSTRDAQVRTGINHSEFVQIRRANLGRFTIDRLISILGRLNQQVEITITTHPRTTDSSP
FT                   MAS"
FT   mobile_element  501753..501906
FT                   /mobile_element_type="MITE:MaeMITEa016"
FT   CDS_pept        complement(501911..502072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05670"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00389"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAG00389.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   CDS_pept        complement(502246..502449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05680"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAG00390.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   CDS_pept        502962..503126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05690"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00391"
FT                   /db_xref="GOA:B0JP80"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP80"
FT                   /protein_id="BAG00391.1"
FT                   /translation="MAWRAKLSGGRSVKTRLRWFWVALGAFLAIIGEEFLRKLLALSLW
FT                   RFSVELLSA"
FT   CDS_pept        503149..503508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05700"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00392"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP81"
FT                   /protein_id="BAG00392.1"
FT                   /translation="MAQTPQPAIGQSQTEQKIDNYFSPIQPDGTPKLGIDRWWATAGVD
FT                   KEITVNWTVEVKEKGEYYLRLGVDLENFDVIKRFRKWKLSDQVSIKISDDYNRPVSSYW
FT                   DLNKFQAQTKPKLAL"
FT   CDS_pept        complement(503742..503978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05710"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00393"
FT                   /db_xref="GOA:B0JP82"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP82"
FT                   /protein_id="BAG00393.1"
FT                   /translation="MFKSHYFITNVVEADTVTASWIVRTYTERNWVEVFYREAKGWLGL
FT                   REYQVRDKRSLLRHFILVFCAYTFILWHHTNFQ"
FT   mobile_element  complement(503963..505328)
FT                   /mobile_element_type="insertion sequence:ISMae34_6"
FT   CDS_pept        complement(503982..505250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05720"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00394"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP83"
FT                   /protein_id="BAG00394.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQMANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDREIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIVMNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        complement(505307..505969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05730"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00395"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP84"
FT                   /protein_id="BAG00395.1"
FT                   /translation="MNQCRQTQIPRGFSLIVDDSGHRKSGNLTAGVGRQYLGEIGKTDN
FT                   GIVAVTTHLYDGKKSVPLDREIYQPASSLAEGKEDKEFKKKPEIAIDLIDRSLTRGYRP
FT                   KIVLIDAGYGNNTNFLKALEERKLKYLGGLAKNRKVIIEKEGGVEETIQLEQLAKSLSE
FT                   KDWEKITLNLDKEKTVWVAVFRAKISQLEGERNLAIVMNASSMEKATEVDYWDLNAK"
FT   mobile_element  complement(505327..506119)
FT                   /mobile_element_type="insertion sequence:ISMae34_7"
FT   mobile_element  506124..506277
FT                   /mobile_element_type="MITE:MaeMITEa017"
FT   CDS_pept        complement(506281..506442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05740"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00396"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAG00396.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   CDS_pept        complement(506616..506819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05750"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00397"
FT                   /db_xref="UniProtKB/TrEMBL:B0JIK6"
FT                   /protein_id="BAG00397.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAYTTISKAFPL
FT                   LCCGQYHPNGSTNGYRERSNPD"
FT   mobile_element  507694..507876
FT                   /mobile_element_type="MITE:MaeMITEc003"
FT   CDS_pept        complement(508170..508343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05760"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00398"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP87"
FT                   /protein_id="BAG00398.1"
FT                   /translation="MPDKDLVDLCPPIEPYQVTKSRILLLLTNLVHSIISPPSEANSLT
FT                   KKMCSPKATRQG"
FT   mobile_element  complement(508283..508462)
FT                   /mobile_element_type="MITE:MaeMITEb010"
FT   CDS_pept        508442..508627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00399"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP88"
FT                   /protein_id="BAG00399.1"
FT                   /translation="MHSTNRRTVNCSNTAIVGFGNDQSDWGEDYYIQSDGTTKLNKCVK
FT                   PENAPSPLPWGVSVCL"
FT   CDS_pept        508838..509113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00400"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP89"
FT                   /protein_id="BAG00400.1"
FT                   /translation="MLFDWDEEKAKRNLAKHGVSFDEAKSVFYDPLFLTFADPEHSLGE
FT                   RRFIIMGESAKGRLLVVSYTDRTETTRLISARLATTQERKAYESDL"
FT   CDS_pept        509097..509297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00401"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP90"
FT                   /protein_id="BAG00401.1"
FT                   /translation="MNQTCDLDDDLRPEYDFTKLPVIARGQGRKRTTLTVEIDPDVATI
FT                   FPDSAAVNEGLRLLLRLIQNS"
FT   CDS_pept        509559..510062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05800"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00402"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP91"
FT                   /protein_id="BAG00402.1"
FT                   /translation="MKRLNSQNLLIASLLGLSTLFAGSYPSVKAQSEPKLGCQATVNKV
FT                   LEEIRSKGVRRVKFSIYKGVANEGRTGNPTNRTDVLNIALSSVDWSVTTRSEPKIESII
FT                   INIMESKILMKSWTDKIVANCGNTAIVSFGVYPSDWGEDYYIQSDGTTKLNKCVPAGTP
FT                   GLLP"
FT   CDS_pept        510196..510363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05810"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00403"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP92"
FT                   /protein_id="BAG00403.1"
FT                   /translation="MTKILIILDIMRLQTVFIQLRDMKSMITIPITLEQLISVIQQLQP
FT                   SERTKIANLS"
FT   CDS_pept        complement(510453..510611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05820"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00404"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP93"
FT                   /protein_id="BAG00404.1"
FT                   /translation="MLISFTKVNSNVHNQVLFCCQYSVNISNTKSVEYRLVMRRGKRQE
FT                   AKGKGNK"
FT   CDS_pept        510610..510792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05830"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00405"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP94"
FT                   /protein_id="BAG00405.1"
FT                   /translation="MEQNWQSGNPLPMAKQAEIDPRKFTEYSMNPFNTNNQGKWQAFMI
FT                   LGYNIESCAKRLGMK"
FT   CDS_pept        complement(511065..511220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05840"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00406"
FT                   /db_xref="UniProtKB/TrEMBL:B0JL27"
FT                   /protein_id="BAG00406.1"
FT                   /translation="MSGKGKTLTIPLILLNVVCQPISLLNVYDGSSRTFGSRLILDGWQ
FT                   WSRFGC"
FT   CDS_pept        511461..513305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05850"
FT                   /product="putative group II intron/maturase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00407"
FT                   /db_xref="GOA:B0JP96"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR025960"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP96"
FT                   /protein_id="BAG00407.1"
FT                   /translation="MTKSREGKGFGKPKTTKTTNVWKTINWAKVQRYVFKLQKRIYQAA
FT                   KSGQDAKVRRLQRLLVKSYYARLLAVRKVTQDNQGKKTAGVDGMIAISPEQRLNLTEEI
FT                   KGTLKAKPLRRVWIPKPGRDEKRPLGIPTIKDRARQALIKSALEPEWESKMEGTSYGFR
FT                   PGRSDHDAISRIYITINQSSYFVLDADIAKCFDRINHDFLLSKIHCPSSLKRDIKQWLK
FT                   AGVLDNGVFEETETGTPQGGVISPLLANIALDGMARLIETLFPKKGNGKNQAVLIRYAD
FT                   DFVVISPSLEIIEQCKTAISEWLKPIGLELKPEKTRVCHTLKPIEYNGKMEEPGFDFLG
FT                   FNIRQYPVGKYKSGKDGAKRLIGHKTHIKPSQKAVKTHTEAIKGVIKKHKTAPQSALIS
FT                   RLNPIIRGWANYYSGVVSMDTFNKLDNTTWLMLRAWTVSRCGKANYEKLRNYFRPDTVK
FT                   LSNGKERHESWLFKTKNGLYLWKHNWTPIVRHTLVRPDASPFDGNWTYWATRRGQAIDT
FT                   PTRVAKLLKKQQGKCSRCGQYFTPSDLIEVDHIHPLSLGGKDEYKNLQLLHRHCHDDKS
FT                   ASDGSPKSSTLTPLEVSIDNTRTTKRSQAVSLTREQSN"
FT   CDS_pept        complement(513797..514282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="MAE_05860"
FT                   /product="holliday juction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00408"
FT                   /db_xref="GOA:B0JP97"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP97"
FT                   /protein_id="BAG00408.1"
FT                   /translation="MTTWLGIDPGLAIVGWAILRDNSELMPILVDYGTIETSKNLSTAQ
FT                   RLIEIERDLKELIAEYKPGEIAVEMPFFNRQIKAAGGVLQALGIINLVSCRDGGIEPIF
FT                   LHQASWKCHLGHGKATKAEVAEQIKYLFGLTKMPINDAVDAIAIAYAGFSGVRNQIS"
FT   CDS_pept        complement(514286..515404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05870"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00409"
FT                   /db_xref="GOA:B0JP98"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP98"
FT                   /protein_id="BAG00409.1"
FT                   /translation="MTDNNMLKSICITLGTRPEAIKLAPVIRAFQESEQFQTHVILTGQ
FT                   HKEMVAQVMELFALKADENLDIMQTRQTLTDITCRSLRGLETVFERIKPDLIIVQGDTT
FT                   TAFAAALAAFYQQIPIAHVEAGLRTNDIYNPYPEEANRRLISQLTTLHFAPTTLAVENL
FT                   QKSGVTGNIHHTGNTVIDALLSVAKTAPECQIAGLNWSDYRVLLATVHRRENWGEPLQD
FT                   IIKGFTLLLEKYADTALLLPLHRNPTVREPIKSALGNHPRVFLTEPIDYAELVGAIQRC
FT                   YLLLTDSGGIQEEAPSLGKPVLVLRETTERPEAVQAGTAKLIGTNPEQILAQAGELLGD
FT                   KIAYDRMANAINPFGDGQASQRILQIVQDFLA"
FT   CDS_pept        complement(515413..515574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00410"
FT                   /db_xref="GOA:B0JP99"
FT                   /db_xref="UniProtKB/TrEMBL:B0JP99"
FT                   /protein_id="BAG00410.1"
FT                   /translation="MNYELGRINKNNLLSPVSCLLSPVSYLLSPISYLLSPISYLLSPV
FT                   SYLLSPDG"
FT   CDS_pept        complement(515638..516969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00411"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR039342"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA0"
FT                   /protein_id="BAG00411.1"
FT                   /translation="MQSSRALREGRLGLFALGGLLVFGALAIWVRGGGFGQRTYQLIFE
FT                   FADVEGLQVGAPVRFRGVRVGRITSFIPGSNQVEVIAEIASATLVMPRKVTVTTNLSGL
FT                   IGEAAIDITPLVSLSAEAKNLDPLAPDCDQQLILCNNTRLQGTTGTQLMSSVGRLVDTF
FT                   TSPEFVGNLNDVTKNTAIAAQKIARLSDDTSQTIRNAQREISRLSLELATTSRSVTNTA
FT                   NNASRFVNTLDNTVQENRSQISRTFQQSSQLVANLNAVLSENRGQIVDTLGNINQASLG
FT                   IGSLANNLNNTALRLNAGLDEIDTKQVMQNIETILNNAVETSNNLREITKTINDPATIV
FT                   VLQKTLESARVTFENTQKITSDIDELIGDPQFRENLRRLIDGLSNLLSSGEQLEYNLRI
FT                   AQTLDTMTQELAKQKVLTISRPLNPKQMQLYPQFIVQQPPTSEK"
FT   CDS_pept        complement(517016..517801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05900"
FT                   /product="ABC-transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00412"
FT                   /db_xref="GOA:B0JPA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA1"
FT                   /protein_id="BAG00412.1"
FT                   /translation="MIKEPLIELRGVSKRFGDNVILDGLDLTIYRGEALVIIGPSGTGK
FT                   STVLRLIAGLTGINAGEIRIKGQLRQGLLEDGREAMRTSLVFQQTALFDSLTVGENVGF
FT                   YLYEQTNLKKARIRELVEKSLEMVGLQGISDLYPSELSGGMRKRVAFARAIITNPDNPA
FT                   DNPELLLYDEPTAGLDPIASTIIEDLVRTLHEKSGSANTYVMVSHQQSTIRRTADRVVF
FT                   LYQGKVQWQGLVADIDRTDHPMIRQFFSASIEGPIRTIV"
FT   CDS_pept        complement(517873..518112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05910"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00413"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA2"
FT                   /protein_id="BAG00413.1"
FT                   /translation="MLGGEAENQSPEPNLSPLPPQHTVFSKTLHLKPLRQLSCFLLGSI
FT                   TLVADLLKGLSIHLHRWSSFPPTPVDAFYYSPSS"
FT   CDS_pept        518801..519949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05920"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00414"
FT                   /db_xref="UniProtKB/TrEMBL:B0JNZ6"
FT                   /protein_id="BAG00414.1"
FT                   /translation="MKSSKGKDNASSLFGIKKIPGDNQIRNLLDPIPAATIFGSFQQVY
FT                   QWLKKPGVIKKFFYLDEEILIALDGTEYFSSKKISCPHCNCRNPRNGTTTYFHGCVTPI
FT                   VVSPEQKQVINLEPEFIKKQDGQQKQDCENAAVKRWLDKNHQKKYGYPVTLLGDDLYSR
FT                   QPICELALKQGYNFIFVCLETSHKTLYEWREFLEKSGEVKTVEKKQWDGRKNLIYRYRY
FT                   VSRVPLREVESSLEVNWCEVTVINEKTQKIIYQNNWITNHQITENNVEKIVKAGRSRWK
FT                   VENEGNNVLKNHGYNLEHNFGHGQSHLCEFLLSLNLLAFLFHTVLDLVNHTYQKIRELL
FT                   VTRTSFFNDIRTLLKYFWFKNWSEFFLFILTEYVPLKKINSS"
FT   CDS_pept        complement(520282..520512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05930"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00415"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA4"
FT                   /protein_id="BAG00415.1"
FT                   /translation="MGAFYRRLYRRAGAAKAITATAHKIARIFYHLWTTKQSYQELGAD
FT                   DYEQQYRQRVINNLSKKAQSLGFQLVEASSA"
FT   CDS_pept        520630..520782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05940"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00416"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA5"
FT                   /protein_id="BAG00416.1"
FT                   /translation="MMFNFWSLLWVFEDLFRDLVMAFLAPSYDRGSTLVLGRVFYLILD
FT                   HGFKS"
FT   CDS_pept        520843..521022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05950"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA6"
FT                   /protein_id="BAG00417.1"
FT                   /translation="MTPLLLRFEFRILPDLEYQGLSLVSLFLFRALCVLQELITDSRLL
FT                   TAKNVTIKININNC"
FT   CDS_pept        521027..522535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00418"
FT                   /db_xref="InterPro:IPR014104"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA7"
FT                   /protein_id="BAG00418.1"
FT                   /translation="MTQITVIGAGIGGLTAAALLARRGYQVTVYDQALVPGGCASTFCR
FT                   RGFTFDVGATQVAGLEVGGIHQRIFAELGIDLPDSVPCDPACAVFLPGETTAINVWRNP
FT                   QKWQEERQKQFPGSEPFWQLLQKLFQASWRFQSRDPVLPPRNWWDLGQLISALRVDTAI
FT                   TFPFTLMTVGDALRLYGLETDKRLKTFLDLQLKLYSQVTADETALLYAATALAVSQSPQ
FT                   GLSHLQGSMQVLSDRLVAALEKYGGKLQMRHTVEKILTEKGKATGIIVRNQKNGQIHPE
FT                   MADEIVANIPIQNLPQLIDREAIPSLYHRRIEKLPPASAAFVVYLGVDRAAIPPDCPPH
FT                   LQFLYDDDGMIGENNSLFVSVSKEGDGRAPVGKATIIASSFTDTSLWWRKGEDNYQQLK
FT                   AAYTQEAINRLGNYFHLSPDHIVHIESATPRTFERFTGRNQGIVGGIGQRLSTFGPFGV
FT                   ATRTPIPHLWLVGDSTHPGEGTAGVSYSALTVVRQIENKLLASS"
FT   CDS_pept        522880..523299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05970"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00419"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA8"
FT                   /protein_id="BAG00419.1"
FT                   /translation="MRGNNLVKLNALNSLAFATGTVTLLLSSVSSVSAYTIYTNRTAWE
FT                   AALATNPSYKITTDTFSNTISSAQSITLDSGIVSTNSAPPTLPNSFNNNSVSIVNSGVY
FT                   DNASGTLTGASDTITWQFPATVLAFGADFSRIDEL"
FT   CDS_pept        523409..523627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05980"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00420"
FT                   /db_xref="GOA:B0JPA9"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPA9"
FT                   /protein_id="BAG00420.1"
FT                   /translation="MAQETKLFLSILQLVERMGFSVLSGQQNLVLLSLPIIQQLSIVLV
FT                   LTMLLLLPKFLNPMRLLLSPYLGVVCS"
FT   CDS_pept        complement(523796..525121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_05990"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00421"
FT                   /db_xref="GOA:B0JPB0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB0"
FT                   /protein_id="BAG00421.1"
FT                   /translation="MIIVRHGQSSYNAEQKIQGRSDGSVLTEKGHLDAEKVGNALSQID
FT                   IAAFYCSPLQRAKSTAEVIQSRLNNSPVIQPTSQLLEIDLPIWENMVKEEVKAQYPQEY
FT                   RDWHQKPHEFKMILPDGQEHYPVLSLYQQAQDFWREIIPQHEGKTILIVAHNGINRCLI
FT                   LSAIGIPVSLYHSLQQSNCCVNVLNFTGDFGDPVQVESLNQTAHLGIALPPPRPPFQGS
FT                   RLLLVRHGETQWNRDKRFQGVRDIPLNDNGKAQAEKAAEFLRETAIDHAVTSPLSRPKE
FT                   TAQIILQYHPDVTLDTQVDLTEICHGLWEGKLEEEIEASFPGMLEDWKNAPETVQMPEG
FT                   ENLQEVWDRAIACWRQIVKTYSNSDSPKTIMVVAHDAINKVILCYLLGLKPANFWNIKQ
FT                   GNGAVSVIDYPKGVDSQPVLQAINITSHLGAGILDRTAAGAL"
FT   CDS_pept        525564..526808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00422"
FT                   /db_xref="GOA:B0JPB1"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB1"
FT                   /protein_id="BAG00422.1"
FT                   /translation="MVPEYPPLDEMTLRQLRRVASQYSISRYSRMRKTQLIESITQAMG
FT                   VSGNFKSIIKEEKPVEAAKFELGQANPIEDILGSVDDGLGDLPGGYGENRITLLPRDPQ
FT                   WAYAYWDIPNESKEDLRRQGGQQLALRLYDVTDIDLNSQGAHSVQEYLCDELAREWYLP
FT                   IPVSDRDYVIDIGYRCADGRWLVLARSPLVRIPPVYPSDWIEDIFVTVNWEEELVGKTV
FT                   YELVPPSKRYGSSAGTTGSPIYDQIFESVGDIEALRVAGSLFGSMQHVAGSVPMSEVIS
FT                   SYVFPSGVGMWAVPTVSGLTASGIGITASGIGMGASETLQRPRKFWLVADAELIVYGAT
FT                   EPDATVTIGGRPIKLNPDGTFRYQMSFQDGLIDYPIMAVAADGEQNRSIHMKFTRETPS
FT                   RNTNTKDEAVLEWLF"
FT   CDS_pept        complement(526933..528585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="MAE_06010"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00423"
FT                   /db_xref="GOA:B0JPB2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB2"
FT                   /protein_id="BAG00423.1"
FT                   /translation="MGELNTAELLVKCLENEGVEYIFGLPGEENLDVLEALKNSSIKFI
FT                   TTRHEQGAAFMADVYGRLTGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGT
FT                   DRMHIESHQYLDLVAMFAPVTKWNKQIVRPGITPEVVRRAFKTAQSEKPGAVHIDLPEN
FT                   IAAMAADGHPLPLDSQEKVYASYRTLNMAAAVISKAKNPLILAGNGAIRANASEALTEF
FT                   ATALNIPVANTFMGKGVIPYTHPLALWAVGLQQRDLISCAFERSDLIIAVGYDLIEYSP
FT                   KKWNPDGKLPIIHIGMTPAEIDSSYAPVVEVVGDITDSLIDILKRADRQNKPTPVTAGL
FT                   KTEIRADYETYANDTGFPIKPQKLIYDLRQVMGPEDIAICDVGAHKMWMARQYHSDCPN
FT                   TCIISNGFAAMGIAIPGAIAAKLVYPNKRIVAVTGDGGFMMNCQELETALRVGTPFVTL
FT                   IFNDGGYGLIEWKQLNYFGTSSFIKFGNPDFVKFAESMGLKGYRVESTQDLIPTLEEAF
FT                   RQEVPTVIDVPVDYGENLRLSQKSGDLSCQIWE"
FT   CDS_pept        complement(528805..529368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00424"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB3"
FT                   /protein_id="BAG00424.1"
FT                   /translation="MREESTSVYGVGYVKIEDSLDYFCGRQSVILNFSLRIVAAKGRLF
FT                   CKFSLYKTYRVVSTAPVDVLWQKLINVADVSWHPLIAKADVPLGLIAKPGLIYQAVTRL
FT                   TPIPIRVFVENVRPGELLSLRVLAIPGMEQKMTYQVESTLCGSYISYSVTLRGWLSPFI
FT                   WWLSRPYLAKVAAQLAHAAEELTA"
FT   mobile_element  complement(529573..530939)
FT                   /mobile_element_type="insertion sequence:ISMae34_8"
FT   CDS_pept        complement(529593..530861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06030"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00425"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB4"
FT                   /protein_id="BAG00425.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQMANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIIMNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHQLTGGLQRRWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        complement(531303..531503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06040"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00426"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB5"
FT                   /protein_id="BAG00426.1"
FT                   /translation="MSLDRRQFLDLSGATLGTATLAGFNPAAFIEKIRFIQPTLYRVFI
FT                   PCNPIHRITQTEEPGYLRFGE"
FT   CDS_pept        complement(531732..532436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06050"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00427"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB6"
FT                   /protein_id="BAG00427.1"
FT                   /translation="MRGGGKPCLLVAGATLAILAPFQAAQAVTVNVGTGTVTGHFDNAI
FT                   TLPGSVYTGNGTDTIEWGTPVDGSFTNQLSFIPSDFTDQPKGQDFVAGRLYYRNGTIFL
FT                   GTQIDGVDLIVNTTSSDLDFTQTLPLKITIVNTPNVADPIASADFIYFTDFPDLGSFRV
FT                   LEGEETYVEVITQFNSLDLVGFGAVGDPLKGFLSPSTGPNPFPAVPEPSSILGLLALGL
FT                   LGMGSVFNKQRK"
FT   CDS_pept        532551..532733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06060"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00428"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB7"
FT                   /protein_id="BAG00428.1"
FT                   /translation="MLTPPAFLIIFVNVCAMETSSLVEFLRLYNCICLSWILAEKCSQS
FT                   HIMGLTPAPLHCTMT"
FT   CDS_pept        complement(532762..533436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06070"
FT                   /product="glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00429"
FT                   /db_xref="GOA:B0JPB8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB8"
FT                   /protein_id="BAG00429.1"
FT                   /translation="MNYLSIIIPTLNEELRIAATLKQIGAGVEIIVVDGGSTDKTREIA
FT                   EQLGGKVIISPSKGRGFQMNLGAKIAKGDILLFLHGDTLLPQEFQEQIINTLSQSGIVA
FT                   GAFELKIDGEEKTLRLVEKLVNWRSRWLSLPYGDQGIFLKASIFADLGGFPELPIMEDF
FT                   ELIQRLKKRGKIAIVSAPVITSARRWQKLGVAKTTLVNQLVIIGYYLKIPPHLLKIFYR
FT                   LW"
FT   CDS_pept        533668..534084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06080"
FT                   /product="CoA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00430"
FT                   /db_xref="GOA:B0JPB9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPB9"
FT                   /protein_id="BAG00430.1"
FT                   /translation="MPNIKGDDGALKTIFSNSKIIAVVGHSEKSSRASYQVAKFLQAVG
FT                   YRVYPVNPMVQQIDGQSCYPSLEAIPEPVDIVNVFRHPDYLPEIVESAIAIGAATLWTQ
FT                   LRIYHPVAEKKAIEAGLNVIMDACIQIEYQRLFA"
FT   CDS_pept        complement(534132..535982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06090"
FT                   /product="porin type major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00431"
FT                   /db_xref="GOA:B0JPC0"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007049"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC0"
FT                   /protein_id="BAG00431.1"
FT                   /translation="MFWKSLLVSPAILGATLVASANASSFDPVKSTSVSTEFNNLEIAQ
FT                   VQNTGAGTGELLNQIEQYGNEGQVAPVQGNTIDQVTSVNQLRDVSPTAWAYEALRSLVE
FT                   RYGCIVGYPDRTFRGDRALTRWEFAAGLNACLNVMERLIQDGVNVLKEDLDALKRLMDE
FT                   FQAELAALGARVDNLESRVSFLENNQFSTTTKLAGEVIFAVTDTVGAGSPASQAAMQYR
FT                   ARLLLNTSFTGQDVLKTRLAAGSATPFGFDYKSTTTLQNGDPASVRFDNLQSPSLFQTW
FT                   TAAGNGSNVVLDWLAYYTPIDLGYFGRFNTYVAAWGGIWNDFVPTTNPFFEDFDGGNGA
FT                   LSTFASENPIYRIGGGSGAGVSLQLGFLQSIVGPTSLSLGYLAGGGGSSSAANPNPGNG
FT                   LFNGDYAALAQINANLFNFLNVGFTYVNAYQGADTAIFGNGGSFGVTGTSAANLSQTQL
FT                   NTLLNVNGNDPDSVTLQDEVGFFNFGAKVSNSYGLTGAVDIGFASLSAFGSYSTVRLLG
FT                   LGDAEVWTYGAGIAFPDLGKEGNILGLFAGAQPYIGHLSFRDMGLKVSNIVPYHVELFY
FT                   KYQVTDNISITPGVIWISAPEQFKGTGNEWIGTLRGTFTF"
FT   CDS_pept        complement(536082..536246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06100"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00432"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC1"
FT                   /protein_id="BAG00432.1"
FT                   /translation="MPDSSRRACCMSLSFLCVRILTYFSFCLSAVRSDRVATLSTGQGK
FT                   KNEIASFPK"
FT   CDS_pept        536381..536767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06110"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00433"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC2"
FT                   /protein_id="BAG00433.1"
FT                   /translation="MKKRKIANTLRKALLEDGKMERALYEYELEEHIDYWYEGLKSDRD
FT                   QFVFAVTENSGDVAMVLITPGKTIYVNEEAREKLAKFWIKAYENNINQLIPMMAENLAN
FT                   DIISVTGVKMVSPNQKRRWVSLRP"
FT   CDS_pept        complement(537090..538466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="MAE_06120"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00434"
FT                   /db_xref="GOA:B0JPC3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC3"
FT                   /protein_id="BAG00434.1"
FT                   /translation="MIIAGERSGVGKTTITLAILAYLISRGDRVQSFKVGPDYIDPMFH
FT                   SHFTGRPCRNLDPVLTSEDYVKTGFAQHCQNVDYALIEGVMGLFDGIQLSDTQFPDYAS
FT                   TAHIARILGLPLLLVIDCSRLSTSVAAIVRGYQSLDKNLHLAGVILNRVGSDRHLQLLQ
FT                   TALESINMPIVGVLRRQDSLTIPDRHLGLVPRDELGEIRQLQDQLASIAQNCFNWDILL
FT                   PLLTISPQENPKNPTEENKLFPPIRIGIARDKAFNFYYPDNLDILANLGAELIFWSPLQ
FT                   GANLPENLQGLYFGGGFPEIFAPELAANTPILTQVRKAIASGMPTYAECGGLMYLCEKI
FT                   VDFEQKNHSMLQIIPQSAIMSPKLTLGYRQAIAKQETILLKAGQPVRGHEFHRSQLSGV
FT                   SDAPIYQLQAFPKSDINAEGWQGKNLHASYLHLHFGANLSLPKKFLAAGLDFFRTAALS
FT                   "
FT   mobile_element  complement(538731..540807)
FT                   /mobile_element_type="insertion sequence:ISMae31_10"
FT   CDS_pept        complement(538979..540637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06130"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00435"
FT                   /db_xref="GOA:B0JPC4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC4"
FT                   /protein_id="BAG00435.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFQK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETSSNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQQSKLKSKDDLPSQSYQVQAELELNLAAI
FT                   ERLKKRAGRFVLATNDLEKKRLSSEDILKKYKGQQAPERGFSFLKDPCFFADSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQCFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   mobile_element  541122..542368
FT                   /mobile_element_type="insertion sequence:ISMae25_1"
FT   CDS_pept        541298..541681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06140"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00436"
FT                   /db_xref="GOA:B0JIV8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0JIV8"
FT                   /protein_id="BAG00436.1"
FT                   /translation="MCDEGEQAKRKWTDEEIGEALEVHRNTVGRIRQRFLQKGEKPALE
FT                   RKSRKTPPTPAKVDGAAAAQIIALCCSEPPSGRAEWTIRLLTSELKQRQIITEISSPTV
FT                   WRTLKKTNYALGKPKDTVFRNRI"
FT   CDS_pept        541699..542355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06150"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00437"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JG84"
FT                   /protein_id="BAG00437.1"
FT                   /translation="MEVVLDLYGTQPSEEEPLIAMDEASKQLLGEVYPPIPMQPGQDKK
FT                   EDYHYSREGVQALFMFFDPHRGWRRVSNRDSRTRIDWAEEIRQLLDVDYPKARKVKLVC
FT                   DNLNTHNIASLYEAFPAPVAHRLARRLEIYYTPRNGSWLNVAETELSVLSRQCLDRRIS
FT                   SKEELKREIETWQKERNQTASTVIWTFTTSDARVKLKHLYPVFEEEESGESIAPN"
FT   CDS_pept        542910..544532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06160"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00438"
FT                   /db_xref="GOA:B0JPC7"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC7"
FT                   /protein_id="BAG00438.1"
FT                   /translation="MENVNFHYELENQFHPTYGLENLGMKNLGRVYRNLSVPQLVEQAI
FT                   ERHEGVLADNGALVVETGKYTGRSPKDKFIVKEATSEKEIDWNQHNAPISEEKFQQLYR
FT                   KVLAYVQGKDLYIFDGYVGSDPNCRFGVRVVTEIAYHNLFAHQLFLRPSAVELAAHQTD
FT                   FTVIALPGLQGDPEDDDLNSEAFIVLNLAKKIVLIGGTRYAGEIKKSVFSMMNYLMTKQ
FT                   GVLPMHGAANMDKHGHTALFFGLSGTGKTTLSADPKRSLIGDDEHGWSEDGIFNFEGGC
FT                   YAKTIRLSAEYEPQIWAAIQFGTILENVILSPDNRLPDYDDGRLTENTRAAYPLRYIPN
FT                   CAVSGMGTHPKTIIFLTADAFGVLPPIAKLTTNQAMYHFLSGYTSKLAGTERGITAPQV
FT                   TFSSCFGQCFFPLSPLVYAQMLGERLEQHPETSVYLINTGWSGGPYGVGDRISIKHTRA
FT                   MVSAALNGDLEEVVFHPHPIFQVLVPEIVPGVPKKILDPRQAWQDGESYDLQARELAHR
FT                   FVENFRQFTTASQEIIAAGPIWE"
FT   CDS_pept        complement(545027..546250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00439"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC8"
FT                   /protein_id="BAG00439.1"
FT                   /translation="MTQIVVIGGGAAGFFGAIKAAESNPKAGVTILEAAKEPLAKVRIS
FT                   GGGRCNVTHHCFDVSQLVNYYPRGGKALRGAFSRFQPQDTIKWFELRGVKLKTEADGRM
FT                   FPSTDNSETIVNCLRESATFAGVNLRLNSPVKSVKKQEESFLIELKRDEQIRADKLLIA
FT                   TGSSPFGYRTAQDLGHSLVSPVPSLFTFQIADPRLKDLLGVTVDKVRVRLGGSKLEQIG
FT                   PLLITHWGVSGPAILKLSAWGARVLHEHHYRMPLIINWLGDYHPEKLREIILQTKSEYP
FT                   KRKLFNYCPFEQLPKRIWQSLLSYLTVNSETPWAELSKNTLNRLMIELQQGEYQIKGKG
FT                   VFKEEFVTAGGVNLQEVDFKTMESKICPGLYFAGEVLDIDAVTGGFNFQSAWTTGYLAG
FT                   QAMGNRRV"
FT   CDS_pept        complement(546522..547220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06180"
FT                   /product="urea transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00440"
FT                   /db_xref="GOA:B0JPC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017780"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPC9"
FT                   /protein_id="BAG00440.1"
FT                   /translation="MLHISDLNVYYGESHILRDVDLNINAGEMVCLIGRNGVGKTTLLK
FT                   TLMGILKPRAGTINYEQENLINKTSDQRARLGLGYVPQGRDIIPRLTVKENLILGLEAL
FT                   PTKRKNATIPEEIFDLFPVLKTMLSRMGGDLSGGQQQQLAIARALVGEPKLLILDEPTE
FT                   GIQPSIILEIEAAVRRIVASKGIAVLLVEQHLHFVRQADRYYAMQKGGIVASGFTSELS
FT                   QEVIQRFLSV"
FT   CDS_pept        complement(547259..548005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06190"
FT                   /product="urea transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00441"
FT                   /db_xref="GOA:B0JPD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017781"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD0"
FT                   /protein_id="BAG00441.1"
FT                   /translation="MTGKILEIENLTVSFGGFKALNNLNFSMDTGELRVIIGPNGAGKT
FT                   TFLDVITGKVQPTIGRVLFKGRDLRKIPEYAIARLGIGRKFQTPRVYLNLTVRENLDLV
FT                   SNRNKNVFSTLFGRPPLEDSRKVIGLLETIGLTAKADLPASLLSHGEKQRLEIGQLVAQ
FT                   SPDLLLVDEPVAGLTDEETENVGNLLLNLAESHSIIVIEHDMEFVRQIARKVTVLHQGT
FT                   VLCEGNMEQIQNDPKVIEVYLGSSEE"
FT   CDS_pept        complement(548119..549273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06200"
FT                   /product="urea transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00442"
FT                   /db_xref="GOA:B0JPD1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD1"
FT                   /protein_id="BAG00442.1"
FT                   /translation="MITETITRNESRQREKKKLITEIAVIVGLVVIFAVLLPLALSAFR
FT                   LRLLGRFLSLAIVALGIDLIWGYTGLLSLGHGIFFALGGYALAMYLNLQLPPGQMPEFF
FT                   TLYGVTELPFIWQPFYSLPLTILALIIVPAIVAGLLGYLIFRNRIKGVYFSILTQAALL
FT                   VFFNFFNGQQKLINGTNGLKTDTQTIFGLLVGSDAVQVAFYLLTIVCLLAIYLLCRWLT
FT                   TGRFGRLLVAIRDDEVRVRFSGYDPTWFKVLVFAISGAIAGVAGALYTVQTGIITPNSM
FT                   DVAFSIEMVIWVAVGGRATLVGAVVGTLLVRLAQTFLSEQFPEVWVFFQGALFLIVVTV
FT                   LPDGLLGGIKRLLTHFGFRKTLITYPSIEEAPEVQLEKEELEHK"
FT   CDS_pept        complement(549277..550437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06210"
FT                   /product="urea transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00443"
FT                   /db_xref="GOA:B0JPD2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD2"
FT                   /protein_id="BAG00443.1"
FT                   /translation="MSALLEGLFNGISIGSVLLLAALGLAIVFGLMGVINLAHGELMML
FT                   GAYSTFVVQNVFKGFGSPLFDTYVLFALPIAFLVSGLAGLLLERGVIRFLYGRPLETLL
FT                   ATWGVSLILQQFVRSVNGLLVISLIVFCLLFFGAMTVLSRRLDWERIRNLTIGITLPLS
FT                   LAIAGLLGYLLSFNPVLARPWFSARNVDVTAPAWLRGGLPLPGFQMPYTRLFIIILTAL
FT                   CLLGTYWFLNKSSWGLRIRAVTQNRQMSACLGIPTNQVDALTFALGSGLAGVAGCAISF
FT                   LGSVGPNVGQNYIVDTFMVVVVGGVGNLLGTIIAAMAIGVANYLIGSGTFALIFGSVEA
FT                   LKPLTDFFTFFSTTSMAKVMIFALIIAFLQFKPAGIFPPKGRTAEL"
FT   CDS_pept        complement(550532..551848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06220"
FT                   /product="ABC-type urea transport system substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00444"
FT                   /db_xref="GOA:B0JPD3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD3"
FT                   /protein_id="BAG00444.1"
FT                   /translation="MSNLGRRKFLLYGSAALGTSILLKACGGNQSQTPTASPSPAASPA
FT                   PTSGETIKVGILHSLSGTMAISETSVVDAEKLAIEEINAAGGVLGKQIEAVVEDGASDW
FT                   PTFAEKATKLIDQDKVATVFGCWTSASRKAVLPVFEAKNHMLWYPVQYEGQECSRNIFY
FT                   TGAAPNQQIEPAVTWLLENKGKKFFLVGSDYVFPRTANTIIKEQLKAKGGETVGEDYLP
FT                   LGNTEVTPIITKIKQALPDGGVIFNTLNGDSNVAFFKQLQAAGLTPDKYPVMSVSVAEE
FT                   EVKQIGKEYLLGQYACWNYFQTVDTPANKKFVEAFRAKYGPERVTNDPMEAAYIMVYLW
FT                   KQAVEQAGTADDLDKVRAAAVGQKFDAPEGPVEMFPNHHISKTVRVGQVRDDGLFDIVW
FT                   STPGVVDPQPWNQFVPETKGFACDWTDPAKGGKFKMEKS"
FT   CDS_pept        complement(552255..552737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00445"
FT                   /db_xref="GOA:B0JPD4"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD4"
FT                   /protein_id="BAG00445.1"
FT                   /translation="MSGWDIIPTQVPYFYLFFRHPTPHTPHPTPHTPHPTSPLPHFPTS
FT                   PLPHLPTSPLPHFPTSPSPISLEFMNWQLFGLTFITVFLAEIGDKSQLVAIALGGSSKS
FT                   PKAVFFGSITALICTSFLGVLAGGSMAQLFPAKILKAIAAIGFALLAVRLLWPDSD"
FT   CDS_pept        complement(552853..553185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00446"
FT                   /db_xref="GOA:B0JPD5"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD5"
FT                   /protein_id="BAG00446.1"
FT                   /translation="MSDSKSIASTEKKPDQPPSWSFWTVFSSTFLTIFFAEIGDKTQLA
FT                   TLLISAESQSPWVVFAGAATALIATSLLGVLIGYWIARRLSPKTLDIGVAILLLLITGL
FT                   LIGDIL"
FT   CDS_pept        553399..554004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00447"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR019303"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD6"
FT                   /protein_id="BAG00447.1"
FT                   /translation="MVENRDYTLIIDKSGSMSTADKPSEKTRWQIAQESTLALARKCEE
FT                   FDPDGITIYLFSGRFRRYDNVTSDKVTQIYQENEPMGRTDLAAVLQDALNNYFQRKTAG
FT                   KTKPNGETILVITDGEPDDRKAVMRQIIEASRKLDRDEELAISLIQVGHDRQATEFLKA
FT                   LDDQLESAGAKFDIVDTITIDDMEDMTLAEVLLNAVTD"
FT   CDS_pept        complement(554053..555480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="MAE_06260"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00448"
FT                   /db_xref="GOA:B0JPD7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPD7"
FT                   /protein_id="BAG00448.1"
FT                   /translation="MRILFVGAEAAPIAKVGGMGDVIGALPKVLRQLGHDVRIFLPYYG
FT                   FLQEKMDIPSEPIWSGFAMFQDFLVYETVLPDTDIPLYLFGHLAFSGRNIYGGEDEAWR
FT                   FTLFANGAAEFAWNYWKPQVIHCHDWHTGMIPVWMHQDPDISTVFTIHNLAYQGPWREA
FT                   LEKMTWCPWYMQGDNTMAAAVQFANRITTVSPTYARQIQTPIYGENLEGLLSYISGNLV
FT                   GIVNGIDTEVYDPAKDVYLKQNFTPETIEKRLINKIALQEEVGLQVSKSAFVMAMVTRL
FT                   VEQKGIDLVMQILDRFLTYTDAQLIILGTGDRYYETQLWEMTSRFRGRMSLHLLYSDAL
FT                   SRRIYGGADALLMPSRFEPCGISQLMAMRYGCIPMVRRTGGLVDTVSFHDPIQERGTGF
FT                   SFDRYEPLDLFTCMIRTWESFRYKQDWQKLQQRAMTQDFSWYKSALEYLKIYKQITGQS
FT                   DQLSDEEKDKLVALTSS"
FT   CDS_pept        complement(556121..556450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00449"
FT                   /db_xref="GOA:B0JPD8"
FT                   /db_xref="InterPro:IPR018922"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JPD8"
FT                   /protein_id="BAG00449.1"
FT                   /translation="MLLKSTTRHIRIYTAEVKNNQLIESNNVLTLDVDPDNEFNWEEVA
FT                   LNKVYSKFDELVESYNGEELSEYNLRRIGSDLEHFIRSLLQKGEISYNLNARVQNYSMG
FT                   LPKLG"
FT   CDS_pept        556742..557011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps15"
FT                   /locus_tag="MAE_06280"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00450"
FT                   /db_xref="GOA:B0JPD9"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JPD9"
FT                   /protein_id="BAG00450.1"
FT                   /translation="MALTQTKKQELISQYQAHETDTGSSELQVAFLTERINQLTEHLKA
FT                   NPKDHASRRGLLQMIGRRRGLLTYIQKKDQQRYQTLIGRLGIRR"
FT   CDS_pept        557036..557500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00451"
FT                   /db_xref="GOA:B0JPE0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021855"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE0"
FT                   /protein_id="BAG00451.1"
FT                   /translation="MASESKSTEKKERLPFEPRQNKRKTPKIAPSPVPPPLKNRSEETS
FT                   LKAIPQVVSQRMAKRMAVFCGLPTALGIASFFGFYWIISHDLLEIPSYVAMLVSLSLFG
FT                   LGFIGLSYGIFSASWDEDRVGDWLGWQEFQANFGRTIAAWRSGKKEVEEK"
FT   CDS_pept        557559..558614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmA"
FT                   /locus_tag="MAE_06300"
FT                   /product="carboxysome formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00452"
FT                   /db_xref="GOA:B0JPE1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE1"
FT                   /protein_id="BAG00452.1"
FT                   /translation="MIIVMKVGSPEIEIERVSAEFEAWGLSPEKIVGKHKVVIGLVGET
FT                   RELDPLQIQELSPWIETVLRVEQPFKRASLEYRHGEYSEVLVPTPNGVIPIGRNHTVSI
FT                   VAGPCSVENEAMIVETAKRVAAAGAQFLRGGAYKPRTSPYAFQGHGESALELLAAARDA
FT                   SGLGIITEVMDAADLDKIVEIADVVQVGARNMQNFSLLKKVGAQPKPVLLKRGMAATIE
FT                   DWLMAAEYILAAGNSNVILCERGIRTFDSKYTRNTLDLSCIPVLRTLTHLPIMIDPSHG
FT                   TGKWEYVPTMAMASLAAGADSLMIEVHPNPAKALSDGPQSLTPDRFDRLTQELAVIGKT
FT                   IGRWPQVPALV"
FT   CDS_pept        558679..559335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00453"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE2"
FT                   /protein_id="BAG00453.1"
FT                   /translation="MVTVPLELNTSEIRAERRVTFYHLSWLSYQQILQALGENNRAHLF
FT                   YDRGTLEITMPLEEHEFYRELIGLFIRILVVELGLKIKSMGSTTLAREDLERGAEPDNA
FT                   YYIQNQAKVLGKRINLTEDPPPDLVVEVDITHTDINKLALYARLGVPELWRFNGQIWRI
FT                   YRLEKGVYQEGEFSPTFPLVPKTKLYEFLATAKEDEVRAEKNLRAWLVSQLAKNN"
FT   CDS_pept        559356..560012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00454"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE3"
FT                   /protein_id="BAG00454.1"
FT                   /translation="MVTVPLELNTSEIRAERRVTFYHLNWLSYQQILQALGENNRAHLF
FT                   YDRGTLEITMPLEEHEFYRELIGRFIYFLVSELGLKIKSMGSTTLAREDLERGAEPDNA
FT                   YYIQNQAKVLGKRINLTEDPPPDLVVEVDITHTDINKLALYARLGVPELWRFNGQIWRI
FT                   YRLEKGVYQEGEFSPTFPLVPKTKLYEFLATAKEDEVKAEKNLRAWLVSQLAKNN"
FT   CDS_pept        560036..560209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06330"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00455"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE4"
FT                   /protein_id="BAG00455.1"
FT                   /translation="MVTFYLELNTNVSCQADNFFSQFNIVLFVYPNVRTVAFNPMPSIL
FT                   AFNTLTIFEGFR"
FT   CDS_pept        complement(560240..560434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06340"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00456"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE5"
FT                   /protein_id="BAG00456.1"
FT                   /translation="MPPSDRIHKRFSLTSTDCPAADGSEFYLWAELTLAVKLLSCLTRH
FT                   HYIFKGDICSEVQRSGRFP"
FT   CDS_pept        560545..561360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06350"
FT                   /product="HAD-superfamily hydrolase subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00457"
FT                   /db_xref="GOA:B0JPE6"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE6"
FT                   /protein_id="BAG00457.1"
FT                   /translation="MDIRLIVVDVDGTIAGDNNQVNPAVVQAVSAVQKKGIPVAIGTGR
FT                   MYRSALRFHKRLKSTLPLIAYNGAWIQDPVSQVHHRHTPISPDLAIDLLDYLEQPQWKE
FT                   KISLNFYMDDVLYVRQLNAETEFYRQRSGIIAQAVGDLRKVAHKTTKILAMGEDKQFIA
FT                   EIWHHLQQRYQNQDLYFTQSSPTFFEVTHVEATKGSATQFLAEDILGLQPQNVMAIGDN
FT                   FNDVSMLTYAGVGVAMGNAPQAVKDQADWVAPSVDLNGVAVALEKFVLI"
FT   CDS_pept        561509..562243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06360"
FT                   /product="carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00458"
FT                   /db_xref="GOA:B0JPE7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE7"
FT                   /protein_id="BAG00458.1"
FT                   /translation="MTINTQTVTIPNKDIDIDAYLAIPDRVGIYPAIIVIQEIFGVNDH
FT                   IRDVTRRIAQEGYIAIAPAIYQRFAPGFETGYSIEDIEIGRQYKEQTKAAELISDIQAT
FT                   IDYLYSLPQVQKTGVGTIGFCFGGHVVYLVSTLEDIKVSASFYGAGITTGTPGGGQGTV
FT                   KVTPQIKGTIYAFFGMLDASIPQKQVDEIENALIRYQIPHRVFRYENADHGFFCDQRAS
FT                   YNANAAKSAWDHVLELFSLLKS"
FT   CDS_pept        562316..563197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nbp1"
FT                   /locus_tag="MAE_06370"
FT                   /product="nucleic acid-binding protein"
FT                   /note="30S ribosomal protein S1 homolog"
FT                   /note="gene:nbp1 or rps1b"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00459"
FT                   /db_xref="GOA:B0JPE8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE8"
FT                   /protein_id="BAG00459.1"
FT                   /translation="MTPNPAFSMDDFAKALDQYDYQFEKGQIVRGRVDQHTSDGAFIDI
FT                   GGKSSAFISLREISLENVTSIAEALPIDAEFDFLITRGQDAEGQVTLSLRQLLLQKAWE
FT                   NVREISESGKSVQLRVTGVNKGGVTGEVEGLKGFIPRSHLIEKNDLDSLIGQLLTATFI
FT                   QIDQENNKLVLSQREIARANAISQLAVGKLLSGTVVKLQPYGVFVDCGGVTGLLHAKQV
FT                   TGASFNSPMTFFKVGQAIKVVVAEIDEYKNRISLSTKILEAHPGEILENFAEVMETAAE
FT                   RLKQAQGKNPES"
FT   CDS_pept        563336..564178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00460"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPE9"
FT                   /protein_id="BAG00460.1"
FT                   /translation="MFQDRIAILGTMHGKERVIAPILAQEIGLKVIVPDNFDTDRFGTF
FT                   TRDIKRIGTQIETARSKAQQAIELSGYDIGIASEGSFYPYPHLPLISCNRELILLLDRV
FT                   HNLEIIGQAIVTETNHAQQTVTNLAAALEFAEKIGFPSHGLVVMFDKNSLDSEHIFKGI
FT                   TDQKNLVKIVEDILDKNGKVHLETDMRAMHNPTRMKAIVAATANLVQKLNQLCPNCGCP
FT                   GFDIIEITSGLPCGLCHFPTSLIKLELYGCQKCDYREEKLFPNGQKTADPMYCEYCNP"
FT   CDS_pept        564192..564851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06390"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00461"
FT                   /db_xref="GOA:B0JPF0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF0"
FT                   /protein_id="BAG00461.1"
FT                   /translation="MERILEPEVMDDREEAIEYDAMDFTEVNTNFAKEAVQLAGINARV
FT                   LDVGTGTARIPIMISQLRPQWQIIAIDLADSMLEIGQKNILNANCQEQIKLEKVDGKNL
FT                   PYQSEQFDLVISNSLIHHLENPLPFLREIKRVLKPNGGIFLRDLFRPDSEEIIQGMVRE
FT                   IDPNFSPRQAQLFKDSLHAAFTLAEIADLIQQSGLKNVKIYQSSNRHWTAIKTSKN"
FT   CDS_pept        564878..565747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06400"
FT                   /product="3-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00462"
FT                   /db_xref="GOA:B0JPF1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF1"
FT                   /protein_id="BAG00462.1"
FT                   /translation="MKVGFLGTGLMGTPMVERLLNQKISVIAYNRTLEKLTALQQLGAK
FT                   TVSSPEQVIQEADCLILMLTNAAAIQEVLGLNSEQSNFNNRTIIQMGTIAPSESKQLRD
FT                   QIVAKGGEYLEAPVLGSIPEAKNGTLLVMVGATEKQFHQWSNLLAHFGQEPMLIGEVGT
FT                   AAALKLALNQLIAALTSAFALSLAFLSQQGVDLEKFMTILRQSALYAPTFDKKLTRMLE
FT                   ENYANPNFPTKHLLKDVNLFLEESEKLDLTTFPLTGVQRLLEKALEMGFAEEDYSALYE
FT                   ALKKELSR"
FT   mobile_element  complement(565829..567248)
FT                   /mobile_element_type="insertion sequence:ISMae35_2"
FT   CDS_pept        complement(566067..567158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06410"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00463"
FT                   /db_xref="GOA:B0JLF9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLF9"
FT                   /protein_id="BAG00463.1"
FT                   /translation="MLSLIEKLKQVKDFRKDKGKRHPLWIVLVVIILGTMLGYSGYREL
FT                   GEFAKNNRHRLSKEFNIIPERVPSYSTIRRVMMGVDWQSLLKMFNEWALEEYGQRDDIN
FT                   WLGMDGKSLKNTLKNPNNEQQNFIMFVSLFSQESGLVLHLKRIENKKGSEIDEGQAIIE
FT                   DCSLQNKVFTGDALHCQKKTISLIAKSKNDYVITVKGNQKNLYKRIQDLSNSSKPESCF
FT                   LEQDNSHGRKISRKIEVFKVRKNERQGFENLRRVIKVERKGSRGDKTYEETAYYISSLT
FT                   ESAQVFAKIIRGHWKIENQLHWVKDVIFEEDKSEISDFQAASNWSILTTIGLNLFRGLG
FT                   FLSITEGQRWLAERWEKLIVLST"
FT   CDS_pept        complement(567389..567556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06420"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00464"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF3"
FT                   /protein_id="BAG00464.1"
FT                   /translation="MAKLTITKIESRIPGTSKPANNPNSVSVIGKYAQNSITSHSNPLF
FT                   RPPQQSLRKI"
FT   CDS_pept        complement(567617..567967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00465"
FT                   /db_xref="InterPro:IPR008479"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF4"
FT                   /protein_id="BAG00465.1"
FT                   /translation="MTFNPDFFPWETEEQNDNCLMQYLQQQHPETLERIAQSVSSEIKD
FT                   IISQNVKGLVGMLPSEDFAVQITTDRENLANLLASAMMTGYFLGQVEKRHHLESILLAT
FT                   ESIKLGKKPKID"
FT   CDS_pept        complement(568103..568531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06440"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00466"
FT                   /db_xref="GOA:B0JPF5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF5"
FT                   /protein_id="BAG00466.1"
FT                   /translation="MVTLTNSDRLTVEDAMIELMSDYAHRDSALEVVETPLGYSLQLRS
FT                   AYQNLIEDLIPAELGTGTLRTLAAIALKEPILQADLINLRGSTAYQQVQDLVERGFVRK
FT                   RKQNEGRSYWLEVTDKFHQYFEVDNLREQGILEATDQE"
FT   CDS_pept        568683..569495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06450"
FT                   /product="myo-inositol-1(or 4)-monophosphatase"
FT                   /note="IMPase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00467"
FT                   /db_xref="GOA:B0JPF6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF6"
FT                   /protein_id="BAG00467.1"
FT                   /translation="METFWSQVLDFCYQATEQVGDRLLADFGKLQATNKADGTLVTAAD
FT                   RWSDGELRSLIARTFQDHGVLTEETTHIFPDQEWCWVVDPIDGTTNFTRGIPIWGISLG
FT                   LLYWGTPVFGFVYLPCLKQAYYGYWYGETGLTGPEGAYRDGQPIHTSEDFPSKNHLFNL
FT                   CARSTDIFKNPFPCKVRMIGVASYNLLLVADGTVLGGVEATPKVWDIAAVWAILQAAGG
FT                   VFISLGEKIFPLQVGENYSDRSYPCLAVARSNLAPVFLPLVGFLKDVA"
FT   mobile_element  569553..569736
FT                   /mobile_element_type="MITE:MaeMITEa018"
FT   CDS_pept        569752..570516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06460"
FT                   /product="ABC-transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00468"
FT                   /db_xref="GOA:B0JPF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF7"
FT                   /protein_id="BAG00468.1"
FT                   /translation="MSFDTSSLSERNDKAEVYQPVIIRLENVSKIYGSGETMVKALNNV
FT                   NLSLKKGEYCAIMGASGSGKSTAMNIIGCLDRPTSGSYYLENLDVSTLPDGDLAQIRNR
FT                   KIGFVFQQFHLLPQMSALENVMLPMIYGGVSPQERKERAIAALTKVKLDNRLHNKPNQL
FT                   SGGQQQRVAIARAIVNQPILLLADEPTGALDSKTTQEVMAIFSELNNSGITIVMVTHEA
FT                   DVARHSQRIIWFKDGEVVYPNLAPTDLHEVIG"
FT   CDS_pept        complement(570576..570854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00469"
FT                   /db_xref="GOA:B0JPF8"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPF8"
FT                   /protein_id="BAG00469.1"
FT                   /translation="MSNETVTYSLEAVLTRIEGKIDSLQRDVNKLEIGQSELKGEIKAL
FT                   DERLTTEIKGLTARVANQEFTNRGILIALVVAILGGAAKLFGFLPNP"
FT   mobile_element  complement(570897..572583)
FT                   /mobile_element_type="insertion sequence:ISMae6_1"
FT   CDS_pept        complement(570949..571599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06480"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00470"
FT                   /db_xref="GOA:B0JMQ8"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMQ8"
FT                   /protein_id="BAG00470.1"
FT                   /translation="MYQNNKQSIEDRIVSLTQPHIRPIVRGKAGKPVEFGAKFSASCID
FT                   GYIFLDRISWDNFNESGDLKAQIEAYYDYTGYYPESVHVDKIYRTRENRAWCKERGIRI
FT                   SGPPLGRPAKNVSKEQKKQATDDERIRNCIEGKFGQGKRRFSLGKVMAKLPHTSFSAIA
FT                   ITFLVMNLSNLLRQVFWAFLCLKWKNSTFSRSMIRISYNLKINQQLKLMLVAK"
FT   CDS_pept        complement(571861..572445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06490"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00471"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMQ9"
FT                   /protein_id="BAG00471.1"
FT                   /translation="MYRKSELPSTPPENFELPFEGKLSQDNRWVIMANLIPWSEFEAEY
FT                   ASLFSEEMGAPAKTFRTALGALIIKEKLGTSDRETVEQIKENPYLQYFLGFSAYSNEPQ
FT                   FEASMLVHFRERITRELINKVNRFMVKNSREIKEEENTEKKLESETQSQPENRGKLILD
FT                   ASCAPADISYPTDLNLLNQGRKQTEKIIDIL"
FT   CDS_pept        complement(572584..572913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00472"
FT                   /db_xref="GOA:B0JPG1"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG1"
FT                   /protein_id="BAG00472.1"
FT                   /translation="MSNETVTYSLEAVLTRIEGKIDKIDERLTKVEIGQSELKGEIKAL
FT                   GFKIEGIDKRLEKVENEQSVLVKSVSDLQGFRGLILPLIVGGISAGIGAIITVSIRFSL
FT                   LGGNP"
FT   CDS_pept        complement(572955..573317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00473"
FT                   /db_xref="GOA:B0JPG2"
FT                   /db_xref="InterPro:IPR025310"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG2"
FT                   /protein_id="BAG00473.1"
FT                   /translation="MSNETVTYSLEAVLTRIEGKIDSLQKDVNQKFDKIDERLTKVEIG
FT                   QSELKGEIKALGFKVEGIDKRLEKVENEQSVLVKSVSDLQGFRGLILPLIVGGISAGIG
FT                   AIITVSIRFSLLGGNP"
FT   CDS_pept        573341..573577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06520"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00474"
FT                   /db_xref="GOA:B0JPG3"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG3"
FT                   /protein_id="BAG00474.1"
FT                   /translation="MLRSRVASALRPPNLLWARLLQWGLILIILQAVLVSDRIKIMTQS
FT                   IKSIIILNPLSNAQKTGFSEKPVFYSCKRQKGE"
FT   CDS_pept        complement(573728..575311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhD1"
FT                   /locus_tag="MAE_06530"
FT                   /product="NADH dehydrogenase subunit 4"
FT                   /note="involved in photosystem-1 cyclic electron flow"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00475"
FT                   /db_xref="GOA:B0JPG4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="InterPro:IPR022997"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JPG4"
FT                   /protein_id="BAG00475.1"
FT                   /translation="MNLTNFPWLTAIILFPIVAALLVPIIPDKDGKTVRWFALTVGLID
FT                   FALIIYAFYSSYDFANPNLQLVESYQWLPEIDLRWSLGADGLSMPLIILTGFITTLAIL
FT                   AAWPVTFKPKLFYFLMLLMYGGQIAVFAVQDLLLFFLVWELELVPVYLILSIWGGKRRL
FT                   YAATKFILYTAGGSLFILVAALTMAFYGDTVSFDMVTIAGKDFPLKLQLFLYAGFLIAY
FT                   GVKLPIFPLHTWLPDAHGEATAPAHMLLAGILLKMGGYALLRMNMGMLPDAHAVFAPVL
FT                   VILGVVNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGMASFTDIGTSGAMLQMISHG
FT                   LIGASLFFMVGCTYDRTHTLMLDEMGGVGKKMKKVFAMWTTCSLASLALPGMSGFVAEL
FT                   MVFIGFATSDAYSPTFRVIIVFLAAIGVILTPIYLLSMLREILYGPENKELEEHHALVD
FT                   AEPREVFIIASLLVPIIGIGLYPKVATTIYDATTNKLTALVRNSVPSLVQQAKAKTPSF
FT                   SLYSLKAPEI"
FT   CDS_pept        complement(575763..576500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcyA"
FT                   /locus_tag="MAE_06540"
FT                   /product="phycocyanobilin:ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00476"
FT                   /db_xref="GOA:B0JPG5"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR022870"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JPG5"
FT                   /protein_id="BAG00476.1"
FT                   /translation="MIAVTTPEILPLLHPLIGQLATAILSHWENYLDLSPFELPEGLGY
FT                   VEGRLEGEKLIIENRCYQTPQFRKMHLELAKLGNGLDILHCVMFPRPEYPLPMFGCDIV
FT                   SGKAGISAAIVDLSPTSGDKTLPSAYNQALAALPGADFAQARDLPPWGHIFSQYCLFIR
FT                   PETAAEERQFLQRVTDFLTIHCKCARESQPLSGEEARIYLQGQRDYCSQQQKNDKTRRV
FT                   LEKAFGWEWAERYMTGVLFDLPD"
FT   CDS_pept        576712..579024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00477"
FT                   /db_xref="GOA:B0JPG6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG6"
FT                   /protein_id="BAG00477.1"
FT                   /translation="MVSSATRPRPSLKTLWQKIESSPLPETEESIILRILVQALVIVGI
FT                   IATDVATDSYTSIWAVPLSIIGGIWSWRRRKKRNIGAKFCIAIGMLVVLALFLGDIVAM
FT                   QDSRIALTQLLIQLQILHSFDLPRRKDLGYSMVIGLILLGVAGTISQTLAFAPWLILFL
FT                   LLSLPTLVLDYRSRLGLDNLNQSLPFFSRKSPRLATKKLVSPPNSPLSPKRFGIFFLTI
FT                   LLLGLTIFALMPRFPGYQIQSFPVNSPGGMENQDFEQGDRQIVNPGYVREGETGNGGVN
FT                   GGNSPTTGSGQLDSTFYYGFNPQINQNLRGSMTPQTVMRVRSQAPGFWRAMAFDRYTGQ
FT                   GWQISRDQEVEDLNRSSWSYRFFVPLPATQAKTHQVVQTYSIVSSLPNIIPALTSPQFL
FT                   FFPTRQVSLDRENSLRSPGGLAEGLTYTVISQVPERNRSQLRSAPETYPKSILKHYLQI
FT                   PAEIAPKVRRKTEELLAKSPTPLTSPYEKALYLAQALKQNYELKADLPFLAENEDLVSA
FT                   FLFRFQGGYADHFSTVLTIMLRSIGIPARLATGFAPGQFNPFTGFYVVQNTDAYAITEV
FT                   FFPGYGWYNFDPIPGHELIPPSFEQAEPFSVLKQFWQWVAGWLPSPVTGFLGLIWENVI
FT                   VTIGQLLAWLWRFISGSLLGGILGGLVGVVFAYAGWLGWGQFHRWRRGRRLAKLPPIER
FT                   LYQQMLGILTEAGYGKHPAQTPLEYAAAARRVQPPPVANIIEEIARAYVDWRYGGKSAN
FT                   IERLRQRFRELPKLVKK"
FT   CDS_pept        complement(579187..579408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00478"
FT                   /db_xref="GOA:B0JPG7"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG7"
FT                   /protein_id="BAG00478.1"
FT                   /translation="MSKLPSVSGKDCIKVLEKVGFYQKRRESSHVILRRDNPFSQVVVP
FT                   DHPKLAKGTLRSIIRDAELSVDQFITLL"
FT   CDS_pept        complement(579405..579611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00479"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG8"
FT                   /protein_id="BAG00479.1"
FT                   /translation="MRQVIVYRDEDGYWIVECPSLKGCVSQGKTKEEALINIKEAIAGY
FT                   IAALAEDGLPIPEDTLETFLAVV"
FT   CDS_pept        579940..580188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00480"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPG9"
FT                   /protein_id="BAG00480.1"
FT                   /translation="MTKYQTETLIKVPLDVAETYWNATEEERQKIAEKIAFYVQFSNLS
FT                   RKESLEKLYKTMDTIGQKAQERGLTTEILESLLNEDN"
FT   CDS_pept        580515..580979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00481"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH0"
FT                   /protein_id="BAG00481.1"
FT                   /translation="MSSCQVFEQSIQIKASATTVERCITDLELMRRWLNPVLVCEPIGD
FT                   WKTDIGGRSRFLIQIPLIQPTLKSTVIEREPGLIVWQFEGFFRGCDRWECQPNDGGTCL
FT                   INRFEFAIPNPVVGWGFQQFAAKWTKKDMEAQLRRLKRVAEEIYLLSATS"
FT   CDS_pept        complement(581053..581256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00482"
FT                   /db_xref="InterPro:IPR040278"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH1"
FT                   /protein_id="BAG00482.1"
FT                   /translation="MFLDELQPVVKELIQQPIAFFGGFASGLLRLKLSDDPLKKWLEEQ
FT                   GLVSFNDNNQDNGNSPQSISID"
FT   CDS_pept        581327..581842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00483"
FT                   /db_xref="GOA:B0JPH2"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH2"
FT                   /protein_id="BAG00483.1"
FT                   /translation="MTETPNTVKKSFRLTPFIFLGILLIWLGIRLIAPDSVSLFAGTRP
FT                   DYLGVREGKLAPCPVTPNCVSSQSQDQAHAIEPLSYQGSGEKAIEQLAKIIASQPRTKI
FT                   INQDSNYLYAEFSSQWMGFVDDVEFSLNPSKNAIDVRSASRLGESDLNVNRERVETLRK
FT                   LFSVISNQ"
FT   CDS_pept        581880..582377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00484"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH3"
FT                   /protein_id="BAG00484.1"
FT                   /translation="MFRPQPIPAKAGQESVWDYPRPPRLELSPKHLKIIFNGVIIADTK
FT                   SSYRVLETSHPPVYYLPPQDIKMEYLQATAEKSFCEWKGLAGYYNITVGDQQAINAAWY
FT                   YPDPTPEFQAIKNYLAFYPAKMTACYADGELVQPQPGNFYGGWITSDVVGPFKGVPNSW
FT                   GW"
FT   CDS_pept        complement(582494..582655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06630"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00485"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ7"
FT                   /protein_id="BAG00485.1"
FT                   /translation="MGIQPRGLNRQGNNNSHYYSTNDSSLVTQEPDTAKVVSPVLKQGV
FT                   GRRLPALL"
FT   CDS_pept        complement(582829..583032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06640"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00486"
FT                   /db_xref="UniProtKB/TrEMBL:B0JFJ6"
FT                   /protein_id="BAG00486.1"
FT                   /translation="MDSPGAKIRINHRQHPRAKRLTGSKQKLTELGLIAHTTISKAFPL
FT                   LCCGQYHPKGSTNGYRERSNPD"
FT   CDS_pept        583370..584251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06650"
FT                   /product="4-hydroxybenzoate-octaprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00487"
FT                   /db_xref="GOA:B0JPH6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH6"
FT                   /protein_id="BAG00487.1"
FT                   /translation="MTISQPDLEPTWMTIIRLLRWDKPAGRLILMIPALWAVFLAADGV
FT                   PPLPLIGVIVLGTLATSAAGCVVNDLWDRDIDPQVDRTRNRPLAARALSIKVGLIIALI
FT                   AFFCAAILALYLNFLSFCLCLAAVPLIICYPLAKRFFPVPQLVLSLAWGFAVLICWSAV
FT                   TGSLNSNTFILWGAVIFWTLAFDTIYALSDREDDLKVGINSSAIFFGKYAPEAVGVFFA
FT                   LTVGLLAWEGQKMQLSAFFWLGLGLSVIAWWRQYRLLRQSDLPKPVYGQMFGQNVWVGF
FT                   ILLAAMIGGSLY"
FT   CDS_pept        complement(584286..584852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00488"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH7"
FT                   /protein_id="BAG00488.1"
FT                   /translation="MIDVFYPIPKLLDTILTEIYAENRRKHEERMAELQVISNSSLRDA
FT                   YAQQLLLDRFLAPVENAQHSIQNAAKHAQYMAEVVNYYHRDHGCSQEQAQEISRQFRAL
FT                   AVKISQIDSLYDLKIIYQVVTVFTQQLSRFKHRERNYSWEREIRKGILNPLNTCIAVEK
FT                   NFQRRVAFMTGEPASAKVMGLLESE"
FT   CDS_pept        584979..585218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00489"
FT                   /db_xref="GOA:B0JPH8"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH8"
FT                   /protein_id="BAG00489.1"
FT                   /translation="MSNSKSSSVWDHKPRWCQPWSILLTGITLIAGCWFLTQRIWLTLL
FT                   LSIPILLWWFVFLILYPRTLQQQLNTERIGESID"
FT   CDS_pept        complement(585183..587483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06680"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00490"
FT                   /db_xref="GOA:B0JPH9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPH9"
FT                   /protein_id="BAG00490.1"
FT                   /translation="MSETKVINRESLLVNLRQQLRAGQQELADWQGGKMAISAVPGAGK
FT                   SHSLAVAAAMVIAREQLHAKKQLIIVTYTRSAAASIKAKIKQRLQDLQLSAQGFSVQTL
FT                   HGLALQLARRYPELSGLDLESSTLVIPTPSHRIIRNSVEKWLITDPIRYQKLLEGVEFD
FT                   GEETERLRRQSVLRTEILPSLAYTAIHELKSSGLSPQQVWELSHYTDDNYQILAIASGL
FT                   YQQYEILMRQKNYIDYDDMILGALRVLEEEKIRRQWQKSVFGVFEDEAQDSSPLQEKLI
FT                   TILAKNNDGEIPNLIRVGDPNQAINSTFTPADPVYFNWFCESCQSEGNLSTMNQAGRSN
FT                   TKIIEAANLVLQWVDRDWKQGKDNHKVTEAPFRVQAILPVSAEDPQPNPVKEGKGLEIY
FT                   QPDDIYQTVELIEKRLVKLLQENPQHNAAILVRENRQGHFFAQKFAHFYKSYQIRIFEA
FT                   NEIDRFSQIPAEMLKLLAFVERPHSPDYLKAALEVLQLRGLITAQDLNPLVTYPEQFLY
FT                   PTPLDPELKSNEKIARRYCCSLLKARLELPHYQLLSFFAMTLQYSGSELATLQKLTARI
FT                   YQETAGNSSLKNTINTLNEIIASERFEGVEEDNDDCYTRPGQLTIITMHKAKGLDWDYV
FT                   FIPFLHEDIIPGKPWVPNGAKFLADFTLAEVARAQIRAAVHQRYLNPDSIPIIPPPLSA
FT                   WLEAGQLKKAEEYRLLYVAMTRAKRLLWMSSEKKAPFRWNTFRGDESSQLQDKNPCPVF
FT                   PVLINAFPDSFCV"
FT   CDS_pept        complement(587826..588800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06690"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00491"
FT                   /db_xref="GOA:B0JPI0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI0"
FT                   /protein_id="BAG00491.1"
FT                   /translation="MANFWTPLHTRLETTVKKGQLLPKNASLLVALSAGQDSLCLGQLL
FT                   LDLRSRWGWQLAIAHCDHRWSSDRGLVTHVRKIAEIWQLPVYITTAPPMAETEAKARQW
FT                   RYQALQTIAQEQGFNYLLTAHTRSDRAETFLYNLTRGAGSDGLSALTWLTSLTSDIFLV
FT                   RPLLNVTRGETFAFCQSRELPIWYDRANENLRYARNRIRQELLPYLQTNLNPQIEKHLA
FT                   QTAEILEAESDYLDSIARDIFRQVIDLDQQRLDRSPLQILPLAIQRRVIRLFLAQYLPS
FT                   SPNFAEVESVVNLITGVNRDATSSLTGKIRVEVQQNWLYISYQ"
FT   CDS_pept        complement(588885..589832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="MAE_06700"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /EC_number="1.3.3.3"
FT                   /note="oxygen-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00492"
FT                   /db_xref="GOA:B0JPI1"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI1"
FT                   /protein_id="BAG00492.1"
FT                   /translation="MKSLQDEICQGLEEVDGQAKFIEDSWQRPEGGGGRSRVLREGAIF
FT                   EQAGVNFSEVWGKELPPSIAKQRPEAAGHQFYATGTSMVLHPHNPYIPTVHLNYRYFEA
FT                   GPVWWFGGGADLTPYYAFEEDASHFHRTFKQVCDQHHPEYYPVFKRWCDEYFYLNHRQE
FT                   ARGIGGIFFDYQDGLDPLYRGPFAESDAAIYSEKLSPQQPRNWEEIFSFINDCGRAFLP
FT                   AYVPIVQKRRSTEYGDRERQFQLYRRGRYVEFNLVYDRGTIFGLQTNGRTESILMSLPP
FT                   LVRWEYCYQPAPNTPEAKLYDVFLKPQDWVNWQG"
FT   CDS_pept        complement(590101..590889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06710"
FT                   /product="ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00493"
FT                   /db_xref="GOA:B0JPI2"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI2"
FT                   /protein_id="BAG00493.1"
FT                   /translation="MLPFRTKIAFYLEDVTTAIGLTVNLLILALILLSLGIYVAQTYPL
FT                   SATWQMWLRQLDWGILSLFSLEYLIRFWCAESKLGFVFNIFSILDLLSILPLFFGFFDI
FT                   RFFRIFRWFRILRVIRFFGSDLSIFRIKTSDQIVFTRILLTLFSIIFVYAGLIYQIEHP
FT                   INPQVYRTFFDAFYFAVVTMTTVGFGDVTPLSDGGKMVTVLMILTGVLLIPLQISTLTK
FT                   QLLKSGTQIDYPCPDCGLPRHDIDANFCKNCGAKLLKKPD"
FT   CDS_pept        complement(590969..591886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06720"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00494"
FT                   /db_xref="GOA:B0JPI3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI3"
FT                   /protein_id="BAG00494.1"
FT                   /translation="MPKIGIIYNDIKPIACKTAHQIQDQLLSRGWQVFMATGSGGLLGH
FT                   SKPSRPVCFTPIDQLVPPHFDQDLSFAIVLGGDGTVLSAARQLATLNLPLLTVNTGHMG
FT                   FLTEIYLNQLEPALELVLEGNYTIENRSMITVRLFREDTLLWEALSLNEVVVHREPLTS
FT                   MCHFEIQIGEHAPVDIAADGVILSTPTGSTAYALSAGGPVITPDVPVLQLAPICPHSLA
FT                   SRSLVFSDKETVNIFPATANRMVMVVDGNGGSYILPEDRINVQKSPYNVHFIRLQSTEF
FT                   FRILREKLGWGLPHIAKPTSVELP"
FT   CDS_pept        complement(591910..592887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06730"
FT                   /product="chaperon-like protein for quinone binding in
FT                   photosystem II"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00495"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI4"
FT                   /protein_id="BAG00495.1"
FT                   /translation="MKVLVVGATGTLGRQIVRHAIDQGHQVRCLVRSQRKGAFLKEWGA
FT                   ELVGGTLRDKSTIIAALEGMDAVIDAATARATDSASIKQVDWDGKVNLIQAAKTAGVDR
FT                   FIFFSILNAEKYPNVPLMEIKRCTEKFIAESGLKYTILRPCGFMQGLIGQYAIPMLDNQ
FT                   TVWITGESTAIAYMDTQDIAKFAVRALEVPETVGQSYPVVGSKAWKAEEIIEVCERLSG
FT                   KEGKIWRLPMGLLRFMRGISRCFQWTYNISDRLAFAEVLASGQALDAPMAEVYQVFGLD
FT                   PSQTTTLESYLQEYFSRILKKLKEIDFEKQKAQKKKKTPFKKKA"
FT   CDS_pept        complement(592949..593839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06740"
FT                   /product="LD-carboxypeptidase A"
FT                   /note="peptidase S66"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00496"
FT                   /db_xref="GOA:B0JPI5"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI5"
FT                   /protein_id="BAG00496.1"
FT                   /translation="MIIPSFLQPGAKVSLVATSGAVKELAALEKGVEIWRSRGYQVEFS
FT                   ENWSNRLGYLAGSDEQRRQALAQAWQDPDCQAILCARGGYGSARLLENWTWAKTNPKWL
FT                   IGFSDVTGILWSLAKQGICSVHGAVLTTLAQESPQSIDRLFSLLEGRPLAPLIGQGWGG
FT                   GKVRGRLLPANLTVATHLLGTSVQPTLEGVILALEDVTEAPYRIDRMLTQWRMLGIFSR
FT                   IKGIALGRFSRCLAASGSDSQTVEEVLKERLGDLGIAVIAELPFGHDGDNAALPVGTMV
FT                   ELDGDRGILEFFYPQ"
FT   CDS_pept        593898..594758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00497"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR022573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI6"
FT                   /protein_id="BAG00497.1"
FT                   /translation="MKTDSIFYRMFLDFPDSFFELIAQPDAIVSNYRFTSQEVKQLAFR
FT                   LDGLFLPLDHLENSPFYLVEVQFQKDEDLYYRLFSELFLYLRQYKPLSPWQIVVIYPSR
FT                   EIEREHPQQFEDLLSLARIKRIYLDELANDETPSLAIALIKLVTESESQAVNSAKILIK
FT                   QAQREVSDRLVQKNVIDLIETIIIYKLPQKSREEIEAMLELQDLKQTRFYQEAFGDGIE
FT                   QGIEQGIEQGIEQGIEQGIERGINLQKLKTIPLLQDLGLTPQQISERLDLTLETVLNYL
FT                   AQQQQ"
FT   CDS_pept        595060..595260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00498"
FT                   /db_xref="GOA:B0JPI7"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI7"
FT                   /protein_id="BAG00498.1"
FT                   /translation="MKLIGDISPSLDLFLLLFFWHCLIGGIATVIAINKGYPRLNWLIF
FT                   GLLGGTFTFFIALFLKKKPKI"
FT   CDS_pept        complement(595278..595736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06770"
FT                   /product="cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00499"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI8"
FT                   /protein_id="BAG00499.1"
FT                   /translation="MNSQLTSDHCMLPVIRSPRDYQVFRISAGDTNRLAIVFDSTVAGD
FT                   SLTVCVEIFDPHGRTPTHRHHFAVEMFFILKGEGMAICDGKPIPLGPGDSLLVRPTGIH
FT                   EIRNVGDGRLYALCFMVPNEDFSELIRNGIPEELDAEDLEVLMGTIKE"
FT   CDS_pept        complement(595785..596627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="MAE_06780"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00500"
FT                   /db_xref="GOA:B0JPI9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPI9"
FT                   /protein_id="BAG00500.1"
FT                   /translation="MSSLTAIREHIFAWGKRTYIMGVLNVTPDSFSDGGEFDNVENALL
FT                   QAMKMIEAGADIIDIGGQSSRPGAEEISLEAELSRVIPVITAIRQQSSIPISLDTTRAI
FT                   VAAQGIAAGADLINDISGGTFDRLLLPTVAKLAVPIILMHLRGNPQTMQSITHYDDLVK
FT                   EIKEFLQNRVKEALQWGIARENIIIDPGIGFAKTGTQNLELLRELGQFRDLDLPILIGL
FT                   SRKRFIGEITGKDDPKERVFGTAAACALAIAKGADILRVHDVAAIVDVSKVVDAIERS"
FT   CDS_pept        complement(596784..597356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06790"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00501"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPJ0"
FT                   /protein_id="BAG00501.1"
FT                   /translation="MERQMVNSDRQQLTSITTWKVKTIHPTITETEIQFHDITVDLQQV
FT                   HLIKSDLNNYDYTNTRRLAPLVKTLLFEINPKIASLVEKKNQLHRLRNLAASSEIFHSQ
FT                   TPLYDRAINQVQLIIDQAETLRQECLKFIRETLIERELVKSDIDTNLVDLPLDFASQYQ
FT                   LIQEKYQLWKEEVQAYFELKDSSLPKN"
FT   CDS_pept        complement(597742..598401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06805"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48272"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF87"
FT                   /protein_id="BAG48272.1"
FT                   /translation="MARREPNDRRKAVPNTSNSGVPSPPVDFDIYQDLARLQEMIFDSF
FT                   HIPLTRWTIIDEGQISEQIDLIYETVPPAVQKALAILQEEQEIITKAEEYAQQVLRSAQ
FT                   QRAAQILDESGIIQQAERQAAQIRQRVQQECESLQQQTLDEIEQMRHSTLQEVQQLRQK
FT                   TQAECHEIQKGADDYAEAVLEHLDRELGEMLQVIRNGRQQVRSKPTSSKNLPGERP"
FT   CDS_pept        complement(598438..598911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06810"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00503"
FT                   /db_xref="GOA:B0JPJ2"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JPJ2"
FT                   /protein_id="BAG00503.1"
FT                   /translation="MIAIYPGSFDPVTLGHLDIIERSVPLFERVIVAVLCNPHKNPLFT
FT                   VEKRIEQISYCTKHLKNVEIDSFSGLTVEYARLKGAKVLLRGLRVLSDFEKELQMAHTN
FT                   KTLWEGIETVFLATTKEYSFLSSSVVKEIAQFGGSVTHLVPENVSRDIYSYYS"
FT   CDS_pept        complement(598908..599192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00504"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPJ3"
FT                   /protein_id="BAG00504.1"
FT                   /translation="MAKAIWNGAVVAESDNCEIVEGNYYFPPDTIKAEYFQSSNTHTIC
FT                   SWKGEASYYTLRVNGQDNKDAAWYYPDPKPKAQNIKGYIAFWRGVQVEK"
FT   CDS_pept        complement(599226..599543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06830"
FT                   /product="thioredoxin M"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00505"
FT                   /db_xref="GOA:B0JPJ4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPJ4"
FT                   /protein_id="BAG00505.1"
FT                   /translation="MAVKKEFSSFQELLQSTNLPVLVDFYATWCGPCQMMAPILEQTGM
FT                   YFKNRLQIVKIDTDKYPNLATKYGIQALPTLVVFKNGQPIDRIEGVVQVNQLVQHLQTL
FT                   L"
FT   CDS_pept        599676..600521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06840"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00506"
FT                   /db_xref="GOA:B0JPJ5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPJ5"
FT                   /protein_id="BAG00506.1"
FT                   /translation="MNILTKLLFPETKTPEQVGSPRVQKSRRGIETKSAAEIVIMRQAG
FT                   KIAATVLKEIAEIAQPGMTTADLDAYAEQRIREMGATPSFKGYYGFPASICASVDNEVV
FT                   HGIPSPKKRLKAGSVLKVDTGAYYQGYHGDSCITIAIGSVSPKTEKLICVAEEALYKGI
FT                   NQVKAGNYLLDIAGAIEDHVQANGFQVVEDFTGHGVGRNLHEEPSVFNFRTNQLPNVKL
FT                   RTGMTLAIEPIVNAGSKHTRTLRDRWTVVTMDNALSAQFEHTVLVTATGYEILTERNNL
FT                   "
FT   CDS_pept        600612..601013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06850"
FT                   /product="universal stress protein UspA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00507"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0JPJ6"
FT                   /protein_id="BAG00507.1"
FT                   /translation="MFKNIVVALDCGELSDRVLDSLNSLSLTANSCLILTHILGKEGDE
FT                   SPVDRPHPSREIIEDQLRCYQSQIAAPSEIEVIFGDPAEEIIRLANIYHADLIVIGSRG
FT                   LTGVQRVIEDSVSSLVVAEATCSVLVVKA"
FT   mobile_element  601064..601266
FT                   /mobile_element_type="MITE:MaeMITEa019"
FT   CDS_pept        complement(601104..601307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06860"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00508"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ49"
FT                   /protein_id="BAG00508.1"
FT                   /translation="MQILIRSDAQDYLGFAAKSFSWVQGVGCGVWGFTDFEVVSYLIFR
FT                   EKVPEFYPRSLQWSALFEVKKV"
FT   CDS_pept        601665..601889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00509"
FT                   /db_xref="InterPro:IPR021231"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ50"
FT                   /protein_id="BAG00509.1"
FT                   /translation="MNTSVSILAEIPEILHQSLQQYLETHPGWDQDGVFTAALSFFLLN
FT                   CQSSERMNFEEQNSCAKVYLETLFQRSEC"
FT   CDS_pept        601939..602565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="MAE_06880"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00510"
FT                   /db_xref="GOA:B0JQ51"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ51"
FT                   /protein_id="BAG00510.1"
FT                   /translation="MNSDKTPNLIIPQLIIGLGNPEPKYDRTRHNIGFEAVDSLARDWG
FT                   LSWQENKRFQGFIAEGDSPLPGKIRLLKPQTYMNRSGQSVRSVLDWYKLAPESILVIYD
FT                   DMDLPLGRLRIRLSGSAGGHNGIKSMIAHVGTENFARLRIGIGKSTEKATISHVLGRFT
FT                   PQENEVILKVLDLSRKAIELGLKQGLQKAMSLYNNQSVEIGSDLC"
FT   CDS_pept        602700..605027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06890"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00511"
FT                   /db_xref="GOA:B0JQ52"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ52"
FT                   /protein_id="BAG00511.1"
FT                   /translation="MINRQSLLRFAHKFNLILLIIATVFCLWSNAAFAHRPHDVISQLE
FT                   VSPDFQTDNTVYILVRNNFYKSRDGGSNWTRLIQGLDYTGELSSLSLSPLNKNILYLAS
FT                   RSDGIYKSEDAGESWQKVNQGLETKFINFLEIAPSDPNIVAAVGLEKGVYLTEDGGKNW
FT                   SNIFPTTALITSLAITPNNPDRIFFGDEQGKLYSSSDGGKTWQNLPLPANVGAVDTIAF
FT                   SPNLDSDKTFFVGTKEAGIFKTVDDGKTFQVVNEGIKDKIIEDIVISPQYAQNSTLYAI
FT                   TWYEGMYVSQDGGKSWTKMSEGLTKDKQADDYKVPHFMDLKIVQDTMFLGGFNGLFKTT
FT                   DSGKQWQEIETLARGTVIAMAVSPNYAEDGTVVMANYVGNIFISRDKGETWTPINRGLE
FT                   VYRLGKDPEESGQDPRRFFDIAFSPNYGEDRTIFAGFLRNKFAKSDNSGDFWKIIEIDE
FT                   GVRGPRIVPSPDFAKDKTLFLTNQQGRIFRSTDGGNTVKNISEVGRISGNYAPAMVASP
FT                   DFAKDKTLFVTGKEGIYQSVDGGLTWKNVSQGTPLSKTPNVQLAMSPNYPSDGTIFAGT
FT                   ISGLFVTKDGAKSWTKLEKPGFNPQASVETIAISPDYANDRTVIVSLQGNGLFKSTDGG
FT                   ETFKSIGDPKIPLVKIHSIPSSGISVQFSPNYAQDKTLFGFGGAKTTVFRSTDGGETWT
FT                   SVTIPPHAEENTPRYKIGEFFSGPLGTILRVVIPILLAIAAYFLVGFLKLEKVINLPKS
FT                   FFRMAGAFMVFLFVFFAIISQV"
FT   CDS_pept        complement(605148..606551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06900"
FT                   /product="fumarase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00512"
FT                   /db_xref="GOA:B0JQ53"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ53"
FT                   /protein_id="BAG00512.1"
FT                   /translation="MTEFRIEKDSMGEIPVPADKLWGAQTQRSLQYFSIGDNLMPREMI
FT                   GSYAILKKACAIVNQQKNRLSQERKNLICQVCDEILAGQHADNFPLYVWMTGSGTQFNM
FT                   NINEVISNRCSQLTGNPLGSKTPVDPNDHVNMSQSTNDSFPSAMYIAVALAVKEKLIPS
FT                   LQLLRNSLDEKAQLWANIVKIGRTHLQDATPLTLGQEFSGYVGLLDDGSDWLEKCLEKV
FT                   YRLSLGGTAVGTGINAPPDFDRDVAAEIANLTKLPFITAPNKFTVQGSHDALVFLSGGL
FT                   KTIASSLYKIANDIRLLSCGPRCGLGELQLPENEPGSSIMPGKVNPTQCEALSMIALQV
FT                   MANDLAVTMGGAGGHLEMNVYKPLLIHNLMQSIRLLTDGCANFCQFLVKGMTANQKQIE
FT                   TFLNQSLMLVTALSPVIGYQKAAYVAHYALEKDLTLKVAALQLGYIKEADFDRIVDPAK
FT                   MVNPYVADG"
FT   CDS_pept        606795..607082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06915"
FT                   /db_xref="EnsemblGenomes-Tr:BAG48273"
FT                   /db_xref="GOA:B3DF88"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B3DF88"
FT                   /protein_id="BAG48273.1"
FT                   /translation="MDTAIALSWTLAIILGLMTLLFILRIVLTWNPQVDLNSFPFNIIA
FT                   WPTEPFLIPVRKLIPPLGGVDISPIIWVGICTLLREILLGQQGLITMALK"
FT   CDS_pept        complement(607087..608211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06920"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00514"
FT                   /db_xref="GOA:B0JQ55"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ55"
FT                   /protein_id="BAG00514.1"
FT                   /translation="MYTGTAAGEIIGLSDRIVKDLDGFVREPDSRNVEYTTAPMTNYDR
FT                   LLCATLKPRLALRRYLRRLGDYTLIPGSTLSLGDSQHFYRSDPHNPYHDYIEQTYGTNV
FT                   VTASIHINVGISDYEDLMRACRLIRLEAPLYLALSASSPFLDGKITGSHSRRWQVFPQT
FT                   PAYVPLFESHQHFVTWTEEQLKLGTMQNVRHLWVSVRPNGSNRPYNLNRLELRICDLIA
FT                   NPISLLAVMAFLEARLTQLLQAPQLDPLILSQLPSSNRSEDLLTLTQENEQAAARFSLD
FT                   ATLRHWYDGREILARDWIKDLYVQVYPIAKEKGFSCFLSPLQKILREGNTAQQWLKQYD
FT                   QGMDVKSIIKQAIITLEEQERELEHKLCQHILVA"
FT   CDS_pept        complement(608281..608673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00515"
FT                   /db_xref="GOA:B0JQ56"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ56"
FT                   /protein_id="BAG00515.1"
FT                   /translation="MCILGFDPGKDKCGIAVRSSTGKIYTHEVIASSQAIERLASLCQQ
FT                   YPLELLVMGNQTTSKSWRQKIAARITIPITLVDERNSTLEARDRYWQMFPPKGLQKLIP
FT                   QGMRLPDRPIDDIVAILLIERHLQSK"
FT   CDS_pept        complement(608800..608955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06940"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00516"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ57"
FT                   /protein_id="BAG00516.1"
FT                   /translation="MLGYNPTPYTPHPPPRRNFLPQTLVMNSTHLVDFCLTIEMANSPQ
FT                   ICLNRG"
FT   CDS_pept        complement(608974..609402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00517"
FT                   /db_xref="GOA:B0JQ58"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ58"
FT                   /protein_id="BAG00517.1"
FT                   /translation="MTKMRGKMTLTLNRDTYGRLLAEYLPKVIENDAENEQAINLAEAL
FT                   SHRENRSLEETTLLNLLLTLIEKYEQDHYPLEESEPHSILWELMEANNLQEKDLSDILG
FT                   SKTIVSDILIGQQIITEKQAVKLGQFFHVDSSLFLSTQ"
FT   CDS_pept        609803..610123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06960"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00518"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ59"
FT                   /protein_id="BAG00518.1"
FT                   /translation="MPKSPIILKPRSEAICLPALSSKIINSASICSASKIASCSPGSSF
FT                   YNPDLEDVLTISIRSQSGGLAIQLRTIDGDSEAFNSSATASGMTTSSYSSCRIIIWSIK
FT                   SR"
FT   CDS_pept        complement(610152..610454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00519"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ60"
FT                   /protein_id="BAG00519.1"
FT                   /translation="MIELTGSDSDNFMQITVDIPDEIAQRLGQTGDNLAHKLLEMVIAD
FT                   AYRAGILSTAEVGRILQLPSRLETHAFLKRMGVYLNYDETELERDLQTLKELRAK"
FT   CDS_pept        610589..610744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06980"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00520"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ61"
FT                   /protein_id="BAG00520.1"
FT                   /translation="MRPYHWRNNIIVGANCLRPQGLRQKVFCGGGVWGRVVSFPQMSFS
FT                   AIQQSF"
FT   mobile_element  610776..610981
FT                   /mobile_element_type="MITE:MaeMITEe001"
FT   CDS_pept        complement(611138..611488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_06990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00521"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ62"
FT                   /protein_id="BAG00521.1"
FT                   /translation="MIARFAPTVDFFTTDRCYADARRYLPILFEKRDLGSEDAMAVLEG
FT                   LTGWVRIVDNSLYASYEGEARKRIAARDVDDWPVVALALLLECPIWTEDADFFGTGVAT
FT                   WTSNLVHLYFGE"
FT   CDS_pept        complement(611921..612175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00522"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ63"
FT                   /protein_id="BAG00522.1"
FT                   /translation="MLEKIGMGEFRDHLAKYLSSTTPIAVTCQGQTVGYFLPARPEPSE
FT                   AEIDGLKRAAERLDALLREQGLSEDALVREFRQLREGER"
FT   CDS_pept        complement(612272..612511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07010"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00523"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ64"
FT                   /protein_id="BAG00523.1"
FT                   /translation="MNAKLIESLVQIIQSLSEEERLLLEKKLAAHETQTDFDNLAQALA
FT                   ELRQICAEENYTIEVPPRQDRSNPFAESLNDIPV"
FT   CDS_pept        complement(612587..614380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00524"
FT                   /db_xref="GOA:B0JQ65"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ65"
FT                   /protein_id="BAG00524.1"
FT                   /translation="MTTINLANLVIDIRDENKELQEQFYQQIQGQINRAKQPLGLDFSN
FT                   SLIQGNFIASRLGLPTPLTKVALATLLSPTEEQLLQQDENFLFDSDEPVFNVTVFRGPV
FT                   KLQGTVFMGEVDFSKTFFLQIVEVMEAKFSRESNWVESRFARVAKFTKATFMGDVNFSQ
FT                   SQFLNKAIFRTAHFKSITNFHRSHFTAEAYFDQTKYDKPADFTRTFWEKEANFSQSQWR
FT                   DRPLFSKSRFLSLLTFRNATFEKSGAFRSSYFNGVVSFQDVKLLDQVDFSNSTFTKNSY
FT                   LSVSGLAFDSDKAKILGDRGVIGQAIYLPTLTGNETVLRNLVRNFRSLEQIADANQIEY
FT                   KTEKLRFQQLKQKLNNISVIRLINLTWVADFLHTSFLALLLLLSQDGTNFSLVFGTGII
FT                   IFAYFGCLFWLIDRVRRLTPKPVIPNRYEIFCMVTSYIILTLSGVFNILQSASRPLLTL
FT                   TAIALILVPLPLILVIELYRRGRYHDLMDSSYFLQDGSMRQLRLLITRLPVVPEFPLFR
FT                   DRYTPIPWQKRWNWLNYYDLSLNNLLKLGFNDWRVRDQELPAIISFLVWYQWGIGIFYI
FT                   TLLIWTLSRTIPGLNLLIYLK"
FT   CDS_pept        complement(614539..614823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00525"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ66"
FT                   /protein_id="BAG00525.1"
FT                   /translation="MNNGRLVWNHSTHIPGLIAVLEKLITYQGITTVTPGVLSRSKGHC
FT                   PRLQLRISVPIRGGFKLIARTGKSVQEVFVITDLNQEDLEMAIQACLGK"
FT   CDS_pept        complement(614826..615119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpS"
FT                   /locus_tag="MAE_07040"
FT                   /product="ATP-dependent Clp protease adaptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00526"
FT                   /db_xref="GOA:B0JQ67"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ67"
FT                   /protein_id="BAG00526.1"
FT                   /translation="MSSAPSTTLDKSTQVVKKTYPNYKVIVLNDDFNTFDHVANCLIKY
FT                   IPDMTTDRAWELTNQVHYQGQAIVWTGPQEQAELYHQQLRREGLTMAPLEAA"
FT   CDS_pept        complement(615175..616308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sqdX"
FT                   /locus_tag="MAE_07050"
FT                   /product="sulfoquinovosyldiacylglycerol biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00527"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ68"
FT                   /protein_id="BAG00527.1"
FT                   /translation="MRIALFTETFLPKIDGIVTRLKHTVEHLQRLGHQVLVFSPDGGLK
FT                   DYKGAKIHGVTGIPLPLYPELKMAFPRPSVGQALERFKPDIIHVVNPAILGVGGIYFAK
FT                   TMNIPLVASYHTHLPQYLQHYGLGSLEGLLWELLKLAHNQASLNLCTSTAMVQELSSRG
FT                   IEKVELWQRGVDTELFQPHLKSPAMRLKLSQNNPDSPLLLYVGRVSAEKEIDRIKPVLE
FT                   AIPEARFAIVGDGPHREALTSHFADTNTHFVGYLQGLELASAFASADAFLFPSRTETLG
FT                   LVLLESMAAGCPVVAANSGGIPDIVTDGVNGHLFDPRDEKGLISATQRLLTAKAEREEL
FT                   RRNARLEAEKWAWQAATKQLLNYYHRVLNNNTVAFAA"
FT   CDS_pept        complement(616404..617066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07060"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00528"
FT                   /db_xref="GOA:B0JQ69"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ69"
FT                   /protein_id="BAG00528.1"
FT                   /translation="MFISTDEVHLYFISLDPSGDRLETLASLLSEDEIIRANRYHFPEH
FT                   KRRFLVARGCLREILGSYLAISPEKIEFIYSERGKPSINYQLQFNLSHSEEMAICGLTL
FT                   TARIGVDLEKMRQMKDLDSLTKRFFCAREHELVEKSAEKEKLFFQLWTAKEAYLKAVGT
FT                   GISGGLDRVEVGLNPLKLDNVAGEWQLWTAAIGDNYRATVVIEGSDRVIKTFGLSDL"
FT   CDS_pept        617177..618118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00529"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ70"
FT                   /protein_id="BAG00529.1"
FT                   /translation="MNFFHTEDHLQQFGTDILETTWREFPQLAQEQIALTWIVYDPPVI
FT                   VNTGGAISHEEFWKYSPRGFSYRGQERTYPASLVKLFYLVAIHEWLEGGMIPENTELNR
FT                   AIRDMIVDSSNDATSLVVDLVTGTTSGPEIAAGPFETWKQQRNIVNRYFQSLNWPELAT
FT                   INVNQKTWSDGPYGRERAFLGELMENRNMLTSNAVARLIHTIIGGIAVSSQRSQMMMSL
FT                   LKRSLNPADWTSQGDETQILGFLGQGLPENSQIWSKAGWTSQVRHDAAYIEIPHHTPYL
FT                   LVVFTEGKDNSQNRSILPFISQKVAEKIMQIH"
FT   CDS_pept        complement(618163..618321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07080"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00530"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ71"
FT                   /protein_id="BAG00530.1"
FT                   /translation="MMTAFPVKVKHRLNPYLIKYFSCKNEPHLSQKSCILRCTSVNLRI
FT                   YCSRMFI"
FT   CDS_pept        618497..619846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00531"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ72"
FT                   /protein_id="BAG00531.1"
FT                   /translation="MTFNPHHCHNEREVESKLIVQYLLPKLGYNAEHWYQQVSFGKVRL
FT                   DFLVSAQKPINKKQFLPSHCLIIEAKNPREKLINHRHRLGYYLDYFKVQWGLLTNGDEI
FT                   QLYRRKPDKIYLVFRCSGLEIAAHLEQLKSLIGYETLSLGIPPLNSPIINHRNPMKTIA
FT                   IYHHKGGVGKTTVATNLAAALSKKGKRVLLIDIDAQANSTFAVGLIKFQFDDDDDLKDK
FT                   NVFHLLDNSNRIFIENIVRKSQGFNHPEIDVIPSHISLIANQAKIKDNAAVFARLARKL
FT                   EKVNDQYDIVIIDAPPALDLYARIALIAADYLIIPSDLKPFSNQGLDSVKNFVQEEINE
FT                   SRGDLGKPTLQILGVLPSKISTHAQYLKYNFPKQKQVIPDKYGLPLMESIISERMPLSR
FT                   CINQYVTVGDLEIPAPQSIIDYAEHQADAGVSAAEFEALALEVLAKIGVK"
FT   CDS_pept        619847..620536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00532"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ73"
FT                   /protein_id="BAG00532.1"
FT                   /translation="MWKFLRVDITDINPSVPRETFSETELENLANLIIEMGGLIRPAIL
FT                   KKADNKKVDERYNLISGDLEYYASVIANQKVPDIEMINAFVVDKEAENIALQQIQLLSP
FT                   SPGLITTPEKTDNPLELRVSNLEKRLETQLQAIREEYQKEIKRLEEKIIILPPPPPASK
FT                   SILELLNTCDANQLKKAGIPPASVNDFLKKRSEKPFDSLEDVLNRPVSGVKEKRLIKLV
FT                   DYLLTSN"
FT   CDS_pept        620815..621513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00533"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ74"
FT                   /protein_id="BAG00533.1"
FT                   /translation="MTTTPVIAASLTIPPLENGDKLTRWEFERRYQGMPHLKKAELIEG
FT                   IVYMASPLRFESHAEPHANIVGWLALYKAATPGVRLGDNATVRLDIDNEPQPDALLRID
FT                   KGGQSTISQDDYVEGAPELIVEIAASSASYDVHQKLNVYRRNQVQEYLVWRFYEQEIDW
FT                   FRLQAGEYIKLEPDSDGIMRSQIFPGLWLDKNALLMGDLGKVLVILQRGLETPEHQDFV
FT                   NKLTSDRSQV"
FT   CDS_pept        621731..622423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00534"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ75"
FT                   /protein_id="BAG00534.1"
FT                   /translation="MTTTPVIAASLTIPPLENGDKLTRWEFERRYQGMPHLKKAELIEG
FT                   IVYMASPLRITQHGEPHAHIMLWLGFYKAFTPYLQLGDNCTVRLDIDNEPQPDALLRID
FT                   KGGQSTISQDDYVEGAPELIVEIAASSASYDVHQKLNVYRRNQVQEYLVWRFYEQEIDW
FT                   FRLQAGEYIKLEPDSDGIMRSQIFPGLWLDKNALLTGDLGKVLVILQRGLETAEHRDFV
FT                   NQLTANHS"
FT   CDS_pept        complement(622500..622685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07130"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00535"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ76"
FT                   /protein_id="BAG00535.1"
FT                   /translation="MGASDFYQSTELGFLKGNYLLKLVLLPILSLNPSFWGVLPPKPRS
FT                   ALVFRWDAYTQLLTYL"
FT   CDS_pept        622806..624230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrA"
FT                   /locus_tag="MAE_07140"
FT                   /product="DNA photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00536"
FT                   /db_xref="GOA:B0JQ77"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ77"
FT                   /protein_id="BAG00536.1"
FT                   /translation="MSNLILFWHRRDLRLSDNIGLSKARERSPKIIGVFCLDPAILEGD
FT                   DIAPARVAYLLGCLEELEKNYHQKGSQLLIIRGNPSQTLVNLAGNLSAKAVFFNLDIEP
FT                   YARQRDQQVIAALQTKGIEVETFWDQLLHAPGQVLTLSKSPYTVYTPFWKNWSQLAKAS
FT                   PKTLENLQGLDENEGEKLTETINLPTLENLGFTWQNPLPLTPGEKAAHSRLEEFCQGVI
FT                   NNYQEDRNFPAFDGTSRLSAALKFGAIGIRTIWTATLELLENCCAQEAKDSIITWQQEL
FT                   AWREFYQHCLYFFPELAVGAYRKEFRHFPWQDNEEHFQAWCQGKTGYPIVDAAMRQLNE
FT                   TGWMHNRCRMIVASFLTKDLIINWQKGEKYFMQKLFDGDLAANNGGWQWSASSGMDPKP
FT                   LRIFNPASQTQKFDPEGEYIRQWLPELASVDTEYLVTGKIPRLERHRCGYPEPIVDHNQ
FT                   QQKEFKRLYSNQKPKR"
FT   CDS_pept        complement(624237..626882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07150"
FT                   /product="cation or drug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00537"
FT                   /db_xref="GOA:B0JQ78"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ78"
FT                   /protein_id="BAG00537.1"
FT                   /translation="MKESWRERLNISRIAINAPRLTIAFWLAVAMAGILAFSSLKYALF
FT                   PDISFPVVIINAQADLATAITTEKQLTKPLENPLFSLPGCRDVSSTTAPGQSVISVFFK
FT                   IGTNLDKATAAVKQAISQIPLPPQATTEVIPVDLNESATVTYALVSEQKTLEELSQIAQ
FT                   DNLIPPLKALPGTAKVNLLGQGTVREDNPHKSLTRPLPTLVRFNGQEAIAVQVIKQGAA
FT                   NSLDLAAVAEKLVKDIAQKLPDVKIILAETQAEYIRAALQGTIDDLLLAVLLSVLVILI
FT                   FLGSFAATIISALVIPLSLLGTFIIMAIYGFNLETLTLLALALVIGIVVDDAIVDVENI
FT                   SRLIDAGETPKNAALKGTREIGLAVTASTLTIVAVFIPVAFMGGAVGQFFQPFGLTVSA
FT                   AVIFSLLIARTLSPVLAVYWLKPQSRAKMTKQKRPIENAYRRLLNWSLRHRLLVIAIAL
FT                   ITFFAGIALIPFISRGFIPRLDRGEFNLVYTSPLPKITQISPNKPTAKSSTDSFAWISQ
FT                   LASSPESFLLRRTIRDGSKLEAPILQDGEVESTFMIAGLRGEPNRGKIHVKLKSDRRSH
FT                   TSAVQQRIRQILPTIRGVNVSVEDIPFVQTEAEKPIQIAIKSDDFKLLRDSAEKLRVEA
FT                   AKIAGLKDISLSSRLNERGDFLAIERLNGQQAIFLSANLSPDLGLEDAAIKIEGIPLPE
FT                   GITLQRWGTSSQSSDVLGSFGRTLILATILMLGVLWLLFRRLLETIVIALCLPLAIVGA
FT                   MLGLLVTGSEFSMISLIGFIFLLGLLDKNAVLLLDYTNQLRQQGWSREEAVLETGMIRL
FT                   RPILMTTCSTILGMIPIALGLGTGAELRQPMAMVIVGGLVTSSLLSLIVVPVLYLSLED
FT                   VWNQIKAGQK"
FT   CDS_pept        complement(627529..627681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07160"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00538"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ79"
FT                   /protein_id="BAG00538.1"
FT                   /translation="MKKFSPPQMKEVFFPTPHTPHPTPSFKSGDSETGDCFYLFSPLPH
FT                   SPTLQ"
FT   CDS_pept        complement(627706..628743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="MAE_07170"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00539"
FT                   /db_xref="GOA:B0JQ80"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ80"
FT                   /protein_id="BAG00539.1"
FT                   /translation="MTTPDWPNLLQQLLDRKSLSLNQAEELMTGWLNGQIPEVLSGAIL
FT                   AALQAKGVSAAELAGMAGVLRQQSRLEDPKPHTTPVIDTCGTGGDGAATFNISTAVAFV
FT                   AAAGGVKVAKHGNRSASSKVGSADVLEYLGVNLSAPSEKVAAALDGVGVTFLFAPGWHP
FT                   ALKSVANLRKTLKVRTVFNLLGPLVNPLRPTGQVIGVYDRQFLTPMATALAQMGTPKAI
FT                   IVHGREKLDEVGLGDLTDMALLNNGEVISAAIDPLSIAIPRASLNALKGGEVPENAEIL
FT                   KNVLQGGGTPAQRDAVAINASLALQVAEKVTFGDHAAGFALARDILASGLAWQKLEELV
FT                   KFLAA"
FT   CDS_pept        complement(628823..629350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00540"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ81"
FT                   /protein_id="BAG00540.1"
FT                   /translation="MNESDTLANLQQLEYIPYLDATGNISADFQGKIGVYAIFDREQVL
FT                   EFVGYSRDIYLSLKQHLARQPQACYWLKIQLIDRPNRTILESIKQAWLRESQAVIDNEK
FT                   LWTEPIDAKLAMTETEKEFYQSADELGQIKLLKQLSRRVENDILSTLEKRGVQMEIRFN
FT                   PKLKEQGLLDLK"
FT   CDS_pept        629932..630552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00541"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ82"
FT                   /protein_id="BAG00541.1"
FT                   /translation="MKVSARTQQRLVHRHQFAEEESGNPVQEISLDGGKVRLRTETKGE
FT                   ACIWKDYQAICVDTFLRKAWFGENESLIYWVNQQPLSDPLTCLGDGHPGIGKIVKNWDC
FT                   PGEKREILDWFHLVENLHKVGGSVKRLKKAESLLWQGKIEETIALISPLKNERAENFCR
FT                   YLEIHRHRIVNYNYYQQEEMVLRYLVSHIPHPQLSHNTKFLNP"
FT   mobile_element  630499..632665
FT                   /mobile_element_type="insertion sequence:ISMae31_11"
FT   CDS_pept        630760..632418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07200"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00542"
FT                   /db_xref="GOA:B0JQ83"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ83"
FT                   /protein_id="BAG00542.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   DVSGIFLLISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKNSAQEKIRQLSRREFENRA
FT                   VALAIAKGLSDSLKSHQLTEIKVNLIPPESQGSKLKSKDDLPSQSYQVQAELELNLTAI
FT                   ERLKKRAGRFVLATNDLEKQRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLSLKQQETGLKNPLGKLTDRPTLRWIFQGFQGIH
FT                   LVRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   mobile_element  complement(632665..632834)
FT                   /mobile_element_type="MITE:MaeMITEb011"
FT   CDS_pept        632744..632989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00543"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ84"
FT                   /protein_id="BAG00543.1"
FT                   /translation="MKTIGKNRSNVFLYKGFIPYNSRPLHNTNRRTEEICSIASGAVES
FT                   TVKQIDRRLKISGAQWNEENIPQVLKHRCAYLNNSL"
FT   CDS_pept        complement(633004..633273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07220"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00544"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ85"
FT                   /protein_id="BAG00544.1"
FT                   /translation="MSKVLRESWFKTLHLHRRLRPLGAKHSDRKSTVSAIGYCPNASPL
FT                   LFQQALINAKFCLARLHNSNRQGGNLAGTDLGGALWEQVSFVRT"
FT   mobile_element  complement(633136..633339)
FT                   /mobile_element_type="MITE:MaeMITEe002"
FT   mobile_element  633621..633803
FT                   /mobile_element_type="MITE:MaeMITEc004"
FT   CDS_pept        complement(633809..634153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07230"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00545"
FT                   /db_xref="GOA:B0JQ86"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ86"
FT                   /protein_id="BAG00545.1"
FT                   /translation="MSVIALCLLNHESSLFALVPLIIFCFPKKEIFQALLAILFYLLIW
FT                   FATRGSMANALATHSEVSVFKIFLENWQLGMMGIFFSYKLLWLVFALLSYFLLIKKENM
FT                   LFLSLLSMIV"
FT   CDS_pept        complement(634754..635185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07240"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00546"
FT                   /db_xref="GOA:B0JQ87"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ87"
FT                   /protein_id="BAG00546.1"
FT                   /translation="MNIFTAPLSERYRKYVSFNTYVPNVAISNVLLWSAIIISYCIVNA
FT                   PKDKLSGALTKLLSIFKEYLNVTSLQNTILYQILIPLKGLLFSVSFLIIISPLIIDLFN
FT                   SKSVWKKIKIRYLACVALIIFIILSLLVSSRAKLISWLG"
FT   CDS_pept        complement(635486..635803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00547"
FT                   /db_xref="GOA:B0JQ88"
FT                   /db_xref="InterPro:IPR021995"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ88"
FT                   /protein_id="BAG00547.1"
FT                   /translation="MNKESLFAISLFPYLGFLWFVTRSGKMPLLALIGFYVLLIFVFIT
FT                   IPAGIYAKIHYGQELANVDWLHGSAELFLTLSNILVVLGFRQAILAKKETEKGEKIISP
FT                   K"
FT   CDS_pept        complement(635796..636107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00548"
FT                   /db_xref="GOA:B0JQ89"
FT                   /db_xref="InterPro:IPR019634"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ89"
FT                   /protein_id="BAG00548.1"
FT                   /translation="MNALSIPTWIVHVSSVVEWIAAIWLVWTYGDISSDRSWRMLSWGM
FT                   LPALIGAMCACTWHFFDNISALSWLVTLQAAMTVLGNFTLCAAGWWLWRSSKISVNNE"
FT   CDS_pept        complement(636265..637245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="MAE_07270"
FT                   /product="glutathione synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00549"
FT                   /db_xref="GOA:B0JQ90"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ90"
FT                   /protein_id="BAG00549.1"
FT                   /translation="MKLAFIIDPIEYLDPGHDTSVAIMEASQLLGHEVWMTSITDLSAI
FT                   AGKAWAKLTKIELVPVELKDNHWEAVSQWYQRQETVFTCLENFDFVWMRKDPPVTIAYL
FT                   YATYLLDLIDPQKTQVINSTRGLRHANEKLYTIHFAQVMPATIVSQDKATIREFVNQKG
FT                   AAVMKPLGGKAGEGILFLSPEDRNLNSMIEISTKWGQEPVMIQDYLPAAKEGDKRIIVL
FT                   NGEPIGAVNRIPTGSEFRGNMAVGGRVAKTEISDQELEICATLAPKLREDGLYFVGLDV
FT                   IGGYLTEVNVTSPTGIREIDRLNNVSLGQQVIKWLENFACAKALS"
FT   CDS_pept        complement(637261..637521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07280"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00550"
FT                   /db_xref="GOA:B0JQ91"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ91"
FT                   /protein_id="BAG00550.1"
FT                   /translation="MAANVEIYTWSSCPFCIRAKALLKKKGVEFTEYCIDGDERARAKM
FT                   SDRANGRTSVPQIFINDQHIGGCDDIYALDRSGGLAPLLQN"
FT   CDS_pept        638077..638433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00551"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ92"
FT                   /protein_id="BAG00551.1"
FT                   /translation="MTPIQLLDVSYKDCPPELAEGSVTSGGTSFPANCFLITGKAKNNS
FT                   GKTVYDADVFGRIYDANGEPALQNRSRVGAIPEVPPGISDFEIRISVSTNQPTPLRLEK
FT                   FKASGFTSSVDPRI"
FT   CDS_pept        complement(638430..638717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00552"
FT                   /db_xref="GOA:B0JQ93"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ93"
FT                   /protein_id="BAG00552.1"
FT                   /translation="MSDIGFILTIINNFLQIYSVILIVRVLLTWFQNAGWAYQIMSFLS
FT                   PITDPYLNLFRSIIPPLGGMDLSPILAFLLLNVVQSVVATGASSLVSSSF"
FT   CDS_pept        639232..639690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl9"
FT                   /locus_tag="MAE_07310"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00553"
FT                   /db_xref="GOA:B0JQ94"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQ94"
FT                   /protein_id="BAG00553.1"
FT                   /translation="MAKRMQVILNQKVSKLGENGDVVEVAPGYARNYLIPQGVAVLATK
FT                   GAIKQAEFRKEKERQRLLAEKQEAETRKTAIEKLSPYSIPKQVGENEAIFGTVTSQDVA
FT                   TVILENAKLEIDRRGITVPDIGQLGVYKVQVKLHPEVSADIEIKVIAQ"
FT   CDS_pept        639790..640374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00554"
FT                   /db_xref="GOA:B0JQ95"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQ95"
FT                   /protein_id="BAG00554.1"
FT                   /translation="MTHPTDIKTLARWMAADFSNQEQAFANPPFFAHIRVCMRPLPDEL
FT                   LNGTSLFLEQAYDFMLNTPYRLRVFKLSLVDDHIELENFKVKEEANFFGASREPQRLKN
FT                   LTLDLLEPMLGCDMNVTWTGNSFKGVVKPGKQCLVFRKDRMTYLDNSFEISERGLISVD
FT                   RGLDPETDQLVWGSIAGPFEFVRRTSFAEEV"
FT   CDS_pept        640397..641197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07330"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00555"
FT                   /db_xref="GOA:B0JQ96"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ96"
FT                   /protein_id="BAG00555.1"
FT                   /translation="MKIATWNVNSIRSRQEQVINWLQLNPVEVLCLQETKVIDRDFPRE
FT                   AFESLGYHLYISGQKSYNGVAIFSRKPLDDITVGFSPIIGENLTGELDEQKRVITGVIG
FT                   DIRIINLYVPNGSSLDSDKYIYKLKWLETLRKYLDKIINSQPEELCICGDFNIALEDKD
FT                   IYDPKGKENHIMSSAKEREALEKVLEIGLQDAFRKFTSAAGHYSWWDYRSGGFARNRGW
FT                   RIDHLYLTPQLYEKAVNCLIDREPRKQEKPSDHTPVILEISSQK"
FT   CDS_pept        complement(641198..641350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07340"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00556"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ97"
FT                   /protein_id="BAG00556.1"
FT                   /translation="MGRTHNLINLVNSTRIIAFSRCRINPQGESPWLGKLREQNSGCAK
FT                   SRLIL"
FT   CDS_pept        641492..641890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07350"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07350"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00557"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ98"
FT                   /protein_id="BAG00557.1"
FT                   /translation="MIEDIQTAIKDKNIALILKHYAPFISSQLTIKTDASTEIFELDGI
FT                   TEHKIFLEESYKNIKSIEVLSENWDVDILANNEMAIVTRERVVNITNTEGDNYIVASEA
FT                   VAKVAPIDGKLRIFSIQETAEVGRRPKK"
FT   CDS_pept        complement(641891..642208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07360"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00558"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQ99"
FT                   /protein_id="BAG00558.1"
FT                   /translation="MGQHWGKALILTTTFLTINIDYAKSLTFGEAVGIGAGALLINRAV
FT                   QDNRQRYRFVPPEQEFQRGLEDGFNFARYDNPRNSRDYDDGFIEGRRRRESGWSSPNRR
FT                   G"
FT   CDS_pept        complement(642328..643221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtR"
FT                   /locus_tag="MAE_07370"
FT                   /product="beta-carotene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07370"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00559"
FT                   /db_xref="GOA:B0JQA0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA0"
FT                   /protein_id="BAG00559.1"
FT                   /translation="MQSAEMLLTVPKEYLKAPGGFNPNVTMFFSALSLITLSTCGYWLW
FT                   SWPDWICFSANVLALHLSGTVIHDASHNSAHSNRLFNAILGHGSALMLGFAFPVFTRVH
FT                   LQHHAHVNDPENDPDHFVSTGGPLWMIAARFFYHEIFFFKRQLWRKYELLEWFLSRLFV
FT                   ATIVIFACQYGFISYVMNFWFVPALVVGIALGLFFDYLPHRPFQERNRWKNARVYPSPL
FT                   LNLLILGQNYHLVHHLWPSIPWYKYQPAYYATKPLLDAKDCEQSLGLLQGKNFWSFLYD
FT                   VFLGIRFHSHSSKSSS"
FT   CDS_pept        complement(643383..643802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07380"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00560"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA1"
FT                   /protein_id="BAG00560.1"
FT                   /translation="MIPTSNPLTYGDLLLQYQPKPINNSQEYERFLSIIEGMMSRELSN
FT                   DEGLLFDLLVLLVEEYERKHYPIARTNPTATLESLLDEFDIDRECLVDIFGDRDRVESV
FT                   IGGKQAIAPSQAESLAEFFNRLSAKLALSARDFLL"
FT   CDS_pept        complement(643786..644091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07390"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00561"
FT                   /db_xref="GOA:B0JQA2"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA2"
FT                   /protein_id="BAG00561.1"
FT                   /translation="MRCSLISKVKLGEFWERHSDAEDALRDWYNFASKANWKNLVEVQG
FT                   RYPKAEAVGNFTVFNIKGNKYRLIADINYSRQTIFVKYILSHAEYNKENWKNDPYF"
FT   CDS_pept        644222..644431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07400"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07400"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00562"
FT                   /db_xref="UniProtKB/TrEMBL:B0JLW0"
FT                   /protein_id="BAG00562.1"
FT                   /translation="MLSENEKRIKELCQELGQCLYEQSPINKFNNLGEIEETVRDLMIQ
FT                   YVNPEIGIFLSKQAQEKQLVGQEK"
FT   CDS_pept        644512..644838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07410"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00563"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA4"
FT                   /protein_id="BAG00563.1"
FT                   /translation="MLEKNCLLLSGDESYEKSAQKIKSLTGIAVSHSTQQRLVHRYAFE
FT                   ELPSNPEVEVEEMSLDGGKVRLRTAKGKALIWRDYKAVSFHQLGVAAFFQDIVISNKCE
FT                   TREK"
FT   mobile_element  644798..645752
FT                   /mobile_element_type="insertion sequence:ISMae21_1"
FT   CDS_pept        644876..645724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07420"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07420"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00564"
FT                   /db_xref="GOA:B0JGD8"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JGD8"
FT                   /protein_id="BAG00564.1"
FT                   /translation="MSYSLDLRKKVIDYVENGGSITKAAALFNIGRATIYRWLGREKLE
FT                   ATKVKHRQRKLDWKALSKDVQENPEARLRDRAEKFGVRPSAICYALKNMKVTRKKKELR
FT                   YRERNREERMKYYRVLRELIKIYGSESLVFIDESGFEEFQACFYAWSKKGKKVFGDRQG
FT                   KRGKRENLVAGRRKGKKDFIAPMVFTRSLNAEGFEGWLSLYLLPSLTITSVLIMDNAPI
FT                   HRKTVIKQLVEEAGHQVVFLPKYSPDLNDIEHDFSALKRARMYAPVGTPLDEIIRTYCV
FT                   A"
FT   CDS_pept        645788..646237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07430"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00565"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA6"
FT                   /protein_id="BAG00565.1"
FT                   /translation="MAKPLICLGDGHDGIWNLFREIGEKQERIEILDWYHLIENLYKVG
FT                   GSFQRIEEVKCFLWKGEVEAAISCCEGWSEPQVENFITYLNKHKHRIVNYGYLQAEGIS
FT                   IGSGSVESKIKQIAHRLKITGASWESGNVPQVLRHRCAYLNGCLF"
FT   mobile_element  complement(646342..648149)
FT                   /mobile_element_type="insertion sequence:ISMae5_2"
FT   CDS_pept        complement(646475..647884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07440"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07440"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00566"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:B0JGQ5"
FT                   /protein_id="BAG00566.1"
FT                   /translation="MEKWAAQELQYADLGDTRRKKRLISIVENLASQPSTSVPQASGNL
FT                   AAASATYDFWNSPYFHPSDIIAAQAKSTVERIKEHPIVLAVQDTTSLDFTTQKAKKGMG
FT                   YLDYKKSFGLKVHTTLGVSPVGIPLGLINQYVWAREEKNLGIAKQRKKRETQEKESQRW
FT                   LDSLSETQQQIPEDIQVVTIGDCEADIFDLFAQSRSPNSHLLIRGTHNRKVNYLEDKQR
FT                   SGHSEPKYLHQSIREIKACGTLDVQVKRNPNHEARLAKLTVRFASFEIQVPSHHSKATP
FT                   RQPVKLQVILAEEENPHSGVNPISWLLLTSLDISSFESAITCVRWYSYRWLIERYHFVL
FT                   KSGCGLEKLQLETGRRIEMALATYSIVAWRLLWLTYQARLHGEESCESFLEEHEWQSLC
FT                   ATIHKKSPPPEKPPSFREAVRMIASLGGFLGRKGDGEPGVKTIWLGLRRLHDISQTWKL
FT                   SHQISPPIEPP"
FT   mobile_element  648153..648355
FT                   /mobile_element_type="MITE:MaeMITEa020"
FT   CDS_pept        complement(648167..648328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07450"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07450"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00567"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA8"
FT                   /protein_id="BAG00567.1"
FT                   /translation="MWGVGCGVWGFTSFEVANYLIFREKVPKFPPDHSHIHYFLIDKRS
FT                   KSLTQQGF"
FT   CDS_pept        complement(648366..648527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07460"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07460"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00568"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQA9"
FT                   /protein_id="BAG00568.1"
FT                   /translation="MLFIFFMLHLAIDYSIGDLGRSPKRAAKWCAFLGCGERSVKLAYT
FT                   IIIRAIDV"
FT   CDS_pept        complement(648690..648842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07470"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07470"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00569"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB0"
FT                   /protein_id="BAG00569.1"
FT                   /translation="MTPAKEPTNGRAGAGEPLKVVLLIELTNTVLLSGCRVPSTVAVMV
FT                   PALEV"
FT   mobile_element  649108..650250
FT                   /mobile_element_type="insertion sequence:ISMae22_3"
FT   CDS_pept        649201..650244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07480"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07480"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00570"
FT                   /db_xref="GOA:B0JQB1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB1"
FT                   /protein_id="BAG00570.1"
FT                   /translation="MINLEFTEEEKNSLYYERFHHPHPRVQLKMEVLWLKSQKIPHQKI
FT                   CQLAGISPNTLLTYLRDYQEGGIEKLKEINFYRPKSELESQRETLKKYFEKNPPATINE
FT                   AVYRREELTGIKRSPTQVRKFLKSLGMKCLKIGSLPSKADPDEQEEYKEKKLEPRLNEA
FT                   KEGKRAVFFVDAAHFVMGAFLGFVWCFERLFVKSPSGRKRFNVLGALNAITHEVILVTN
FT                   DTYITATQVCELRSKIAALGLMIPITLVLDNARYQKCQIVEELALSLSIELLYLPSYSP
FT                   NLNLIERRWKFVKKKCLYGKYYENFSDFSSAIYECLNDAHLKHKKELDSLLTLRFQKFN
FT                   KSQIMNV"
FT   mobile_element  complement(650453..652138)
FT                   /mobile_element_type="insertion sequence:ISMae6_2"
FT   CDS_pept        complement(650505..651155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07490"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07490"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00571"
FT                   /db_xref="GOA:B0JMQ8"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0JMQ8"
FT                   /protein_id="BAG00571.1"
FT                   /translation="MYQNNKQSIEDRIVSLTQPHIRPIVRGKAGKPVEFGAKFSASCID
FT                   GYIFLDRISWDNFNESGDLKAQIEAYYDYTGYYPESVHVDKIYRTRENRAWCKERGIRI
FT                   SGPPLGRPAKNVSKEQKKQATDDERIRNCIEGKFGQGKRRFSLGKVMAKLPHTSFSAIA
FT                   ITFLVMNLSNLLRQVFWAFLCLKWKNSTFSRSMIRISYNLKINQQLKLMLVAK"
FT   CDS_pept        complement(651417..652001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07500"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07500"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00572"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB3"
FT                   /protein_id="BAG00572.1"
FT                   /translation="MYRKSELPSTPPENFELPFEGKLSQDNRWVIMANLIPWSEFEAEY
FT                   ASLFSEEMGAPAKTFRTALGALIIKEKLGTSDRETVEQIKENPYLQYFLGFSSYSNEPR
FT                   FEASMLVHFRERITRELINKVNRFMVKNSREIKEEENTEKKLESETQSQPENRGKLILD
FT                   ASCAPADISYPTDLNLLNQGRKQTEKIIDIL"
FT   mobile_element  complement(652156..652339)
FT                   /mobile_element_type="MITE:MaeMITEh006"
FT   CDS_pept        complement(652192..652356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07510"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07510"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00573"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB4"
FT                   /protein_id="BAG00573.1"
FT                   /translation="MNQPYYWDLDKKQIEKSLNSNPRLGFTSRSPKSLKPRYIKENHKS
FT                   RLTLCPVMV"
FT   CDS_pept        complement(652411..652818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07520"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00574"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB5"
FT                   /protein_id="BAG00574.1"
FT                   /translation="MPDKVFIDTNVLIYAYSEDEPDKRQRAIDCVRSGEAWISTQVLNE
FT                   TINVLKRKFSLSYSQIRDAVQELSEGFPIVLVSVNTIEMALNLAERYQYSYFDSLILAS
FT                   ALEAGCQILYSEDLQDGQRIENQLMIVNPFS"
FT   CDS_pept        653144..653311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07530"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07530"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00575"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB6"
FT                   /protein_id="BAG00575.1"
FT                   /translation="MDEKETGLNERELEEILKMARDAAEKARSMCEVITENSKKWRERA
FT                   KQSPQVRSGG"
FT   CDS_pept        653331..653540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07540"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07540"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00576"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB7"
FT                   /protein_id="BAG00576.1"
FT                   /translation="MGNSRGFDRYDKLNDIHSRKPRWFKRPNISISFETTRFYTGNQLS
FT                   KERVHPSAPSSKLGVWGSLPKKYP"
FT   CDS_pept        653674..654021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07550"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00577"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB8"
FT                   /protein_id="BAG00577.1"
FT                   /translation="MNNLFIRLYLDEDVNVLIAELLRARGFDAITARDAGQLNATDKAQ
FT                   LAHAVSQGRTLVTHNRTDFEELVRDYFDANRTHYGVIFAVRRPPREIATRLLVILDRVT
FT                   ADEMRNQVRYI"
FT   CDS_pept        654231..658805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="MAE_07560"
FT                   /product="NADH-dependent glutamate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07560"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00578"
FT                   /db_xref="GOA:B0JQB9"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQB9"
FT                   /protein_id="BAG00578.1"
FT                   /translation="MNNNQTPRKQGLYDPRFEHDACGVGFIVHKTGKKSHDIVEQALTI
FT                   LLNLDHRGACGAEKNTGDGAGILCQIPDLFFRKVTSNLGFTLPAAGQYGVGMLYTAPDA
FT                   EIRGKSRQEFEKIAAEEGLKVLGWRDVPTDNSSLGNSAKSTEPFIEQVFIERDANLSDD
FT                   LAFERKLYVIRKRSHLSRQSFNRYWYPCSISSRTIVYKGQLMPVQVGDYFPDLHDPDFQ
FT                   SALGLVHSRFSTNTFPSWERAHPYRYIAHNGEINTLRGNINWMHARQSMFASPLFGEDI
FT                   KKIQPVINIEGSDSLIFDNALELMVLSGRSLPHAVMMMIPEPWAAHESMSDEKKAFYEY
FT                   HSCLMEPWDGPASIAFTDGTMMGAVLDRNGLRPSRYYVTKDDLVIMASEAGVLPIEPER
FT                   VAFKGRLQPGRMFLVDMKEGRIVADEEIKEGIAKAHPYRQWLNENLVNLDDLLAVETAP
FT                   PETAVSLIQQQTAFGYTFEELRLLLAPMGRDGVEAVGSMGSDTPLAVLSDRPKLLYDYF
FT                   QQLFAQVTNPPIDSIREEIITSPITTIGAERNLLDPQPESCHLIKLNSPILTNAQLARL
FT                   QGNSEFKTVTIPILFDPTSGVEGMRSTIEAICQEVDEAILAGASIIILSDRGIDKNHAP
FT                   IPSLLAVAGLHHHLIRQGTRTRVGLVLESGEPREVHHYALLLGYGCGAINPYLAFATLG
FT                   SMIEEGLLVGVDHQSACKNYIKAATKGVIKVASKIGISTLQSYRGAQIFEAIGLNRSVV
FT                   DRYFTWTASRIEGADLEIIAKESLLRHGHAFPDRDVNVHTLDIGGEYQWRKDGEAHLFS
FT                   PETIHTLQQAVKLGKYDLFKKYSQLVNQQNQKFFTLRGLLTFKNRESIPIEEVEPIEAI
FT                   MKRFKTGAMSYGSISKEAHESLAIAMNRIGGKSNTGEGGEDSERYTWTNEQGDSKNSAI
FT                   KQVASGRFGVTSLYLSQARELQIKMAQGAKPGEGGQLPGKKVYPWIAKVRHSTPGVGLI
FT                   SPPPHHDIYSIEDLAELIHDLKNANRAARVSVKLVSEVGVGTIAAGVAKAHADVVLISG
FT                   FDGGTGASPQTSIKHAGLPWELGLAETHQTLVLNNLRSRIAVETDGQMKTGRDVVVATL
FT                   LGAEEFGFSTAPLVTLGCIMMRVCHLNTCPAGVATQDPLLRKNFIGDPEYTVNFMKFIA
FT                   QEVREIMAELGFRTLNEMVGRTDVLEPKQAVEHWKAKGIDLTPILYQPEVAPEVGRYCQ
FT                   IPQDHGLDKSLDITVLLDLCKDAIEKGEKVKATLPIKNINRVVGTILGNEITKRHWGGL
FT                   PEDTVHLHFQGSAGQSFGAFVPKGVTLELEGDANDYVGKGLSGGKIIVYPPKGSTFVAE
FT                   ENIIIGNVALYGATSGEVYISGVAGERFGVRNSGVTTVVESVGDHACEYMTGGKVVVLG
FT                   PTGRNFAAGMSGGVAYVLDESGDFATRCNTQMVALEALEAEEIDDLRELIQRHADYTQS
FT                   QKAALVLANWSEMLPKFVKVMPKDYKRMLQCIKEALDSGLTGDSALDAAFEANARDVAR
FT                   IGGS"
FT   CDS_pept        complement(658872..659459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07570"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07570"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00579"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC0"
FT                   /protein_id="BAG00579.1"
FT                   /translation="MADHIIYKKSIEGSALRQGEILTDVIQYNPVASDLSQESEDVAFD
FT                   PILHPFVIVVSQDCDLDWDYQARQPDINQPHKLLNSIIFCEISSAQEIKDIVRKTDAWN
FT                   LIKTQRDERYYFFEKIPNNCDLQNEGVQELTADFKKVFGLDSKTIYRQLEIGMAKRRTI
FT                   LSSPYLEHFSKRFYNFHGRIALPFQYQSEKEG"
FT   CDS_pept        complement(659480..659857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07580"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07580"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00580"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC1"
FT                   /protein_id="BAG00580.1"
FT                   /translation="MSIRPNKSQTSTGDFLVNLLIDRKAGRTITGNYPSFDLTMSDSSL
FT                   SLTTHWREFPQDKLIALIKCLLILQSLPEDALDESVTQLEDIASFYSNLSPEKIVPVIP
FT                   ASSIRGKLRAIQIRQPIILEP"
FT   CDS_pept        complement(659841..660632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07590"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00581"
FT                   /db_xref="InterPro:IPR026349"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC2"
FT                   /protein_id="BAG00581.1"
FT                   /translation="MKLPEFDRVIYEYNPLFEVVCQLTFPPILKISHQEPVEFQDEIRF
FT                   QYPLFERTQPQIPPEIAKVVQQFNLPLPNNSAYIFKSEDQKWKLAVDKDLIALTTSAYE
FT                   RYEYFREKLEFAVTIFERIYKPSFYTRVGLRYRDLIVRSELQLESKKWSELITRRIASE
FT                   LYDSDFSASIQSINKSLVLKVDNGQVNFNHGLVYVENTKANDEEEAYLLDADFYTERKI
FT                   ARDENVWNILDSFNKSARKLFRCSISETLHDALRPTNVDPS"
FT   CDS_pept        661133..661381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07600"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00582"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC3"
FT                   /protein_id="BAG00582.1"
FT                   /translation="MIKNLRVSYDGMVFRPEEKIELEPNTHYIIQIISREDPLENNHKN
FT                   AWELLEEMAGTYEAPEDWSREHDHYLYDTPKRNISDE"
FT   CDS_pept        661374..661784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07610"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00583"
FT                   /db_xref="GOA:B0JQC4"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR039018"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC4"
FT                   /protein_id="BAG00583.1"
FT                   /translation="MNKSKLFLDTVFIQAILNPHDQYHQIAMQFLPYVKNATAVWVTEA
FT                   IFMEVGNALSHYNRPKVSAFIKQCYQTDNLFVVTITSTLFQKGLKLYESRADKSWGLVD
FT                   CFSFIVMEENQITDALTSDVHFIQAGFQALLR"
FT   CDS_pept        661973..662212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07620"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00584"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC5"
FT                   /protein_id="BAG00584.1"
FT                   /translation="MPNLTLSNEQVIDLFKQLPEDQKREVYKILILSQWRQLEPVFNEG
FT                   AERARIVAKERGYDWDTMTEDEREEFIDEIVHEK"
FT   CDS_pept        662212..662640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07630"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00585"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC6"
FT                   /protein_id="BAG00585.1"
FT                   /translation="MTYVVVFDTNILISAWLSKNSPTFSCLSLAKTGSVSSVTCQEILD
FT                   ELSEKLQQKFQISERGLREYIAEIRQFSSLVPITRQLRAVPNDPDDDMIIECAIVGKAT
FT                   HIITGDKHLLSLVEYQNIQIVKAKDFLDFLDQNNNHQL"
FT   CDS_pept        662952..663152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07640"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07640"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00586"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC7"
FT                   /protein_id="BAG00586.1"
FT                   /translation="MQEVYSIYTNNRNIFNNGLSYQKAIKGVFMIKRKGDQRIRMFWCD
FT                   GKDIKLILIKAYVDKIFVRLM"
FT   mobile_element  complement(663243..663424)
FT                   /mobile_element_type="MITE:MaeMITEb012"
FT   CDS_pept        complement(663508..663735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07650"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00587"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC8"
FT                   /protein_id="BAG00587.1"
FT                   /translation="MIVSLQEAQAKLPELIYNLKPGEELLITDNNLPLAKLIGQTPTSP
FT                   QRPGPGLCKGMITIVADDEEHLQDFAEYLH"
FT   CDS_pept        663978..664202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07660"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00588"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQC9"
FT                   /protein_id="BAG00588.1"
FT                   /translation="MSKISIEVSPEAAEVYQSASPEEQERVRVLVDLLIRKPVNSDIDF
FT                   LRKLMDEISDEAEARGLTPEILESLLNEP"
FT   CDS_pept        664389..664712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07670"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00589"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD0"
FT                   /protein_id="BAG00589.1"
FT                   /translation="MNITLNPELEQLINSQLSTGKYNSVEDLLKDALLNLADKQNRQAL
FT                   SKKVKELFDKTQSLPGVQDITEEEIAEEIEAYRREGLKEKWAKWFQEVEEMEFPASEIS
FT                   EKD"
FT   CDS_pept        664757..665137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07680"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00590"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD1"
FT                   /protein_id="BAG00590.1"
FT                   /translation="MILCDTAPLFCSVDKSQPRHQAVKIFIENESSYLITTWACFTESM
FT                   YLCLQRGGWSMQAQLGKLLLKKMVRLASIEEKDYPRLLSLMEKYKDRPMDLADATLVVT
FT                   AENLKIKRILTFDSDFFSVSII"
FT   CDS_pept        665250..665414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07690"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07690"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00591"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD2"
FT                   /protein_id="BAG00591.1"
FT                   /translation="MLLLIILGRGGLNEHNKGLLRQFLPKKTNFKILKPKEVERAVNLI
FT                   NNRGGSITA"
FT   CDS_pept        complement(665422..665901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07700"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00592"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD3"
FT                   /protein_id="BAG00592.1"
FT                   /translation="MNTLDQDLFMKCDRFLTLSLVFSLGLAFPSSLPAQNPPATTFQPG
FT                   PWQPVARVNTSRPVEIKIINQTDIDLNYDLSANINSSPQLLSPGTETNLRGLVIPAYIL
FT                   INRANAAADPYSSSLIYAVEVNDDNLVTITVTKVPGSTPGYTTFNINQQGAIYIY"
FT   CDS_pept        666106..666957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07710"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07710"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00593"
FT                   /db_xref="GOA:B0JQD4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD4"
FT                   /protein_id="BAG00593.1"
FT                   /translation="MPTIDISGVSHSYELFSPRADKPVLVFIHGWLLSRHYWQPLVDIL
FT                   SSDYPCLVYDLRGFGDSQKITSNSPPSSYNLESYSQDVITLLNRLNLDAAWLVGHSLGG
FT                   SVALWAADSCPERIKGVICMNAGGGIYLKEEFERFREAGRQILERRPPWLPRVPFIDVL
FT                   FSRMMVKQTLGKKWGKQRVIDFVRADYQAALGSLLETTTISEVHLLPQIVSRLPQPVYF
FT                   LAGKEDTIMEVKYVNHLASFHPLFETGSNVIELSDCGHFAMLEQTAAVAQKMMAILHQH
FT                   RS"
FT   CDS_pept        667341..667493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07720"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07720"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00594"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD5"
FT                   /protein_id="BAG00594.1"
FT                   /translation="MPVSLPQVQDFERIVVQNLASSGRSISDRKSTVSAIGYARMLRPY
FT                   FFSKL"
FT   CDS_pept        complement(667494..669458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07730"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD6"
FT                   /protein_id="BAG00595.1"
FT                   /translation="MREILYREIPTPDSIAVCQWLQSDWQPASGVKTNTPNGVRLRLSE
FT                   AIELSIFVWTLQRTTYLKVFRWGERSHSQETSLTRQLDRALQKRFPPQFSTIPNIDQKN
FT                   HSIFTDLEADYPLTVHYFRKMPQGEADLERLYWWEKRWRDSAKNPQQPQPVIFSSSEEN
FT                   DHPITYDLIYIGGALGAIHAAQMAKLGYRVLLVERLPFGRMNREWNISRSEFQSLINLG
FT                   LFTAEEFEELIFQEYIDGFNKFFDGNNPPHLKAEILHTPTVLNIAINSDKLLQSCGKKI
FT                   QDHGGKILDQTEFIKADITANSVTVTLNHSGEIQQIKCRLLIDAMGSASAIAWQLNGVR
FT                   AFDSVCPTVGAVVEGFDPVVWDSHYGDVLNSHGDISKGRQLIWELFPGEGKELTFYLFH
FT                   YHQVHPDNPGSLLEMYEDFFTILPEYRQCDPEKLTWKKPTFGYIPGHFSTGKKDRIVSF
FT                   DRILAIGDAASLQSPLIFTGFGSLVRNLERLTHLLDLALKHDLLTAKDLENVRAYQSNV
FT                   AVTWLFSKGMMVPTGKTLPPQRINAMLNTFFGLLADEPPEISETFIKDKTDWLTFSRLA
FT                   IKAARKNPALLLWIAEMAGSQDLIRWLGSYLDFSLDGVKNLLFGPWFSQWLKNSQSWLE
FT                   KDNPRLWLKLLSFNYGLRN"
FT   CDS_pept        669580..669822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07740"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00596"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD7"
FT                   /protein_id="BAG00596.1"
FT                   /translation="MNYPIPTTPEEIAALRQRPVDEEMIAAVIAGIIRMARAQGQSLDD
FT                   LTEEILAEDPILDQVQRRWLSQLLTNAWQNLAEWV"
FT   CDS_pept        669830..670645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07750"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00597"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD8"
FT                   /protein_id="BAG00597.1"
FT                   /translation="MEWLTITLAGVLTLLTPAGAIIDTVLAHTLRSQVQKVEQLAVRVD
FT                   NTPNYQALQGKIDRVRISARGIYPLADVRIEKIELETEPISLDLRRLQQKNSSLAAALR
FT                   RPAAGALHLVLTETNVNQALQSAAVKEQIQTLINNLIPSREESSSTKYQLSQANFNFLN
FT                   NNRVALSLQLETQRPDEPAATLNLSLEVGFKLVQGRKIELIDPTATLNGRRISSRLLKG
FT                   FAEGISTQLDLKNFEKQGIIARLLQLQIDDDKLSIAAFGSIEPRSGNPN"
FT   CDS_pept        670883..671563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07760"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00598"
FT                   /db_xref="GOA:B0JQD9"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQD9"
FT                   /protein_id="BAG00598.1"
FT                   /translation="MPSSRSSDKISLPWIIGIGLALFTAGGATAWFAVHHLSFSQKTSE
FT                   NPIESPTPAPISQSPIVEPVSPGPVETSPTATPAAIPVRETRQVYWLKVTDTGNQLVSQ
FT                   EITVQKADSGEGELTAVLQTLLAGPSNPQDMTTIPAGTKLLDLKVDKTGIKINLSREFG
FT                   NDDGPDMLIGRLAQIIYTTTTEDSNAKVWIQVEGKPLELLGEGHGIEVAQPMTRKFFEE
FT                   NYQL"
FT   mobile_element  671587..671772
FT                   /mobile_element_type="MITE:MaeMITEb013"
FT   CDS_pept        671630..671800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07770"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07770"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00599"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE0"
FT                   /protein_id="BAG00599.1"
FT                   /translation="MKPLYRKTWLRFLPIVFNLERANQLSPLPDKDLADFCPLIEPYQV
FT                   TKNQIVVAIAN"
FT   CDS_pept        complement(671803..672864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07780"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00600"
FT                   /db_xref="GOA:B0JQE1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE1"
FT                   /protein_id="BAG00600.1"
FT                   /translation="MNLLTRLEDWPYIILPITIILSFLLLGWLVEQRVVSQLLSIAREK
FT                   NLRFSEGVLRSLRGLSILWFGLLGLNIALSLPNLPLFPSLILLSKKFLLVTFLASATWV
FT                   VAQLSVEILRVYTTGDDGISSLTSLFEFLAKVLIFSCGFLLILSSIGISITPMLTALGI
FT                   GGVSLGLALQNTLANLMSGINIITSKKVRPGDYIELRTGEAGYVRDVDLRCTVIEEITN
FT                   NLLVIPNAQIISSSFRNYSLPDHSLLVPVEVGISYDSDLEKVEKVTLEVMQEIAQLLQP
FT                   QLGDYQPFIRYHKFDYYSIVLTVYLKVVEEEFFQHLTIKHEFIKLLHRRYQQEGIKIPY
FT                   PIFFPYPPTNPPS"
FT   CDS_pept        673001..673384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytM"
FT                   /locus_tag="MAE_07790"
FT                   /product="cytochrome cM"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07790"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00601"
FT                   /db_xref="GOA:B0JQE2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE2"
FT                   /protein_id="BAG00601.1"
FT                   /translation="MNSQLFKPKFGLYRFLMVIIVVLFLISTYLITFHLAKMSDPYIKE
FT                   VLSLQGNVSRGYEIFQINCAACHGQFADGIVGPSLEDVSHRKSRISLIEQVISGKTPPM
FT                   PKFQPDTQAMADLLVYLENISKN"
FT   CDS_pept        673769..675910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07800"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00602"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE3"
FT                   /protein_id="BAG00602.1"
FT                   /translation="MSWHSQVEPAIIQGDFWQVSQFYEELIEREPLEISHYWYLGLAYL
FT                   LEAREEEAQTTWLFVLSQGDEGEMTAWTADLVNILDGEARRQLELGNLETSWLIRGHIR
FT                   EISPDNIDNLLRFILLAINLNYFEKEQLKTWLFVDVLKINDFQSLELSLLAEVLEKFLD
FT                   YQIPETVPYLEAIFQSNCQRKTFIKVVEAKLPSLAIPLAIDIINTCLAVEPGQIYLLAE
FT                   LYQCYFYNRDFAAAMQVASQLKTSCQGLPSQAVADFLALYVKLFSGNWVDIKADVEEYT
FT                   ESLQKSITNRECPRLLDAPSLAILSPLVYLEDNPRKNRYISNCVGQLFQEYVCNNYKGN
FT                   FLHKSTIKDTNKVLKIGYIAHTLYNHSIGLISRWLMKYHDYNEFHVSLYLVSQQEDYIT
FT                   ENFFKNQVNACYNLPIDPQMIAEKISEDNIDILVDLDSITNNTTCQVMALKPAPVQVTW
FT                   LGFDASGIPAIDYYLADNYVLPADAQEYYREKIWRLPNSYICVDGVEVAYPSLRRDDLG
FT                   IPEDAINYLTVQTGVKRNPETIRLQLQVLKAVPHSYLSIQGLSDAKSVEKLFFKVAEEE
FT                   GINYERLKIFPLYPTGIYRANLRIADVVLDTYPFTGGMTTLDVLWMGIPLVTKVGQQWS
FT                   SRNSYTLMVNAGISEGIAWSDEEYIDWGIKLGKDENLRRKVIAKLDESRQTSPIWNARQ
FT                   FTKDMENAYRQMWQIYCES"
FT   CDS_pept        675928..678087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07810"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00603"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE4"
FT                   /protein_id="BAG00603.1"
FT                   /translation="MSWQNEVKTALENNQYDIVSQFYEELIERETTEISYYWYLGLSYL
FT                   LQGREEEAQATWLFVFTQGDEQETESWLLELSNILTTEANRQIELKNLEISWLIRKHLQ
FT                   EINPSYLDNLLHLTLVEIKLNRFDPQQLQEWQILELITQGSVNSQLLERVVIALIPYTH
FT                   KYTIELVRLSLPYLSNSLKLLDHILKITRQVAFQKKLPLYSVDLAEAFLPLYPESWYLQ
FT                   VNLFWFYISSDDYDKAINLANKLKKKSQTIDLKMFSQSLLFNGSLRASKWNDIPSICQE
FT                   YKHLIREFLEQNPQDIHPLVRENLLTVMNPISYYEDNPKENRPLLSQIGSFFQTTYKEM
FT                   LGFQEESFDKPREDNANKKLKIGYIAQSLKRHPVGLLSRWTINYHNREQFDIHLYMVSQ
FT                   PVDEITKQWFSNPADKIYHATADSLVTYRKIKEDNIDILVDLDSGTGAIVAKVIALKPA
FT                   PIQVNWLGFDGSGLPAVDYLLADPYVLPENAQEYYQEKIWRLPDAFVAVDGFEIAVPTL
FT                   RREDLGINNDAVIYLSSQTAIKRNPAMIRLQMQIIKSVPNSYFLIQGVADDNSLWDLFC
FT                   QIAAEVGVETNRIKMLPLYQTETYRANLAIADVVLDTYPFNGGTTTLETLWMGIPLVVK
FT                   VGQQWSSRNGYTLMMNAGITEGISWSDEEYVQWGIKLGLDRNLREEVRWKLRKSRHTSP
FT                   LWNAKQFTRDLETAYRQMWNIYCQS"
FT   CDS_pept        678100..679440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07820"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07820"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00604"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE5"
FT                   /protein_id="BAG00604.1"
FT                   /translation="MQWHQDTQTNLNDNNYQLVVQFYEQLIENNSPAIEDYFYLGLAYL
FT                   LQDREEDAQATWLLVLSQAAESELSGWIETLTQILDAEATRQENSQRLETSYLIRLHLQ
FT                   NLNPSFLNNLLHLMELEIQFQNFAMEKCNDWCVFELLENTATAAINLDLLLGVTEKVLI
FT                   YPCTNTIHFLELAALHINNPEIIAAKVISAIVNYAYQQKQSVFAINLVELCLRFLPEDL
FT                   YLQNSLFNLYKTTTVDYKKSLEIAENFYKNCQTTTEKLLGISLVIGILQAKGDWGNLPK
FT                   FIDELIQLIEGQINAEQFNALPFIIDSILGVTSCLPYYQDNPKINRYLQSKLAEIFQAD
FT                   VRTRYNYIAPVYYPKSPARKIKIGYIAHTLRRHSVGWLSRWLFHYHNRDKFEIYTYFVT
FT                   QAADEITQKWFKNNSDYSYNLPAKIEQITAQIRQDKLDILVDIRPLA"
FT   mobile_element  679423..680644
FT                   /mobile_element_type="insertion sequence:ISMae4_2"
FT   CDS_pept        679549..680406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07830"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07830"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00605"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:B0JHW1"
FT                   /protein_id="BAG00605.1"
FT                   /translation="MFISKIMDYQNLSDEQFKRRFGVYKQTYRKMVESVKSVEADSNSP
FT                   SKRGPKPKLSIEEQVLVTLEYWREYRTYFHIGTSWELSESTICRIVNKTEKMLLQSGNF
FT                   RLKGKKALLNQAEIPVITVMDVTETPIERPQKKQKDFFSGKRGYHTLKSQLVADQNTKE
FT                   IICVFCGKGRGHDFSLFKKSRVRFHPLTTSIEDSGYQGIAAYHSNSYTPKKKSKNRKLT
FT                   ELEKEYNKALAKERIIIEHINRKLKIFKILSCKYRNRRRRYSLRVNLLAAIYNCELGIG
FT                   IAAS"
FT   CDS_pept        680680..681474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07840"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00606"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE7"
FT                   /protein_id="BAG00606.1"
FT                   /translation="MALKPAPIQVTWLGLDASGIPAIDYFIADNYVLPENAEEIYSEKI
FT                   IRLPNSYLSVDGFEVGVPTRRRTDLNIPDDAIIYLTVQSGLKRTLNMICLQLQILQQVP
FT                   NSYILIKGFADKETIRELFLKSADELGISQDRLRFLPNDFNEETHRANLGIADIVLDTY
FT                   PYSGATTTLETLWMGIPLVTRVGEQFAARNSYTFMKNAGISQGIAWSDEEYVQWGIKLG
FT                   LDENLREEVRYQLRQSRHTSPLWNAKQFTRDLETAYQQMWNI"
FT   CDS_pept        complement(681715..681897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07850"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07850"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00607"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE8"
FT                   /protein_id="BAG00607.1"
FT                   /translation="MVSNRAVSLAIRVSLGLTPGERGVGCGEKVGRLHLTFAKIPTISN
FT                   YQSLSNAYKSINNYL"
FT   CDS_pept        681952..683343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07860"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07860"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00608"
FT                   /db_xref="GOA:B0JQE9"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQE9"
FT                   /protein_id="BAG00608.1"
FT                   /translation="MVHLTPNPSYSLSLKIEIPNQAGTFASVLNAIADVGGNLGQISLI
FT                   ERNLKISTREVMVDAASTDQAEQIIAAVKALPDVKLLKVSDRTFDLHRRGKISIESRIP
FT                   LTSQDDLAMAYTPGVGRICTAIAHDPEQVYSLTIKGNTVAVVTDGSAVLGLGNLGPEAA
FT                   LPVMEGKAMLFKEFAGIDAFPICLATQDPEEIIATVKRIAPVFGGINLEDIGAPRCFEI
FT                   EKRLRAELNIPVFHDDQHGTAIVSLAALINALKFVKKSLDTVKIVINGAGAAGIAIATL
FT                   FKTAGATNIILCDSLGILSQKRDDLTPEKQAWAVAASGKLGDALKGADVFLGVSVPGVL
FT                   TPEMVKGMAKDAIVFAMANPIPEIQPELINDLVAVVATGRSDYPNQINNVLAFPGLFRG
FT                   ALDCRARAITDNMYLEAAKAIASLITPANLNRENIIPSVFDSRVVTAVAAAVQHAARQD
FT                   GVAGE"
FT   CDS_pept        683375..684109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07870"
FT                   /product="putative carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07870"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00609"
FT                   /db_xref="GOA:B0JQF0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF0"
FT                   /protein_id="BAG00609.1"
FT                   /translation="MKPIDDIPEALRDSQYRKTTNPNGLIAIASGLLALVGTGIIALAV
FT                   LNRPPATVKKPVINPSPLIKATPSPIENILGHLPYEEAPETELAPITGDGAMRLRKPAA
FT                   KAFIQMQSDARRSGVILMPISAFRSKATQDKLFFEVKEQRNQETRKRAEVSAPPGYSEH
FT                   HTGYAIDIGDGRAPATNLSSSFANTAAFRWLQNNAAQYSFELSFPENNLQGINYEPWHW
FT                   RFVGDSHSLETFYKAQQLGKQK"
FT   CDS_pept        684336..684680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07880"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07880"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00610"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF1"
FT                   /protein_id="BAG00610.1"
FT                   /translation="MSKPVEYLTNEQGERVGVLLDWNTYSRFANSLGLDEDCLIGLSVD
FT                   ELKALASCQLSLVEQTRLDDLVTRNAESLLCADEVAELDELLAKTDQLTILKTRARYTL
FT                   KCLEQGTTAA"
FT   CDS_pept        684911..687583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07890"
FT                   /product="HEAT domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07890"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00611"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF2"
FT                   /protein_id="BAG00611.1"
FT                   /translation="MIDWTPYLKSISDSEKYAQWETFYTLTDVEGKTRPAKTAPLLRDL
FT                   WVQTIEKEPQNRQERPERPEKTERFTVLDGLRKYATNHVLLKGRPGSGKSTALARLLLE
FT                   ESVAVQSLRLNQQNQAKIIQIPILIELRLYETSILDLILQFLKRHKLIIDSNTLESWLL
FT                   ENQNFRPLLLFDGINELPSEAARQNLKNFRQQYAEISMIFTTRDLGSDDLDIEKKLEML
FT                   PLSEAQMRDFVKVYLPEKGEEMLKQLGNRLKEFGQTPLLLWMLCSVFDNNQNKIPANLG
FT                   LVFQIFTGIYDKKLKADVPTYQESRDWWRELLQVLAWKMNQGESKTEIQVAISRTEAEE
FT                   ELSKFIKNKGFPEYYSKQWLEDLLKYHLIHLEGNDKIAFRHQLIQEYYTAEELKKKLPH
FT                   LRDEQLQWDYLNYLKWTEPMALLLGLLDNETQAKRVVKLGLEIDLKLGARLAGEVNFKF
FT                   QKQTVGLVLRLDVPKRFKVELLGLTKSNEVVNELSQALKDSDEDVRRNAAEALGEIGSE
FT                   KAIPGLIKALEDSDDDVRRKAAEALAEIGSETAIPGLLKALKDSDRYVRRSAAEVLAEI
FT                   GSETAIAGLIKALEDSDRFVRSRYVRRRAAAALGKIGTETAIAGLIKALEHSDGDVRFQ
FT                   AAFALGKIGSETAIPELLKALEHSDDDVRGEAAEALAEIGTETAIPGLLKALEDSDVFV
FT                   RRKAAFALGKIGSETAIPGLLKALEDSNQYVRSNAAFALGKIGSETAIPGLLKALEDSN
FT                   QYVRSNAAFALGEIGSETAIPGLLKALEDSDEDVRSNAAFALGEIGSETAIAGLLKALE
FT                   DSNQYVRSNAAFALGEIGSETAIPGLLKALEDSDEDVRSNAAFALGEIGSETAIAGLLK
FT                   ALVGLKRQIKIKSSIIVKE"
FT   mobile_element  687529..688894
FT                   /mobile_element_type="insertion sequence:ISMae34_9"
FT   CDS_pept        687608..688876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07900"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07900"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00612"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:B0JG46"
FT                   /protein_id="BAG00612.1"
FT                   /translation="MKETTPAAMPPCFDRWCRRFDNCFKNEAQKNGFRQYLGGLLGESE
FT                   RKNLTQMANNAVGVVYNRLHHFLTESPWSDRQVNECRLQVMNQCRQTQIPRGFSLIVDD
FT                   SGHRKSGNLTAGVGRQYLGEIGKTDNGIVAVTTHLYDGKKSVPLDIEIYQPASSLAEGK
FT                   EDKEFKKKPEIAIDLIDRSLTRGYRPKIVLIDAGYGNNTNFLKALEERKLKYLGGLAKN
FT                   RKVIIEKEGGVEETIQLEQLAKSLSEKDWEKITLNLDKEKTVWVAVFRAKISQLEGERN
FT                   LAIVMNASSMEKATEVDYFITNVVEADTVTASWIVRTYTERNWVEVFYREAKGWLGLRE
FT                   YQVRDKRSLLRHFILVFCAYTFILWHKLTGGLQRQWANRPLNTFVEALEAFRTAMSFRF
FT                   FEWLTENRDVFAAYKASLGFVWA"
FT   CDS_pept        complement(689007..689441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07910"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07910"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00613"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF4"
FT                   /protein_id="BAG00613.1"
FT                   /translation="MAVSEPILPKASAAFPRTYSLESSKALSNSGMAVSEPILPKAKAA
FT                   FLPDQSQSSESSKALSNSGMAVSEPMLPKAKAAFLRTSSSESSKALSNPGMAVSEPISP
FT                   KASAAFRRTSSSESSKALSNPGMAVSEPILPKAKAAFLRT"
FT   CDS_pept        689668..690342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07920"
FT                   /product="HEAT domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07920"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00614"
FT                   /db_xref="GOA:B0JQF5"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF5"
FT                   /protein_id="BAG00614.1"
FT                   /translation="MNQQVYISYNWQEDSNEMANQLVQAFAAKGIEIIRDKTHTSYKDS
FT                   IKNFMRQIGQGKCVVAVISDRYLKSENCMFELVEIARNGDFYQRIFPIILPDARIHKDL
FT                   ERIDYLKYWEDEKAKLQAKYKQIDLAKTNSIMATLNLYDEIRGNIDNLTNILKDMNTLN
FT                   IDLHRQSEFAAMIQKVETKLAEDSQKLSNQSPVKSESKYTIHAKNVQIIEKGDGQIQDS
FT                   SS"
FT   CDS_pept        690448..690711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07930"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00615"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF6"
FT                   /protein_id="BAG00615.1"
FT                   /translation="MTKYLNITETGQKLVEWSEQMTDEPIIITKEGQPIMVALNYAQIE
FT                   SWLETLDILQDKEFAEILSEAIQQDQSGQRITWEDAKKQLGW"
FT   CDS_pept        690711..691019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07940"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00616"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF7"
FT                   /protein_id="BAG00616.1"
FT                   /translation="MEYQIQLIPLALSFLSKITDKRIQQEIRKRIEKLKIEPDKQGKAL
FT                   SGKLKGYRSVRAVGQRYRIVYRVEEAQIIVIVIGVGIRKQGDKKDIYALLEKLINNE"
FT   CDS_pept        691213..691788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07950"
FT                   /product="HEAT domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07950"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00617"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF8"
FT                   /protein_id="BAG00617.1"
FT                   /translation="MCKEANRIIPSNLITITQRKNNMVQQLNNTQIAINTLLNKLNDSL
FT                   PQIRAKAAEALGKIGNSSLADTLVSHLIGENDLNVRLNLIRALGEIGNESAIPYLASCL
FT                   SDTNPDIRIITAESIGKIGSEKAISYLIQSLQDTEVKVRVTATIALGEIGLEDVIPDLV
FT                   NVCSDEDDSVRFSAVDALGKIGSRYAVN"
FT   CDS_pept        complement(691920..692093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07960"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07960"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00618"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQF9"
FT                   /protein_id="BAG00618.1"
FT                   /translation="MKHDSLKILHLFRKKSHKTPILPTFHIYSASPNYSIHNGKTENIS
FT                   LNESDTSNSIPP"
FT   mobile_element  complement(691998..692213)
FT                   /mobile_element_type="MITE:MaeMITEe003"
FT   CDS_pept        complement(692775..693353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07970"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00619"
FT                   /db_xref="GOA:B0JQG0"
FT                   /db_xref="InterPro:IPR002472"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG0"
FT                   /protein_id="BAG00619.1"
FT                   /translation="MNPVVLVHGFLATTAVFKPMSEYLNYHGWQVHSFNLIPNHGYEKL
FT                   EVLAGQVDNYIEKNFAKEQKVDLIGFSMGGLITRYYLQRLGGVERVQRYLNISAPNRGT
FT                   LTAYSLPLDGIRQMQPGSQFLEDLNQDCQQILNKIKTTIIWTPYDLMIFPAHSSRLSVG
FT                   KEISIPVLLHAWMVKDSKVLTTIKETLLE"
FT   CDS_pept        complement(693463..693861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07980"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00620"
FT                   /db_xref="GOA:B0JQG1"
FT                   /db_xref="InterPro:IPR025310"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG1"
FT                   /protein_id="BAG00620.1"
FT                   /translation="MSNETVTYSLEAVLTRIEGKIDSLEKRIDEKIDSLEKRIDEKIDS
FT                   LEKRIDEKIDSLENRIDERFDKVEDRLTKVEIGQAELKGDIKALDEKINGLTARVAYQE
FT                   FTNRGILIALVVAILGGAAKLFGFFPNP"
FT   CDS_pept        complement(694042..695532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_07990"
FT                   /product="putative peptidase M"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_07990"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00621"
FT                   /db_xref="GOA:B0JQG2"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG2"
FT                   /protein_id="BAG00621.1"
FT                   /translation="MVNISSEIAAVAVIFLVAGAILTWSFYRAKPYGQLGILAWLQSLV
FT                   LIAPWLIFFGLFAAGIYLNLAVILFLLVASTIIYIYLGNRLRLLKTNQIIEPKVNQAVS
FT                   QSVTPLEIPAAVTAIVPDVMPIPEEDLKVIQSIFAIDTFFATETISFQEGAIFKGNLRG
FT                   DPDIVHSRLTQKLSNNFGDKYRLFLVEGTEEKPVVIILPKTNDPSPATLAQKNLSLVLL
FT                   VATIVTSLEAAGILLGFDLFGNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLS
FT                   LPYFLPTWQIGSFGAITRFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSAS
FT                   LFQIPSTFFQSSILVSFLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLD
FT                   GGRIVQAIYGRKIARRTTVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNE
FT                   LTEPDDTRAGWGLLLLFLMLATLIPLSPSLAGRLGIGG"
FT   CDS_pept        complement(695560..696480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08000"
FT                   /product="N-acetylmuramic acid 6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08000"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00622"
FT                   /db_xref="GOA:B0JQG3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQG3"
FT                   /protein_id="BAG00622.1"
FT                   /translation="MEQWESRGHLLTEQINPNSLNLDQLNPLELVDLFNREDAQTLKAI
FT                   AMARQELALGISLTSQALAKGGRLFYIGAGTSGRLGVLDAAECPPTFCTPPELVQGIIA
FT                   GGAAALVRSSEDLEDKAEDGAAIIAQREIHELDVVVGITAGGTTPYVHGALQAAKQRGA
FT                   TTIAISCVPAEQVEIAVDVDIRLLTGPELLAGSTRLKAGTVTKMALNILSTGTMVMLGK
FT                   VYGNQMVDVAVTNHKLHDRALRIICHLTDVSREEAAILLEKSGRRVKLALLMQKTGLSA
FT                   AAGQELLQKHRGQLRAALQAYNQID"
FT   CDS_pept        696676..697065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl21"
FT                   /locus_tag="MAE_08010"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08010"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00623"
FT                   /db_xref="GOA:B0JQG4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQG4"
FT                   /protein_id="BAG00623.1"
FT                   /translation="MSYAIIETGGKQIRVEPGRYYDIELLPVDEQSTHTIDKVLLIHDE
FT                   DDISIGQPFIEGATVEGTVIQHRRGKKVIVYKMRPKKKTRKKRGHRQEITRFMIDSINY
FT                   NGKTLVATAATSSAEVVEDSSDEEE"
FT   CDS_pept        697100..697369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl27"
FT                   /locus_tag="MAE_08020"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08020"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00624"
FT                   /db_xref="GOA:B0JQG5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQG5"
FT                   /protein_id="BAG00624.1"
FT                   /translation="MAHKKGTGSTRNGRDSRSQRLGVKRYGGQVVKAGNILIRQRGTKV
FT                   HPGKNVGRGGDDTLFALIDGVVKFEYKDKSRRQVSVYPAEVSAS"
FT   CDS_pept        697517..698449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08030"
FT                   /product="putative phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08030"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00625"
FT                   /db_xref="GOA:B0JQG6"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG6"
FT                   /protein_id="BAG00625.1"
FT                   /translation="MILKIADILKNLPWSFNSTAELPWLERSQAEKSLQKARQQRRISE
FT                   REYQLLDHWRELGYCIVKDLIPATAIDNLVAELADLFFLESAIPGLRIEGIQAENLPAS
FT                   LSHDQVLALDIEQRKALVNSIWRLHGFHEISPAAQAIFDNQNLKDLVNLIIGKSCEPRY
FT                   SINFLHGTEQGLHEDMAVFYVHPANHLVGVWIALEDISADAGPLIFYPKSHKNIKVTDF
FT                   FPDYPAVNLKNITAAQIPQYQDYVNQRAQNYDCQSFTAKKGEILLWHGMLIHGGGKINN
FT                   TLLTRKSMVIHFIAEGGDYNDRALGPFNW"
FT   mobile_element  complement(698522..698744)
FT                   /mobile_element_type="MITE:MaeMITEd003"
FT   CDS_pept        698523..698693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08040"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08040"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00626"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG7"
FT                   /protein_id="BAG00626.1"
FT                   /translation="MLKKFFLGVGVRSQESGAGRFRLCCPCFLYQAMYYKKDNARFLKV
FT                   PILFSCTNIGL"
FT   CDS_pept        complement(698733..699011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08050"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00627"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG8"
FT                   /protein_id="BAG00627.1"
FT                   /translation="MPSRDWRLRLQDILESISEIEQRTKAMTFEEFAKNQTNIKAVLYD
FT                   FIIIGEATRNVPKEIQSRYPLIPWRLMAGMRNVATHEYFQVNLSRAC"
FT   CDS_pept        complement(699001..699291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08060"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00628"
FT                   /db_xref="GOA:B0JQG9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQG9"
FT                   /protein_id="BAG00628.1"
FT                   /translation="MKRDEVLAILEAHREQLQKLGVKSLSLFGSVARDEADADSDVDLL
FT                   VEFDRQGGFFQLLQVQYYLEDILGCSVDLGTQDALREHLREPVLEDLINAF"
FT   CDS_pept        complement(699422..700411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="MAE_08070"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08070"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00629"
FT                   /db_xref="GOA:B0JQH0"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH0"
FT                   /protein_id="BAG00629.1"
FT                   /translation="MTKNETTEKKIFLLDFEKPLYELESRIEQIKELAQENSVDVSEQI
FT                   TQLDERANQLRREIFSNLTPSQRLQLARHPRRPSTLDYIQAITDEWFELHGDRGGYDDP
FT                   ALVGGVARFNGRPVVIIGHQKGRDTKDNVARNFGMAAPGGYRKAMRLMEHAHQFNQPIL
FT                   TFIDTPGAWAGVEAEKLGQGEAIAYNLREMFRLDVPIICTVIGEGGSGGALGIGVGDRL
FT                   LMLEHSVYTVATPEACAAILWKDAKKSDKAAVALKITSKDLKELNIIDQIVPEPSRGAH
FT                   ADPIRAAANLKAAISENLEALSLLTPQQRRESRYQKFRNLGVFLEATA"
FT   CDS_pept        700773..701720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08080"
FT                   /product="spermine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08080"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00630"
FT                   /db_xref="GOA:B0JQH1"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH1"
FT                   /protein_id="BAG00630.1"
FT                   /translation="MAGSELKADLWVNEYITPWDIYSHGVSRILAYKKTAFQEMYIVES
FT                   GAYGKALVLDGKWQSCTGDEFIYHEALVQPAMIAHQEPKTALILGGGEGATTRELLRWK
FT                   TIEKVMMIDIDGDVVAACKEHLPEMHQGTFDDPRFQLVVADALEVLDTTNDQWDIIISD
FT                   LVDPIEEGPSFPLFTKEYFEKLQRVLAENGIVVVQSGPVSPPSVMYHARLVNTLKAVFP
FT                   YVHSYCAPTPSYGSPWGFTLCANHPLNTRPDPDVVDELISDTTTGGLRLIDGMSLLGML
FT                   QTPLYIRQAIAQNTEVYTLAKPPKFFGQGVISDQ"
FT   CDS_pept        complement(701790..704072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="MAE_08090"
FT                   /product="single-strand-DNA-specific exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08090"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00631"
FT                   /db_xref="GOA:B0JQH2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH2"
FT                   /protein_id="BAG00631.1"
FT                   /translation="MSNWQIPPSVSLPQEFLKIVQDYTPESDGSVVAQILWHRGVRDMA
FT                   TLGTFLDEKAYQSKTPFDFGQEMNFAVKRLEKALNKGEKVTIWGDFDADGVTATTVLWE
FT                   GLGQFFPADQQLDYYIPDRQKESHGLNCPGIEKLAHQGTSLIVTCDTGSTNIAEIDYAN
FT                   SLGIDIIITDHHTLPDERPEVIALINPRYFVETHPFYHLSGVAVAYKLVEAMYLTLADI
FT                   PRKPLENLLDLVAIGLIADLVKLTGECRYLAQKGLKKLQNTQRLGVKKLLDLCNKTGDR
FT                   PMDISFGIGPRINAVSRIYGDARFCVELLTSEDEKRCHELAEQAELANIRRQEIQRDII
FT                   KQVQKKLERIDLSTTNVIILDDPQWMAGILGLVAGQIAQEYQRPTILLSTSEPPFAKGS
FT                   ARSIREIDLYQLVSSQSHLLHRFGGHPLAAGLSLALENLPLFIEGINQQLRRTGIDLTS
FT                   LSSEIEVAAVVTVSQLGKSLFRELKLLEPCGMGNPTPKLLIQNCYFHNLWHKNLEDFKG
FT                   RKIAYPRTTFEIWDSSIEQGFPGMWWGHHKDEIAADTRYDAVVELDFNTYKNRYEVRLI
FT                   ALHPYQQESLTYSNKKDFLIDNRHREISQEVSQLNPLFLWECPRDWTKLSREYQQAILR
FT                   DKKLVLAYASPLKKSAHTTWINLVGIGKYLARTKTSISCQQLQNRLNLSYHTLELGLIS
FT                   LAENGFKVKKNQENLSFELVNHEAKINKIEQFLEAVALENFLQQYFATVPLEILQAILN
FT                   HEDSIDF"
FT   mobile_element  complement(704133..704334)
FT                   /mobile_element_type="MITE:MaeMITEe004"
FT   CDS_pept        complement(704349..704603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08100"
FT                   /product="thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08100"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00632"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH3"
FT                   /protein_id="BAG00632.1"
FT                   /translation="MEKITITVKLFAIYQEVYQTSQLNLEFPAHTSVTEVLNYIIAPYP
FT                   QLERWRDVTRFGVNLQFVSGEKILKNGDEIVLIPPVSGG"
FT   CDS_pept        complement(704623..707646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08110"
FT                   /product="exonuclease SbcC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08110"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00633"
FT                   /db_xref="GOA:B0JQH4"
FT                   /db_xref="InterPro:IPR004592"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH4"
FT                   /protein_id="BAG00633.1"
FT                   /translation="MIPLQLTLKNFLSYREAVLDFRGLHTACICGANGAGKSSLLEAIT
FT                   WAIWGESRTSIADDVIHAGSDYARVDFEFSYGGEIYKIIRSRHRGGKASGLDFQVINDQ
FT                   SFRPLSGKSIKDTQAQINTYLKIDHKTFINSAYLRQGQADEFMKQPPSGRKQILAELLQ
FT                   LDRYEILANKAKDISKQFDGQSLQIEQQVETIKLRLQEKNSYQQQLQELSTQINQINQE
FT                   QEVNNRRLQQLQGEENQRQNWEKQLQWQREQERALLAEIERLDREKVSLDNQLNQIRTI
FT                   LHRKNDIITAHERLINLDKKEASLSSQLQAWQQAQYDKQQLEQKLQQKINEFTLPIQQT
FT                   SARLEELGRQEQETQKIIEQAGDIQAGLEKLNYHRQRLQELDRLALKYAPLNSRKADLN
FT                   MQLEREKAKINARWEQLQRNRQQLETEIARIPLLREEALNLAKRIKELDKKQTYCERVE
FT                   EKETLKQVDKKSLLEQQKRYEEQLLELTDKLEKLNIPDSVCPLCEQNLDSHHRHQVIRK
FT                   THQHQEQIQEQIWSLQERMADCDRDLKRLGEELAQIKQELPARSNLQQKYVQLEVKLET
FT                   IEEKEIELEKTEEILVQLEALLSSGNYALELQQELQIVNQEIAFLNYDEQSHALVRGEE
FT                   KRWRWAEIQESELKQANRRLANIKAEKPNLINQLARLEQEKQELGQNSPLKQEVERLEK
FT                   FIQNLNYDRSEHQNIQNLIRQLQGVRLQYQDWQQAEKNYPEIAAKIAEIEQRLQLRNQD
FT                   RQKLNQELANISQKIGTLTDYRQEIAALSTNIQQRRQIIDGLLSQKGRVEEKLHQLETL
FT                   GKQLTEKEGDLAKVKKQYTVYKELAIAFGKNGLQTLMIENILPELEAQTNHILARLTGN
FT                   QFHVQFLTQKSGKGTKKQRQKLIDTLDIIIGDTRGSRPYETYSGGEAFRINFSIRLALA
FT                   RLLAQRAGTALQMLIVDEGFGTQDAEGCDRLIAAINAISADFACILTVTHMPQFKEAFQ
FT                   HRIEVRKTEQGSQLMLLS"
FT   CDS_pept        complement(707762..707989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08120"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00634"
FT                   /db_xref="InterPro:IPR018739"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH5"
FT                   /protein_id="BAG00634.1"
FT                   /translation="MNIEQAVIENLRKLPLEKQQEVLNFSQFLTQRTSPKIAEMTSHEK
FT                   AEDWLKFLESQPKDTPGLPDEALGRETIYD"
FT   CDS_pept        708195..708533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08130"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00635"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH6"
FT                   /protein_id="BAG00635.1"
FT                   /translation="MSIPEISVHELALRLADHDPNLQLIDVREPEEVAMASVANFTILP
FT                   LSQYQEWSPTIASQFNPQAETLVICHHGMRSLQMCQWLQSQGFTNVKNINGGIDAYSLL
FT                   VDPNIPRY"
FT   CDS_pept        708691..709767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="MAE_08140"
FT                   /product="heat-inducible transcription repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08140"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00636"
FT                   /db_xref="GOA:B0JQH7"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH7"
FT                   /protein_id="BAG00636.1"
FT                   /translation="MSARNHLSDRYQHILKATIQHYIATAEPVGSKTLLEEYKFTVSSA
FT                   TIRNALGKLEKEGLLYQPHTSSGRIPSDWGYRLYVDELMTPDDRIGEKIGYYLHQNAKS
FT                   PAWSLESLLQRATQLLAGLSGYIAIVTLPHTLTNTLRHLQLVPVSDRQIMLIIVTDSLQ
FT                   TRSVMIEIPESMATDKKDGLAEELQILSNFLGEKLKGYCLADLINLDWQQIEREFTRYT
FT                   HFLQQLSQEIGASLQSTATPEIIVHGVAEVIRQPEFAQWQQVQMLLHLLEAEQDRLLPL
FT                   ILQRPEPEKSAKKVKITIGSENPLESMRPCTLISAFYKQGDTPVGSVGIIGPTRMLYEN
FT                   TIPLVESTANYLSEAISK"
FT   CDS_pept        complement(709754..710047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08150"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00637"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH8"
FT                   /protein_id="BAG00637.1"
FT                   /translation="MRAIAKDDILYIHHEDVPVYKKGGSVVRNSYFWALKSIACGARRG
FT                   QDWEFDAEVWVALVRMLLCFANSGYLGDGETILEFTVDCPIPEPLRGISTYL"
FT   CDS_pept        complement(710044..710205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08160"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08160"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00638"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQH9"
FT                   /protein_id="BAG00638.1"
FT                   /translation="MKTPGFEARFSQNLAPVSQEKPQNPYHAYISHLFSQPYLGQSAEN
FT                   SRNLPSHR"
FT   mobile_element  710094..710292
FT                   /mobile_element_type="MITE:MaeMITEe005"
FT   CDS_pept        710424..710819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08170"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08170"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00639"
FT                   /db_xref="GOA:B0JQI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI0"
FT                   /protein_id="BAG00639.1"
FT                   /translation="MKSYPVEFRQKILDCYYNEPISQRQLAKRFCVTLSFVQKLLKQYR
FT                   ETGDLRPKTYRCGRHLKLTPEQMIVLGTLIEENNDATLAELSKLFLERTGIVLSVATVA
FT                   RIAERLGITRKKNYTTTRKRDRKSTTT"
FT   CDS_pept        complement(710951..713947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08180"
FT                   /product="adenine specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08180"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00640"
FT                   /db_xref="GOA:B0JQI1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI1"
FT                   /protein_id="BAG00640.1"
FT                   /translation="MSRLLISQYQAEVEKIVQYGGSRKETSIRVAFQNLLNDYCKARDF
FT                   LLIPELDYRTKSGKVVYPDGTVKDALRLDWGYWESKDQYDNLDEEIEKKLAKGYPNDNI
FT                   LFEDSQTAVLIQGGEERLRVSMRDDEALDGIINAFINYVRPEVEDFREAIDSFKEDLPT
FT                   ILEALRDLIALQSETNRNFVTARDNFLEICRKSINPEISLEDVREMIIQHILTEDIFIN
FT                   IFNESQFHRENNIARELQGVIETFFTGNTKRNTLGTIERYYAVIRRTAANIYNHHEKQK
FT                   FLKAIYENFYKAYNPKAADRLGIVYTPNEIVRFMIESVDYLVHKHFRKLLADPGVEILD
FT                   PATGTGTFITELIEYLPKDKLRYKYKHEMHCNEVAILPYYIANLNIEFTYKQKMGEYEE
FT                   FEHICFVDTLDHAAFHLKQMDLFAMSVENTQRIQNQNDRNISVIIGNPPYNANQQNEND
FT                   NNKNRKYPAIDKRIKDTYIEESTAQKTKLYDMYSRFFRWATDRLGENGIIAFITNSSFI
FT                   DARTFDGFRKVVENEFSEIYIIDLGGNVRKNPKLSGTTHNVFGIQTGVAISLIVKRESN
FT                   NLPCRILYTRRPELDTASQKLEFLSSTKLNQLDFEHIIPDKKHNWIEQSDNDFNDLIPV
FT                   VDKNTKLLKNKTDIQALFEFFSLGVSTNRDEWVFEDDEQLLSKKMQYFISIYNKSIECN
FT                   HINYSIKWSSSLISKFKNKEKSEYFPRFVISLIYRPYITKYYYSNKFFSDRLTSNHYQV
FT                   FGNELINSNQVIMFSGVGSSKPNSVLVTNKIFCLDTLEKTQCLPLYYYEKEGNRIDNIT
FT                   DWGLQQFQNHYNDKNLTKLDIFHYTYAVLHYPEYRSKYELNLKREFPRLPFYDNFSQWV
FT                   EWGSKLMELHINYETVAPYPLTRIDTNNNLKPKTKLKADREKNSINLDDVTFLQDIPKI
FT                   AWEYKLGNRSALEWILDQYKEKKPKDQTIAERFNNYRFADYKETVIDLLQRVCTVSVET
FT                   MKIIEAMRH"
FT   tRNA            complement(714114..714187)
FT                   /locus_tag="MAE_t002"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCG"
FT   CDS_pept        714289..715164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08190"
FT                   /product="lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08190"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00641"
FT                   /db_xref="GOA:B0JQI2"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI2"
FT                   /protein_id="BAG00641.1"
FT                   /translation="MTVKPEWLRVKAPQWQRVGSVKEVLRDLGLNTVCEEASCPNIGEC
FT                   FHAGTATFLIMGPACTRACPYCDIDFEKKPQPLDPTEPLRLAAAVQRLDLNHVVITSVN
FT                   RDDLADGGASQFVRCIEEIRRISPKTTIEVLIPDLCGNWQALALILAAKPEVLNHNTET
FT                   VPRLYRRVRPQGDYQRSLELLQRARAIVPATYTKSGIMVGLGETDEEVRQVMRDLRAVD
FT                   CDILTIGQYLQPSPKHLGVQEFITPEQFHAWREYGESLGFLQIVASPLTRSSYHAEQVR
FT                   ALMNLYPRES"
FT   CDS_pept        complement(715127..715720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08200"
FT                   /product="HAM1 protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08200"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00642"
FT                   /db_xref="GOA:B0JQI3"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI3"
FT                   /protein_id="BAG00642.1"
FT                   /translation="MKKLILATSNPGKLAEIGEYLTDIDLELQLKPDDLEIEETGATFA
FT                   ENAYLKAAQIALTLGEWSIADDSGLEVTGLGNAPGIYSARYGENDRERIDRLVRELGDN
FT                   QDRSARFVCVIAIARPDGEIALTATGICTGEILTSPRGKGGFGYDPIFYVPEYALTFAE
FT                   MSPELKRKISHRGRAFQQLLPHLKTLAGTNSLRL"
FT   CDS_pept        complement(715926..716141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08210"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08210"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00643"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI4"
FT                   /protein_id="BAG00643.1"
FT                   /translation="MRYRVLGFEESGVRSQDSGFRSQDSGFRIRDSGVKILVYLMRLGN
FT                   AIFFHLHKYTQSQTSEPSILDVFVLP"
FT   CDS_pept        716383..716826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="MAE_08220"
FT                   /product="molybdopterin (MPT) converting factor subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08220"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00644"
FT                   /db_xref="GOA:B0JQI5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI5"
FT                   /protein_id="BAG00644.1"
FT                   /translation="MTQDSFRVSFAPLSLQEVYQLADDGANGAIVLMSGTVREQTDGKP
FT                   VIYLDYQAYEPMAIEVFRQIAGQIRQTWPDTNRVVIHHRTGKLQIGEISVLVAVGCPHR
FT                   GEAFAACRYAIDTLKHNAPIWKKEYWSDGSSQWVSIGACETAH"
FT   CDS_pept        complement(716829..717908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08230"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00645"
FT                   /db_xref="InterPro:IPR041289"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI6"
FT                   /protein_id="BAG00645.1"
FT                   /translation="MITRQELKKLQSLTQIPALSILLPTHRTSPDNKQDPILVKNLVDE
FT                   AKRRLSAEFSKREIEPLFERLDSLVAEIDYPYTLDGLALYIGPDIAKLYNLPFSVQARV
FT                   VIDKTFATRDLVYGLHREQPYWLLLLSQGSTRLISATGETLEEIRDQNFPLEMTGPGAT
FT                   APLPFDADTSYLDDRIRRFFQQVDNALGEYIDIDDSSPLIVGGVVRQISFFQEVSQYTS
FT                   AIVGTLTGNFDKTSLPELIPQVLPIMHSVRQTQKTEALQALDAAVSAQKVISTLGEVWR
FT                   LAQEGRGKLLLVDKNYHVPAVLSENGDLILVENVGGTEVIDDAVDEIIEVVLAKGGRVA
FT                   LVDEDSLNDYQKIALILRY"
FT   mobile_element  718178..718381
FT                   /mobile_element_type="MITE:MaeMITEa021"
FT   CDS_pept        complement(718388..719950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08240"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00646"
FT                   /db_xref="GOA:B0JQI7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI7"
FT                   /protein_id="BAG00646.1"
FT                   /translation="MRALLIYPVFPPTFWSYNKILELVDRKVLLPPLGMVTVAAILPQQ
FT                   WEFKLVDRNIRAVTEAEWDWAEIVILSGMIVQRQDLIEQIHEAKQRGKLVAVGGPYPTS
FT                   IPHEVAEADFLILDEGEITIPMFVEALARGETKGVFRTTEKPDVTITPIPRYDLLDFEA
FT                   YDSMSVQFSRGCPFQCEFCDIIVLYGRKPRTKTPAQLLKELDYLYELGWRRGVFMVDDN
FT                   FIGNKRNVKLLLKELKVWQEEHQYPFRFNTEASVDLAADPELMEMMVDCYFDAVFLGIE
FT                   TPDEESLQLTKKFQNTRSSLTETVEKIIKAGLRPMAGFIIGFDGEKKGAADRIINFVEE
FT                   AAIPTALFGMLQALPNTALWTRLEKEGRLRLTGKQDINQSTLMNFVPTRPIEDIATEYI
FT                   EAFWKLYDPEVFLDRTYRCFLKLGAPKAKPAFKLPRRADLYALAVIIWRQGFKRSTRWK
FT                   FWQNLFGILRHNPANAEHYITVCAHNEHFLEYRQIVRDEIMAQLAEFQRQEALTSEKTA
FT                   IAA"
FT   CDS_pept        720227..720370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08250"
FT                   /product="CAB/ELIP/HLIP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08250"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00647"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI8"
FT                   /protein_id="BAG00647.1"
FT                   /translation="MDKQENKLGFTAFAENWNGRLAMLGFVIGVATEYLTHKGILAQLG
FT                   LM"
FT   CDS_pept        720674..721969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="MAE_08260"
FT                   /product="glutamate dehydrogenase (NADP+)"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08260"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00648"
FT                   /db_xref="GOA:B0JQI9"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQI9"
FT                   /protein_id="BAG00648.1"
FT                   /translation="MSKSLFTDASSRLERALKYVSISDDAIERLKYPKASLSVSIPVRM
FT                   DNGTLRIFQGYRVRYDDTRGPGKGGVRYHPNVSIDEVQSLAFWMTFKCALLDLPFGGAK
FT                   GGITLNPKELSKAELERLSRGYIEGIADFIGPDIDILAPDVYTNEMIMGWMMDQYSIIQ
FT                   RKISPAVVTGKPLTMGGSRGRDTATGTGAFHVINSLLPKLDKKPANTTVAVQGFGNAGA
FT                   VVADLLAKAGYQVVAVSDSQGGIYREKGLDIASIREYKQEHRGITAIYCEGTVCNIVEH
FT                   EAISNEELLALDVDVLIPAALENQITAENADRVRAKYIFEVANGPTTSEADRILDSKGI
FT                   LVFPDILVNAGGVTVSYFEWVQNRSGLYWRLNEINERLKERMVTEAEKVWSFAQEFDIS
FT                   LRNAAYAQAIARLGEALDAKGTRDYYQNKTRA"
FT   CDS_pept        722108..724840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08270"
FT                   /product="cation-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08270"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00649"
FT                   /db_xref="GOA:B0JQJ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ0"
FT                   /protein_id="BAG00649.1"
FT                   /translation="MPVQLSLPLYHQLSQPEVIEYLTSDGSAGLSAEEVASRYEKYGPN
FT                   ELRFKPGKPAWLRFLQQFHQPLLYILLLAGTIKAFLGSWTNASVIWGVTLINAIIGYVQ
FT                   EAKAEGAIASLAKAVTTEATVLREGQTLRIPSQDLVPGDIVLLASGDKVPADLRLLKVR
FT                   NLQVDESALTGESLPGSKAIEPLPGDTPLAERTNMAYAGSFVTFGQGKGIVVSTANATE
FT                   VGQISQSMESRVSLSTPLTRKFAQFSRTLLYAILTLATLTFAIGLGRGKSWIDMFEAAV
FT                   ALAVSAIPEGLPAVVTITLAIGVNRMARRNAIIRKLPAVEALGSATVICSDKTGTLTEN
FT                   QMTVQSIYTEGQYYAVSGGGYSPKGEISLITDGNPGSPFAEELPPALGDCLVAGLLCND
FT                   SGLKQTGEDWSVVGDPTEGALIAAAAKAGLSQLGLLSLTPRLDAIPFESEYQYMATLHD
FT                   GIPRLIYVKGSVESLMRRCSQMIDRYGQMTALNAQQIEQAVETMAEQGLRVLAFAKKAA
FT                   ASHQHSIDHEDIETGLVFLGLQGMIDPPRPEAIAAVHACQTAGIRVKMITGDHLVTARA
FT                   IAERMGIKTAAQVLAFEGKQLAQMDNHQLAQAVEDGSVFARVAPTQKLQLVEVLQSQGE
FT                   IVAMTGDGVNDAPALKQADIGIAMGKGGTEVARESADMLLTDDNFASIKAAVEEGRTVY
FT                   QNLRKAISFLLPVNGGESMTILISTLLARDLPILSLQVLWLNMINSVTMTVPLAFEAKS
FT                   PGIMQSPPRNPNEPLITKKLLRRILAVSLFNWILIFGMFEWAKSTTGDIAVARTMAIQS
FT                   LVAARVIYLLSISQLGMSLVNYLRRQSTSITNAPILILGIVAAVALQILFSQWGVMNSL
FT                   FATATLTGHQWLICLLPMPLMVLWAIFANVIDPPHCHGK"
FT   CDS_pept        complement(724884..725918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="MAE_08280"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08280"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00650"
FT                   /db_xref="GOA:B0JQJ1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0JQJ1"
FT                   /protein_id="BAG00650.1"
FT                   /translation="MRRLTMTRPDDWHLHLRDGAAMKAVLPHTVRQFARAIIMPNLKPP
FT                   VRSVADAASYRERILAAVPEGQQFEPLMTLYLTDNTSPEEIVAAKASQFVKAVKYYPAG
FT                   ATTNSDLGVTDLRRCDGVLAAMEQVDMPLLLHGEVTDGDIDVFDREKVFIEKHLIPLIT
FT                   RFPKLRVVFEHITTADAVKFVLSANNNVAATITPQHLLFSRNILFTGGIRPHFYCLPIL
FT                   KREDHRLALLQAATSGNPKFFLGTDSAPHSRYSKESSCGCAGCYSALHALELYAEAFES
FT                   VDAIDQLEGFASFHGPDFYQLPRNTEQITLTKSPWRIPDELPFPESGLVPLRAGEEITW
FT                   QLGE"
FT   mobile_element  complement(726028..727450)
FT                   /mobile_element_type="insertion sequence:ISMae36_5"
FT   CDS_pept        complement(726055..727269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08290"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08290"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00651"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ2"
FT                   /protein_id="BAG00651.1"
FT                   /translation="MILDKFLNLKGTCIQGYLHLENIGIVCRIESKNQKATCPRCGLES
FT                   DKLHQNHRHLVKDLPISGQPVYLQINRRQFKCDNCQRPLSEELDFVAKKRTYTKRLAAN
FT                   ILEQLKEGDILNVSRINDVTEEEIQRMIEDIAEEITEPDLSELKRLGIDEIALVKGQKN
FT                   YCAVLVNLDTGKLIAILEKRTQEELRETLTGWGKEVLEQIEEVSIDLWLPYKNLVKELM
FT                   PSAEVVADRFHVMKQINQELDEQRRAEKRAVEAQKNKKQKAEKEAKLEVLKRSKYSLLK
FT                   NEEDLTEPQKIKLEAIKEKFPNLKKMQELKEELRTIYETSNNPTEGLLSISEWLAKSSS
FT                   VFTKSCQTIRNWFGEIISYFERRTTNGVVEGINNKLKLIKRRGYGFRNFRNFWVRSMLS
FT                   WHLVC"
FT   CDS_pept        complement(727530..727694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08300"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08300"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00652"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ3"
FT                   /protein_id="BAG00652.1"
FT                   /translation="MCAQNLIFLSLSCLKMRGSQAGTDSHYINKYMSSAGILSRGIIVT
FT                   VKSISPLSR"
FT   CDS_pept        complement(727720..727893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08310"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08310"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00653"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ4"
FT                   /protein_id="BAG00653.1"
FT                   /translation="MLGFCQEELSSAISPENNMIVLIVEAHRVRPKFNLDISPQWDFVK
FT                   GNYPLQSLQRII"
FT   mobile_element  728057..730131
FT                   /mobile_element_type="insertion sequence:ISMae31_12"
FT   CDS_pept        728227..729885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08320"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08320"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00654"
FT                   /db_xref="GOA:B0JQJ5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ5"
FT                   /protein_id="BAG00654.1"
FT                   /translation="MNQSTEIEVKNLDHLGLVAGIIDEIGIVEIINEQVSIERGEIVTA
FT                   GQVVKAIILNGLGFVSRALYLFPQFFEDKATEHLLGEGIEPKHLNDDKIGRVMDKLYQL
FT                   NVSVIFLRISLAAVKKFGVATENSHLDSTSLSVEGEYKKEYPTVEILKSGAVGEEIETR
FT                   QQPIKITYGYSRDRRPDLKQFMIDLIVSGDGDVPLFLKVGDGNEADKAVFGQIAREFKK
FT                   QVDFDSLIVGDSALYSKENLKLMKEMRWLSRVPLSIKEAQELVDSISEKELTDSEIPGY
FT                   SWRETISNYGGIEQRWLLVESQARQESDLKKLEKKIEQEKKTAQEKIRQLSRREFENRA
FT                   VALAIVKGLSDSLKYHQLTEIKVNLIPPESQQSKLKSKDDLPSQSYQVQAELELNLAAI
FT                   ERLKKRAGRFVLATNNLEKKRLSSEDILKKYKGQQAPERGFSFLKDPCFFAHSVFLKSP
FT                   HRIEVMAMLMGLCLLVYTIGQRQLRLNLKQQETGLKNQLGKLTDRPTLRWIFQNFQGIH
FT                   LLRIQDNQKISNLTDERRNILRFFPKPCQEYYLLS"
FT   CDS_pept        730162..731859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08330"
FT                   /product="DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08330"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00655"
FT                   /db_xref="GOA:B0JQJ6"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ6"
FT                   /protein_id="BAG00655.1"
FT                   /translation="MQSIPLISMVNKLYYGDNLEVLRKYIKDESIDLCYIDPPFNSKRN
FT                   YNQIYNNLGKEDQAQAQAFVDTWTWDNHANEALEEIQSNYQGKFTSQTIDLIDGLTKVL
FT                   GKGSLLAYLVSMTLRIVEIHRVLKSTGSFYLHCDPTASHYLKIVLDTVFCPQGGDFKNE
FT                   ISWKRTTAHNDAKQGQKQYGNIRDVILFYTKSNRWNWNCQYSSYSEEYIEKNYRLVEEK
FT                   TGRRYCLDNLTAAKSGGDVSYEFYGTYPYKGRYWAYSKENMEKFMAEGRLYFPKNGGPP
FT                   RYIRYLDEMPGVTLQNNWDDIFPLTSSAKERLGYPTQKPEALLERIIKASSNKGDVILD
FT                   AYCGCGTTIAVAERLERNWIGIDITYQSISLMLKRLEDSFGKNVLDKIELNGIPKDLES
FT                   AKALATKPDDRTRKEFEKWAVLTYSNNRAVINDKKGADKGVDAIAYFQGDKDNREKIVF
FT                   QVKSGNVKSGDIRDLQGTMTLQGAALGIFITLKPPSKDMIQTAKSAGIYRGRYMSQSVD
FT                   KIEIVTVQEILEQKKRLDVILTFEVLKAAEKQRETQGQQMSLDIPFPE"
FT   CDS_pept        732082..732936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MAE_08340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MAE_08340"
FT                   /db_xref="EnsemblGenomes-Tr:BAG00656"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:B0JQJ7"
FT                   /protein_id="BAG00656.1"
FT                   /translation="MYDSTCKFIALEYSRDLATWLLGKPLELTEIKPSELSLEPIRADT
FT                   LIFLESEELILHIEFQTDPKEDIPYRMLDYATRLYRRYPRKPIHQVVIYLRKSGSPTVR
FT                   QNDYKQGKTSHQFEVIRLWEQPSEPLLKAPGLFPFAILAQAEKQENLLRQIAQEIEQIS
FT                   DSREQSNLAASTAILAGLVLEKDIIQRLLRKDIMKESVIYQEIWSEGLQEGRQEGRQEG
FT                   RQEGEANLVLRQLNRRVGDISPELLPNIRSLDLEQLENLGEALLDFQSLQDLEQWLENC
FT