(data stored in ACNUC7421 zone)

EMBL: AP010804

ID   AP010804; SV 1; circular; genomic DNA; STD; PRO; 681892 BP.
XX
AC   AP010804;
XX
PR   Project:PRJDA19949;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 6)
XX
DE   Sphingobium japonicum UT26S DNA, chromosome 2, complete genome.
XX
KW   .
XX
OS   Sphingobium japonicum UT26S
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Sphingobium.
XX
RN   [1]
RP   1-681892
RA   Nagata Y., Ohtsubo Y., Oguchi A., Ankai A., Yashiro I., Fukui S.,
RA   Kamata S., Takahashi M., Ichikawa N., Tanikawa S., Tsuda M., Fujita N.;
RT   ;
RL   Submitted (04-JUL-2008) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institure of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RX   DOI; 10.1128/JB.00961-10.
RX   PUBMED; 20817768.
RA   Nagata Y., Ohtsubo Y., Endo R., Ichikawa N., Ankai A., Oguchi A., Fukui S.,
RA   Fujita N., Tsuda M.;
RT   "Complete Genome Sequence of the Representative
RT   gamma-Hexachlorocyclohexane-Degrading Bacterium Sphingobium japonicum
RT   UT26";
RL   J. Bacteriol. 192(21):5852-5853(2010).
XX
DR   MD5; bbcdd9a957d945326e2e4d215eedcea1.
DR   BioSample; SAMD00060927.
DR   EnsemblGenomes-Gn; EBG00001155017.
DR   EnsemblGenomes-Gn; EBG00001155018.
DR   EnsemblGenomes-Gn; EBG00001155019.
DR   EnsemblGenomes-Gn; EBG00001155020.
DR   EnsemblGenomes-Gn; EBG00001155021.
DR   EnsemblGenomes-Gn; EBG00001155022.
DR   EnsemblGenomes-Gn; EBG00001155023.
DR   EnsemblGenomes-Gn; EBG00001155024.
DR   EnsemblGenomes-Gn; EBG00001155025.
DR   EnsemblGenomes-Gn; EBG00001155026.
DR   EnsemblGenomes-Gn; EBG00001155027.
DR   EnsemblGenomes-Gn; EBG00001155028.
DR   EnsemblGenomes-Gn; EBG00001155029.
DR   EnsemblGenomes-Gn; EBG00001155030.
DR   EnsemblGenomes-Gn; SJA_C2-r0010.
DR   EnsemblGenomes-Gn; SJA_C2-r0020.
DR   EnsemblGenomes-Gn; SJA_C2-r0030.
DR   EnsemblGenomes-Gn; SJA_C2-r0040.
DR   EnsemblGenomes-Gn; SJA_C2-r0050.
DR   EnsemblGenomes-Gn; SJA_C2-r0060.
DR   EnsemblGenomes-Gn; SJA_C2-t0010.
DR   EnsemblGenomes-Gn; SJA_C2-t0020.
DR   EnsemblGenomes-Gn; SJA_C2-t0030.
DR   EnsemblGenomes-Gn; SJA_C2-t0040.
DR   EnsemblGenomes-Tr; EBT00001744093.
DR   EnsemblGenomes-Tr; EBT00001744094.
DR   EnsemblGenomes-Tr; EBT00001744095.
DR   EnsemblGenomes-Tr; EBT00001744096.
DR   EnsemblGenomes-Tr; EBT00001744097.
DR   EnsemblGenomes-Tr; EBT00001744098.
DR   EnsemblGenomes-Tr; EBT00001744099.
DR   EnsemblGenomes-Tr; EBT00001744100.
DR   EnsemblGenomes-Tr; EBT00001744101.
DR   EnsemblGenomes-Tr; EBT00001744102.
DR   EnsemblGenomes-Tr; EBT00001744103.
DR   EnsemblGenomes-Tr; EBT00001744104.
DR   EnsemblGenomes-Tr; EBT00001744105.
DR   EnsemblGenomes-Tr; EBT00001744106.
DR   EnsemblGenomes-Tr; SJA_C2-r0010-1.
DR   EnsemblGenomes-Tr; SJA_C2-r0020-1.
DR   EnsemblGenomes-Tr; SJA_C2-r0030-1.
DR   EnsemblGenomes-Tr; SJA_C2-r0040-1.
DR   EnsemblGenomes-Tr; SJA_C2-r0050-1.
DR   EnsemblGenomes-Tr; SJA_C2-r0060-1.
DR   EnsemblGenomes-Tr; SJA_C2-t0010-1.
DR   EnsemblGenomes-Tr; SJA_C2-t0020-1.
DR   EnsemblGenomes-Tr; SJA_C2-t0030-1.
DR   EnsemblGenomes-Tr; SJA_C2-t0040-1.
DR   EuropePMC; PMC5144681; 27581378.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP010804.
DR   SILVA-SSU; AP010804.
DR   StrainInfo; 715801; 0.
XX
CC   "Nagata, Y., Ohtsubo, Y. and Tsuda, M. are at Department of
CC   Environmental Life Sciences Graduate School of Life Science,
CC   Tohoku University. The other authors are at NITE Genome Analysis
CC   Center (NGAC).
CC   Please visit our web site. URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE. The database
CC   contains genome sequence data, physical maps and the genomic and
CC   proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for the
CC   sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..681892
FT                   /organism="Sphingobium japonicum UT26S"
FT                   /chromosome="2"
FT                   /strain="UT26S"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 101211"
FT                   /db_xref="taxon:452662"
FT                   /culture_collection="NBRC:101211"
FT   CDS_pept        1..1203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SJA_C2-00010"
FT                   /product="plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98364"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z795"
FT                   /protein_id="BAI98364.1"
FT                   /translation="MTRAARTQINDQFELFLPYIADMPLRDQREMMERPFFSLAKTKRV
FT                   KPIDYTSPDGKAWVHVSANPDYGMATIWDADILIYCASVLADMARRGLNDVPRKLHLMP
FT                   YDLLRAIHRPTTGRAYELLGQSLDRLVSTTIKTNIRAENRREATFSWLDGWTQLVDERT
FT                   ERSRGMTIELSNWFYEGVLMQGGVLSIDRAYFDLTGGRERWLYKVARKHAGGAGEGGFA
FT                   ISMPTLFEKSGAEGAYRRFKFEIARIAERDPLPGYTVELEQPEGKREPSLRMRRRTQSD
FT                   PLPPTTTSRRTAATPQSAAAATHNNSAVRHPPADADMLVDAGGMIRRTLAGMSAKASAG
FT                   EITDATMATLRAEYPGWDYQTLHQEFRDWLDADPARTPVNYQKAFIGFVRRFHEKNRHR
FT                   L"
FT   CDS_pept        complement(1896..2825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98365"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z796"
FT                   /protein_id="BAI98365.1"
FT                   /translation="MHDFSASPDHALLVLGRLDGRLCNSPAADIWLARERLKGASMLSG
FT                   FAGVPVSVTELQNWICGRTPPPRHSEGLNDPLSVAALFHFALSASDDRDPIARATLNIS
FT                   RTLLDDRKEAGLWAPEDLVRFGPSWRMAQMLLEAPYPAGTLLGIAQRLIDARGSLDAPV
FT                   TEGHLVTTADGRQWRIDPRRFDMGWVLACHLPGALLAAGLSLRRLPSLVGLPRFLPDDA
FT                   GSLAKAIAAMIARQAGQGLIELDRLEAKLARLPKELRVTRRSKAPLLMRLELAYPGLGK
FT                   MAVARLLGISHQGATKLVAQVERLTGGH"
FT   CDS_pept        2873..3238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98366"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z797"
FT                   /protein_id="BAI98366.1"
FT                   /translation="MYMLGWGWIDGASCFEATLQAIAICHNKAMPASIIRHPLARWDES
FT                   VARRPRLFCRWRWPAEARGSPYTVWEKGTEQETRLFRPRRLVRRRGGGQLGWPVSRANF
FT                   FPVSFPACLNFGQWPLA"
FT   CDS_pept        complement(3473..3778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98367"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z798"
FT                   /protein_id="BAI98367.1"
FT                   /translation="MAHSGHRPSVLMGDGFCYTSLTDFSLLASLSSGPFMDEDLRLLEF
FT                   NLIRFMTRQLGQIRKCREMAMSGHYPHRHPGLDPGSRFCLYTAPSPRQRDPGSSPG"
FT   CDS_pept        3913..4134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98368"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z799"
FT                   /protein_id="BAI98368.1"
FT                   /translation="MLPPSFFRQPDSCGIIRTMNLTRLAGHGRISIQLTSRKTPDQHLR
FT                   WPERDPDRQPDCPARKCGVKRWTCFHDE"
FT   CDS_pept        complement(4158..4997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00060"
FT                   /product="AlgP-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98369"
FT                   /db_xref="GOA:D4Z7A0"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A0"
FT                   /protein_id="BAI98369.1"
FT                   /translation="MSENNQPDITTLTVQLVSAFVSNNNVASEGLADLIRTTRLALTDD
FT                   LAAKPEDAAAPTYTPAVSVRKSLSSPEHILSMIDGRPYKTLKRHLASHGLTPNEYRERY
FT                   GLPKSYPLVAPNYSEARRAVATKLGLGKKPVSVKKPAEAAPAPAVAAPAAAKPAAAPKA
FT                   APAKAAPAKPAAAKTPAPKTAATKAPAAKPVEAKPAVAKAPAAKAPAAKPAASRKRLSI
FT                   ATPSAPAPKKDAAPAAKPAEKAAAGNKPAPAAKAPAKPAPKKKPAAKSSKATAAEKA"
FT   CDS_pept        5121..5363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98370"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A1"
FT                   /protein_id="BAI98370.1"
FT                   /translation="MFRDGTALSCASVPCSRPSSSMVRQLHCASITLHTAKPEYRSIFV
FT                   SRLPVFGQRKAIFVRRETCFRWTKKKAGLSTGPMS"
FT   CDS_pept        complement(5360..5527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98371"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A2"
FT                   /protein_id="BAI98371.1"
FT                   /translation="MFCRDVGKPFSALPAVLPDETARMDCVKRNHIAAFRICHCTPAAP
FT                   IGECLSGILS"
FT   CDS_pept        complement(5751..6026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00090"
FT                   /product="histone-like DNA-binding protein"
FT                   /note="bacterial nucleoid DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98372"
FT                   /db_xref="GOA:D4Z7A3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A3"
FT                   /protein_id="BAI98372.1"
FT                   /translation="MNNTELAEALAADHGLTKADARKYVDGVFSAIAGAAAKGEEVSLN
FT                   GFGKFKVKDQPAREGRNPSTGAVIQIAASKKLTFTPAKAVKDQLNG"
FT   CDS_pept        6050..6370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98373"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A4"
FT                   /protein_id="BAI98373.1"
FT                   /translation="MVLTCLFALNQPLCDRRTAKIGSKIALLALCDAEIMPDREPLGAF
FT                   PLRRDSDLPGARRRSGRGKGRAGVRSAKMVAIVERQAMPAWADRPRRGFGTARIFYKGL
FT                   QI"
FT   CDS_pept        6486..8156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00110"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98374"
FT                   /db_xref="GOA:D4Z7A5"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A5"
FT                   /protein_id="BAI98374.1"
FT                   /translation="MGWRRGAAWAVATGLGLMLAVPAAAQDAAPGQQSAAPIIDRDRTD
FT                   RLEPQIASPPVAAPRPAPSVQVAPAASSAGQTLLTRLRYSGTTLPTGQLDAAASPYIGH
FT                   PLTGETLQAIANAISATYARSDIAFYSVSIPPQVPSGGVLTIRLVEGRVTDYRLAGMSP
FT                   SMPAGLIAAHMRRLMRDAPLRKSSLERTLALLRDIPGQTVDARLRQSGAPGDLLMDLIV
FT                   KRKQVQIGLTIDNSGVSNVVQGVQAQMSVTVNGLVREGDSTRIAGYLPFYPDRYQYYSL
FT                   SHATPIGSNGLTLAAQAAHVETRSRDSRTTGEATLAGLALSYPVLRSTKSQLSVTASLD
FT                   GIDSDNYFLDIRFGDYRSRALRLGASWSRADARDGYAISTVVSQGIDALGARPFAGFSE
FT                   TGFTKVNVQAVAVKGISGKLSLRTSIKGQYSKDDLPVTERFPLGGRGVGMAFRTGTLTA
FT                   EQAVAGSAELSWSLPARSPLLKASALFVALDGALAHGTARPAYRLAARDYSLASAGGGV
FT                   RLGLGPKWRVSAEVAVPVKRPDPGHSRKARFFFGVGRAF"
FT   CDS_pept        8205..8765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00120"
FT                   /product="putative oxygenase"
FT                   /note="uncharacterized iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98375"
FT                   /db_xref="GOA:D4Z7A6"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A6"
FT                   /protein_id="BAI98375.1"
FT                   /translation="MNNVWEVWPAALTGAECDAIVKRAALYQPESATVGFAQAVRSDHA
FT                   YRSSTISWLDVHRDKDIVDRLMQFVHSSNRTNFGIDIAGPFELQYTEYHGRAQGKYDWH
FT                   QDVWLESSRPFDRKLSVVVQLSDPDEYEGGAFEFFGLQQPGVNFASRGSMLIFPSFLQH
FT                   RVLPVTKGLRRSLVSWIEGPRWR"
FT   CDS_pept        complement(8984..9187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98376"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A7"
FT                   /protein_id="BAI98376.1"
FT                   /translation="MKWHCKTPCFPASRSQREHVKPGSAYRRVKKKPVWSERFTSPIFV
FT                   TIRHAKACRGPRKAAQEIRQSP"
FT   CDS_pept        complement(9211..9606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98377"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A8"
FT                   /protein_id="BAI98377.1"
FT                   /translation="MIDPLLVGPVGPVGPVGPPGPVGPPGPVGPAGPVGPPGPVGPPGP
FT                   VGPEGPVGPAGPVGLVGPAGPPGPVGPLGPVGPDGPVGLVGPVGLVGPVGPLGPEGDWP
FT                   PPAPMSKPTPSAQALSKRRGIAVAHSR"
FT   CDS_pept        9707..10648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00150"
FT                   /product="hypothetical protein"
FT                   /note="large exoprotein involved in heme utilization or
FT                   adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98378"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7A9"
FT                   /protein_id="BAI98378.1"
FT                   /translation="MATVDLLTGDGTVAQVALPTTPQGVQQGLAPVGTLAGSLLGAPAG
FT                   EAVTQLTDGLSPAVAAVTSTVGQLAAPLLDTVNGALSPVTDPLVGGNGVLAPVTGLVEN
FT                   AVGGLTGALGGIGGDPSAALGGPLIGANVGGDVLTGASTSGTLVGVNLLPSDGGAVAGQ
FT                   LATVDVLTQGNLVDVTVPTTAAGVEAGLQPAGNLAGGLLGPQAETTVNQVVSAVAPVVA
FT                   TVTSTVDSVAAPLLDTVNSLAPTLPGGESGSPLAPVTGLVDGLLGGGEGATGNVLAPVT
FT                   GLLNGALAPATGSGSATAPVTGLLGGLLGGGN"
FT   CDS_pept        10841..12058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00160"
FT                   /product="hypothetical protein"
FT                   /note="uncharacterized protein with a C-terminal OMP (outer
FT                   membrane protein) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98379"
FT                   /db_xref="GOA:D4Z7B0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B0"
FT                   /protein_id="BAI98379.1"
FT                   /translation="MPNRLFPIRRLIEGAAALLLLNAQPAMAGPYAPYAVTPGETAVGT
FT                   MLDAAGGAPGGDRAAMLASIDALPTAAARADALGQLSPRSYSLLPRLSIQSMDAADREI
FT                   RSWLAERRSIAIDAPADVPASGDRTITMMLSGGIKQASYKARVDRPEAESDSRSLRFAM
FT                   DVKPVPGLIVGATLGIDGIDARLDPARRPRISQFNSQIGSYASYGDGRFYVDATAAYTL
FT                   SEYKLRRQIGWAGFAGRMVAPVDGDGWAASGEAGAMLRAGPVRMQPFAGLHYRYADVSG
FT                   FVENGGPAALEVATFRTKSLRGALGARLSANVAQGGWTLRPSVEAQWQRELRSRPDSRI
FT                   EARFSTRDLPIFTLRPTRLARDAGLVNAGISATWNNRTTFRLGYAGEFSSDRHVHAAAL
FT                   TVGRRF"
FT   CDS_pept        12153..13154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00170"
FT                   /product="ParB-like protein"
FT                   /note="chromosome partitioning protein ParB / putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98380"
FT                   /db_xref="GOA:D4Z7B1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B1"
FT                   /protein_id="BAI98380.1"
FT                   /translation="MARFIRDILATLSHEPAAGKGPVDQEELSRLDQRLAPFTDKGPGS
FT                   RGTISIQPDECSVWDGNPRDQPGLTADGCRSLIDSIASEGGNRIPVLVRLNPPGSDRPY
FT                   QLLVGSRRRFAVDWLNHNGRPEMRLAALVVDLSDEEAFRLADIENRERADISELDRARS
FT                   YQHAVERFYGGVQSRMAEALTLSNSQLSRLLALAQLPEEVVDAFATRDELRVRYSEILT
FT                   PLLRRPDQRARIIAEARSIGEQQQELAREGGRMLSPATVLARLREAAMPQPVEEGRDMA
FT                   IIAGGARIGRARPGRSGGLTIDLNISEDADLDELLARLRETIVAARAAPVMP"
FT   CDS_pept        complement(13233..13547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00180"
FT                   /product="putative cytochrome C"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98381"
FT                   /db_xref="GOA:D4Z7B2"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B2"
FT                   /protein_id="BAI98381.1"
FT                   /translation="MKALLPIALLAASGAAAAGYRLPDERPIVLPPGDGAELTTAICSA
FT                   CHSLDYVTTQPRGKGTQFWKDSVGKMIKVYGAPIEPADAERIAAYLAATYGRKEAAGPS
FT                   "
FT   CDS_pept        complement(13544..14764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00190"
FT                   /product="putative oxidoreductase"
FT                   /note="sulfite:cytochrome c oxidoreductase subunit A /
FT                   sulfite oxidase or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98382"
FT                   /db_xref="GOA:D4Z7B3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B3"
FT                   /protein_id="BAI98382.1"
FT                   /translation="MADGRTMNGVDRRGLIAAMAGALLPVSGWARTRGGYAALPFGNGE
FT                   RPLVRYPQKRALIGLTTRPPQLETPLALFDGPITPNDAFFVRYHLSDLPLDIDARRFRL
FT                   ALGGHVERPLSLSLAELKRDFPVQEIVAVNQCSGNGRGFFEPRVGGGQLGNGAMGNARW
FT                   RGVPLRALLDRTGVRAGARQVTFNGLDNPQADGIPDFVKALDVDHARDGEVMVAWAMNG
FT                   ADLPFLNGYPLRLVLPGHYGTYWIKHLHEINVVDAAYDGYWMKTAYRIPDNDCACVAPG
FT                   GKPDRTRPIGRLNIRSFLTSHMSGAQVAAGKLTVLSGIAFDGGSGIARVDISTDGGASW
FT                   RQADLGENLGRYSFRAWRSAQSLAPGRHRILVRATGRSGEVQPFDPLWQPAGYMRNVVE
FT                   AVEVVAL"
FT   CDS_pept        14819..14950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98383"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B4"
FT                   /protein_id="BAI98383.1"
FT                   /translation="MSGAQSGCPGHPGGNADPLWVGRGGWPVNPAGAALPRRKPNRR"
FT   CDS_pept        15066..15278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98384"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B5"
FT                   /protein_id="BAI98384.1"
FT                   /translation="MSLSHFQGPFEVAHHPQLEPEVKRAILASWASDANAVEGNPAVRR
FT                   PPPHKRPIPIDEILDALRKVDRNPG"
FT   CDS_pept        complement(15394..16461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98385"
FT                   /db_xref="GOA:D4Z7B6"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B6"
FT                   /protein_id="BAI98385.1"
FT                   /translation="MGNRWTPEAAHRWFARQPWLVGCNFTPSNAINQLEMWQAGSFDLA
FT                   TIDRELELAASVGMNSVRVYLHDLLWLDDAAAFLARIDAFLAVADRHGIRTMLVLFDSC
FT                   WHPEPALGPQPQPREGVHNSGWVQSPGVAVLRNPDEHARLEDYVRGVVGRFGQDRRVLA
FT                   WDIWNEPDNGPEVALCDPAALKAKADLVVPLLVEAFGWARAMQPMQPLTSGIWLGDWSA
FT                   PDLLSPIQQAQTSHSDVISFHNYGIAEDFAQRVKWLKTMGRPLLCTEYMARPAGSTFQA
FT                   ILPIAKEEQVGTFCWGLVKGKTQTHLPWDKWENPNLEGLKEKWFHDIFDADGTPHDESE
FT                   VAFLRLINRLDEMTA"
FT   CDS_pept        complement(16696..18930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SJA_C2-00230"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98386"
FT                   /db_xref="GOA:D4Z7B7"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B7"
FT                   /protein_id="BAI98386.1"
FT                   /translation="MTMQPQLWGGLECTVNRVHDRYQDQVRATGHQDRAEDLDRLAMLG
FT                   IRAIRYPVLWERVSPRHPDERDWQWTDERLGRLRDLDIRVIAGLVHHGSGPAYSGLLEE
FT                   GFAAGLARHAGAAAERYPWIADWTPVNEPLTTARFSALYGHWYPHHRSEPSFWLALLNQ
FT                   IDAVRLSMQAIRRVNPAARLIQTDDLGRSYATASLREQAGFDNLRRWASWDLLCGMMTR
FT                   EHPLWERLSGFGFQDRLRAIADDPCPPDIIGINHYLTSDRFLDHRLHRYPAHSHGGSDT
FT                   QLYADVEAIRVLEPPPQGLEGALREAWTRYGRPLAVTEVHNGCTREEQLRWIAQAWDVA
FT                   SRLCAEGIKVEAVTLWSLLGSSGWNSLLTQPGHYEPGLWDVSSGTPRATALLPLAQALA
FT                   RGGERPMLADGAGWWQRPVRIVHPGVARPASMKAHLAGRSHNSAARPCSDHLSSVRPLL
FT                   ICGATGTLGRAMARACALRNIPFILTSRAELDLTAPETVAAALDRIAPWAVVNAAGWVR
FT                   VDEAETARDACLSANARGAVALAKACGDRGVASLSFSSDLVFDGKKGAPYVEDDPVAPR
FT                   NCYGLSKAEMEEGIAALGAPHPSGRHLIIRTAAFFSPHDDHNFAVAVVRSLRRGETILA
FT                   AEDLIVTPTYVPHLVATSLDLLIDGEAGPWHLTNGEALSWADFARRIAMSCGCDPSRIR
FT                   GVPHRTLGWTAERPANAALASRRGAPLHSLAMAIDHFAAHLPGEMIRQAA"
FT   CDS_pept        19235..21481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="SJA_C2-00240"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98387"
FT                   /db_xref="GOA:D4Z7B8"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B8"
FT                   /protein_id="BAI98387.1"
FT                   /translation="MSRFAAQSRVLFWEEPCLVEGLPEPDLHIDVCATSGVIVITPQLP
FT                   ADGAREEDGENSKRLLDLFLTGESGPFVRWYYTPMMLPFSEHVMADCIVYDCMDELANF
FT                   KGAPPELLPLEQRLLSQADLVFTGGYSLYEAKKDRHGHVYPFPSSVDAAHFAQARSAPI
FT                   RRPDDARPRLGFYGVVDERMDVELLAALADARPGWDLEIVGPVVKIGEADLPRRPNLHF
FT                   LGGRSYDDLPGCVADWDVALMPFAINDATRFISPTKTPEYLAAGKPVVSTPIADVIRHY
FT                   GQIEAVRIAERGDAFIRACDAALALSRSGGDWLAEADKVLAGMSWDKSFQQMSRLIREA
FT                   ISRGAHAHPIVSPTSWKSGPSRHYDAMVVGAGFAGAVMAERLAADGGRKVLLVDRRPHV
FT                   GGNAYDELDDAGVLIHRYGPHIFHTNSQEIFDYLSRFTRWRPYEHRVLAAVDDLLVPMP
FT                   INRTTLNLLYGLDLATEEDAAAFLAAQAEPVSVVRTSEDVVISAVGRELYEKFFQGYTR
FT                   KQWGLDPSELDKAVTSRVPTRTSKDDRYFTDRFQAMPLEGYTRMFERMLDHPNIDILLG
FT                   VDYCEARDAYPHDHLVFTGPIDEYFGYRYGKLPYRSLRFRHVSLDVDRYQPVAVVNYPS
FT                   PDVPHTRITEYKHLTGQQVPGTSITYEFPAAEGDPYYPIPRPENQQLFKRYEALAMAQT
FT                   DVTFVGRLATYRYYNMDQVVGQALATYRRMTKTPAIRTVPAHLAAAAQPRPSAG"
FT   CDS_pept        complement(21603..22136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00250"
FT                   /product="conserved hypothetical protein"
FT                   /note="hemerythrin HHE cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7B9"
FT                   /protein_id="BAI98388.1"
FT                   /translation="MSVIDRFVAAVTPPESEEDRARAREKARAAAGAGDWLDQILQHHQ
FT                   QIEMAFSEAEAAMDASSRTRAQRKLAALLTAHSSAEEAVIYPQLSHDHKTHMAMAYEEQ
FT                   QAAKVQLALLEALDPLSDDWGEKLEHIKGAVAHHVYEEENDRFLHLKEEIPPADQERMT
FT                   ARYQEEMARYDSGL"
FT   CDS_pept        complement(22252..22674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00260"
FT                   /product="TadE-like protein"
FT                   /note="Flp pilus assembly protein TadG"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98389"
FT                   /db_xref="GOA:D4Z7C0"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C0"
FT                   /protein_id="BAI98389.1"
FT                   /translation="MPALRLRTCERGLAALEFALLAPALLMLVFAVVLYSFYFAALMGV
FT                   RHAAVEGARAAVAGLSTTERTALAQSRARAVVDGYGALLAAGGGPMVTAGPDATGTFRV
FT                   RVSYDMSGSPMMRYATFIPMPSPTVSASIVVTNGSY"
FT   CDS_pept        complement(22680..22862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00270"
FT                   /product="putative pilus assembly protein"
FT                   /note="pilus assembly protein pilin subunit / Flp pilus
FT                   assembly protein, pilin Flp"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98390"
FT                   /db_xref="GOA:D4Z7C1"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C1"
FT                   /protein_id="BAI98390.1"
FT                   /translation="MNKFLGSLIAKLARDEKGLTAVEYAVLGAVVVAAIVAVGANFRTQ
FT                   LGTAFTTMFNSVNPG"
FT   CDS_pept        complement(22936..24732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00280"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98391"
FT                   /db_xref="GOA:D4Z7C2"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C2"
FT                   /protein_id="BAI98391.1"
FT                   /translation="MIRSRRPVFRRAWLRPLLGDRSAAVAPMFAALGAVLIGAAGFALD
FT                   GGLYYVGQRNLRAATDAAALAAAQNPAQAAARARDSLSRNGYDPAILRSVELGRYCADA
FT                   GLGAAQRFDASMALCPGNGRVNAVRIRTGKPARQFLMRVLGPANPLPDLSASATAARID
FT                   EAGIGISSGVLTVTNALVNSVNDLLGALLGIELRLSAADVEALMASNVDAGLFFDALAQ
FT                   RVGESGTYGALTARTVGLRDLLAAAASAADDSATAATLSLLAGQVGNGHAVPLNGLFGL
FT                   GVWKNMPVGGADEKPALRAGINAYQLFSYAVQAGNGAVDLSDAIGAVAPGSSVLLAAMA
FT                   TGPMDRPRFSFGPAGETSVSTSALRLQLDVGIRNVSLLGVPLIVVKLPVTIDIAAAQGQ
FT                   VSAIDCPDTAEQARDTRVTVQAGSGLVNAYIGALPAGAMTRPMPPLSAADVRSVRIVNV
FT                   LGVVTVDSRAVAQPVMGASGALVFGPGGQGSIGRPGSPGTPASIGNGAQVGPLLTSLVG
FT                   SLGGQDGLQVTLLGSCLPIVCDATRALARSQLSSAVVNPIAGLVGTTIDPLVTDLLAAL
FT                   GVQLGHATLWATGARCGVPVLV"
FT   CDS_pept        complement(24729..24926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98392"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C3"
FT                   /protein_id="BAI98392.1"
FT                   /translation="MVVLLLMAAAPAPVPVGEARRVVEAQLKAPVREDAELSAEEAAVI
FT                   RQRYLESIGRRVERAVDGAR"
FT   CDS_pept        complement(24928..25542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadD"
FT                   /locus_tag="SJA_C2-00300"
FT                   /product="Flp pilus assembly protein TadD"
FT                   /note="TPR repeats"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98393"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C4"
FT                   /protein_id="BAI98393.1"
FT                   /translation="MRRLMLAAMLIAAAPGQAEEAPDTRGLYLQLIHQARADGRPRAAL
FT                   AYLDDFERRYPGDAEARLLRVNSLLDLKQIDAAEAVALPPETASGGVSAVRGHLLAARG
FT                   RWDEAAACYERASRASPADPLPRNALGYALLRAGRIGAAIEALRGASDLAPQLAVVRNN
FT                   LLLALIMGGRRDEAEAGLRRAGDGALRQKLAAEAARIGKGG"
FT   CDS_pept        complement(25539..26402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadC"
FT                   /locus_tag="SJA_C2-00310"
FT                   /product="Flp pilus assembly protein TadC"
FT                   /note="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98394"
FT                   /db_xref="GOA:D4Z7C5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C5"
FT                   /protein_id="BAI98394.1"
FT                   /translation="MGALFLLCAALGVACAAMGMRMLLADRRLEARLGMAGDRPGFRLP
FT                   AAFGARGRDRSEIADKLMLAGFQDARAADRFVWARMAATVGAGLAAMLVSRIGWGGFLA
FT                   QPLLVVIVTGLTYVGAKQAIHLLAARRARAIMAEFPFLLDLMLMMLESGISLDQCFRSI
FT                   ARDEAIAVPHHARLIAMLVADLDRGMRYEQALDRWAARVAVNGAKELAALFRQALFQGV
FT                   ELAPALREFVREFTQRRVANAREAMGGITVRMVVLMILFFMPALFVVLGGPPVVAIFDT
FT                   LRGVSQ"
FT   CDS_pept        complement(26402..27295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadB"
FT                   /locus_tag="SJA_C2-00320"
FT                   /product="Flp pilus assembly protein TadB"
FT                   /note="type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98395"
FT                   /db_xref="GOA:D4Z7C6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C6"
FT                   /protein_id="BAI98395.1"
FT                   /translation="MLSGAAFMMLSLMILMGIGWQLLADQARERAVIDRRLGLTPTAAM
FT                   PRPAVLAAPDRMAPLLAQAQIDVTARGLGMVGGGLLLIALFALLAAGPVAALAVAAGVP
FT                   VALIGWVRRRAQRRVEALIEALPYYIDAVRQMQAVGNSLAQALDRALADAPAVVRSYIA
FT                   PVARRLELGAPVADAMQVLAERLRVPEISMLAAAIRTNMRYGGSISAVLLNLANILRER
FT                   IRIKRELKAAISEAKISGRVLIVMPLVAMAVLVAMNPDYIDFFLRDPRGHRLAVVALVL
FT                   QGMGMLVMRRVMRLAF"
FT   CDS_pept        complement(27289..28617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaF"
FT                   /locus_tag="SJA_C2-00330"
FT                   /product="pilus assembly protein CpaF"
FT                   /note="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98396"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C7"
FT                   /protein_id="BAI98396.1"
FT                   /translation="MSLLTGEEGFIPAREVRITPVAQPAAQRMSDIYQLAKAQTCAQLI
FT                   EQLEARGETAETLGPRALREEIEQVISSRSRRGQMALNSAERLLLIEDVEDEVAGMGPL
FT                   APLLRDPGVDDIIVNGPGHVYAERGGLLEKVETRFRDDAHLMNIIQRIVGPIGRRVDEA
FT                   SPYVDARLADGSRVNIVIPPVALDGPTLSIRKFRLQSMTIEDCVAGQVMSADMAAYLSA
FT                   AVRSRLNILICGGTGAGKTTLLNMLSTFIGDRERLITIEDAAELQLRQSHVVRLETRPP
FT                   TVDGSREVSSRELVRNALRMRPDRIILGEVRGVEAVEMLQAMSTGHDGSMATLHGNSPR
FT                   DAFARLEMLLGFAGVQSDVRAIRRFIANSVHVVVQLQRLSNGSRRVMSVSEVTGLEGEA
FT                   YSLNELFAFQEQPALSGLGEFQTLSPRPFFAGRLRDYRGNRPC"
FT   CDS_pept        complement(28614..29765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaE"
FT                   /locus_tag="SJA_C2-00340"
FT                   /product="pilus assembly protein CpaE"
FT                   /note="Flp pilus assembly protein, ATPase CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98397"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C8"
FT                   /protein_id="BAI98397.1"
FT                   /translation="MAKILLLSVDRVLAQRIEEAAGGRATVELAQSVEREALDGLALIV
FT                   IDRAAIPPERALSVAIGAVVADAGGRPVLLATDEMEAEPLLRAIRAGVHDVVPRDGQRG
FT                   EIAPILARLLNEAVADRGGRGRLTLLLGADRDACAMVATDMAVATTARGSTLLIDCTLP
FT                   TSAAASYLDLVVDYGLASAIGDMDRLDASLLASTVARHEPSGVMLLTFDGGTGAEPAGL
FT                   TPVDLAALIRLLRGCCGHVVLNAGSLRHGGLLREVAAEADRVELLCGQTIREIEACRRL
FT                   LDRIGTERERIEAMRLLVWDHLPGVLLDGRRMADALGVGAALALPIDRARMRNALNAGR
FT                   PMAMEADGGAYMAAIRRLCGIAPKPGGIDRLRGAMLRVVQRAS"
FT   CDS_pept        complement(29768..30925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaC"
FT                   /locus_tag="SJA_C2-00350"
FT                   /product="Flp pilus assembly protein secretin CpaC"
FT                   /note="general secretory pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98398"
FT                   /db_xref="GOA:D4Z7C9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7C9"
FT                   /protein_id="BAI98398.1"
FT                   /translation="MGLIAMGLPLATVAQTALQVKEQRTLSYPRAIGRVEVDREGVLSI
FT                   AAPSARSLRLTAIGEGAATVSVYGGDGGLMAREPVSVAPDAAASAPIVRAGEQVVAVDV
FT                   QFAAVSATTLKALGFNFSKLSGDIQGAIVSPSSLGSASFNPDGLALEASAPIQNAFNLF
FT                   LSAPNRGIGAVLSALSSNGLSQLLAQPTLLVRSGEQASFLAGGEFPVPVPQVSGSGNTL
FT                   SIQYKEFGVRLSVTPFVLSKDHIVLKIAPEVSELDYNNGVQLQGYVVPGLRRRSAETTV
FT                   ELGSGQSFVIAGLSYSSQTVTKEKTPLFGDIPVLGAFFKRQQNQKEKQELIIVATPRLV
FT                   GPMKPEEVPPLPGAATAGIDPGIGDMILGTDGLDQSSAPFGVVRR"
FT   CDS_pept        complement(30961..31869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaB"
FT                   /locus_tag="SJA_C2-00360"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="uncharacterized protein involved in type IV pili
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98399"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D0"
FT                   /protein_id="BAI98399.1"
FT                   /translation="MRLGSKAKLTIAVGLTSASAFLALGVRELRNASAATVQGQAAPVR
FT                   VAAPVLLVRAARAIRTGETITAAMIRNAPGDPTRYPYAATSAEVVGKVATRDIGLHALI
FT                   ARDAVGMESKLAIRVPMGMRAISIDTTAEIAVAGLIRPGDRVDVQVVYPGADAISGARG
FT                   SGRSRAQALLQMVQVLAVGEVVVGTQQASGANGGVEGALSSPPPPARTVTLALTPEQVS
FT                   ILSLAKNIGALTLSLRNPADSAQVAVAVAASAGVEPVAAPAPMPVATAPAPRATARPAP
FT                   HAIELVVGSRRETIYSGSGAK"
FT   CDS_pept        complement(32173..33213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00370"
FT                   /product="putative 4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="related hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98400"
FT                   /db_xref="GOA:D4Z7D1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D1"
FT                   /protein_id="BAI98400.1"
FT                   /translation="MADIINPLGLNGFEFVEFTSPDPEAMGRQFEQLGFVASHRHPTKN
FT                   ITRYKQGRINLMLNRDDAGRVAAFRGEHGPSASAMAFRVADPEAAMQWALEHGARPTDE
FT                   DDTVIQGIGGSYLYFIKDGEDLYADWAEFPGWRQAAAENDVGLDLLDHLTHNVRRGQMR
FT                   VWSQFYRTLFGFEEQKYFDIKGQATGLFSQAMIAPDRAIRIPLNESQDDKSQIEEFIRQ
FT                   YHGEGIQHLALTTDNIYETVEKLRARGVRLQDTIETYYELVDKRVPGHGEDLERLRRNR
FT                   ILIDGSVENGEGILLQIFTENMFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRG
FT                   VISVDA"
FT   CDS_pept        complement(33251..34114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00380"
FT                   /product="putative phenylalanine-4-hydroxylase"
FT                   /EC_number="1.14.16.1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98401"
FT                   /db_xref="GOA:D4Z7D2"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D2"
FT                   /protein_id="BAI98401.1"
FT                   /translation="MAQADMTPPEGAAADWTVPQDWSAYTPGEHAMWDRLFERQAAMLP
FT                   GRVVPEFLEGLDILRMTRPGIPDFAELSERLMKRTGWQVVAVPGLVPDRVFFEHLANRR
FT                   FVAGRFIRRPEQIDYLQEPDVFHDVFGHVPLLTHPAFADYMQAYGEGGLRADGLGSIDH
FT                   LARLYWYTVEFGLMRHGNDLRLYGAGIVSSFGESVFALEDASPNRIGFDLKRLMRTQYR
FT                   IDDYQQSYFVIDSFEDLLRKTSDVDFGPIYRELETESDVAPDAVLAQDRVYHRGSQDHA
FT                   RAKMPC"
FT   CDS_pept        complement(34218..35069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00390"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98402"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D3"
FT                   /protein_id="BAI98402.1"
FT                   /translation="MSVERPSHLVRRLLVRQVRGVFHDSARGEAPVVASDRALYPPGSV
FT                   IRRVHGDVTSMMIGGVGALLLQMLHPAALAGIWDHSRFRDDMLGRLRRTARFIAVTTYA
FT                   ERAEAEAAIARVRQVHDHVRGTLADGTAYAAGDPWLLAWVHVCEAVSFLDAWMAYGEPF
FT                   MPVAEQDRYFAEAALVARALGADPVPESRAEAMALMARFRGELAVTERTREVARIVLRQ
FT                   PAPSLGLMPAQAMTMQAAVALLPGWARRMHGFSMPVVARPLVRAAAFALAGTMRWAFKA
FT                   QK"
FT   CDS_pept        complement(35108..38503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="SJA_C2-00400"
FT                   /product="long-chain-fatty-acid--[acyl-carrier-protein]
FT                   ligase"
FT                   /EC_number="6.2.1.20"
FT                   /note="acyl-CoA synthetase / AMP-acid ligase II"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98403"
FT                   /db_xref="GOA:D4Z7D4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D4"
FT                   /protein_id="BAI98403.1"
FT                   /translation="MSAPDLSLLGKRRFAPLFVVQFLGAFNDNLLKFALLFLANFGLYR
FT                   AEPDKAEMLATVATGLFILPYFLFSALAGQLADAWDKAKLVRAVKAAEIVIMTLAVTGF
FT                   WLESVPLLLSCLFLMGLHSTIFGPVKFSILPQHLRTDEIMGGTGLIEAGTFLAILSGQL
FT                   LAGVIPPWEAGLVAVGLAILGFLASLAVPSAPTVVPGLRIEPNIFRSTWHILKAARHGR
FT                   GVWLSILGISWFFAVGAVLLAEFAPLVSGVLKAKQEVATFFLLIFSVSVALGSMLVNRL
FT                   LGGQVSARFVPVSALALAGFMIDLWLSTGSYAPMHSGAGIAEFVGSPGSWRIMVDLFGI
FT                   AFSGGMFIVPLYAILQTHSPRQERSRTIAANNIVNAAVTVAVVAVVTAMLARGESVPGV
FT                   IGAMGFATLAVALISCWLLPETVIKAIVRGMLRLCYRVEVIGAENMPGAGEPAVVVVNH
FT                   VSFLDGLLLAAFLPGKPTFAVHTRIARAWWVKPFLPLFDAFPVDPTNPLSAKAMVKAVR
FT                   EGRTLVIFPEGRITVTGALMKVFDGPGMVADKADAPIIPVRIDGAQFTPFSRLRGKVRL
FT                   RRFPRITLTVLPPRRFAIEGEMTARARRAIAGRRLYDEMSQMMFATSDTDRTLFEALLE
FT                   ASHVHGRGSAVVEDVKREPLTYGRLVTGSLVLGRVLARSTRQGEAVGVLLPNVAGVAVA
FT                   FFALQAGGRVPAMLNFTAGLANLKAACMAAEIRTVVTARAFVEQGKLGDVVAGLEAEGI
FT                   AFLWLEDVAAGIGPGAKLRGLIASRFAGRAHRRLKVSPDDAAVILFTSGSEGLPKGVVL
FT                   THRNLLSNCRQLAARIDFNSADVVLNALPVFHSFGLTGGTLLPIFHGVKTLLYPSPLHY
FT                   RIVPALAYDANATILFGTDTFLSGYARMAHGYDFYSLRYIFAGAERVRDETRKIYAEKF
FT                   GLRILEGYGATEAGPVIAVNTPMHFRAGSVGRLLPGIEARLDDVPGIEEGGRLSIRGPN
FT                   IMAGYMKADAPGVLQPPEGGWHDTGDIVTIDDQGFVTIRGRAKRFAKIGGEMISLPAVE
FT                   GYASAVWPDADHAVVTRPDARKGEQLVLFTTARDAKAAALQAWGKANGVAELALPREIR
FT                   VLDALPLLGTGKTDYASMTQMAAG"
FT   CDS_pept        complement(38528..41485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00410"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98404"
FT                   /db_xref="GOA:D4Z7D5"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D5"
FT                   /protein_id="BAI98404.1"
FT                   /translation="MLVTLVLLVFGVMLFDMRGRLKAAEQRLALLEGGVGNAPSLPDRP
FT                   VPEDGDDDARARPAAPASVVERRVVMDAAAPPPASAVIVDRQSSEGGTGGEEAKGIAIE
FT                   VARPARPSFSFEELFGRRLPIWAGGVTLAVAGVLLVKYSIDAGLLSPLVRVVLGLLFGG
FT                   ALIGGAEAALRLEDRVRDARVRQALAGAGLATLYAAVLAAHMLYGLVGPGIAFAGLAGV
FT                   TGLAMALSLRFGAPSALLGLVGGLAAPALVEAGQPNVPLLSCYLALAVGGLCVLSRTQR
FT                   WMWLGVSALAGGAGWGVVMLAMGALDWASSLSVGLLVLMLGMALPVLAFSGMRAALLRM
FT                   GAAVVAAGQMAALVATGGFGLLQWGLFGLLSLMLVWLGREAALRPLAAIGAGVALLLAA
FT                   VWPQPEMGRFALVMLGMAAIYGGAALLRVWRGGLVEAGQIAGLALGGFAVALGQCWRVG
FT                   LDGEFALLALAAAGLPGAAMAMGWRCGTRREDARFVTLASAAALLLVVAGGLGLPEWTL
FT                   AMVIAAVAAGLLKLAALAEDRRVEWSGWGFAFGALVVLAGSDDVVRLWGEAADGPGWQG
FT                   VMRWTAGAAMAALFAWRARFAEGRMVAQGVAVLLAYGAVAQAVPTPWVPVGAALGLAVL
FT                   AEGARRLAGGRMAPALGVALALVVLWAAWPLGIWLGRVLLSLVGEPVLVRDLPGTSEVA
FT                   RRIALPAMALGLALWRGGSAVDAVGRRIGGCVAAVLGGVAAHVAFKQLFALGSLAEVTR
FT                   LALAERTLWEAVLIGLGFVALGARIAPAHFHPSRKAGENWARVVGTCLVAAGLGHLLVY
FT                   SVVLHNPLWFPQAVGRWPFVNLLPVVLALAFVALKVADGWSRRIADGVRMALIALFGVA
FT                   MLRQLFVGSLLTVRGVGQVEDILRSVLALALAIGFLLWGIRRQAQAENARDWRIASLLL
FT                   MLLAVAKVFLLDASGLTGLLRIASFLALGFSLIGIGWLYNRLLREPINNSATIAA"
FT   CDS_pept        41591..42190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00420"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98405"
FT                   /db_xref="GOA:D4Z7D6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D6"
FT                   /protein_id="BAI98405.1"
FT                   /translation="MGRRSDHSREELEALILEEGHRHMAESGFAKFSSREVAKRIGYSV
FT                   GTLYNVFGSYDRLVAAINTRTFNLWAAFLERRLASRPRDRIAALVEGYFRFASENTNIW
FT                   MAIYDHRLPSGVPLPEEYARQRAGLTDVVVREVAAVLPPESQDVAPRLARSLVATVHGH
FT                   CTFALNGSFALLGETDPLEMATARVKESLRAAGAEL"
FT   CDS_pept        42244..43392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00430"
FT                   /product="sterol desaturase"
FT                   /EC_number="1.14.19.20"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98406"
FT                   /db_xref="GOA:D4Z7D7"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D7"
FT                   /protein_id="BAI98406.1"
FT                   /translation="MANWFDSLERDLQSPLAVRRLGSGWFSGFFALLLSTTGLCLVMAL
FT                   RWPDWFATPELAALHAWGGLRPLVHALLIGGYALALLSLLLRTRKAIGATALIVALLAT
FT                   LLGGAEVQPRETHDWGVFFGVDFFAVNMVATGLMFAPIERLFPHRAQQRLFRQEWREDL
FT                   FYYLISSMMVQLITFLALAPSSFINANTAGLAGVRAMIAGQPWPLQFLEVVLLTDFVQY
FT                   WFHRAFHRVPFLWGFHAVHHSARSMDWLAGARMHFFEIIALRGVTSLPLLTFGFSPSVM
FT                   QAYIGFVYIYSSLLHANLRGDFNRLGRIVATPRFHHWHHAIEEVAVDKNFAIHFPFLDR
FT                   LFGTHHLPDGAWPTGYGVPEQVPQGYRAQFLYPFRRKRDAAL"
FT   CDS_pept        43431..44063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00440"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98407"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="InterPro:IPR014581"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D8"
FT                   /protein_id="BAI98407.1"
FT                   /translation="MVYWMLKGREFANCNCEYGCNCQFGGLPDKGHCQAAFGFAIDEGR
FT                   HGDTDLSGLNIAAVFRWPGPIHEGQGECAAFVDERATEAQRNALLTIMTGGDTAPMATV
FT                   FAVFASTITTMHEPSFVPVDFEVDVEGRKGRLRIAGHLEMDGEPIRSPVDGSEIRARID
FT                   LPDGFEYEVAEIGSGTSRSIAPMRLDHAASYGQFAYLHLDSHGVVRG"
FT   CDS_pept        44066..44857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00450"
FT                   /product="putative membrane protein"
FT                   /note="putative metal-binding integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98408"
FT                   /db_xref="GOA:D4Z7D9"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7D9"
FT                   /protein_id="BAI98408.1"
FT                   /translation="MPIWSVVLARHRLISLVALAVLILLAWGWLLSGAGMGMALTASLF
FT                   PAGLAEDPMAAMMMPGDMPWAMARFVMTFAMWWVMMVAMMLPSAAPMVLLYARAAPAST
FT                   RPATESFTLGYLLVWGFFSLIATLAQWRLAAMAMLSPMAMATSSRPLAAALLIAAGTYQ
FT                   ISPWKDACLRQCRNPAQFLSRHYRPGWTGALRMGALHGAWCVGCCWMLMALLFVGGIMN
FT                   LAWIALLTLLVGLEKLLPWGRVVSVATGIGCILSAWAILMG"
FT   CDS_pept        complement(44955..45578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00460"
FT                   /product="NarL-family response regulator"
FT                   /note="two-component system, NarL family, response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98409"
FT                   /db_xref="GOA:D4Z7E0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E0"
FT                   /protein_id="BAI98409.1"
FT                   /translation="MSEPFPIYVVDDDEAIRRSLSFMLKTSGFAVKLFEGGLPFLKEAA
FT                   GLEPGCVLLDVRMPDMDGLAVQRELRDRGIMLPVVIMTGHGDIDMAVTAMKAGASDFIE
FT                   KPFEKAALLGCVEAARRMAVADRGANARAEDARARLNILTEREREVLDGLVEGLPNKTI
FT                   AYDLAISPRTVEIHRANLMQKLEVKSLAEALRIAFHAGVEKDKA"
FT   CDS_pept        complement(45591..46736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00470"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98410"
FT                   /db_xref="GOA:D4Z7E1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E1"
FT                   /protein_id="BAI98410.1"
FT                   /translation="MAVADDETDGLTQREHSLEQALLGSILATVPDALIVIDMRGTIVS
FT                   FSAAAQRMFQYAESDVLGENISMLMPSPDREKHDGYIHHYLTTGEKRIIGIGRLTSARR
FT                   RDGSTFPIELSVGEVQDEGRRLFTGFIRDLTESQQAERRVADLQAELAHASRVTAMGTL
FT                   ASALAHELNQPLTAIANYLEAGRDMLDAGEPVDRELLREAMAESANQALRAGEIIRSLR
FT                   EFIKRGETMRQPEPLRGLLAEGAALAFIGVDSRGLDMDISVDPRVDKVLVNRVQLQQVI
FT                   INLTRNAVEAMADSPARILRLSAVPGENGRVEVIVADSGPGLAPDMSRTLFTPFTTTKA
FT                   SGMGVGLSISQTIVEGHGGRIWAGPSQWGGTAFHFTLDAVD"
FT   CDS_pept        complement(46757..47572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="SJA_C2-00480"
FT                   /product="universal stress protein UspA"
FT                   /note="nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98411"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E2"
FT                   /protein_id="BAI98411.1"
FT                   /translation="MKSVLLHIHEDRGAESRLQAACDLARASGAHIHCVQVTAMPDFVA
FT                   ADMYGGASMAPAMMAELYDIDEKARMRVEDRLRREDVSWDWRHVEGDVVHGLLSAAALT
FT                   DGMIVTLPSGPRREFADPLHLAADLALAGRVPVIAVPQEAKSFPVTGRALVAWEGSQEA
FT                   SAALRLSVPLLKLAEEVHVVTVEEAGKYPFPATDAPEYLARHGIKCQLHTWPQDGRTID
FT                   ASLKAAIGVLKPDWMAMGAFGHSRLREMIFGGVTRAMLREAHVPLLLAH"
FT   CDS_pept        47687..48049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98412"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E3"
FT                   /protein_id="BAI98412.1"
FT                   /translation="MSWTTIRLELARTPAFPNGSAARSYVLRLPLGSGGLIDEREYRIH
FT                   PELATARRFWPNEPDRHGTLLHTGNGWALSYEQGEADDEKIYRLDAHAIQPGAYLTLTD
FT                   PDGECLPFVVKGMSPA"
FT   CDS_pept        48260..50458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00500"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98413"
FT                   /db_xref="GOA:D4Z7E4"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E4"
FT                   /protein_id="BAI98413.1"
FT                   /translation="MHIRPSFLLVTTMLALSSRPALAQSEPATQSEPATQSEPAAEAEG
FT                   AGPIVVTAARTILPANALPMTIDVIDRETLNQQVAIGGSIVDAVSALTPSFSPTRQKLS
FT                   GAGETLRGRSPLYAINGIPQTAPLRDGSRDGFTIDPFFIDRVELIYGSNALQGIGGAGG
FT                   IVNQVTVAPPQSDGLSGRMLVQGNADTGFHGDGVGGKIAGLLAWRAGRWDATVGAAYEK
FT                   RGAFYDGHGNRVGTDLTQGETQDSRSWSLFGRFGYALSDSARLDLTMSRFHLKGEGDYV
FT                   TLDGNPAIDLPTTSVRGTPPGVPATNRTESAALTLTDGDLWGGNFIAQLFFNRSRDTYG
FT                   GEVAPIATFQDAAIAPVNTLFDQSQNRSRKYGGKISYERAVPGFEALTAVLGFDALYDL
FT                   TEQRLIATGRTWVPPTDYRSLAPFAQLNLALFDKKLRLAGGIRYEDVRIHIDDYHTLAS
FT                   YRGGFDVAGGTPTFHDTLFNGGAILEPWEGIRAYASYAEGYTVPDVGRIARAVDRAGVD
FT                   IDNYVNISPIVSNNREIGVEVKRGPVDASAAYFWSTSKNGSLLVQQSVGAPFEVQRQRV
FT                   EIQGLELNLSVRTPLPGLTLSTGYAHLIGRTDGSDNGIDKVDRDLDGANISPDRLNVAA
FT                   SYVHGPLSARIQTQFFLSRQFEREPGKYPVLYRFDGYEVTDVSLRYQTRFGALTLAAQN
FT                   IFDRFTIDYYTQTVRPTDKAHYFAGRGRNFTLSWDYRF"
FT   CDS_pept        50458..51540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00510"
FT                   /product="iron-uptake factor"
FT                   /note="uncharacterized iron-regulated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98414"
FT                   /db_xref="GOA:D4Z7E5"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E5"
FT                   /protein_id="BAI98414.1"
FT                   /translation="MKLIDALHRWTGGLIGLLLALLGLSGALLVHKNAWTLAPHAGDPR
FT                   VEDVRQLAQVTQRIMVDPAARPQSITYASDDFGLLKLLFDNGGGAYADQRGGVVMRWSS
FT                   QWERPELWLFDFHHHLFSGETGDWVIGIAALCGLFFVFTGLILWWRTRRTFEWRLWPAR
FT                   MSRPAIVRHHRDLGVVVAPLLLLSLATGAVLVFRPMAALLFGPGAPAQIDKALAAPPPR
FT                   DARLADRLDWAGMIVTAKARFPDAELRSLSLPRKNSGLITLRMRRPQEWLPNGRTTLWF
FT                   AADSGALVAARDAATLPTVVKGYNLLYPLHAAKVGGLAFRLVMTLAGLAMTLLGTLAVW
FT                   TFWFRRPARAARPRQIAIRA"
FT   CDS_pept        complement(51519..52262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00520"
FT                   /product="putative metallophosphoesterase"
FT                   /note="phosphoesterase related to the Icc protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98415"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E6"
FT                   /protein_id="BAI98415.1"
FT                   /translation="MTATSEARPRDSLVLAAVGDLHVTDSSEHRYRAMFEEISARADIL
FT                   ALCGDLTNFGKTREAEVLAEDLRSCTIPTVAVLGNHDHECGQPEVVAQILHGAGVTVLD
FT                   DQAVEIRGVGFAGVKGFVGGFGRGELGAFGESAIKGFVEESINEARKLENALRSLRTER
FT                   TVAVLHYAPVVDTVQGEPPEIFPFLGSSRLAEAIDRFDNVRFAVHGHAHRGAFEGKTPG
FT                   GVPVYNCAQFVLSERFDRPYALIAI"
FT   CDS_pept        complement(52246..53019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98416"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E7"
FT                   /protein_id="BAI98416.1"
FT                   /translation="MNREPATFDPPPDAAEFYAESLAHLVQSGIPFMLSGTYALGCHTG
FT                   ITRPTKDLDVFCKPGDAPRILAYFKALGHRVEFEDERWIGKVWRDGNFFDVIYNISSAS
FT                   LPVTEEWFRDISHAEVYGTTVRITPPTEFILSKVFIQDRYRYDGADVAHIILRQHERID
FT                   WQRLLDAMELHWEVLLIHLLNFRFIYPTERHCIPLWLFEELLGRLQTRAELPVPNLRVC
FT                   RGRLLSPRDYLVDITDWGFADVVGKGLEESHDRNQ"
FT   CDS_pept        complement(53074..54573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /gene_synonym="iolA"
FT                   /locus_tag="SJA_C2-00540"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98417"
FT                   /db_xref="GOA:D4Z7E8"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E8"
FT                   /protein_id="BAI98417.1"
FT                   /translation="MRSVHHFIHGQSAPQPGARLSDILNPATGAVQAQVELATAAHLQK
FT                   AVDSALSAQPEWAATNPQRRARVMFRFKELIEQNMDELALLLSSEHGKVLADAKGDIQR
FT                   GLEVVEFACGIPHLLKGEYTQGAGPGIDVYSMRQPLGIAAGITPFNFPAMIPLWMSAMA
FT                   IACGNAFILKPSERDPSVPVRLAELAIEAGIPAGILNVVHGDKEMVDAILDHPAIKAVS
FT                   FVGSSDIANYVYARGAQNGKRVQAMGGAKNHGIILPDADMDQAVADIVGAAYGSAGERC
FT                   MALPVVVPVGEATADAFRAKLLDAIETLRPGIPTDPDAQYGPLVTGVHKARVESYIQMA
FT                   ADEGAEIVVDGRGFSLQGYEEGFYLAPTLIDRVTPDMKSYQDEIFGPVLQILRAQSFEE
FT                   ALSYPSKHQYGNGVAIFTRNGDYARKFAADVEVGMVGVNVPIPVPVAYHSFGGWKRSGF
FT                   GDLDQYGMDGVRFYTRTKKITQRWPDGGAVIDQSFVIPTMK"
FT   CDS_pept        54674..55558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00550"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98418"
FT                   /db_xref="GOA:D4Z7E9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7E9"
FT                   /protein_id="BAI98418.1"
FT                   /translation="MLNSDELRLFLAVMREGNMLAAARRIGVDHSTVARRLTNMEATLG
FT                   ARLFDRSPRGVTPTPAAFALVSHAERIESELLAAMSSVAGRDREVEGTVRLATPEAFAS
FT                   HLIAPRVAALRERHPRLTLELASESKAASLSRREAEIAVMLKPPPKGRFVTRKLADYRL
FT                   GLYASKAYLEREGRPSLRADLSRHVFVSYIEELAGFAEMIALDQLLPGAAIVFRASSSA
FT                   AQHAAVAAGMGLGVLHVFAAAEDERLVQIFPESMEVWRSYWLVMHADLQRLPRVRAAAD
FT                   FLDEVMRGVRERL"
FT   CDS_pept        55666..56310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00560"
FT                   /product="putative methyltransferase"
FT                   /note="phospholipid N-methyltransferase / dimethyladenosine
FT                   transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98419"
FT                   /db_xref="GOA:D4Z7F0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F0"
FT                   /protein_id="BAI98419.1"
FT                   /translation="MQEPGFGSVGLPCRTMVEREAIVATLVEDRTALAFREFFRNPLAV
FT                   GSAFPASHFLVDAMLGPVDWSRMERVIEYGPGTGIFTRALLDRLPGHARLLAIDTSPAF
FT                   IGHLRGEMRDRRLVAVTGSADGVLEIMAAQGWDRADCILSGLPFSTLAPERAERLMEAS
FT                   ACALRPEGKFLAYQMRRAVKPLLERRFEEVRVGFEWRNLPPCHLYWASGPG"
FT   CDS_pept        complement(56422..57159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00570"
FT                   /product="putative phosphatase"
FT                   /note="3'-phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   3'-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98420"
FT                   /db_xref="GOA:D4Z7F1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F1"
FT                   /protein_id="BAI98420.1"
FT                   /translation="MTDAELAAHLAEVAGRILVNVRESGLFGPAALGKAGDQTANQFLC
FT                   RALRETRPEDGLLSEEEKDDEARLTKSRVWIVDPVDGTREYGEARADWAVHVGLAMDGR
FT                   PAAGAVALPGLNGGTLLRSDQPVPIPPAPEKLRMVISRTRPAKEAVAVAERLDAELVPM
FT                   GSAGAKAMAVILGQADIYLHSGGQYEWDSLAPVAVAQAHGLHCSRIDGSPLIYNQRDVY
FT                   LPDLLICRKDHADKVLHLIADLP"
FT   CDS_pept        complement(57177..59090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="SJA_C2-00580"
FT                   /product="adenylylsulfate kinase"
FT                   /note="GTPase - sulfate adenylate transferase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98421"
FT                   /db_xref="GOA:D4Z7F2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F2"
FT                   /protein_id="BAI98421.1"
FT                   /translation="MTDTLDDPIYKTDALIAEDIDRYLEVHQHKTMLRFITCGSVDDGK
FT                   STLIGRLLYDSKMIFEDQLAALEADSRRVGTQGQEIDFALLVDGLAAEREQGITIDVAY
FT                   RFFATEKRKFIVADTPGHEQYTRNMVTGASTADLAVILIDARKGVLTQTRRHSYLAHLI
FT                   GIRNIVLAVNKMDLVDYDQAVYDGIVKDYAEFANGIGIKAFTPIPISGFRGDNITGLSA
FT                   NTPWYKGPALMEHLETVEVDQVSDREKPFRMAVQWVNRPNLDFRGFSGQIATGTVRVGD
FT                   PIRVLPSGKTSTVSRIVTLEGDLDSAVAGQSITLCFADEVDCSRGDVIAASDNPPQSAD
FT                   QFEATIVWMADEDMLPGRPYWLKIGTQTVTATVQQPKYQVNVNTMEHLAAKTLELNAIG
FT                   VANLSTDRQIVFEPYAQNRALGGFILIDKISNATVAAGMLHFSLRRAQNVHWQATDVSR
FT                   DFHANLKNQKPAVLWFTGLSGAGKSTIANLVEKKLARMNRHTFLLDGDNVRHGLNKDLG
FT                   FTDADRVENIRRVGEVAKLMTDAGLIVITAFISPFRAEREMVRQMMQPGEFIEVHIDTP
FT                   LADAEARDVKGLYKKARSGELKNFTGIDSPYEAPEDPEIRIDTTAMTAEQAAEAIVARI
FT                   IP"
FT   CDS_pept        complement(59194..60105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="SJA_C2-00590"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98422"
FT                   /db_xref="GOA:D4Z7F3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F3"
FT                   /protein_id="BAI98422.1"
FT                   /translation="MIDSKRLTHLERLEAESIHILREVVAEAEKPVMLYSVGKDSAVML
FT                   HLARKAFYPSPPPFPLLHVDTTWKFRAMYDLRDRMARESGMELLVYRNPEAQERGINPF
FT                   DHGPLHTDMWKTEGLKQALNLYGFDAAFGGARRDEEKSRAKERIFSFRTASHGWDPKNQ
FT                   RPELWNLYNARKNKGESIRVFPISNWTELDIWQYIHLNDVPIVPLYFAEERPTVERDGM
FT                   LLMVDDERFPLKPGEEPVMRSIRFRTLGCYPLTGAVESTAKTLPEVIQETLLTTTSERQ
FT                   GRAIDKDAGGAGMEKKKQEGYF"
FT   CDS_pept        60235..61278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00600"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98423"
FT                   /db_xref="GOA:D4Z7F4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F4"
FT                   /protein_id="BAI98423.1"
FT                   /translation="MFEQPLWHGFLEKLRARTGAAYAGLAFRPIDEERIVELHAGPAGP
FT                   LHPDRLFNEKQGRDPLPYRRMREARVYTLDELIEPKDAALQSYRREWLDPLRITAFRSV
FT                   RVAEASGMDAWLSCAGGREVGPAVGALLTALVPHLRIALRSFVAFEREKFRSSVTSEAF
FT                   GRLNSGWLTLDARCRIVDMTAHLEPLFQRSSVLRRGRYDRLMPSSPAVDRELTALVKRF
FT                   AEDAEARPKAINLSRDPMIDMLVRPIQDRSPSVQSPPVAIAYISGDRWSQADRCGQLVD
FT                   LFGLLPSEARLAWAIAQGMSIGEAADDLGLTVETARNYSKKIYAKTGARGQAELVRNIL
FT                   TSVLALA"
FT   CDS_pept        complement(61403..61618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98424"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F5"
FT                   /protein_id="BAI98424.1"
FT                   /translation="MRSSALALLAIIPLTAVQPPAAAAQSPWYCGSAPPGWTPPWQRKP
FT                   ATPDDKNAPCHFIPCDRKKIRSETCR"
FT   CDS_pept        complement(61608..62924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /gene_synonym="hemZ"
FT                   /locus_tag="SJA_C2-00620"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.98.3"
FT                   /note="coproporphyrinogen III oxidase or related Fe-S
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98425"
FT                   /db_xref="GOA:D4Z7F6"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F6"
FT                   /protein_id="BAI98425.1"
FT                   /translation="MWTYHPDLLDRPVPRYTSYPTAAQFGGDVGAAELAARLDAVAGVK
FT                   RDDALSLYVHIPYCHDICWYCGCNTGAANRVQRLAAYVESLEREIATLAARLNGRGRVR
FT                   RIAFGGGSPNSLPLVDFVRLLQQLLLCFEAHHAELSVELDPRRLDGQWISTMAAMGVDR
FT                   VNLGVQTFTPHVQARIGRIQPLDMVERAVGQLRAAGIATGFDLMYGLPGQTQDDLAATL
FT                   EAAIAMRPARIALFGYAHMPRLLPRQRRIDAGDLPDLATRFAMAARGHETLTGAGYEAI
FT                   GFDHFALPEDAMARAAREGRLRRNFQGFTDDPADILLGLGASAISQFPDLIVQNEKQAG
FT                   PWRALADAGQLTAARGTLRTPEDRRRGRIIEALLCQGEAHVGTAHPLPDLSRFERLGLV
FT                   RLSEGRVALTRDALPYARSIAACFDAYMEPAERRFSHAV"
FT   CDS_pept        complement(63304..63657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98426"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F7"
FT                   /protein_id="BAI98426.1"
FT                   /translation="MTLSNIKTCPASRREAGVLPDQAQQGMGRPPGRATPFSGFPPSSG
FT                   RKTRMFINLLFRRMTFIQIPYHVGPAIRGLWLNGGHSDSGLEPVELIQIRGAPAKNPPS
FT                   PAIFRKNTMTFDI"
FT   CDS_pept        63660..64835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00640"
FT                   /product="putative fatty acid/hydrocarbon transporter"
FT                   /note="long-chain fatty acid transport protein / membrane
FT                   protein XylN"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98427"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F8"
FT                   /protein_id="BAI98427.1"
FT                   /translation="MMNKLNIFSAGICLIGLGIAFPAYATDGYYLTGANARATGMGGVG
FT                   IALPQGPEAATINPAGATFVDNGFEIGAQLFILNTRTTDLFFPGNDVKGHQYQPIPDFG
FT                   VNYHLNDKVTIAVTSFGGGLGQSYNKPFVPGMGFSKERANFIQAGIAPTIAFKLRDNLS
FT                   IGVGLGVVNEFFRARGVIVPTPQGPAQLPNHGWSHAFGVGGRFGILWKPVPAVGLGATY
FT                   FTKVHMSNLKGYEDDLLAGLGGSIDTPEQFGAGVSVKPNDRLTLGFDVIRTNWSGVKAF
FT                   SEQAGFGWRDHTTFKLGVAYGLMPGLTVRAGTSLAKRHFGSEFVLANVNTPGTSSKSLT
FT                   FGFTKRLGEKDELTFSADYELNGKVVGTGHSAGTVIRSRYGFTGLSFSHRF"
FT   misc_feature    64124..64835
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        65121..65783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompW"
FT                   /locus_tag="SJA_C2-00650"
FT                   /product="outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98428"
FT                   /db_xref="GOA:D4Z7F9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7F9"
FT                   /protein_id="BAI98428.1"
FT                   /translation="MSVKTILLGAAAGCAVLAGPAEAAQGDVLVRLRGIMVAPNEKSGS
FT                   VLPAFPGEKVKVDDSVMPEVDVTYMATDHIGFELIAATTKHSASGRSGTTGGIGKLAST
FT                   WVLPPTLTAQYHFLPEGKIRPYVGAGVNYTLFYSEKASGALEGAVGATKVHMSDSFGWA
FT                   GQVGVDIDLNERMFLNFDVKYIDIDTTARLSTAGAGVQRVKLELDPFVFGVGVGMKF"
FT   CDS_pept        66008..66775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /gene_synonym="fnr"
FT                   /locus_tag="SJA_C2-00660"
FT                   /product="Crp/Fnr-family transcriptional regulator"
FT                   /note="anaerobic regulatory protein / cAMP-binding protein-
FT                   catabolite gene activator or regulatory subunit of
FT                   cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98429"
FT                   /db_xref="GOA:D4Z7G0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G0"
FT                   /protein_id="BAI98429.1"
FT                   /translation="MDMRFDLAQKAQEDAAFAMAATPSAKGCGGQYCDRCEVRDQAICA
FT                   DLDEKQRGALNRIGRRVSLQAGQTVMWEGDSSTLVANVIEGTLKLSTSTGDGREQIVGV
FT                   VYASDFIGRPFGARTPHSVTALTDARLCLYPRGAFDGFAREHPALEHRLLRRTLDDLDR
FT                   TRAWMLLLGRKNAREKVATLLLDMRRRLRADRAGVIELPLSRQQIADVLGLTIETVSRQ
FT                   IGELKRMGVIALAGRRGVRVVDAERLEGMAEGE"
FT   CDS_pept        67010..68668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoN"
FT                   /locus_tag="SJA_C2-00670"
FT                   /product="cb-type cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98430"
FT                   /db_xref="GOA:D4Z7G1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G1"
FT                   /protein_id="BAI98430.1"
FT                   /translation="MEQLVWKTGGWFALATLAFLAALAAADFGFAVHMGIACAAALAVA
FT                   VLTMRHADYEAITRGLLKMPASQGRYDDDPIRWGVIATVFWGLAGFLAGLYIALQLAFP
FT                   ALNLGIEYTSFGRLRPLHTSAVIFAFGGNALIATSFYVVQRTCRARLAFPALARFVFWG
FT                   YQLFIVLAATGYLLGITEGKEYAEPEWYVDLWLTIVWVAYLVVFGGTILRRSEPHIYVA
FT                   NWFYLSFILTIAMLHIVNNLSMPVSLLGSKSYSAFAGVQDALTQWWYGHNAVGFFLTAG
FT                   FLAMMYYFVPKQAERPVYSYRLSIIHFWSLIFLYIWAGPHHLHYTALPDWAQTLGMVFS
FT                   VMLWMPSWGGMINGLMTLNGAWDRIRTDPIIRMMVMALAFYGMSTFEGPMMSVKAVNSL
FT                   SHYTDWTIGHVHSGALGWNGLITFACLYYLTPRLWKRERLYSLRLVNCHFWLATVGIVL
FT                   YAASMWVAGIMQGLMWREYGSDGYLVYAFSEVVSAMFPMYLIRAAGGLLYLSGALVMAW
FT                   NIGRTIAGSPLRVEKPMNDAAYDAAADRPIVAQPA"
FT   CDS_pept        68683..69429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoO"
FT                   /locus_tag="SJA_C2-00680"
FT                   /product="cb-type cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98431"
FT                   /db_xref="GOA:D4Z7G2"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G2"
FT                   /protein_id="BAI98431.1"
FT                   /translation="METKTKGKFFDHGRLERNVSLLGIAALITVAIGGIVEIAPLFWID
FT                   NTIEKVEGVRPYTPLELAGRNIYIREGCYNCHSQMIRPFRDETERYGHYSLAAESMYDH
FT                   PFQWGSKRTGPDLARVGGRYSDEWHVQHLKDPRAVVPESIMPGYAFLAERELKAGDMSR
FT                   DLTALNDVGVPYTKDDIDRANDDLKAQADPDADSSDLLKRYPKAQARDFDGDPGKLTEM
FT                   DALVAYLQMLGTLVDVDSAKPQEVGR"
FT   CDS_pept        69426..69590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoQ"
FT                   /locus_tag="SJA_C2-00690"
FT                   /product="Cbb3-type cytochrome oxidase subunit 3"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98432"
FT                   /db_xref="GOA:D4Z7G3"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G3"
FT                   /protein_id="BAI98432.1"
FT                   /translation="MSYDALRHFADSWGLVFMGLLYAILIGWHFLPHGRQRSADAALAI
FT                   FEQEEADHG"
FT   CDS_pept        69583..70470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccoP"
FT                   /locus_tag="SJA_C2-00700"
FT                   /product="cb-type cytochrome c oxidase subunit III"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98433"
FT                   /db_xref="GOA:D4Z7G4"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G4"
FT                   /protein_id="BAI98433.1"
FT                   /translation="MADEKRIDPATGTEIKHHEWDGIQELDTPLPRWWLWTFYATILFA
FT                   VGYMIAYPAIPMIDRATGGMLGWSSRGALDRELAARERQIAPIRKAIAETPVTALPGRP
FT                   ELMQQAVEGGRAAFRVHCVQCHGSGAAGSKGYPNLNDDDWLWGGDLAAIEKTITDGVRN
FT                   PGHDATRQSLMPAFGKDQLLTAAQVDDVVAHVRAISGQDRPGAASRRGDRVFADNCAVC
FT                   HGPAGKGNRALGAPDLTDAIWLYGGDAGTIRETVWNSRHGVMPRWDDKLDKATIRMLAA
FT                   YVHSLGGGEGDAGR"
FT   CDS_pept        70624..72054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixG"
FT                   /locus_tag="SJA_C2-00710"
FT                   /product="nitrogen fixation protein FixG"
FT                   /note="polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98434"
FT                   /db_xref="GOA:D4Z7G5"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G5"
FT                   /protein_id="BAI98434.1"
FT                   /translation="MLMSGSASLYEKRKGVYPKAVDGFYRRLKWAIMAVTLAIYWGTPW
FT                   LRWDRGPYAPDQAVLVDLAHRRFYMFAIEIWPQEFYYVAGLLIMAGIGLFLVTSAVGRA
FT                   WCGYACPQTVWTDLYQHVERFVDGDRNAQLRLAKAPWSAAKIARRIVKWSVWLGIAFVT
FT                   GGAWIFYFADAPTLQREFWSGTAAWQAYATTFVLTATTFVLGGFMREQVCIYMCPWPRI
FT                   QTAMLDEKSLVVTYKHWRGEKRGSLKKAEARPGAFGDCIDCNQCVAVCPTGIDIREGPQ
FT                   IGCITCALCIDACDKVMAQVGRPRGLIDYCTQDDAEAEQKGSEPRPVLKTLLRPRTIAY
FT                   FAIWAGIGAAMLFALGARERLEISAQQDRNPIFVRLSDGAIRNAYTVKLRNMQARPRPM
FT                   EVGLTGLPGGRIWTDAGSRENAAATVRTTVPADSVAKLRIFLTLPSGGPARQDFRFTVR
FT                   AIDREGGSASEPARFERP"
FT   CDS_pept        72058..72534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixH"
FT                   /locus_tag="SJA_C2-00720"
FT                   /product="nitrogen fixation protein FixH"
FT                   /note="putative integral membrane protein linked to a
FT                   cation pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98435"
FT                   /db_xref="GOA:D4Z7G6"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="InterPro:IPR018037"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G6"
FT                   /protein_id="BAI98435.1"
FT                   /translation="MTPAPSPLRRFTGWHMTAILVAFFAVVIAVNMLMATVAVRSFGGT
FT                   VVENSYVASQKFNGWLAQARAQKRLGWRDAVTLDAARHVGLVLTDAKGAPVAGGQVTAV
FT                   AQHPLGRTPDLSLVFRETAPGVYASDRALPEGRWQIRFDLRLTGREEHLLREVD"
FT   CDS_pept        72534..74666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixI"
FT                   /locus_tag="SJA_C2-00730"
FT                   /product="nitrogen fixation protein FixI"
FT                   /EC_number="3.6.1.-"
FT                   /note="cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98436"
FT                   /db_xref="GOA:D4Z7G7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G7"
FT                   /protein_id="BAI98436.1"
FT                   /translation="MATKALISDPVAEGAAESLFAVPGIHCVGCIAKIEEGLPRQPGIM
FT                   SARVNMGAKRVAIRHDPALTPPDLRAAIAALGFEAEPLADAGLDVAAAESRRLTRALVV
FT                   AGFAAMNIMLLSVSVWSGAAGATRGMFHWLSALIALPTVAYAGQPFFRSAWAAVRQGRT
FT                   NMDVPISIGVLLTTGMSLYETVTGGAHAWFDGAVMLLFFLLAGRSLDSMMRGRARAGVA
FT                   ALLKQTAPGALVLEADGSSRWMRADALRPGMTILVAAGERLAADGRVTEGESGLDIAFL
FT                   TGESAPVRVHPGDDVQAGALNIDGPIRVEVTAAGADTVIADIARLMEEAGQGKSRYVRL
FT                   ADRAARLYAPCVHLLAALSFAGWMIAGAGVHQALLIAVAVLLITCPCALGLAVPAAQIV
FT                   ACGALMRRGVLVKDGSALERLAEVSEAVFDKTGTLTLGRPVPQGLRRLWRDDRSILLSL
FT                   SRASRHPLSVALRQALEARGVTPAALDNVREVAGEGVFGDYEGVAVSLARPRSLINLFG
FT                   LAAEYRRGDQALLLGFTDALRPDAAETLDVLRGMGMKILIASGDRPEALEEIARETRTT
FT                   AIGHLRPADKLALIDRLKARGEKVLMIGDGLNDGPALAAGHASMAPASASDASQLTADA
FT                   VFLGDRLAPVALTVHAARRTVAVVKQNFALAIGYNVLAVPLAIAGKVTPLVAAVAMSTS
FT                   SLIVIANALRLKGAVK"
FT   CDS_pept        74663..74803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixS"
FT                   /locus_tag="SJA_C2-00740"
FT                   /product="nitrogen fixation protein FixS"
FT                   /note="uncharacterized protein, possibly involved in
FT                   nitrogen fixation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98437"
FT                   /db_xref="GOA:D4Z7G8"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G8"
FT                   /protein_id="BAI98437.1"
FT                   /translation="MTGLSLLIPIALGLGLLGLAAFFWALGNGQFEDTDGAAVRILIDE
FT                   D"
FT   CDS_pept        74934..78545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="SJA_C2-00750"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /EC_number="1.2.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98438"
FT                   /db_xref="GOA:D4Z7G9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7G9"
FT                   /protein_id="BAI98438.1"
FT                   /translation="MARMTNPPTFTDFAPVIRPQSPLRQAITAAYRRDEAECMAPLLEA
FT                   AALPDAMRRGVRDMARRLVTTLRANGKGSGVEALVQEYSLSSQEGVALMCLAEALLRIP
FT                   DDATRDALIRDKIADGDWGGHLGGGRSLFVNAATWGLVVTGKLVGSVDDRGLGAALTRL
FT                   VARLGEPVIRRGVDLAMRMMGEQFVTGETIGEALKRARAQEAKGFQYSYDMLGEAAATA
FT                   ADAARYLEDYRQAIHAIGRASDGRGVYAGPGISIKLSALHPRYSRAQADRVMGELLPRV
FT                   KELALLAKGHDIGLNIDAEEADRLELSLDLLESLALDPELAGWNGLGFVVQAYGKRCPF
FT                   VIDWIVDLAGRAGRRIMVRLVKGAYWDAEVKRAQVDGLADFPVYTRKVHTDVAYIACAR
FT                   KLLAARDRVFPQFATHNAQTLATVHHLAGPGFTLGDYEFQCLHGMGEPLYEQVVGKGDL
FT                   DRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVHRIADPAVPVEEMIADPVEQVRAMP
FT                   HPGARHADIALPSGLYPDRRNSDGIDLSDENALAMLTRALAESAQIGWTARPEGGEGAA
FT                   RPVLNPADRRDVVGTVFEASTDFARAAVARADGSGWARAPVTERAAILERAADAMQARM
FT                   PILLGLIVREAGKSLPNAIAEVREAIDFLRYYAEQARSTFGPAQEPLGPVVCISPWNFP
FT                   LAIFTGQVAAALVAGNAVLAKPAEETPLIAAEAVRLLHEAGAPGDALQLIPGGGEIGAA
FT                   LVAAPQTAGVLFTGSTEVARLIQRQLASRLSASGRPIPLVAETGGQNAMIVDSSALAEQ
FT                   VVADVIASAFDSAGQRCSALRILCLQEDVADRTLAMLKGALRELRIGRTDRLAVDIGPV
FT                   ITDEAKEGIGRHIEAMRALGCAVEQQPLPEESAHGSFVPPTIIEIDDIAQLRREVFGPV
FT                   LHVIRFPRAGLDALVDAINATGYGLTFGLHTRLDDTVAQVTGRVKAGNLYVNRNVIGAI
FT                   VGVQPFGGRGLSGTGPKAGGPLYLGRLVRVPPAFAGRADSFPSALADFADWLAAEGEAE
FT                   ASAMARRCGDASALGVEMALPGPVGERNLYALHPRGWIGMRPATRQGLLRQMAAVLATG
FT                   NRGVLQDMALPRGLPPHIAAHFASRPEGPLGAVLVEGDAGRIGAAVRDVAGLPGPVVSV
FT                   HAAGADGMYPLHWLLEEVSTSINTTAAGGNASLMMIG"
FT   CDS_pept        complement(78622..79323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="SJA_C2-00760"
FT                   /product="lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98439"
FT                   /db_xref="GOA:D4Z7H0"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H0"
FT                   /protein_id="BAI98439.1"
FT                   /translation="MKAGRRSIYVGAAAIVQLLTACSGEPAADNHAAPSVQAGNAAAPV
FT                   ADGKLVLAFGDSLYAGYGVAQNESFPFRLEQALKAQGLAVQVRNAGVSGETSLGGMQRL
FT                   AFTLDGLPRKPDLLLLDLGGNDMLRGLPPEDSEKNLRAILDELKRRQIPVLLTGMLAAP
FT                   NMGKDYGAKFDAIYPRLAKDYGLPLYPFFLDGVIGDPKLMQADSIHPNPAGVNIVVGRI
FT                   APVVAGLLKDA"
FT   CDS_pept        79322..80041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00770"
FT                   /product="ABC-type transport system ATPase component"
FT                   /note="putative ABC-type transport system involved in
FT                   lysophospholipase L1 biosynthesis, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98440"
FT                   /db_xref="GOA:D4Z7H1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H1"
FT                   /protein_id="BAI98440.1"
FT                   /translation="MGFLSPMHGSSSLAHIAIEARNVTLSLGTREAPTQILRGVDLSIP
FT                   KGESLAILGPSGSGKSSLMAILSGLERASGGDVRVAGIDYGPLDEDALARARRGRVGII
FT                   LQSFHLLPTMTAVENVAVPLELAGFADAFARAADELAAVGLGHRLHHYPAQLSGGEQQR
FT                   VAIARAVAPGPDIIFADEPTGNLDGATSGSIVELLFARRAANGATLVIITHDPGLAARC
FT                   DRIVEMRDGSIVADRRP"
FT   CDS_pept        80038..82560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00780"
FT                   /product="ABC-type transport system permease component"
FT                   /note="putative ABC-type transport system involved in
FT                   lysophospholipase L1 biosynthesis, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98441"
FT                   /db_xref="GOA:D4Z7H2"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H2"
FT                   /protein_id="BAI98441.1"
FT                   /translation="MKALGWRGCWRIARRDLHRGFRGLRLLFICLFLGVATLATIGGLT
FT                   AAITGEIASKGQVLLGGDVEVAMSQREAGAAEKAAFRREGALSETIRLRAMAQRVGQGA
FT                   GNGPSAVLTELKGVDGAYPLYGALTLKGGRAGPMRADELVIGQALADRLDVKPGDGLRY
FT                   GAAAFRIRGIIADEPDRVGEGFTLGPVALTSMEGIRRTGLIQPGSLYESKYRIRLSAGG
FT                   DAGAAAERLKRAFPSAGFEIKDRDGAAPGTSRFLERMGQFLSLIGLAALAIAGIGVSNG
FT                   VASYLAIKRNGIATLKILGASSADIARIYLMQIGAVALLAIGCGLAAGVVLPLGLVTAM
FT                   RDILPVQPGFAVAIWPLVTSALYGLLIAFIFTVPPLARARTLPAAALFRETVDRRRGVD
FT                   RASMIAVGAAGAAALALALGTAREPWFAAAMLGAVAGMLALLTGIGLLVRHGARRAPAP
FT                   RRPLARLAVANLHRPGAQTSALVVALGLGLTLFVTLAAIQSSLSAEIRNTVPRTAPDQF
FT                   VLDIPIAAKDRFLALVGQEAPGAKVNMVPTLRGTIVAYGGQRVADLKQLPEGAWFLRGE
FT                   RGVTYSDALPEGSELVKGRWWPRDYAGPPLVSLDREAAEVMGVGVGDMLTVSVLGREME
FT                   ARIASLRQVNWETMGFNYIMVFSPNALRGAPHSLSATITMKGASEGVMARTLLAAFPSI
FT                   SIIAVGDVVAQVTVLLGQMSTAIVLAGSVAILAGIAVLIGAIAASRQARAYDSVILKTL
FT                   GATRWQILGAQGIEYALLAGVLALVALGLGLAAGWFVIVRIFEFHWAPDWLLVLLTLGA
FT                   GAVLTLGIGLLGSIPLMSVRPARALRAL"
FT   CDS_pept        complement(82620..84347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00790"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98442"
FT                   /db_xref="GOA:D4Z7H3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H3"
FT                   /protein_id="BAI98442.1"
FT                   /translation="MKPATQGRLSLGKVVGQMATPLSAVLIAFLLLAAGLAAAIQLEQL
FT                   GRVEKLRQTTVQAQVLANGIAAPLAFEDDVALQEYLNALKADPQIVAVAAYDGKGAFVA
FT                   GFARPPARLPRLAAEAGRDSPPSGLAVTVPVKQGGTQLGSVYLQSTMDSLSRRLTRYLG
FT                   IAVIVIAAAVLIVMLAASYSSLRRAHQALQAEIASRQQAEEALRQSQKMEAMGQLTGGV
FT                   AHDFNNLLMVASGGLDLMERTQDAARLEKLRAGIRQALDRGAKLTRQLLAFSRRTPLNP
FT                   EVVDLRERIRGMDALLERSLGESIEVAMHLPADLWPVEVDASELEVAILNIALNARDAM
FT                   RKSGAIVIEGANRPGHGGLPDRVQIAVTDNGEGIAPELLNKIFEPFYTTKAVGQGTGLG
FT                   LSQVYGFARASGGEVLVDSIVDRGTTITLLLPRSLLAPRPGDGPVEPVGASGKQRILLV
FT                   EDDDTVADTVGGMLTTLGYEMERVDNGDAALRRLERADDFSLILSDMIMPGEVGGMELA
FT                   LRVRTHWPHLGTMLMTGYSAAAASAAKEGVPLLAKPFTIQDLSVHLMAALDRAGGHRA"
FT   CDS_pept        complement(84344..84919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00800"
FT                   /product="putative transmembrane protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98443"
FT                   /db_xref="GOA:D4Z7H4"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H4"
FT                   /protein_id="BAI98443.1"
FT                   /translation="MDDLSPWRGRRGQRRRRAALSCLAAVALLVPAPVPANSPAALERA
FT                   IQANFLFKFAPFVEWPPAAFSGTERNFVICVVGEDPFGAMLNDVVRGQKMVGRPVVVRR
FT                   TGGEAGPACHILFAGRSADPGYAPFATTGGQPVLTVADKGAGPSGAMIEFVRRNGRVRF
FT                   QIDDKAARANGLKISSKLLGLAIAVDRK"
FT   CDS_pept        complement(84907..86817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00810"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98444"
FT                   /db_xref="GOA:D4Z7H5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H5"
FT                   /protein_id="BAI98444.1"
FT                   /translation="MAWAFGGAAFGGMAVGLLSLCCTAAQAQSLEELRDMPIAALSKLD
FT                   VTSVTRSTASLADSPASIYVITHDDIVRSGTLTLPGILRLAPNLQVMRGGPNNTVIAAR
FT                   GMGGNDAAQSFSNKLLVLIDGRSIYSPLYSGVYWDMQDVLPEDVDRIEVISGPGATLWG
FT                   SNAVNGVINIITRDAGASQGLYGTGVVGNSTYDLGLRYGGHAGGNASYRLFVKRHENFE
FT                   SANDADDGNRRTQAGFRFDWNATPDDALMVQGDGYYGSRSQGAAPDESLHGYDLLARWR
FT                   HGAASGATLQLQAYYDHSARKIENDGGRFALDTFDVEGQHSFALGSGHNIVWGGGARLS
FT                   RYVIRNIPGLDFVPDRRNLFVGNLFAQDSIALTPSVTATVGAKLERRSYMDLTFLPSVR
FT                   LSWKPDAETLLWGAVSRAVRSPTPFDEDVVESIGGTVFLTALPGFRSEKLTAFELGTRL
FT                   MLSPRASLSVSAFYNVYDDLRTVEPAPGGFLPLRWGNGIKGDSYGFDAWADIRLASWWR
FT                   LKPGYSLLIQKFRFKPDSVPLIGVSQVGNDPRHRATLRSSMDIGPEVNVDFDLRYVSAL
FT                   PDPHVPGYVELGARLGWQFDERAELSVSGFNLLHRRHRELPASQATPLRRSVFVALKWT
FT                   I"
FT   CDS_pept        complement(86990..89002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00820"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor histidine
FT                   kinase HydH"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98445"
FT                   /db_xref="GOA:D4Z7H6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H6"
FT                   /protein_id="BAI98445.1"
FT                   /translation="MIPHLSERALILAPVGRDAEIAASMLAEAGLRSHVCRDLPDLLGG
FT                   IDHGAGFALVTEEALHNRDLHPLVGWLQNQPEWSDFPFILLTRRGGGLERNPSASRYLE
FT                   MLGNVNFLERPFHPTTLISLARSALRGRRRQYDARARLEELHRGAEKYRSLFDSIEAGF
FT                   CIIEMIFDDAGKPVDYRFIETNPAFARHTGLSDAVGKSMRSLVPGHEQHWFDIYGQVAR
FT                   TGEAVRFEDAAEALGGYWYDVYAFRVGDPKAPQVAVLFNDITERRRMEAALRRSEERLR
FT                   ALNETLEERVQQRSHELELAQEALRQSQKLESMGQLTGGVAHDFNNLLTPIVGSLDLLH
FT                   RRGLGTDRERRLIEGALQSADRAKMLVQRLLAFARRQPLQPTAIDIGGLVRDMRDLIVS
FT                   TSGPRVQVELAVAEGLPAAHADANQIEMALLNLAVNARDAMPDGGQLRIGVTCDSMAAD
FT                   NRLRLREGRYVRLSVADTGIGMDQQTAEKAIEPFFTTKGVGQGTGLGLSMVHGLAAQLG
FT                   GGLTIESAVGQGTTISLWLPTSEIEAGRDAAGPDTAPVKLDHGMALVVDDEELVRASTV
FT                   HMLRELGYDVLEASSAEHALAIMKAEPDIDVLVTDHLMPGTTGTDLIEQARVLKPAIRA
FT                   LLISGYAENAGISAELPRLTKPFKQIDLAKSLAAL"
FT   CDS_pept        complement(88999..90489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kaiC"
FT                   /locus_tag="SJA_C2-00830"
FT                   /product="circadian clock protein KaiC"
FT                   /note="RecA-superfamily ATPase implicated in signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98446"
FT                   /db_xref="GOA:D4Z7H7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H7"
FT                   /protein_id="BAI98446.1"
FT                   /translation="METYSTKQALAGVDGLDDILSGGLTRGRVFLLEGSPGTGKTTIAT
FT                   QFLIEGARRGERCLYITLSETEEEMRESAASHGWTLEGVDLFELVPPESLLDEQQQQSL
FT                   LYSSDLELGETTRRIFDAFERVRPDRVVLDSLSEIRLLAQSSLRYRRQILALKHFFSKQ
FT                   NATVLMLDDLTAEVADKTVHSVAHGVIRLEELSLDYGPERRRMRVIKYRGRHFRGGFHD
FT                   FVIERGGVRVFPRLVSAEHKTDFQRDVLKSESTELDALLGGGIERGSSVLVLGPAGTGK
FT                   SLLALTFVTAAVARGEKAAIFVFDEEMGLLFNRALGLGIDMRAMADSGDLIVEQVDAAE
FT                   LSPGEFSQRVRNCVERHGVRTVVIDSLNGYQSAMPEENALVLHMHELLQYLNRQGATTF
FT                   LTVAQHGLVGDMKTPVDVTYLADTVILLRYFEALGRVRRAMSIIKKRTGSHEDTIREFR
FT                   IGSYGIRLGEPLIGFQGVLRGVPHFVGGAPALLEDEEA"
FT   CDS_pept        complement(90595..90792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98447"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H8"
FT                   /protein_id="BAI98447.1"
FT                   /translation="MPRDGVFDESGKAYAEEGQVMLDGPDGVAISMTPDAAEETGNELI
FT                   RAAAEARQQIDDSARGAHGP"
FT   CDS_pept        complement(90849..91559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /gene_synonym="fnr"
FT                   /locus_tag="SJA_C2-00850"
FT                   /product="Crp/Fnr-family transcriptional regulator"
FT                   /note="anaerobic regulatory protein / cAMP-binding protein
FT                   - catabolite gene activator or regulatory subunit of
FT                   cAMP-dependent protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98448"
FT                   /db_xref="GOA:D4Z7H9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7H9"
FT                   /protein_id="BAI98448.1"
FT                   /translation="MIFADFLRNRRREQLSERDLAALEASVSQVRKTHARQLIAQAGEP
FT                   IAYSTYLMEGFICRYMDDRNGLRQLVAVHVPGDFVDLHGYPLGRLDHDVATLCASRIAM
FT                   VPHEALDGLLAQRPNLTKLLWFSTLLDAAMHREWIFRLGRLDAMARIAHFFCEIEAKLR
FT                   AVGLSDGSRFALPLTQADLGEACGMTSVHINRMLRELRERELLQVQRGRVTIFDLAALR
FT                   RLCDYDPSYLFIGG"
FT   CDS_pept        91562..92143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00860"
FT                   /product="general stress protein"
FT                   /note="uncharacterized stress protein (general stress
FT                   protein 26)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98449"
FT                   /db_xref="GOA:D4Z7I0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I0"
FT                   /protein_id="BAI98449.1"
FT                   /translation="MDNAWTADRLHPVGNGGPFAPAVRIAGSINQETIMTDARKLKEHL
FT                   WDRMADSPFMMLGLTGSGQHSEPLTVQLDEDQVDRLWFFIGKDNRLAGGGAAMGQFVSK
FT                   GHDFFACFAGQARIDNDPAMIDKLWSTTVEAWFPGGKSDPNLALLRFVIDEAELWEADV
FT                   SLTGKLKMLFGGKIRPGEEGSHARVETTAK"
FT   CDS_pept        92257..92922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00870"
FT                   /product="HAD-superfamily hydrolase"
FT                   /EC_number="3.1.3.-"
FT                   /note="putative phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98450"
FT                   /db_xref="GOA:D4Z7I1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I1"
FT                   /protein_id="BAI98450.1"
FT                   /translation="MTTLMEHRSVDAVLLDMDGTILNSIKAAERVWGEWALRHGLDVDA
FT                   FLPTVHGVQSVETIRRLGLPGVDPVAEAALVTQAEIDAVEGIEAIEGAAAFLAALADCR
FT                   WAVVTSAPRRLARRRIRAAGLPAPPLLIAAEDVERGKPAPDCFHLAAERLGTRADRCLV
FT                   IEDSVAGIMAAERAGASILVVAATHHRPMETRHPVIIDYRGLGAVPDSGGAVRIGPMG"
FT   CDS_pept        93028..93753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00880"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98451"
FT                   /db_xref="GOA:D4Z7I2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I2"
FT                   /protein_id="BAI98451.1"
FT                   /translation="MSDLHNMSQPASAIGPAARAASGPTLVERAYEHLLSMLMTVKIAP
FT                   GERIPIDTVARQLGISQTPIREALSQLEAEKLVYKTTNVGYRASPQMTPEEVHDLYTLR
FT                   LLIEPYAAARAAEQMDDETLSILQSIQADMDAVVERDEQAYARFAEADALLHRLIAKGS
FT                   GNRLIEETIERLHAHLQIFRSLYQNSAQPNAPEVAAREHQAIIAALLAHDPVAAEQSVR
FT                   DHLTCSQQRMDRANGTSPR"
FT   CDS_pept        93965..95347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00890"
FT                   /product="putative amidohydrolase"
FT                   /note="imidazolonepropionase or related amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98452"
FT                   /db_xref="GOA:D4Z7I3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I3"
FT                   /protein_id="BAI98452.1"
FT                   /translation="MRSAMKAGFSLVSLTVAMLAGLPATAMAETTVLRDFTLIDGTGKA
FT                   PAANQALVMTDGRIKWVGPVAKLKAPAGAKVERLKGKYLMPGLIDSHVHLGLVDGITQN
FT                   LQYQTPENIEKQLRTYAAYGVTTVQTLGTEKDMIFPIQQRRKGRAAMSRVYTVGQGVVF
FT                   KGSYGGVAGLDQSVATPEEARAMVDREAAKGADLIKLWVDDEFGMLEERMPPPISSAVI
FT                   DQAHKDGKKAVAHIFYYSNAAELTREGVDAFAHSVRDRAVDDALLGQMKARGVWQMAAT
FT                   LSREASFTYKTLPFLDDPFFARGVTPAVLKELASPERAAKLGAAPNFPKYAPTLQYAMD
FT                   NFAAEAKAGIRYGMGTDSGPTARFPGYFAHWELELMVKAGVTPMQAITAATSANAEFMG
FT                   ARDIGAVAPGKWADLLVLDRDPTADIRNTRAIDAVYIAGNKVPTIWQTCTGRAADACGP
FT                   RP"
FT   CDS_pept        95344..96678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00900"
FT                   /product="putative MFS permease"
FT                   /note="MFS transporter, ACS family, D-galactonate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98453"
FT                   /db_xref="GOA:D4Z7I4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I4"
FT                   /protein_id="BAI98453.1"
FT                   /translation="MTGEASVAEPRGAAAGAGAARPTRARHVVLWLTVLAYLITYMDRV
FT                   VIATAAPVIEKEYGFSPVTMGWIFASFSIAYALFQIPGGWLGDRFGPRRALTGVVLWWS
FT                   TFTAATALTWSAGSMMVCRFLFGMGEAGAFPIATRSLSRWMLPSERGWAQGVTHAGARL
FT                   GGAVTPVFVALLIVQFGWRMPFMAFALIGIGWAALWFWYYRDTPREHPAVNGAELAMIE
FT                   GALGAGRARVSVPWRHLLANSQLWVLSAMYFCYAYCINIFLTWFPKYLHDARGFDIALM
FT                   GLFASLPLMAGVVGDLMGGWASDLLVKRGAGLKMARRSVAVVGFLTAAAMIPLAAAMDG
FT                   HVASILCFCIALFGLELTVGVSWAVTLDIGGEYAGSVSAVMNTLGNSGAAVAAAVTGYI
FT                   VSMSGWFAAFAVLSVLCLIAAALFLRIDASRRLEDGQGARAPEEI"
FT   CDS_pept        96718..97116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00910"
FT                   /product="cytochrome c2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98454"
FT                   /db_xref="GOA:D4Z7I5"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I5"
FT                   /protein_id="BAI98454.1"
FT                   /translation="MKTWIFAAGIGAVIAGAAVAAPAPKGNAAHGQQLFARCAACHKVG
FT                   PNPARAMGPSLNGVVGRAAGSQGGYGYSPAMKASGIKWDETSIDKLLQGPSKLVPGTKM
FT                   IFPGMAAAQDRADIIAYLKQFGADGRKK"
FT   CDS_pept        97113..98348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="SJA_C2-00920"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="alcohol dehydrogenase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98455"
FT                   /db_xref="GOA:D4Z7I6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I6"
FT                   /protein_id="BAI98455.1"
FT                   /translation="MSDVHTAFGALRLPRSVLFGRGQRHALGSAAGKLGSRALLCTDER
FT                   QAAQPEFHAMVADLKAHGLEVRVFDRTIPDLPIGSINACVDEVRGFVPDLVVGIGGGSS
FT                   MDMAKVVAVLLTHGGDIRSYYGEFAVPGPVMPLIAMPTTAGTGSEVTPVAVVSDDERGV
FT                   KVGIASPHLIPLVAICDPELTATCPPALTACSGADALTHAVEAYTTLARPADPMLTQDH
FT                   VFVGKNLLSDHFARLAVDNIFRFLERAYRDGGDMEAREGLMLAALAAGCAFGTAGTAAA
FT                   HALQYPVGNLTHTAHGDGVATLLPYVMQFNRPFCAPAFAELARTVGLPDAAEEDMSQAF
FT                   IDAVADLLGSVDIPRSLAALGLKAEQQDFVAENALNAARLVKNNPRPLDLPAMQSITRA
FT                   AFAGERAALKSA"
FT   CDS_pept        98369..99853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="SJA_C2-00930"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98456"
FT                   /db_xref="GOA:D4Z7I7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I7"
FT                   /protein_id="BAI98456.1"
FT                   /translation="MTTQSYSCTTTDGHAGPFAIPTDLLIGEAWVPAASGRRIDILNPA
FT                   TETVLTSVADASPAEGIAAVDAAAAAAADWAATPPRRRADILLACFHAMMAEQEWLAQL
FT                   ISLENGKALPDARGEVAYAAEFFRWYAEEAVRINGELAVSPSGANRIMVQYQPIGIALL
FT                   ITPWNFPAAMATRKIAPALAAGCTCILKPAEETPLTALAVAEIMRRAGVPAGVVNVVNS
FT                   SDPGPLCSGILHDPRVRKLSFTGSTEVGRILLRQAADQVISSSMELGGNAPFLVLDDAD
FT                   IDEAIEGAMVAKMRNAGEACTAANRFYVQRGIHDAFVAKLAERMGAMKMGPGTESATQC
FT                   GAMINRQAIDKIEHLVADAVGRGAEVRLGGRTPEGAGFFYPPSVIANVQPGSEILTTEV
FT                   FGPVAAVIPFDDPAEAVALANATEYGLAAYVYTADLKRGLQLAERIEAGMVAVNRGLVS
FT                   DAAAPFGGVKQSGLGREGGHHGLLEYCEAKYIAVSW"
FT   CDS_pept        99895..101964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00940"
FT                   /product="glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="pyrroloquinoline-quinone dehydrogenase (EC
FT                   1.1.99.25) / quinate/shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98457"
FT                   /db_xref="GOA:D4Z7I8"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I8"
FT                   /protein_id="BAI98457.1"
FT                   /translation="MLKMTRRRLLGGTVAVAATIGTAPVRRAMAQELPGGPDTEWRHYA
FT                   ADQANTRYSPLDQINADNFSDLQVAWSFKTDILGARKEYQFEPTPLLVKGRLFLTAGSR
FT                   RDCVAVDAATGELLWMFRKDEGQRALNSPRQLSGHGCSYWTDGKQERILFVTIGYQLVS
FT                   LDAATGIPDPAFGVNGVVDLKKDFDQELDPETADVGLHATPLVARDTVVVGAAHTAGDV
FT                   PAVRKNVKGYVRGFDVRTGKRKWIFHTIPKKGEYGYDSWLNGDADEAGNGGVWAEMSAD
FT                   EELGLVYVPVELPTGDEMGMFRRGNALFGESLVALDLETGVRRWHYQLVHHGLWDRDIP
FT                   CAPILCDIPVNGRTVKALAQPTKQCFLYVLDRTNGQPIWPIVERPVEAGDVPGEWYAKT
FT                   QPFPTKPPAYDVQGIGMDDLIDFTPELRKQAVELVKQYKIGPLYTPPVVSKPGRWGTIS
FT                   VPGIQGGTNWPGGCYDPESHTVFVYSKTQPSVIGIIPNDDPSVSEFPHVHGIAGSEVRP
FT                   QVAMGAAAPTPFMRPPAAKPGSGPPPGFLTVQGLPLLKPPYGRITAIDLSKGDLKWQVA
FT                   HGETPDNVRNHPALKGLKIPRTGRAGNLGPLCTKSLVICGEAGFYTNEYGIRGAMLRAY
FT                   DKATGEEKGAVYMPAPQSGSPMTYMLNNRQYIVVAIGGGNYSAELVAFRLPGVA"
FT   CDS_pept        101981..102457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00950"
FT                   /product="cytochrome c"
FT                   /note="class I"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98458"
FT                   /db_xref="GOA:D4Z7I9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7I9"
FT                   /protein_id="BAI98458.1"
FT                   /translation="MGKVTRGYWLAGALLLAGGAVVTRAQAPERHVWTGVYTKDQAERG
FT                   KAAYAENCAACHGETLAGIDVAPALVGPTFLNNWNNTSAGDLFARIQTTMPLNAPGSLG
FT                   GRKVADIEAYMFEANGFPAGDLALPPNAALMPNVRIVAQRPEPAKAGPECKCGK"
FT   CDS_pept        complement(102493..103275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00960"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /note="carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98459"
FT                   /db_xref="GOA:D4Z7J0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J0"
FT                   /protein_id="BAI98459.1"
FT                   /translation="MSKARLIYEKRGDQAHIRFDNPAAHNALTGAMWHDLRDAARDIAA
FT                   DRSIRVAVFRGVGGKAFISGTDISKFADYESGRQGVDYERDIDECMGALDAIPCTTIAV
FT                   VEGWAVGGGINISSACDFRIATRDARFGSPIGRTIGNCLSVASVARIGAAVGLQRAKRM
FT                   VLLGEMLTAEELLASGFLLRIVERETLDAEADALARRAAENAPLTTRATKETIRRMTFG
FT                   ALPDVEDLIAQVYGSADFRRGVADFLARTKKLPDWTGA"
FT   CDS_pept        complement(103272..104459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00970"
FT                   /product="putative acyl-CoA transferase"
FT                   /note="carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98460"
FT                   /db_xref="GOA:D4Z7J1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J1"
FT                   /protein_id="BAI98460.1"
FT                   /translation="MATLPLAGIRVLDISQVMAGPFCCMLLGDMGADVIKIEPPKTGDS
FT                   TRHSMGFRLKGEDSPGFLALNRNKRSIALNLKDDADREVLYALVKTADVLVENARPGVA
FT                   ARLGIDYDTLAAINPRLVYASISGFGQTGPWAQRPGFDLIAQAMSGILSSNGFPGMEPA
FT                   KNSIAVADLGAGLFSAYAILSAIIGREKSGQGQYIDASLLEAALGLSIWETTELWGTGK
FT                   SPTPIGSANRMSAPYQAVQASDGWFVIGAANQGLWLTFLQVLGRPELQDDPRYSTNAAR
FT                   VTNRIALIEDLAPTFLTRTRQEWIDALLAAGVPAAPILDYGEAVGSEQAVARDMVMQVP
FT                   HPVEGEFKALGFPVKMRGTPQEVRLPPPLLDEHGELIRRELAERGLLAPQREAAK"
FT   CDS_pept        104609..106534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="SJA_C2-00980"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="glucose dehydrogenase (pyrroloquinoline-quinone)
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98461"
FT                   /db_xref="GOA:D4Z7J2"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J2"
FT                   /protein_id="BAI98461.1"
FT                   /translation="MSLKIASSFRRSIALASMISVAASALGGAAGAAPSADADWAAYGR
FT                   DPGGARHSPLRQITTANVSTLRQAWVYHMRPPGVTADTGPMPDGMRAKFATGFSASEAT
FT                   PLVVDGVMYLATPYNRVVALDAATGKERWAYTLANKDQPSTRGVAYWPGARGKGARIFF
FT                   GTRSGKLIALDAATGQPAAAFGEAGIVNMKTPEVMNGLRAAPLGMSSPPAIYKDLVITG
FT                   SRVQEMPVKGAAGDVRAWDARTGKLVWTFHTIPQAGEKGSETWEGDSAKARSGTNVWTF
FT                   VQVDEKRGIAYLPVGAPTFDRWGADRKGANLYSNSVVAVDAATGKYLWHFQTVHHDIWD
FT                   LDLPTLTLVDIKRGGRVTPALVAMNKTAIMFILDRVTGKPLFDVREVPVPTETDVPGEQ
FT                   PWPTQPMPVAPPPLTRLSYDADDILDVTPELKARCEALVKKLNITPSKPFQPLRADSAI
FT                   NFFPGSLGGADWGGGAFDPDLGLYVINLNELASPQQLEQQPDGSWGMKGGYAYFADMET
FT                   GFPCHKPPWGELVAVDVVKGAVAWRRPLGDTGHPALKDAGITSAGGPFTTSGGLTFIGA
FT                   TKDQRFRAFETKTGKLLWTAELPGSSYGTPMTYAAGKRQMVAVVATGGFAFSPATSDAV
FT                   VAYALP"
FT   CDS_pept        106544..106873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98462"
FT                   /db_xref="GOA:D4Z7J3"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J3"
FT                   /protein_id="BAI98462.1"
FT                   /translation="MHKVGLTIMALALPLIGAGAMAQQAPATVAAATPPPGPGLDLINE
FT                   RCGFCHTTGQVFQKRRSEAEWAATVQGMADRGAEVSPEEIKTITAYLAKNYAPAPGAAP
FT                   SAGGR"
FT   CDS_pept        complement(106919..107935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01000"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98463"
FT                   /db_xref="GOA:D4Z7J4"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J4"
FT                   /protein_id="BAI98463.1"
FT                   /translation="MSSRLRAALLAAALCPLTAPSLAQAPAASAAAPSFERLDPAFDAI
FT                   IAPGTPIERVATGFGFTEGPLWHDGRLWFSDVTGDKMRAVTPDGKVEELLANSGGLPNP
FT                   PAGASIGSNGMAPAPDGTVLMTQMGARRIVRVGKDGSLQPFLSDYQGKRLNSPNDLVYD
FT                   KSGALWFTDPPFGLFNGMDKDPAKELPYNAVFRYADGRLTPVITDMTLPNGIGFSPDFK
FT                   TLYVGNYGPDMYIRAYDVRPDGSLSAPRELIRFPGGRGGPDGLKVDTAGNIWMTGPGGI
FT                   RIVTPQGKVLGQIRLPETAANLAFAEDGHMVYITGSTSIYRLRSKVKGMLPLYARGQ"
FT   CDS_pept        complement(107993..108910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98464"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J5"
FT                   /protein_id="BAI98464.1"
FT                   /translation="MGMGTPRMALVAALMAFGGTAAQAAPPLAQRIGHTDPDGMRVANG
FT                   VHGGAGSMKFGPLLGADALSTNLIFVHRGTIAPKSGIGQHFHNDCEEMFVILDGEAEFT
FT                   IDGRTSRLAGPAGVPDRMGHAHGIYNPTDRPLQWLNVNVGMTKSYDNFDLGDPRTGATL
FT                   DPVPQFINMRLDRALLKPAAAALPDATGAVLYRRALGPAVFSTPWSYVDHILLPAGATL
FT                   GRRTQADMSEVYYAISGTGEVTLGGETAPIRAGDAVPVDLGEARAIRQTGGQPLELMVI
FT                   GVARDLAAKARYRAEAEARLRPRR"
FT   CDS_pept        109019..110338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01020"
FT                   /product="putative MFS permease"
FT                   /note="MFS transporter, ACS family, D-galactonate
FT                   transporter / permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98465"
FT                   /db_xref="GOA:D4Z7J6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J6"
FT                   /protein_id="BAI98465.1"
FT                   /translation="MNGAARSRVRLGLIFLLFIISAIAFLDRTNISVAGVEMRKEYAID
FT                   QVQLGWVFSAFLIGYALFQVPAGWLAARYGPRIVLTGALLWWGVFTAATALIHPEGSAA
FT                   LLLLALTRFALGIGESVVYPCGNQFLSRWIPAQERGKANGWIFAGVGAGSGITPPLITA
FT                   IILWGGWRASFYVCAVLGLAAAAIWFWLARDRPQEHPSVNAAELAHIEAGLPPAKRASS
FT                   GPIPWGAIFSSRNVWGLFVSYFAFGYVIWIFFSWFFIYLAEARHLDVKSSAVFSMLPFL
FT                   CMTFGCLLGGVINDRVSARHGLYWGRSGLGILSFVLTGLFLAGGSMVDNAPLAVLILAG
FT                   GAGAIYLSQSSFWSVTADIAGPHSGVVSGFMNMGCQIGGALTSTLTPMIAAQFGWTAAF
FT                   IAGSAVVLAGVLAWAVVDPNRLLEQPAGEGALGPIGGATA"
FT   CDS_pept        complement(110316..110792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98466"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J7"
FT                   /protein_id="BAI98466.1"
FT                   /translation="MKHIWKLAVIGGIALFPQCVAHAQEDGCARLDDPSERLACYDRRS
FT                   GRAAADSRPIPLPASPAPAPAAGAAAAESDSYRDRRDALKSRTDFDSRLKAAVPLRHGY
FT                   YRLELEDGTAYDMTTVGPPPPVGAMVHVRRTPFGTTFFDMEGRKPFTVRLSRRQ"
FT   CDS_pept        110897..111889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98467"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J8"
FT                   /protein_id="BAI98467.1"
FT                   /translation="MAIVKAAFYLCSPALLILGAAAQTSAPSPSQAPSPIPSQAPSTPP
FT                   ARPPMENAWSPKRTPPRAYDAPNRPWWKLADILAAHKGEKSWTHAIVRNRDLEADWRQM
FT                   AAGQRTEPLMYADNATALIVWGGQLRVSIKGQEPFVAVKGGEVNIPFRLPFTLESVGEE
FT                   PALWLEVHGAGDVPLYPVATRPDKPKDVPGFTYVKAALMGGDGRYGAADRPYLDYYRDV
FT                   VTGGQRAGAFMAGDHLFVNNIRGAGIQTPPASDLGHFHFGYDEFWFVMEGNIDYQIEGV
FT                   PFFTASPGDVVTAAQGRWHRASFGGQPGRMATRVAINPYPRGLHSFQPH"
FT   CDS_pept        112008..114974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01050"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98468"
FT                   /db_xref="GOA:D4Z7J9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7J9"
FT                   /protein_id="BAI98468.1"
FT                   /translation="MLGEYLPARLNSSLIAIAAAMVAGQPALAQDNATIAPPPQGSQSV
FT                   ADSDIIVTGSAIRGVAPVGSNLISVGQDTIEKTAPVNVSQLVNTVPSISTAGSVAQGEN
FT                   AYSYYSPQIHSLAGSSSNTTLVIMDGLRLPGGGTQFAQTDPNIIPVSAIQRVEVLADGA
FT                   SSVYGSDAVAGVVNFITRRTFDGFEANAQAGFADSYHNTNFNFIWGKKWDTGGVYVAGS
FT                   YSDQSELKNRDRRFSSLGDYRPVGGTNTNSYQCSPATIIAPGVSGVFLSPGATTTVPNI
FT                   QANAPCNNSVYANLLPSQFRANAMIKVTNDFSDKFTVTAMMNYNRQETHNASGPGGLTN
FT                   AAAFGPGSGRGGQINPFYQAPAGAPGATQQTVTWLALLPDGNYGEQESQSDSIYSTAVA
FT                   EYHVNDDWTLTFSDAFGWNRSALNTVNGFCSACALLALNGTAQLSGSTTATNIPGQNVI
FT                   ALNLPLTAANALDVWRPFDGTNRTSEAVIRSLYRNNSENTNYNTFNQMKLDLNGSLFSL
FT                   PAGKLKIAVGGEYLWYEQTQKITGSNNTGPTTTGSNFRVYNYKRDVKSLYAELYIPVVS
FT                   PDMGIPLVHSFDLSISGRYDSYSDVGSTTNPKFAANWEPVEGVKLRGNYSRAFVAPPTA
FT                   VIGDPTQGYLYASGSVGVNGTQIAVPIANYPDVVNIPGVQCDATTCTIGTPAIQGMRRQ
FT                   LGGGFSNMTPQKGRSWSAGIDLAPRFLPGFTAAFTYFHNKFIGGVSSPSPSAIVNSAGL
FT                   RNLLTICPQTCSPAQIDEFANIANGATVSGAIPPQVYFLIDQSSRNALNLTVEGIDGQF
FT                   NYRADIGELGSFVIGTGFTYFTKFRQNFGGGTDFSILNTSGYNTTFPSVRFKNRAQLGW
FT                   AKDGLSADLFWNHTGSYRNWISTTVAPIIVNSAGNPIGGGDKVKANDTFDLHLQYEFQG
FT                   ESFARGWQIYVDAQNILDKDPPFYNGNTNGILGGAWGYNGFVSNPIGRMVSVGLRIRM"
FT   CDS_pept        115305..116192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01060"
FT                   /product="EamA family transporter"
FT                   /note="putative permease, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98469"
FT                   /db_xref="GOA:D4Z7K0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K0"
FT                   /protein_id="BAI98469.1"
FT                   /translation="MPSVAAPRSVSTRVDPIAFGALSLSLLSVTSGASLAKRLFPLVGP
FT                   EGATTLRLIVGAVILSLVFRPWRLDWRAGWRPLLAYGVVLGVMNLSFYNALAYIPLGLA
FT                   IAIEFTGPLAVALLTSRRRLDFLWIGLAVLGLASLLPLWGASSRLDWRGIALALMAGAC
FT                   WAGYILIGRRAGRMHGAAASAGGMIVAALLVAPVGMVHAGAALLAPDALLLGVAVGIVS
FT                   SAIPYSLEMVALPRLPSNTFGILMSAEPAVGAVMALILLGEVLTLAQWFAIGLIICASV
FT                   GTAVTARSEAMEQP"
FT   CDS_pept        116341..118740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98470"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K1"
FT                   /protein_id="BAI98470.1"
FT                   /translation="MPLPSRRNILPRTCGAAAAALCAASAQAADPAPFELGGPGLRIAV
FT                   TRGKDVLPIAQVPSLAEGDRLSIRADLPEDQGAKFLLLSTFLRGATNPPPKDWIKSAES
FT                   WKKKAKDNSLSLTVPKGARQMTLFLVPDTGGAEGTIEDAVRGKPGEFVRATQELNQASL
FT                   DRSRLDAFMAAIRAQENSHPEYLRSVAPALARSLSMKLNDECLSKVVELQANCLLENRE
FT                   QLVLADVHSSSIAETLTGAPTDLALQLSSTREAGYGFYSPYIGVVRDLARIFGAFSNPE
FT                   FDYLPTLSIRRGDAAALLLNKAPSFQKPKSVLVVGMPAIEADSPPRLRSAANGPICAAR
FT                   PGVVLPVEGAPLIYSTAYARNMTVKLTAASGDMIDLPVEARADRGGYVVKSNGPLPAAF
FT                   KGTVKGHLSGYWGFERFDGPDFALQLPGDAAWKVAGDPPTLVVGRDNGLTLTGDAPACV
FT                   EGVTLRQGDGAPQSLSWKVQGTDALALTLPLADRKPGDIRIEVKYQGIAAPSVLSLKAL
FT                   AQASRLDALSLHAGDRNAVLSGQRLDQVAAVDLSGMMLAPAELVRDGAVDRLNLVAKGE
FT                   GAALKAGDRATARVRLKDGRSFDLAATVKEARPRPTLLGRSVSQGAGAGRILQLSGEDL
FT                   LPDDGRLVFSVRTEQGAAFRADDMLEVASADGAKSVRLGNASGLRLSGADVMVATLDAA
FT                   ALAPASGPLRFRLLRDGVNSDWQPLVTLARLPRIDDVSCEAQDCTIKGRDLFLMEAVDG
FT                   TPGFETPTVVARGFTGSSLSVPAPRDGKLYIRLRDARDQPVMLDLS"
FT   CDS_pept        complement(118721..118990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98471"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K2"
FT                   /protein_id="BAI98471.1"
FT                   /translation="MAILDIGDRAQRKPEVITASVEWHLGSSNESVNRKMGFLGKFLRN
FT                   QGIARSPGLCLVPVQAPGGGCRLKIAGLPPSREQAMRRISSGRA"
FT   rRNA            119248..120738
FT                   /locus_tag="SJA_C2-r0010"
FT                   /product="16S ribosomal RNA"
FT   tRNA            120913..120991
FT                   /locus_tag="SJA_C2-t0010"
FT                   /product="tRNA-Ile (GAT)"
FT   tRNA            121004..121079
FT                   /locus_tag="SJA_C2-t0020"
FT                   /product="tRNA-Ala (TGC)"
FT   rRNA            121409..124202
FT                   /locus_tag="SJA_C2-r0020"
FT                   /product="23S ribosomal RNA"
FT   misc_feature    123232..123257
FT                   /note="recognition site for restriction enzyme I-CeuI"
FT   rRNA            124345..124462
FT                   /locus_tag="SJA_C2-r0030"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(124600..125337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98472"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K3"
FT                   /protein_id="BAI98472.1"
FT                   /translation="MRAGGWATALLALLALSGCQRQAETGMGTVDPAAHDAFYLWPGVR
FT                   PAGNVRPKILYLLDGEVRRGGPPRLERLRMGTPRLPGKKVWLVVRADRLDWNDALYAMI
FT                   FDDLNRWREAGNEVVGLQVDFDAATRGIDGYACFLHDLRRRLPQDWRLSITGLMDWSAH
FT                   GDPHALTRLAGLVDEVVVQTYQGRTTILGYEDYFRRMEGFPIPFRVALVEGGAWQAPPM
FT                   LSHHPQFKGYVVFLLTRTPSDER"
FT   CDS_pept        complement(125340..127478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01100"
FT                   /product="hypothetical protein"
FT                   /note="mucin-associated surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98473"
FT                   /db_xref="GOA:D4Z7K4"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K4"
FT                   /protein_id="BAI98473.1"
FT                   /translation="MSHDFAFHRRHPIAAMLIMLALSGIGLGGALWACADSSCSPGWQL
FT                   ASPDYDCGGRAAISPGNDTRINILLLMRSLRPVDMDRAGAAADVNNPQFGRTFMTWPGL
FT                   RAAFWPQAAEESEGNADATGCAVSREAVAAFDAALAAEAALPGAERAELGRLRAQTGCG
FT                   TTDWGNAAVSSKPGREYLSYLKAADAFHKGDWQAAREGFASLTRSRSKWVAETAQYMPI
FT                   RIGLRAAVATAVDEYGDFAGPEKVDRAAVKEAGNAIGAYLKAYPSGRYAASAQGLTRRV
FT                   AWLSGDMATLVRSYEKLLSTVPGDDEAAANLAEEIDIKLLEREDADRIIGNQSDAPLLL
FT                   AVADLKRMRRQDADPAFLTAGELAAQKGQFARHADLYGLLQASRAYYGGDDPKTILALL
FT                   PDAARDNRFTPLAFSRQVLRGMALGGARDPHETGFWRDLLRGANPLYERPLVEMGLAIR
FT                   WQRDGRVEQVFAPGSPITDSMTRTILLQTLATPAILRAAAQDGARPARERDVARFTLLY
FT                   KDLTRGAFGDFTGDLALVPANAGNDGGLWDFSQQDGIPVGLFRKGRWSDGFPCPSIAQT
FT                   AGTLARSPANAKARLCLGDFYRLNGFDGFSLFKAGEDGFALGNGRDGFSGRFLSRSDIY
FT                   AAIIADRGAAPEDRAYALYRAVMCYAPSGYNGCGGPYRTYEEMDAAQAPQADRKAWFTE
FT                   LKQRYPDSRWAKSLRYYW"
FT   CDS_pept        complement(127664..128881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01110"
FT                   /product="putative monooxygenase"
FT                   /note="monooxygenase, FAD-binding /
FT                   3-(3-hydroxy-phenyl)propionate hydroxylase /
FT                   2-polyprenyl-6-methoxyphenol hydroxylase or related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98474"
FT                   /db_xref="GOA:D4Z7K5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K5"
FT                   /protein_id="BAI98474.1"
FT                   /translation="MALAMEDRVIIVGGGPVGLVAALDLAQRGVPLLILEAASTPIQDP
FT                   RGAAFHPPTLDILGRLGVLPALMEIGLRIPLWQVRNRDGSVVAEFDLNILKDVTDHPYR
FT                   FHLGQQKVVPVLLAALARHANVEVRAGARMTGFTEDASGVVVEYVDGEGGEHLATGRWL
FT                   IGADGARSQVRKSAGIDFEGFTWPERFVVTNLADDLTQFGFAYTNYVTDPDRWAVVLRL
FT                   EDEDGKPNWRVTYPTDPSLSDEEVLDPANVQARLLDVISGADELHLRYCGIYRVHQRVA
FT                   RHFRKGRVLLAGDAAHINNPLGGFGLNSGIQDAASLAEKLADVWHRRADDTLLDRYDRQ
FT                   RRASNIEFVQKASIRNKAMIEERDPDVKRQAQEQLRAIAGDPARSLNYLLESSMINSVR
FT                   AAEKVD"
FT   CDS_pept        129080..130036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01120"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98475"
FT                   /db_xref="GOA:D4Z7K6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K6"
FT                   /protein_id="BAI98475.1"
FT                   /translation="MHKAANKGGRAMLKLADVGLSELQAFEAVYRCRSVIEASRVLDLP
FT                   QPTVSRWLAKLRDHFGDALFVRTPRGMEPTGTADAIIGPVRDMLRIYRDRLMQDRSFDP
FT                   RSTNRNFRIAASDFGQLTVLPMLDRWSADQAPRARFSSVAVDRHSLAAGLESGEIDIAF
FT                   GGFPALYSGVIEQTLYEDVYVCVMRRGHPLLDRDFTVEAFRDATHVLVSARTAGHIHHE
FT                   VEARITAMVSPENVRLTSNSFLVAPLLLGQTDMILTVPRRVALIFKAQVDLEIMSPPFD
FT                   LPQFKVKQYWHERSRHDPGHQWLRQGIAELMAGRPPS"
FT   CDS_pept        complement(130049..131509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01130"
FT                   /product="putative MFS permease"
FT                   /note="MFS transporter, AAHS family,
FT                   3-hydroxyphenylpropionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98476"
FT                   /db_xref="GOA:D4Z7K7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K7"
FT                   /protein_id="BAI98476.1"
FT                   /translation="MRLQYLPSPTCRPILDDSGQPRPPDATTGGDIEREGRPAKIMNVV
FT                   STGNPDMADAPATIGGVIDNRPISPFQYRIVAMGCLVMLLDGFDIQAMALSVPPIAEQW
FT                   ALAPSTFGPALASALLAMLFSAAFLAPLGDRIGRQPMLVTALAIAGFGSLATSQAATVA
FT                   GLVASRALTGIGLGMSIPNAVALVSEFVPARRKALCVALVYSSVALGALTAGFAGPPIV
FT                   HWLGWQGLFQVGGWLPLGVSLLLLFALPESPDYLLRTGRRPGQLRKVLRRLALEGHALR
FT                   PGPTVAHGGALRSLLTPRLRVQTAILWILSWLTMFILYLMISWLPALLELAGFSRADAL
FT                   RSSVVVQAGGILGGLALSVPSDRGGIVPALLCAYGIAIAALLGFEIFAPDPLLWSALFF
FT                   FTGIGTAGSQVALTALAVMIYPPDIRATGLGWAVMAGRFGAVISALAGSLLIGSALSPG
FT                   RVLALLSLPLVLCAANVLMLRAQRRPSP"
FT   CDS_pept        131829..134117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01140"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98477"
FT                   /db_xref="GOA:D4Z7K8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K8"
FT                   /protein_id="BAI98477.1"
FT                   /translation="MWGEAMNICNRSAFIILMLSTSSAMAQTAPFSEDAQADAAAAAQG
FT                   AGGQIEEIVVTAQKRAENIQRVPIAISALGGEALANKGFDSLATLTKLAPSLQLSNYGP
FT                   IAFVTMRGIGNENTTAGGDPGVAFHYDGVYIGRPIGTLFSAFDTERVEILRGPQGTLYG
FT                   RNATGGSINYITRKPGDELEGHVDMTAGKYDMWRVRGAVNLPLSDAVSTRIVAFREKRD
FT                   GFTRNSVPGGTDANDANNWGVRGHVRIEPASDFSVLLSGVHIHSGGVGSQPEIRTPFPG
FT                   STTGRNLGGPQIAGLNNYLVNGVPLVNDLRPFHEGKNSPEYQRNSLSILSANLEYDLGA
FT                   ATIKSITAYAESKFSSQADTDYSPKDLGVLDLEERAHQFSQELQILSNAGANAPFNWIL
FT                   GAYYFREKGFRQSAFRGGRYAIVAANNNVPDGFRLAGDVTSKSYAFFGQATVRPLDRWS
FT                   ITGGLRYTHDEKDGVNSGFQFTPPSYSGPVGGQWEKVTYRIATDYQLTDAILGYVSYST
FT                   GYKSGGINQAINPLLSNAVFQPETVKAMEAGLKSQLFDRRLQVNLAAYRNKYDDLQFQI
FT                   LGPFGAQAYNASGATVQGVELEFQAAPTSWFRLDGSGAYTDATFDPQLVQNVQLGGNRV
FT                   QRTPKWTANVGGSVSFPIRGFGEGRLRVDYSYTSRIFYTAFNRAAPFPVNPGSDLAPGY
FT                   ENVDMRLFLTTADDRWTGEVFVTNLFDTVQTGNVFRGIGFNDVPGGGGAEVVTYKPPRQ
FT                   YGLRIGYKF"
FT   CDS_pept        134202..135047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="estC"
FT                   /locus_tag="SJA_C2-01150"
FT                   /product="esterase EstC"
FT                   /note="putative hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98478"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7K9"
FT                   /protein_id="BAI98478.1"
FT                   /translation="MHHYPPLVLVHGAWHGAWCWNRTQFHLALLNRMAVAVDLPNHGLR
FT                   ALFPRAQRARPFSAEAMAAEPSRAGAISLGEAASFLAGQIEALSIATGSRVALVAHSLG
FT                   GAIANAAAEIAAEHLSHLVHLCAITPVDGHAALEYRMAPENEGSRTASLQTGHPPEIGA
FT                   ARIDAADEARLQDIRQIFFHDIDEDAARAATHFMTPDVPLGFLRDPVITTGRFAAIPRA
FT                   YIVCTQDNALREPAQRRCIADMDRAYPDAPTRVSTLASSHSPFFSCPDRLAALIDMHSK
FT                   "
FT   CDS_pept        complement(135127..135984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="SJA_C2-01160"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98479"
FT                   /db_xref="GOA:D4Z7L0"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L0"
FT                   /protein_id="BAI98479.1"
FT                   /translation="MPEDHILKLSCPDRPGIVAAVSAALFSAGANITDAQQFNDPETNK
FT                   FFMRVVARFPDDRTVAFENMFIDVAAGFGMQWSLRPAAQRRRVVALVSKFDHCLGHLLY
FT                   GSRIGEIDMDVVAIISNHPKEALTIRSWLEDIPYHHFPVARDNRAAQEARIKETIVASG
FT                   AELVVLARYMQILSDDLAAFLAGRCINIHHSFLPGFKGAKPYHQAHSRGVKMIGATAHY
FT                   VTADLDEGPIIHQDVEMVSHADTPEALVGKGRNIEQRVLSRAVQYHVQDRVFINANKTV
FT                   VFRD"
FT   CDS_pept        136310..138739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01170"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98480"
FT                   /db_xref="GOA:D4Z7L1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L1"
FT                   /protein_id="BAI98480.1"
FT                   /translation="MSGASKRACRPHFSALLMRGAFLGAFASTAPAHAWQGSAAAGPEQ
FT                   ASQAARTASGGIADIVVTARRRSESLQNTPVAVSAITGATLADRGATDISAVAQAVPSL
FT                   TFNTTAGNSGASNAAVVFIRGIGQDDFFPTIDPGVGIYLDGIYVSRTLGSVLDTVDLEQ
FT                   VEVLRGPQGTLFGKNTIGGAVQITTRKPSDKFEGSLEATTGRFDRIDVKGSINIPFTSS
FT                   LFGRFSLATLNRDGYVTILRKDPGTGAVTEADAPKLGDISTIAGRGALRWEATPEFKLD
FT                   LSFDYTRKREQSSGTTLLATQPLVPGIPVGDPNFINANAATIGGFYNLVVAGAQGCNPL
FT                   AGGDAFDQSNPSCFNDQYVTGNPYTTFYDPARSRSDLDLWGLTGVAEWNVSPDVSVKSI
FT                   TGYRRTESHFMRDDDTPFRLLELQTDQTARQFSQELQFSGKTMDSRLTWLIGLYYFSEK
FT                   VRFDNPACFSFVCTAVKTKLDTHSYAAFSQATFAIDPRTNLTAGLRYTNETKRNDPDNF
FT                   YIDNGFGLPPFAVNNPNPDPATIIDNPAKVKLKNVSPMVSLDHRWSPSIMTYASFSQGI
FT                   KGGGFQQRVILPRLQQPTFGPEKLTSYEIGAKTDLFDHHVRFNIAAFWADYKNLQITVF
FT                   DPNFSIEPLQVNGGTARIRGIEVESTIKPFEGLTATLGGSYLDTEYTRIAPNAAIPPDA
FT                   VLPYTPKWSISGGLSYAYELADAGTLTLRGDWNYRSRTFFNAANDPIISQPGYHVVNMS
FT                   AAFLTRDEHWRLTLGVTNLTDKAYLGSGFADLRNSSFADGVYARPREWYLSARYAF"
FT   CDS_pept        complement(138837..139325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01180"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98481"
FT                   /db_xref="GOA:D4Z7L2"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L2"
FT                   /protein_id="BAI98481.1"
FT                   /translation="MMSRQSTGLLGISCMIETNFPGLAANEPSCRHCRHRTGSAIGPEQ
FT                   KLWVRAQNISIMASVGIHRGEKDHHQEILLNIAAEVREPESDRIDRAVDYRTLVDAARR
FT                   LAAEGHFELIETLACELGRRLMGLDRVSAVDIELFKPAAIAPAMASVRYHAAKPDQPS"
FT   CDS_pept        complement(139744..140772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01190"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98482"
FT                   /db_xref="GOA:D4Z7L3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L3"
FT                   /protein_id="BAI98482.1"
FT                   /translation="MLPTSRDPAAMLSFFHLSVFEAMMRLKSVTLAADELELPQSSLSR
FT                   NLSALREHFNDPLFVRTRNGMVPTSIAQSVAKGVEEALRIYRNGLCGRQSFDPALSERN
FT                   FRIAASDLGHYCIMPLVQRHSAHIASNVKFTAVPIGRNTLISQLEAGMADIAVGSYPTL
FT                   YANVKEQTLFREDYVCILPKALAPNGVLSLSDYKALDHIVVDGQHYGHGHREAESRILD
FT                   IIDPARIRMVSETFMVTALIAEMSDLVLTVPRSVARVVQSPRMTIVAPPLELPVIDVKQ
FT                   YWHERFDHDPGNIWLRSLISECRVDHQLGARRVNVQGQPIAASLEEAGHEAGAPAVDVS
FT                   AC"
FT   CDS_pept        complement(141047..142021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="SJA_C2-01200"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98483"
FT                   /db_xref="GOA:D4Z7L4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L4"
FT                   /protein_id="BAI98483.1"
FT                   /translation="MKLALERFPSDRNRSLIKKSRKTRNPERQSDSIGSKPALPGQDAP
FT                   ILDLVRSFSLEMTAKDVASLADAAPMIPAGTPISVTYLPGETMPARVAAARTVKSLGFV
FT                   PVPHISARRIPSKDDLVEFLTVLDGEVGIDRAFVIAGDPPAPMGPYEDALAVIRSGLLD
FT                   RAGIGTVGISGYPEGHPDIGREKLDQAMKDKIAALAEQGKRVEIMTQFAFDADAILDWL
FT                   ARIRRDGVAAPVRIGLPGPASVGKLIRFAARCGVGASARVMVKYGASITRLLSTAGPEH
FT                   LIESLARQRDPAIHGEAMLHFYPFGALVDTARFIRSHYGDACE"
FT   CDS_pept        complement(142087..143466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01210"
FT                   /product="putative aminomethyltransferase"
FT                   /note="glycine cleavage system T protein
FT                   (aminomethyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98484"
FT                   /db_xref="GOA:D4Z7L5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L5"
FT                   /protein_id="BAI98484.1"
FT                   /translation="MKNPLLQYRNLEEALQAVGGPVKLLRSSLIGPYQFPVAAPEYTNW
FT                   RDEQRAWKQGVALLNQSFHMTDLYLRGPDALKILRKVGLTKMTTFPVNRGKQLIAASPD
FT                   GYLIGDGIVFHLEQDYFRVVGPPVISDWTQFHAETGGYDVEIDRDETVSMRPGDPRIWI
FT                   YQIQGPYALELLKEVTGNRLPEISFFGIGSFEIAGKPVRALRHGMAGTPGFEMFGPWAD
FT                   GEAVMDALMEAGAKYDIRKVGSLAYPTSAIESGWMPHPVPAVYHSEEMKPFREWLSPMS
FT                   LETLGSMGGSFYSDDIRDYYMDPIDVGYGPLIDQQRDDFIGKAALARRAADQKRRKVTL
FT                   IWNHDDLMRVIHDSLYADPPARFINFPLSAYSTFHIDDVRARDGGRHVGLAQFSGFSAN
FT                   AGEFLSGAVVDVDHAEPGAQLTLLWGEDKMRRPTIERNTLREVRVTVAPSPYFEKVIKK
FT                   D"
FT   CDS_pept        complement(143776..145152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98485"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L6"
FT                   /protein_id="BAI98485.1"
FT                   /translation="MQEICRPQRKGRNSAAEARRDIARPIRSAIRFRASNLREITESAL
FT                   MKHRSPTIRNPDGAYPICRCSGSRRPSLSSDRGFPFRSDEGVVVRQRRASSDHAENFDN
FT                   ARAHERMKPMTVKSTPILLVGSVPLRDEAEVFAEVAGILGERVAAIPDGETGARTNWIN
FT                   WQKSVMDQAPMIERRQHVDGYGAVQVDLYSEKKDHAGERAFPPLGYARAALASYATFRA
FT                   MKEEGRIAPGTRFQVALPTPFAPMMSFIEPGSFHRVEPLYVAAMHRELDEILSAIPHEE
FT                   LAVQWDAALEFAVLEGVFPAPVTDFRSLVGRMVELGSWVPDAVAMGFHLCYGDANHKHF
FT                   KDPDSTSLMVQVMNDLARRVVRTIDWFHLPVPIARDDDAYFKPLSVLKTSPDTQIYLGL
FT                   AHVRDGREGALRRATSARKFIKGFGIATECGLGRRPSETIVPLLRMQVEIAEAIDGLDA
FT                   "
FT   CDS_pept        145240..146811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98486"
FT                   /db_xref="GOA:D4Z7L7"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L7"
FT                   /protein_id="BAI98486.1"
FT                   /translation="MVSSAVPPSLPLLARFRWKLAPALLIVGIGDWLFYQRHLHGGYLG
FT                   LFALAVLLALLAGRPVLRRDRRAWAAMAAAALFALALIYDASLLAWLLFWTAAGVAALI
FT                   PATARFDDGWRWFQRLVWLGLRAPFGPLIDLKRLLKLRAAGRAGRWSLHAALGTLTLPV
FT                   AGSAVILTLFSAANPLIERFFSSLLLPDLSPELMARLAFWALLFAMIWGLLRPRLARVL
FT                   LPGFSGRGDWALPGVSVASVTLSLTVFNLIFALQNLMDAAWLWGWAPMPQGMTMADYAH
FT                   RGAYPLIATALLAALFVLVTLRPGSETARTGSIRRLVMLWIGQNIFLVASSMLRTADYI
FT                   DAYSMTRLRIAALVWMALVGFGLAAICWRLLRERSAAWLVNVNLAAAGLVLAVICFIDL
FT                   GAVAAQWNVRHAREVGGRGVALDLCYLGGLGDSALLPLLSLERRPGLQPEFRERVQAVR
FT                   LRIHAGLEAELDRRWTWTGQRRRDQARAMLSGAAPAALTLGQRDCAGRPVRPRSTLPAL
FT                   TGERGK"
FT   CDS_pept        146823..147533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01240"
FT                   /product="two-component system response regulator"
FT                   /note="two-component system, OmpR family, response
FT                   regulator RegX3"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98487"
FT                   /db_xref="GOA:D4Z7L8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L8"
FT                   /protein_id="BAI98487.1"
FT                   /translation="MPSTILIVDDDPHIRQLLVFAFGKAGLETIEAADGEAALAAVERH
FT                   APDLVILDINMPRMDGLEVCRRLRAHDDVPIFFLSSRDDEIDRVLGIELGGDDYVVKPF
FT                   SPREVVARSMAILRRASARPPAVEAIGAIRHGRLSLDTESWSAHWGGAEVSLTVTEFTI
FT                   LRTLLAMPSRIFSRDQIIDRFRGPGFALTDRTVDSHIRNLRRKFADVGGFDIIETRPGI
FT                   GYRLGGCSGTAPPA"
FT   CDS_pept        147506..149104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01250"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, OmpR family, sensor histiidine
FT                   kinase MtrB"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98488"
FT                   /db_xref="GOA:D4Z7L9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7L9"
FT                   /protein_id="BAI98488.1"
FT                   /translation="MQRDGASCMIAGLKARIARHWPVLRLRTILLCTLLFVAALPGFGA
FT                   IFLRVYENALVRRTEAELVAQGAALAAGAAVVGRGMADRPAPSAAPMRYHDRMTEVDLR
FT                   SSPILPPRPRAVPTRERPDGAAVEIARRMMPAFAETKVTTLSSILMLDRRGVVLNGREG
FT                   GRSLAALPEIRAALAGRAVTVLRENEGVTAHYPLEWLSRAAGIRLHHARPISVDGRVVG
FT                   ALLVSRSPRALFLGLYEDRGKIALGVVAIFLMLVLLSAILSRAIVRPIESLSRATRELA
FT                   LGRRVAPRHPSLQVVEIQALYRDFEQMAESIGKRSRYLRDFASSVSHEFKTPLAGISGA
FT                   IELLQDHGADMAPADRRRFLANMAADAQRLSRLVRRLMELARADVLVGESDARTDAAPV
FT                   LVSVADALSADGFAIDLHLPQHMPDLTVDAGALEAVLTTLAENARQAGASRLDIGVALH
FT                   QGAAWIDFADDGPGIPPGDRGRVFDLFFTSKREEGGTGLGLAIARSLLDAYHGELRLLP
FT                   SDRGAHFRLVVGTAP"
FT   CDS_pept        complement(149107..150030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01260"
FT                   /product="putative membrane protein"
FT                   /note="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98489"
FT                   /db_xref="GOA:D4Z7M0"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M0"
FT                   /protein_id="BAI98489.1"
FT                   /translation="MRHIFSGPVHGDIGDAGHVSGQPEMQMEMIVPEAALIGSAKPGAL
FT                   LRRSSLALVATAWASGMVFGAYILLFFGGSALGGLADRWNGALRGLHDPALPLAVIAIG
FT                   LHFAAGGILLLLGPIQLIGPVRRAVPRLHRWLGRLYVGAAALAGVGGLGFIIVKGTIGG
FT                   PLMDVGFGIYGALMILCAERAFTLARQRRFDAHRAWAIRLFALTVGSWLYRMEYALWYL
FT                   AMGDLGTNHFRGWFDAIMMFFFYVPNLLVAEFFIRARDGGTHGKGEIPAALALIAASLF
FT                   IAVATWFFTVSIWGPGMAKGMEGLAA"
FT   CDS_pept        150075..150776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01270"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98490"
FT                   /db_xref="GOA:D4Z7M1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M1"
FT                   /protein_id="BAI98490.1"
FT                   /translation="MKPSTQPPLRPSEGGYAKGEQTRARLLEAALDCFGPDGFERVTTR
FT                   QIATRAGVNLPALTYYFGSKEGLYLACAQHIAGQYSQALNPAAVEAQAALDAGLPPAVI
FT                   GERLKGLMAALAGFLLASSDAVNRNLFIQREMANRGPAFDLLYDRLWGPGIEFAAVLVE
FT                   RAAGGRLTPTEAGVRAALMIASLAGFGEGRAVIERAISKSDRIDYAIAALNEQIDALVR
FT                   PPSATQAAGDR"
FT   CDS_pept        151027..152022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01280"
FT                   /product="sterol desaturase"
FT                   /EC_number="1.14.19.20"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98491"
FT                   /db_xref="GOA:D4Z7M2"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M2"
FT                   /protein_id="BAI98491.1"
FT                   /translation="MDGVRVGKRIIGAQAPVTVGWENIPRVQGGPVKRFVFTWFQPTML
FT                   FALIAFWYYAPNSIAKASTAIGIGIGFKILLLALEWVNPRHESWRLTWKELASDLFYVG
FT                   LGYTLLDLVERYIGSDAVIEAVQHGFDWDKLAWFTGLPLLLQAFLISFIFDFGQYWMHR
FT                   GMHNWYPLWLTHAPHHYITQLNVNKGAVGNPVELFLIGIGIGGFFDFLPRAALLAGTLG
FT                   LAVGTYQHINVRFNSPRWWRFLFNTTEHHSMHHSQDYEATRSNYASTWIVIDRIFGTCV
FT                   DGEAELLGMEGGRKMSIAETMTYPFTEGWRTMKERFGRARADGPIAQPAE"
FT   CDS_pept        152054..152662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98492"
FT                   /db_xref="GOA:D4Z7M3"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M3"
FT                   /protein_id="BAI98492.1"
FT                   /translation="MNRRFIDWIWHIRGSLPLAPGQSGDDAFGRLDPLFHEPGTSHDRM
FT                   DDTLTFRKKGQAAQDKMSIFDSGVLQVRKGAAGLVLHYRLSSRALLFCFLAPLLFLGFA
FT                   QLTIAVGKIEKATAHAAEKKPEKKDASLPQHPIDKFLGAPAPEKPKKDKAGKSGEDDKK
FT                   PSPKAAYVFAAIFAALYGIGRVLEGKLVRSLFRKRLLGA"
FT   CDS_pept        complement(152706..153650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01300"
FT                   /product="putative metallo-beta-lactamase"
FT                   /note="hydroxyacylglutathione hydrolase / Zn-dependent
FT                   hydrolase/glyoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M4"
FT                   /protein_id="BAI98493.1"
FT                   /translation="MMARGTAVLRSASLAGILLAIMLLPGQPPVSAKEAARSKLFAEGW
FT                   IDGTLPQEPEVQVQALDRDSFVIRQSVKTNFEAPFLYLLLGREKALLVDTGAEGGRIRP
FT                   VVDRLLAQWSAAHGRAAIPLVVAHSHSHGDHVAGDKAFRDRPDTTVIGLEPQDVARFFG
FT                   IARWPDALASFDLGGRVLTIIPAPGHQAAAIMIYDPKLKLKILLSGDTLYPGRLYVPVN
FT                   FLADNRASVDRVAAFAARHPIRAVLGAHIEMTRAPGRDYPHEAPAHPDEHLLELPAASI
FT                   AGLRTGLKAALDVPDRPQVHDDFIIYPVAPRPN"
FT   CDS_pept        complement(153805..156228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01310"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98494"
FT                   /db_xref="GOA:D4Z7M5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M5"
FT                   /protein_id="BAI98494.1"
FT                   /translation="MKLLRNTLLGATMLMGVGTNMAFAQDAAENDASDDRNEIVVTATR
FT                   RAVSIQDVPINISALGAEQIAKQRIDDVRDLADFTPGMTISDTGPGSTGTIVLRGLNAS
FT                   DMDSTGDSYDSAIGVYLGEVPLYYDFKMLDIARVETLLGPQGTLYGLGTLAGAIRNIPN
FT                   RPDTTNFASEAHGRLYAKDHSGRAGYQLDGVINIPIFQDHVAFRSATGYFYDPGFIDSP
FT                   LLLQQPGVSLPQPSGPGGVSAADYAANLKRQDDVNFEKTFTTRNQLLVRFSEDLQANFT
FT                   YAYQQTKTDGGQYNSNGVLGTGKYENGARYLEPVKRRAHLGSMEINANLADIADLVATT
FT                   AYTDVKNETQSDNTDLLLDLDYGYETFPAFSSWNESVDRRKQFNQEVRFVSRHGGPFSW
FT                   VLGGFFNRQKLHRDYIEHVPNHPWVEFGTQPNPDEVEYASYVKSKVTEKAIFGEGTFRV
FT                   TPNWQLTAGARYFGYTSKVAGALVVPLIGDPVSPYDLPSAGGTAKKSGWVWKFNSSYNF
FT                   TTDIMLYATYSKGYRIGGPNSVAPCPNPLPNDPDGDNINNTQLPCGLPNEVQYGPDTTK
FT                   NAEIGIRTQWFDRKLTFNFNVFQIKWDGIQLASATLNGIVGITVNGGKGESEGFETSFQ
FT                   VRPVDGLSIQGTYSYTDAKLTQDVLENIPVNDPAGSYPSVPIKLDALSGDRLPGSAKNS
FT                   GSLGATYTMPFKDGSIVADWTATYRGNVVTRLGWDRAFGDKLPSYVLHRASLTYETDRY
FT                   SVGLFANNIFDKYAVSSVANDRSRVGLNDGVLLRYYKRTVINPRTFGIEARFKY"
FT   CDS_pept        complement(156404..156949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98495"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M6"
FT                   /protein_id="BAI98495.1"
FT                   /translation="MSNNEGLRGAAAEAGRKSTAPKRRAETCPWASCCIWRVSGRALPR
FT                   RGHAVVMPARFANRSLAKARAIAPLRHAAGRRRHGAQRSIDRNQPLNAMQHASPFILSR
FT                   CGIITLDALGNIHTVSYVVRPNDGTKGSNCRHAPVQSEGAWIERGSAMGQFRAMCSPYP
FT                   PRRSHFRYSAPPAKCSGK"
FT   CDS_pept        157026..158108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01330"
FT                   /product="ABC-type transport system periplasmic component"
FT                   /note="sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98496"
FT                   /db_xref="InterPro:IPR017793"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M7"
FT                   /protein_id="BAI98496.1"
FT                   /translation="MIRLIGKAGRVAAIAGALMLASCSKAPDPAAAHRKEFSIGWSIYA
FT                   GWMPWPYAQQAGIVKKWADKYGIKINVVQVNDYVESINQYTAGKFDGVTVTNMDALTIP
FT                   AAGGKDTSAIIVGDYSNGNDGILLKGADRLAAIKGRQVYLVELSVSHYLLARGLEIAGL
FT                   KPTDVRTVNTSDADIVGAFGSPGATAAVAWNPQLSVMKAQPGVKQLFSSAQIPGEILDL
FT                   LAVDTATLRANPDLGKALTGIWYETVALMQRQDAEGKAARAAMAKLSGATPESFDGQLS
FT                   TTHLYADPKAAVAATVDPALVKTMTQVRDFSFSKGLFKGASSADAVGIAFPGGKTLGDP
FT                   QRVTLRFDDSFMKLAADGKL"
FT   CDS_pept        158145..158960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01340"
FT                   /product="ABC-type transport system permease component"
FT                   /note="sulfonate/nitrate/taurine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98497"
FT                   /db_xref="GOA:D4Z7M8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M8"
FT                   /protein_id="BAI98497.1"
FT                   /translation="MRWVNRHVRRRQRIGWGSLPILLLVLLYLIVAAQRHAANPLDKIL
FT                   PLPGSMAEAMAALLFRADPLTNQFVFWADTLASLQRLGLGLGIATLSALLMGLVLGVLP
FT                   PVRATFGPLVTAVAVIPPIALLPILFIALGLGETAKVALIVIGIAPVMMRDIAAHVADL
FT                   PREQVIKAQTLGASSWQIMIRVALPQAMPRLLHAVRLSLGPAWVFLISAEAIASDVGLG
FT                   YRIFLVRRYLSMDVIIPYVAWIAILAILMDAALTLASRRLYPWAHGARH"
FT   CDS_pept        158957..159760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01350"
FT                   /product="ABC-type transport system ATPase component"
FT                   /note="spermidine/putrescine transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98498"
FT                   /db_xref="GOA:D4Z7M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7M9"
FT                   /protein_id="BAI98498.1"
FT                   /translation="MSALLSLRDIWVEYGDKIVLERVNLDIEAGSFVSIIGPSGAGKSS
FT                   LLRVVLGQEAPARGTISLDGMPLTPECGPDRGVVFQRYSVFPHLSALQNTIFGLECAQA
FT                   PFMARLFGHARRAAMADAEQMLAAVGLGDSLHLYPAQMSGGMQQRLAIAQALIKRPRIL
FT                   LLDEPFGALDPGIRADMHALITRLWRDYSLTIIMVTHDIREAFSLGTRVLALDKRRHDP
FT                   HAPHRFGATAVYDLPLRNRIDAEASEQADAPDESERKEEERTEHE"
FT   CDS_pept        159753..160226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nikR"
FT                   /locus_tag="SJA_C2-01360"
FT                   /product="CopG-family transcriptional regulator"
FT                   /note="nickel-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98499"
FT                   /db_xref="GOA:D4Z7N0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N0"
FT                   /protein_id="BAI98499.1"
FT                   /translation="MSSDTGTLARLSMSLPSDLFRQLDAMVEERGLPSRSQLIAELIRH
FT                   ALAEHEAFTRPDEMLAGTITIVYRGDRGRVRHQLAQTQADYLKEVISSQHVFLEGDQSL
FT                   EVLLVQGPASLLKELCDALRRVRGVHQLQLVTTTALLPPLYEQEAGGRKGNAA"
FT   CDS_pept        160223..161047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01370"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98500"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N1"
FT                   /protein_id="BAI98500.1"
FT                   /translation="MTESLANPLAARDHARSMAGTVVEAMPLLPPMADDLPDGVPAGDL
FT                   LWEETVAAGGYATRRLPRGARLRLIDLKGDACASILLFNAEMPTERLNVADTVKVQWNA
FT                   YLGEGKLLLSDMGRVLMSFLEDDAGTHDSFCGTSNAATNAARYGDGANSGPCPNGRDRF
FT                   LLGAAKHGLQRRDVHPCVTLFKGAKIEADGAITPLIGPFAPGRSVVLRAEMDVILVLAN
FT                   CPHVLDPRESWTVTPLRATAWRGPVTPEDDAIRNATPEGLRAFQNVEDYYRR"
FT   CDS_pept        161156..161791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01380"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98501"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N2"
FT                   /protein_id="BAI98501.1"
FT                   /translation="MSFDPHLSGLSGAIVHDVVVPARAPWLHHVDAGQTLRIVDLEGNQ
FT                   AVDFLLYSAADDAERYSAQDTVAAQGNLFLRAGTVLRSNEGRAMMTIVATSVDYHDTIG
FT                   GACSCESNTLRYGHHTKAEHACVENFLEANLREGRGKRDIVSNINFFMNVPVEEDGSLG
FT                   IVDGISAPGLTVDLRAEMDVIVVVSNCPQINNPCNGFNPTPVRMIVTA"
FT   CDS_pept        161788..165384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01390"
FT                   /product="putative allophanate hydrolase subunit 2/urea
FT                   carboxylase"
FT                   /EC_number="3.5.1.54"
FT                   /note="allophanate hydrolase subunit 2 precursor / urea
FT                   amidolyase-related protein (EC 6.3.4.6) / biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98502"
FT                   /db_xref="GOA:D4Z7N3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N3"
FT                   /protein_id="BAI98502.1"
FT                   /translation="MSFDTVLIANRGAIATRIIRTLRRMGLRSVAVYSEADENSLHVAQ
FT                   ADEAVCIGPARASDSYLNIDAILDAARATGAGAIHPGYGFLAENVEFAEACAAAGIVFI
FT                   GPTPDNIRTFGLKHSARALAAAHGVPLAPGTDLLTDEEEAAAAARAIGFPVILKATAGG
FT                   GGIGMRICEDEGDVREGFAAVARQGQSNFGDAGIFLERYIRRARHIEVQLFGDGEGRVM
FT                   PLGERDCSLQRRNQKVVEESPAPLLPPAVRRDLIAAATRLGQAARYRSAGTVEFLYDAE
FT                   RQQFFFLEMNTRLQVEHGVTEEVMGIDLVEWMIRGGAGDFAFLDADPPQQRGHSVEVRL
FT                   YAEDPALDYRPTSGTLTAVQFPADIRAETWCMAGSEVSIWYDPMLAKLIVHAPTRDEAI
FT                   GKMQAALDRSRVDGMETNLRWLRDVVRSDAFVSGEVSTRALEGVVSNPSSIRVVSGGTA
FT                   TTVQDWPGRQKLWAVGVPPSGPMDDQSFRIGNRLLGNPEGTAGLEVTVTGPTLDFAAPA
FT                   RICLTGADFGATLDGQPVQRGAAVDVEAGQTLALGRASGGGLRGYILFAGGLDIAPYLG
FT                   SRSTFELGQFGGHAARRLLAGDTLHLAGDRTDAPLASADMPDLSTRWTLRVLYGPHGAP
FT                   DFFTDADIEAIVAAEWQVHYNSNRTGVRLIGPKPQWARADGGEAGLHPSNIHDNPYAIG
FT                   AVDFTGDMPIILGPDGPSLGGFVCPFVVIAADRWKIGQLAPGDKLRFAPVNIDDAAVAD
FT                   ALQRRLVASGSVEDAAPVRPIEMLSPILARIPEGPGRPRTVYRQQGDRNILVEYGPIVL
FT                   DIELRIRVHALMTELERLALPGIVDVVPGIRSLQLHFDGEQLDQRAALAALISAEERLG
FT                   DLEDFTIPSRIVHMPLSWRDPATIETIEKYMGGVRADAPWCPDNIEFIRRVNGLPDAAA
FT                   VERLIFEANYLVLGLGDVYLGAPVATPVDPRHRLVTTKYNPARTWTPPNVVGIGGAYMC
FT                   IYGMEGPGGYQLFGRTIQVWNTHRQTDVFVEGKPWLLRFFDQIRFYPVSAEELAEWRRD
FT                   FPSGRRSIRIEPSEFRLADYRAFLAGNADAIAAFEARRQAAFDEERAEWQRNGEFDRVT
FT                   SLTEADVAGPDAIDVPDGADLVETPFGGSIWKLLVAVGDEVKAGDTIAVIEAMKMECAV
FT                   QSPATGTVAAIYVQERQALQPGAPMLALRAVA"
FT   CDS_pept        165381..167150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01400"
FT                   /product="putative amidase"
FT                   /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
FT                   or related amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98503"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N4"
FT                   /protein_id="BAI98503.1"
FT                   /translation="MIALDRRSAATIAEAVRAGRTSAVAVMEETVARLAAYDAVQPQIW
FT                   IGRATPDDLIGAARSVDARLAAGEDLPLAGVPFAVKDNIDAAGFETTAACPAFAYRPER
FT                   SATVVERLTAAGAICVGKTNLDQFATGLNGTRSPYGSPRNAYHLAYVSGGSSSGSSVAV
FT                   AAGLVPFALGTDTAGSGRVPAAFQHLVGFKPSKGRWSNNGLVPACRTLDCITVFTGDTA
FT                   DARLLDGVIAGFDPADPYSKPLADLPRRCGTIGVPRRDQRAWFGDAESEYLYDRALQRL
FT                   AGLADVVEIDIAPLLEAAQLLYGGPWVAERAAALATLLADDPDAIDPTVREVVEPGLAI
FT                   SAVELFNGIYRLAELKRHADLQWAGIDLMAFPTAGTIFRVAELLAAPVALNSALGYYTN
FT                   FVNLLDMAAVAVPAGARANGTGFGITLIGPADSDRALLDAADAYLAEADLLSQPPLDLE
FT                   GKMQTVKLAVVGAHLKDMPLHWQLTSREAKFIGAFETAPTYRLYAMANSVPPKPALVHS
FT                   EDGGPIALEVYELGVAEFGSFVAEVPAPLAIGTVTLADGSSVKGFVAEPRAVTGAEDIT
FT                   ALGGWRAYMAGRA"
FT   CDS_pept        167153..168079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01410"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98504"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N5"
FT                   /protein_id="BAI98504.1"
FT                   /translation="MPKLRILAAALAASCAAIASAAPAAEQVIQVPGFADFLAVDGDGV
FT                   WVTNAGRVERWTRKGKRAEVAMGRPCGAMALSAGSLWVADCEKNALVRIDAATAEKTAT
FT                   IATGIANPKGELNVVAEAGSIWVASDQKGVVSRVDPASNRVIATVPVSAGTYYLASGFG
FT                   SVWAVSSESATIQRIDPATNSVASTTALGRQPGFLAAGEGAVWVQEQGDGTVARVDPVS
FT                   GEVTGRVKVGDVLQYGDIDTGGGMIWLRTTEGQTFVAIDPKTLKIKARVGKVEGSGALR
FT                   FTAKGLWTSAHDVHTLTWWPHPARLAK"
FT   CDS_pept        complement(168141..168473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98505"
FT                   /db_xref="InterPro:IPR030972"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N6"
FT                   /protein_id="BAI98505.1"
FT                   /translation="MMMKIGLAALAAAAFAVPAVAGAADNPFARDQAILNLKGLDLSTA
FT                   QGQQRLAIRMEQAASAVCGNRLSGVHLALEAKARACREAVVADIHAQVEAQLAMAPAPV
FT                   RLAALR"
FT   CDS_pept        complement(168593..168946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98506"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N7"
FT                   /protein_id="BAI98506.1"
FT                   /translation="MLGRLILGGALAAAATPALAAGEPVTRLVDCRSGSCLLVSGRRED
FT                   AAVPVAINGHAVPVDGARKWRVRLPVDTVRSWSLPHERTITVAVGGKASEARLPLGLLG
FT                   RSERLTMLVVRAK"
FT   CDS_pept        complement(168988..170556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01440"
FT                   /product="putative sulfotransferase"
FT                   /note="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98507"
FT                   /db_xref="GOA:D4Z7N8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N8"
FT                   /protein_id="BAI98507.1"
FT                   /translation="MTVTGAPQASAARNALMRGDMQATRQLAATMVAKDPQDAEGHFLL
FT                   GVAESDAGRIQAGIRHLDHAVTIDPRGEYRAQLARLLIMTRRDGDAAATLREAEQAPPA
FT                   DAFSRDTIGCVYARLGNHAAALAHFDEAVRMEPRNRNYRYNLAVTLNFLGRVEEADAAL
FT                   EALLSLAPDDARAHHLLAGIRRQTPTCNHVERLERTLGGMTDGRGRLLISYALAKELED
FT                   IGRPDDALARLCVANAEHRRTLPYAFARDAALFDAMEAAWPLPQASAPSAADPIFIIGM
FT                   PRTGTTLVDRILSSHPQVESAGELQAMPLAVKKAAGTRTPTVMDAETIASAARADMAAI
FT                   GRDYLERASHHRRDANLRFIDKFPGNFFYAGFIARALPSARIICLRRDPMDTVLSNFRN
FT                   LFAVGSPYYDYSYDLLDTAAYHVRFDRLMALWREALPGRLIELRYEDLVADLEGETRRL
FT                   LAHCGLDWSEDCLSFHSNSAPVSTPSAAQVRQPIYTGSVGRWKRHAAVLEPVRRYFEQA
FT                   GIDIP"
FT   CDS_pept        complement(170553..171566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01450"
FT                   /product="sterol desaturase"
FT                   /EC_number="1.14.19.20"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98508"
FT                   /db_xref="GOA:D4Z7N9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7N9"
FT                   /protein_id="BAI98508.1"
FT                   /translation="MESPVGAGMAGEAGSAMKDKVFNYTPPAMIAMVLMFWAFGPKALL
FT                   DRPWTFVATSSLITIVVLLLEQVHERHSGWRMNRQEFFTDLFYNVLSATVISWVSTKLA
FT                   EEPLKAAKASLGITTQWAMHMPWLLQVALVVFLIEFGQYWMHRLMHNSTPFWLTHAPHH
FT                   HLTQLNAAKGAVGNPIELVLISLSVVALFDLDNSAVFAGINVLGVISTFAHANVRADPP
FT                   IWYAFFFTTIRHHSLHHSTDYESTRCNYGNSLILLDRIFGTYREGEAALVGQDDRRRLS
FT                   IWEQTIFPFRPLIDRVRNGSARNGRGAAQAAGEGAVDGRAEADASVQNAVEGAAPA"
FT   CDS_pept        complement(171657..172595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01460"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98509"
FT                   /db_xref="GOA:D4Z7P0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P0"
FT                   /protein_id="BAI98509.1"
FT                   /translation="MSDRSFLIDKRFASRVDWNLMRTFVDIVRAGGIGAAARQLNRQQP
FT                   SISAALKRLEDHVGVTLLHRTATGVEMTAAGKAMMALCEDMLESAQMMPHQIAQATRRV
FT                   EGIVRIQIISGLVSPEFDEAIASLHRRNPAIHIEIRVSPWRQVLDALEQGEVEIGVGYD
FT                   SSVRGSLMYEPLLVERQQLYCSRYSPYFGYRLNRLHDLKDEGFVLTGDDEIELITHLRR
FT                   RYRLGTKVNGLAEDINEAKRLIVQGVGIGFLPVLAAEDEVARERLWPILDADAEPSYDI
FT                   FLLSRSERARDTATQLFWDEVIRRLRAKART"
FT   CDS_pept        172721..173716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01470"
FT                   /product="putative oxidoreductase"
FT                   /note="2OG-Fe(II) oxygenase / isopenicillin N synthase or
FT                   related dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98510"
FT                   /db_xref="GOA:D4Z7P1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P1"
FT                   /protein_id="BAI98510.1"
FT                   /translation="MAVLPFVDISMLASDSREDRLGVARALDRACTDAGFLYIGGAQLD
FT                   WALFRRLVARAEAYFALDREVKMANYIGHSQNHSGYVPVGEEQFGAGTSDLKEAYDVNR
FT                   DYPWPEGRRPLLGPNNWPQMPGFREDVSAYYRHLTDIGGQIFRAFALALGLEEDHFDAH
FT                   RRNPPSQLRLIHYPFDSSAQDRPGIGAHTDYECFTLLFATAAGLQILDRKGDWVDVPLM
FT                   DGAMIMNIGDMMEILSNGRYVATTHRVKKVAQQRYAFPFFHACDYDYVVAPLVGDEAPR
FT                   YAPLKGGEHLFNQTAQTFAYLKRRIAKGELVLANAMPLDSFGRRQGPSGA"
FT   CDS_pept        173713..174600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98511"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P2"
FT                   /protein_id="BAI98511.1"
FT                   /translation="MTLADLLGALPPVVPEQPAFPRRLLGAFRRKSITFCTGVTDERTV
FT                   VYWFQSRSFTIDLRLPDGAATSVTDRQGWVGDTLWDAESQQMSWSVATSYQPRNQWPEP
FT                   AILRFIGNSVLEFAPSGAYVEDWRQQCFRGPLLGLRLLSLHDEETGRDLPMDGGLIVAG
FT                   GHVAYAQSRLPRLDAALRNAADLDRALADRLLTAEEIESYEVSVALNGRTIDHSTRTGR
FT                   IGQQIASGEFALQPDGSILLSRPVGGRTCRLRFAVDIHVPDFTFDRRTQAASPAPDWME
FT                   KEKSHLFRHAMIAA"
FT   CDS_pept        complement(174622..175296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01490"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98512"
FT                   /db_xref="GOA:D4Z7P3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P3"
FT                   /protein_id="BAI98512.1"
FT                   /translation="MAENESLTEQFQALHRERVRSWKPENLAENVARRARLVADFDPSR
FT                   TVRPGDVVEPFQLAEADGTTLTLERLTAEGPAVLVFFRYAGCPACNLALPYYERQLWPR
FT                   LRKAGIPLVAISPHLPETGLGAIRERHGLTYGIANDRGNALARRFGITFDRDLVPDGQP
FT                   SPGWIGELTGTGTAELPQPAVIAIDRDRVARFVDVSPDWLARTEAPAILEAVGRIESAA
FT                   VG"
FT   CDS_pept        complement(175316..176653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01500"
FT                   /product="putative monooxygenase"
FT                   /note="monooxygenase, NtaA / SnaA/SoxAfamily / coenzyme
FT                   F420-dependent N5,N10-methylene tetrahydromethanopterin
FT                   reductase or related flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98513"
FT                   /db_xref="GOA:D4Z7P4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P4"
FT                   /protein_id="BAI98513.1"
FT                   /translation="MSQNRHIKLGFILHGVGRTWNDWRHPDRDVNASTSLAFYQKQAAT
FT                   AERGKFDLLFIADSLSITEKSSPHYLNRFEPITILSALAVTTSRIGLVGTLTVSYSEPF
FT                   NVARQFASLDHLSGGRAGWNIVTSWLGDTAANFSKTEHPPHSVRYRIAGEYLDVVQGLW
FT                   DSWEDGAHVADKESGRFVDPERLHRLDHKGEFFQVRGPLNIKRTPQGQPVIFQAGASDD
FT                   GRNFAAKRAEVIFAHAPDLESGQAYYADVKARASGFGRDPGQLFVMPGIAPIVGDTDED
FT                   AEARYRELAALESIETGLGFLSRTFNDHDFHQYDLDAPFPDVEHIGINSQQSGTLGILA
FT                   QVRAGNLTLRQVVERLATPRGAFVGSPETVADRLQQWFEAGAADGFMLFEPLPGQLDLF
FT                   VDRVIPILQARGLFRTEYEGATLREHLGLAQPDNRFARKAAEKNAA"
FT   CDS_pept        complement(176819..178228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01510"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98514"
FT                   /db_xref="GOA:D4Z7P5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P5"
FT                   /protein_id="BAI98514.1"
FT                   /translation="MMIKTLLPLLLGASALTACAAGPDYKAPATPTAAAGAFIGAASPA
FT                   VSVAQADDHWWRLYSDPVLDGLVQDALKANTDIRVAVARLEKARAQLRGARSDRLPQTT
FT                   LSGSPSYGRASAAQSLPGADRENWTIDAGLNVAYEVDLFGRVKRSIEAAKGDVNAASAD
FT                   ADAVRVAVVADTVRAYVDATSSAERLAVARQTVALLDNSIRITNARFEVGRSDRLDVIR
FT                   VTALRDSQAAVIPSLVADRDGALFRLATLTGRTPRDLPGTVRERTVTPGLSQPIPVGDG
FT                   RALLARRPDVRAAEQRLAADTARIGVATADLYPRITLGGSIGTTAIGGGDIFGGGPFRW
FT                   LLGPLINWAFPNQEANRARIAAARADADGSLASFDGTVLRALEETETALSVYAHALERR
FT                   DTLKAAREAADRAARISLARQREGQIDFLTVLDAQRTLAAAESDLATANRAVAFAQVDL
FT                   FRALGGGWTTG"
FT   CDS_pept        complement(178237..181422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01520"
FT                   /product="putative multidrug efflux pump"
FT                   /note="cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98515"
FT                   /db_xref="GOA:D4Z7P6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P6"
FT                   /protein_id="BAI98515.1"
FT                   /translation="MRLSRFFIDRPIFAAVIAVIITVVGALAFVGLPVSQYPDIVPPTV
FT                   TVSAQYPGASAETVASTVAAPIEQEINGVDNMLYQSSQSTGDGKVTITVTFKVGTDLDA
FT                   AQVLVQNRVAVAVPRLPEEVQRLGVVTRKTTPEFLMVVNLQSPDGTFDRNYISNYALTQ
FT                   VRDRLARLDGVGDVQLFGSRDYAMRIWIDPDRAAALDLTAGEIVQALRAQNVQVSAGSI
FT                   GQPPYDRGEAFQLGVEMQGRLTEPQQFADIVVRTDADGRQVRVGDVARVELGAQDYGIN
FT                   TYLSNKPTVVIATMQRPGSNALDAAEKVKAEMEQLSRRFPKGLEYSVIYNPTEFISQSI
FT                   DAVYQTLFEAVILVVIVILVFLQNWRAAVIPIIAIPVSLIGTAAILAGLGYSLNNLSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIEHGMTPLEAARTSMDEVSTALVAIVLVLCAVFVPT
FT                   LFITGISGAFYQQFAVTISTATIISLILSLTLSPAAAALLLKSRHDGHALRNAPRWRRI
FT                   AAQAADRFNRGFDRLSAGYARLTRFLVARPKKMLLTYSGLIAATIALFWVTPGGFIPAQ
FT                   DQGYFLAVVQLPSGASLERTDKVTREVAAKILPIKGLRGAVMFAGFHGPSQTQAPNSAA
FT                   IYFPFKTFAERRQEGVTYAGIMEQANQAVAGYDKARILIVPPPLIQGIGSAGGYRLMVQ
FT                   DREDHGYAELNRVAQDFIAKANQTPGLNMVYTLFDVGTPRVYADVDRRKADLLGVPPER
FT                   VFEAMQVYLGSAFVNDFNLLGRTYRVTAQADADHRGTVADIANLKTRSNSGQMVPIGSV
FT                   STFKDKTGPYRVVRYNLLPAVEIDGDTAPGYSSGQSLTTMEKLADSTLPDGYGREWTGV
FT                   AYQQVIAGNTAGIVFAMAVFFVFLVLAAQYESLTLPLSIILIVPMCLFAAMLGVNLRGM
FT                   DNNILTQIGLVVLIALAAKNAILVVEFAKQAEEEQGLSPVEAAVQAAQTRLRPILMTSF
FT                   AFILGAVPLVIASGAGAELRQALGTAVFFGMTGVTAFGLLFTPTFYVVCRALGDRFSRK
FT                   GKGQAPAALQPAE"
FT   CDS_pept        complement(181576..182826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01530"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98516"
FT                   /db_xref="GOA:D4Z7P7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P7"
FT                   /protein_id="BAI98516.1"
FT                   /translation="MNMHAPIDVDTRSATPLSRWRKRHVSLAAMALVILGGVGWKIVDR
FT                   PEAQAAATPLVTVGIAAPLSRAVTQWDDYVGRFAPSQTVEIRPRVSGSVTAIHFRDGDY
FT                   VKAGQLLFTIDQRPFLAALAEARASTASARSALLLAQNDYGRVQRLTGDEAVSASEVDS
FT                   LRSRLQAAQAALAGAQARERQRALEVEFTQVRAPISGRVSDRRVDIGNLVSAGEGAGAT
FT                   LLTTVNKIDPIYFNFDASEALYLKSQRDRGAGGTVEVRLQDEADYRHKGRLDFTDNGLD
FT                   PRSGTIRVRAVFDNPDMFLTPGLFGNMRLANGGKVNALLVPDEAIQSDQARKTVLVVAQ
FT                   DDSVVAKPVELGPVVDGLRIIRAGLAPGDRVIVSNIQAAMPGAKVATRAVAVKAAPAPV
FT                   AAVGAAVPAAAQATFAR"
FT   CDS_pept        complement(182830..183213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98517"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P8"
FT                   /protein_id="BAI98517.1"
FT                   /translation="MAFLQLAALADDGGTIGVKKAAANPGFAPVEWQIIQLARRDGLDS
FT                   LRAPDLWDRVKGWIFGQRANPRLANMRLESLRRLAVDAWHRGYAVRPSYLKAFLKAGFN
FT                   EGQLETLLASISAQRRFRASRSR"
FT   CDS_pept        complement(183559..184167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01550"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98518"
FT                   /db_xref="GOA:D4Z7P9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7P9"
FT                   /protein_id="BAI98518.1"
FT                   /translation="METQTQAARGRPREFDPEEALGAALNVFWRRGYEGASMAELTEAM
FT                   GITKPSLYACFGNKESLFRKALDLYERDKLCYMKSALEAPTAKGVAERLLRGSLAIQTG
FT                   TTDPHGCLGVISTVGCTIQADSIREDVMARRTSSDAALLARLERARDEGDFPDTIEPQA
FT                   LATYLTTVMQGMAVHAGAGMSRELLEQLVDTTLAVWPGK"
FT   CDS_pept        184264..185151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01560"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98519"
FT                   /db_xref="GOA:D4Z7Q0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q0"
FT                   /protein_id="BAI98519.1"
FT                   /translation="MQTRLLQYFLALEREGHFARAATACNVSQPTLSAGISALEAQLGK
FT                   RLILRNRRYAGLTEEGRAILPWAQQLVAAADNLMQAAAVAKGPLQGELRLGAIPAAMPA
FT                   VGPLVEALLERHPGLNISVRALTSRQIERELTAFELDAGLTYLDFEPPSHMLAAPLYVE
FT                   RYMLAAAKGVLDEGRTPSWEDVAALPLCLLHQGMQNRRILDARLGERGLALRPVVTADS
FT                   YVALFALVRQGRLCSIVPDSHAMLLDGLDWVRTFALPEADEGSRIGVIVSDRAPLGPLA
FT                   QAVLNIAREIPNIT"
FT   CDS_pept        complement(185305..185748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01570"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98520"
FT                   /db_xref="GOA:D4Z7Q1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q1"
FT                   /protein_id="BAI98520.1"
FT                   /translation="MTDKMLRLDAFIPYRLSFTAALLSDAIAQSYEDLFGIGIAEWRVI
FT                   AWVAERGSITQQQICAMSRMDKVTVSRAAIALTGRGVLRRLPNAEDRRSHLLALTEEGE
FT                   RLHAAIAPKALEMESGVFSHFSAEEVEAFVGMLRRIDAVVLGG"
FT   CDS_pept        185859..187148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="SJA_C2-01580"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98521"
FT                   /db_xref="GOA:D4Z7Q2"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q2"
FT                   /protein_id="BAI98521.1"
FT                   /translation="MTGFGNHFATEAVPGALPVGRNSPQHAPYGLYAEQLSGTAFTAPR
FT                   AENRRSWLYRLRPAANHPPYRPYEADTLLCSGPFDEVPPTPNRLRWDPLPIPERPVDFI
FT                   DGLVSYCGAGDPAAGEGLAVHLYAANRPMEQRAFANADGEMLIVPQQGRLRLTTEMGVM
FT                   DIAPHQIALIPRGVRFKVDLPDGTARGYVCENYGASFRLPDLGPIGSNGLANPRDFETP
FT                   AARYEDDDTPHEIVQKYGGQLWATTQDHSPFDVAAWHGNLAPCCYDLRRFNTMNTVSYD
FT                   HPDPSIFTVLTAPSDRPGTANCDFVIFPPRWMVAEDTFRPPWFHRNVMSEFMGLIHGSY
FT                   DAKAGGFAPGGASLHNCMAGHGPDRASYEGALAAELKPHRIADSMAFMFESRYPFRPTR
FT                   FAMETPLGQLDYDDCWSGFAKARLPREERA"
FT   CDS_pept        187145..188446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgB"
FT                   /locus_tag="SJA_C2-01590"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="2-keto-4-pentenoate hydratase /
FT                   2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98522"
FT                   /db_xref="GOA:D4Z7Q3"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q3"
FT                   /protein_id="BAI98522.1"
FT                   /translation="MSFPRIDETHDPARSSWVEGADGHPAFPIQNLPYGIFSPPGGAAR
FT                   AGVAIGERIFDLRAAAQTGLLPAAASAVFGEPTLNALMALPAADRLALRRWLSALFSDE
FT                   AQRPATEPLLHRAADCALHLPATIGDYSDFYVGIHHATNIGRLFRPDNPLLPNYKYVPI
FT                   GYHGRASSIRPSGVPVVRPRGQRKPPEADAPVVGPSQRLDYELELGIWIGAGNALGETV
FT                   PIADAADHIAGFCLLNDWSARDFQAWEYVPLGPFLAKNFQSTISPWVVTAEAMAPFRIA
FT                   QPPRPQGDPQPLPYLWDEADQAQGALAIDLEVHLSSAKMRAEAMPPMRLSRGPAFSMYW
FT                   TAQQIVAHHASNGCNLNPGDLLGTGTLSGPTPDSFGSLMELTGGGQAKIVLPTGEERAF
FT                   LEDGDELALSAVARADGYVSIGFGECRAMIAPAR"
FT   CDS_pept        188416..189084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgC"
FT                   /locus_tag="SJA_C2-01600"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="glutathione S-transferase (EC 2.5.1.18)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98523"
FT                   /db_xref="GOA:D4Z7Q4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q4"
FT                   /protein_id="BAI98523.1"
FT                   /translation="MPRHDRPGPMSALTLHGYWRSTSAYRVRIALNLKGVAYDQVTHDL
FT                   RTGAQREPDYRAIAPQGLVPAVEADDFTLTQSPAIMEWIEERWPQPPLLPPDAEGRALV
FT                   RSMAALIGCDIHPLNNLRVLQALKADFGADQPALDRWIARWITDGFAALETLVARHGRG
FT                   FAFGERPGLADCYLVPQLYSAERFHVDLSPFPALVAAGERARALDAFAAAHPSAQPDAD
FT                   "
FT   CDS_pept        189168..189635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01610"
FT                   /product="NAD-dependent formate dehydrogenase gamma
FT                   subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98524"
FT                   /db_xref="GOA:D4Z7Q5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q5"
FT                   /protein_id="BAI98524.1"
FT                   /translation="MQQEETARLIEDWTQTHGRTRDRLLPLLHMLQEEIGFIDGNAIKI
FT                   IAEKLNLTRADVHGVVTFYHDFRRAPAGRHVVKLCRAESCQARGAAAMEKAAAERLGVP
FT                   MGETRPDGQVTLEPIYCLGLCAVGPNALVDGRPVARIDAAALDRIAQEVAA"
FT   CDS_pept        189632..191212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01620"
FT                   /product="NAD-dependent formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98525"
FT                   /db_xref="GOA:D4Z7Q6"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q6"
FT                   /protein_id="BAI98525.1"
FT                   /translation="MTRIYISRDMASVALGADDVARAFEAAGCEVVRTGSRGLFSIEPL
FT                   VEVESEGKRIGFGPVGPEDVAAVLDGSHKARLGDVAELPFFAGQQRFTFARCGIIDPLS
FT                   LQDYADHGGWRGLDAARAMAPQAVVDAVKASGLRGRGGAGFPTGIKWQTVLDAVSDAKF
FT                   IVCNADEGDSGTFADRMLMEGDPFCLIEGMAIAGHAVGAGHGYIYIRSEYPFAIAAMRE
FT                   AIALSAERIAPFTLEVRVGAGAYVCGEETALLDSIEGKRGQVRAKPPLPALSGLFGQPT
FT                   VINNVLSLAAVPFILAEGAEAYAAVGFGRSRGTMPVQLAGNVKHGGLYEIGFGITLGEL
FT                   VNGIGGGTASGRPVRAVQVGGPLGAYFPPSMFDLPFDYEAFAQAGGLIGHAGITLFDDM
FT                   VDMAHMARFAMEFCAVESCGKCTPCRIGSTRGVEVMDRIIAARDSAPAVPAGRQWEGYL
FT                   QKALNSRTPDRIDTGLEAQTALLRDLCDTMKHGSLCALGGFTPYPVLSALDHFPQDFGA
FT                   PAPIKEAAE"
FT   CDS_pept        191209..194055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01630"
FT                   /product="NAD-dependent formate dehydrogenase alpha
FT                   subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98526"
FT                   /db_xref="GOA:D4Z7Q7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q7"
FT                   /protein_id="BAI98526.1"
FT                   /translation="MSYARETDHGTPPAIATGKRVTLTIDGETVTMPEGTSIMRAASLT
FT                   GCSIPKLCATDNVESFGSCRLCLVEVEGRNGYPASCTTPVAEGMVVRTQTERLKQLRRG
FT                   VMELYISDHPLDCLTCPANGDCELQDQAGAVGLRDVRYGYDGATNMGQAKDQSNPYFDF
FT                   DPSKCILCSRCVRACDEVQGTFALTIEGRGFDSKVSPSQGQDFLSSECVSCGACVQACP
FT                   TATLTEKKVVEVGTPDRSVVTTCAYCGVGCTFRAEMRGEELVRMVPWKDGKANRGHSCV
FT                   KGRFAWGYAQHRDRILNPMIRASVNEPWREVSWEEAIAHTAGEFRRIQAKYGTRSIGGI
FT                   TSSRCTNEETFLVQKLIRQGFGNNNVDTCARVCHSPTGYGLKTTFGTSAGTQDFDSVMQ
FT                   ADVMLVIGANPTDGHPVFASRMKKRLRQGAKLIVIDPRRIDLVKSPHVEAAHHLPLRPG
FT                   TNVAMLTALAHVIVTEKLYDEAFIRDRCDWDEFAEWADFVSEPQRSPEAVEPLTGVEAE
FT                   EVRAAARLYATGGNAAIYYGLGVTEHSQGSSTVMAIANLAMATGNVGREGVGVNPLRGQ
FT                   NNVQGACDMGSFPHEFSGYRHVSDDAVRGQFEQAWGVALDAEPGLRIPNMLDAATDGTF
FT                   KGIFIQGEDILQSDPNTHHVAACLAVMECVVVQDLFLNETANYAHVFLPGSTFLEKDGT
FT                   FTNAERRIQRVRKVMAPLNGYADWEIVQLVANAMGLNWTYDHPSEIMDEIAALTPTFAG
FT                   VHYDRLEAEGSLQWPANDAAPDGTPTMHVGGFVRGKGKFVVTDYVPTDEKTGPRFPLLL
FT                   TTGRILSQYNVGAQTRRTANEAWHPEDRLEIHPADAENRGINDGDWVSLKSRAGETSLR
FT                   ALITERVAPGVVYTTFHHPDTQANVITTDYSDWATNCPEYKVTAVQVMRSNGPSDWQRD
FT                   YVEQARRSRRIAPAEAAE"
FT   CDS_pept        194066..194302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01640"
FT                   /product="NAD-dependent formate dehydrogenase delta
FT                   subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98527"
FT                   /db_xref="GOA:D4Z7Q8"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q8"
FT                   /protein_id="BAI98527.1"
FT                   /translation="MSDENEVMSTEDRLIYMANQIARNVEALGEAEAVAMTADHIRAFW
FT                   DPAMRRRIGMLAAARPGALSPIAAAAVGRIVAP"
FT   CDS_pept        194299..195117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="SJA_C2-01650"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98528"
FT                   /db_xref="GOA:D4Z7Q9"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Q9"
FT                   /protein_id="BAI98528.1"
FT                   /translation="MSAGPEDRSFTFRQVTPEGRVAPVTRELAEEVPIAIEFNGIGYAV
FT                   LMATPADVEELVLGFALAERLIGREDAPFEVDVHATAQGIVARATLPQERTEALLSRVR
FT                   HRASESSCGICGVENLEQAIRPLPPVTPSTLTGSQAVFRALEELKGRQPLNARTGAAHA
FT                   AALAAADGAIRLAREDVGRHNAFDKLIGAMWRRGWAWDGGFALLSSRCSYELVEKAVLA
FT                   DCPLLATISAPTRLAAERAAGAGLALAVLARPDSILLYGEGTSGLDQREA"
FT   CDS_pept        complement(195188..196582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="SJA_C2-01660"
FT                   /product="NAD(P) transhydrogenase subunit beta"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98529"
FT                   /db_xref="GOA:D4Z7R0"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R0"
FT                   /protein_id="BAI98529.1"
FT                   /translation="MNALVPFAAIVASSLFILALMWMSHPSTARRGVRAGEVGMLVAIV
FT                   GALVQHEVVDYNLILIAMVAGAAAGIPMALLMPMTAIPQRTAISHAFGALAVGLIGAAE
FT                   YYKHAHAEYAGSFILWALMFEMLLGFLTCTASVIAFAKLQELMGSRPVSFVGQRVLNGG
FT                   VALATVVIGAMLAIDPTQTWLFPAFVALALLFGILLVIPIGGADMPTVIALLNSYAGLA
FT                   ASAMGFALGNKLLIVAGALDGASGFILAVIMCKAMNRSFANVMFGGFGAVVAGAAGGKD
FT                   DRVVRSASAEEAALQLENASSVVIIPGYGMAVAQAQHKVSELYQALTKKGVDVKFAIHP
FT                   VAGRMPGHMNVLLAEANVPYEQLVELDDINPELPQADVALIIGANDTINPSARDDPQSA
FT                   IAGMPIIEADRAKSVFVIKRSMNAGFAGIDNPIYYNSNTQMLFGDAKDMVGTIAKELAG
FT                   GGSGLH"
FT   CDS_pept        complement(196584..196874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntA"
FT                   /locus_tag="SJA_C2-01670"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98530"
FT                   /db_xref="GOA:D4Z7R1"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R1"
FT                   /protein_id="BAI98530.1"
FT                   /translation="MSSLNPDYLFVFILAAFVGFQLIKKVSPLLHSPLMSLTNAIAAVV
FT                   IVGAITITGEEGATPLAKTLGFIAVFCATVNLVSGFMITDRMLKMFKPRGK"
FT   CDS_pept        complement(196871..198010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01680"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.6.1.2"
FT                   /note="PNT-like protein / NAD(P) transhydrogenase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98531"
FT                   /db_xref="GOA:D4Z7R2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R2"
FT                   /protein_id="BAI98531.1"
FT                   /translation="MKIGIVKETAPDERRVSGTPETVKKFRALGADVAVESGAGLSAAI
FT                   SDADYAAMGATVADRAATVADADIILGVQGPDPASIAGARPGAWIVAGLNPYVERARID
FT                   AYAAAGFEALAMEFMPRITRAQSMDILSSQSNLAGYKAVLDAAAEYGRSFPMMMTAAGT
FT                   VSPAKAFIMGVGVAGLQAIATAKRLGAQVSATDVRSATREQIESLGAKAIFVESVAGIE
FT                   GEGKGGYATEMSDDYRQAQAELVSSHIAKQDIVITTALIPGKAAPRLISDAQIATMKPG
FT                   SVIVDLAVEQGGNVEGAVPGQVVERHGVKIVGHKNVPSRLAADASALFARNLYNFLSAF
FT                   WNKDRNAPVLDEEIGNAIRVTQGGKVVSERLLQLAGILS"
FT   CDS_pept        198234..198929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01690"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98532"
FT                   /db_xref="GOA:D4Z7R3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R3"
FT                   /protein_id="BAI98532.1"
FT                   /translation="MSIRKQNSREGLVTAAVAKLRDMIVAQPPEAQIGSLPDLAKALGV
FT                   GIVTVQQAARVLEHEGFLKVRRGPGGGYYGTRPDAEGLSQAISGFLALHHSAHPEAIDI
FT                   ITLLDCELMAAAARATDEALRQRLAALVKSIDGRNTARQRGAFDQSMLDILYLMVDRPL
FT                   MELLSRVAVHHYAEYPRGPVYGGSEGKQRWKRERRAIIAAILDGDPERARFEAQRRRRE
FT                   IMRQLDAAI"
FT   CDS_pept        199018..199602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01700"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98533"
FT                   /db_xref="GOA:D4Z7R4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R4"
FT                   /protein_id="BAI98533.1"
FT                   /translation="MTKPVLPSGPNDEPSARRRQILEIAAQLFAKKGYRGTSMRDIGEQ
FT                   AGVLGGSLYHHIRSKDALFVELHNAALDEAEARIDEAVRAQSDPWAKLNAACATLLDIQ
FT                   LAPDSLTTPMMNDFREVSDDVREQLIARRDRFEGLFRSLVDELPLPPRIDRSIYRNLLL
FT                   AQLNATADWYRPGKLTPAQIAAQIAAIFRHE"
FT   CDS_pept        complement(199669..200379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01710"
FT                   /product="Xre-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98534"
FT                   /db_xref="GOA:D4Z7R5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R5"
FT                   /protein_id="BAI98534.1"
FT                   /translation="MPISAIVDQPPETDNRRGAARWRIRLELPGTSGDADANLVIHDIS
FT                   TAGMLIETRSTLEIGQGVMLSLPDADEVVARVVWQNDTLFGCRFETALPQGVVSAIRLR
FT                   HPGRDAMQTAGDRPEGAADEGLGERLLRLRHEKGMSRTALSERTGFSKPTIWGWETGRT
FT                   TPRRENLRILSAVFGLTEQQLLYGKGRSTLRETDGSGPESYTRSLKEVIDQSKTRIAEA
FT                   AGVSKLKVNISIEF"
FT   CDS_pept        200522..202255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01720"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98535"
FT                   /db_xref="GOA:D4Z7R6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R6"
FT                   /protein_id="BAI98535.1"
FT                   /translation="MFSYVPPIDDYRFLLTEVLGFDRAMAEMGKEVDADLAAAVLEEAG
FT                   RMCADRLHPLNRHGDEEGSRLVDGLVKTPEGFADAWRDFAAAGWASLSADPAYGGQGLP
FT                   FILQLWLDEMLAATNLSFGLFPGLTRGACEAIMAHASDFLKATYLPPMVSGEWTGAMAL
FT                   TESGAGTDLALLKTKAAPDADGSYAITGQKIFISSGDHDFGGNIVHLVLARLPDAPAGV
FT                   KGISLFLVPKYLPDADGGFTIRNSMSVGALEKKMGIHAQPTCVMNYDGATGWLVGEPHK
FT                   GLAAMFTMMNAERLMVGIQGLGIAGASYQQAAGYAKERLQGRSADGARGPVTIIEHADV
FT                   RRMLLNIRAFVEAGRALAGWTALQLDRAHHHPDAAERARADALVALLTPVVKAAFTDFG
FT                   FESAVQAQQVFGGHGYIREWGMEQYVRDARIAQIYEGTNGVQAMDLVGRKLPMAGGAVV
FT                   EGFFALVEMDLAAAEGLNIAAKTREALALLRGVTASLRGAGTEAAGAAAVDYLRLFALV
FT                   SMGWMWTRMAAAAQGDAPLHGAKRAVADYFAQRMLPQAQGLAVGIAAGEATIMALGAEA
FT                   F"
FT   CDS_pept        202266..204353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01730"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="4.2.1.17"
FT                   /note="3,2-trans-enoyl-CoA isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98536"
FT                   /db_xref="GOA:D4Z7R7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R7"
FT                   /protein_id="BAI98536.1"
FT                   /translation="MAVEKRREGETIVLRLSNGPVNALSAGNGFVDQIAAAVDEAAGDP
FT                   ACRVIVIAGAGRMFCGGADIGDFDGAPTQVSRVRDVIAAVEACEKPVIMAIHGMALGGG
FT                   LELAMAGHYRIAQAGSRLGLPEVTLGLLPGAGGTQRLPRLIGAGAALDMMLSGKPVTAE
FT                   QAASSGLVDRLVDDDVVEAALEVARGAPPLRRTGALPVPVDLAEAVDARRAKLRAGLSQ
FT                   APARIVDCVAALSDDLAAGLALEARLFGELMRSEASRGLRHAFFGERTVARIPGLAADV
FT                   RPRDVRRVGVVGGGLMGTGIALALLNAGVPVTMVELRAEALSKAEAAIRKTIQRDVEKG
FT                   RIGQDAADARMAAFTSATELEALAEADLVIEAVFEDMGVKKQVFSALDAITRPDAILAS
FT                   NTSTLDLDAIAALVADPSRVVGLHFFSPANIMRLLEVVRGRDTAPDVLATAMALGKRIG
FT                   KVGVVSGVCDGFIGNRMFEEYLRQVYFLLEEGALPQQIDAAMERWGMAMGPCRTMDLAG
FT                   HDIGWAIRKRRAVEQPDRPYSGVIDRICELGRFGQKSGKGIYVYPDGRTAQTDPEITRL
FT                   IEDYSAEIGLQRRAIGDEEIVGRCLLALVNEGAHILEEGIAYRPVDIDMIYLHGYGFGR
FT                   ERGGPMFQADLMGLPAVLDRLRALAAGRNGWAWTPAPLIERLAATGGRFGDLDFQDGNA
FT                   Q"
FT   CDS_pept        complement(204332..204670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98537"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R8"
FT                   /protein_id="BAI98537.1"
FT                   /translation="MQRCAAGRRLPRRSHDFTQTGCKAADTPIGSDFGGRDDDDARARQ
FT                   SRLRILYASGYAKDVIVRDGGLDSGANGWPSPSPAWRSGCARACGDSAHGGPRRRYRKD
FT                   IRHWAFPS"
FT   CDS_pept        204707..204973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01750"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98538"
FT                   /db_xref="InterPro:IPR018684"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7R9"
FT                   /protein_id="BAI98538.1"
FT                   /translation="MADLSAIKEHMDIIGADGVHVGTVDKVEGDRIKMVKADSGSHGDH
FT                   HHFIAGGLVAAVEGNQVRLSAEGAAAVLLEEEEGGQAIMDDDD"
FT   CDS_pept        205001..205186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98539"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S0"
FT                   /protein_id="BAI98539.1"
FT                   /translation="MAGNSPGDHRAEVANMTDEELIDSWETASDKETENLSPFLRAVVE
FT                   EMDRRRIAFSRDQGGA"
FT   CDS_pept        205186..205392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98540"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S1"
FT                   /protein_id="BAI98540.1"
FT                   /translation="MAGTLGKGDAVTWKSRGGEARGKVVKKVTGTTRIKGHKVAATPDD
FT                   PQFIVETDAGKRAAHKPEALRKR"
FT   CDS_pept        complement(205411..207291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="SJA_C2-01780"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98541"
FT                   /db_xref="GOA:D4Z7S2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S2"
FT                   /protein_id="BAI98541.1"
FT                   /translation="MAAPDKPRRPEALDRRELLAAGLSGLALAGIASTAGAQSGARAPD
FT                   APRSGGTSVAAHRVEVPMPHGGVTAGHPLAAMAGTRMLMQGGSAADAVVAAMAVMNVVE
FT                   PWASSAGGNGFATCLDRKAGKVHSLAFTGGAPRLLDPQVDPKALDHGPRALTVPGAFGG
FT                   WIALARRFGRLPLATLLEPAIGYARDGHPLDPSIALFIGRAQKTISLYPTSAALFLPDG
FT                   QPPAPRSIFRNPDLARTFQALADAETAALKGGADRDRALQAAYDYFYTGPIAREFARFS
FT                   TETGGWLRLDDLKAYRPRWSDPVSTHYRGLDVYSSPLTSRTGLELCEQLNLVEGFDLAA
FT                   LPADGPQLAHLLIEAIKVAKADVYRYASDPRFAQTPVEGLLSKRFAAERRKLIDPARAG
FT                   LYPEGGNAAAFDQAAALERARPRFAARGDDRTRGGDTTSLSAVDADGNAIAVTTTIGGG
FT                   FGTFLVMGNTGILFNNGLRLGSTAPYDGHPNKVAPGKVALLGNGPTILLDKGRLHLVFG
FT                   SPGGETIGQTQFQFLVNIVDRGMPIQAAIEAPRFALDADPNFYRPGAAVTVQAEGRFPD
FT                   PVLQGLAAMGHRIEKVGPYAIGSVQGISVAPSGARMGGADPRRMGYAVGY"
FT   CDS_pept        complement(207366..210485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01790"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98542"
FT                   /db_xref="GOA:D4Z7S3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S3"
FT                   /protein_id="BAI98542.1"
FT                   /translation="MRVRRNSISILAGASIWAMTTGALYAQTDAAPQDEADKGAEIVVI
FT                   GSQIRGANTTGALPVNVVGEQQIEAVAAVSGADLFRSIPQLGGVTFNEQVLGGGNANAA
FT                   RGDVSTVSLRGLGQGNTLLLINGRRTVLHPTSQAISGVIDSGVPTFGYNANTIPVGNIA
FT                   RVEVLRDGAAALYGSDAVAGVVNNVLNSDFDGAKFDAQYGGAEGTNLREFTVNGLIGKD
FT                   FSEGRGNITLFAGYAQKSKLYLSDQDYTANVDRRGYVAGTPFANVSAFNGTSTSTPWGT
FT                   FRALSPAANGTFLNRTITSNGTAFTNSSSQFHIQPSTNSGCRIPSGTTGTCYDDGNGAT
FT                   EMATVDSNLRFNSPATFSDLTTQPSVKRINLFANGHFDLTDSLTLYGEAGFYRGKTQAI
FT                   IGAPGSLANIPITVAANAYWNPLGPVGSPNRLPGLSTAVVPASGLPVQITSLNYVDVGS
FT                   RKVDVTNYQYRFLGGLKGQIGDWDWDTAGLYTWATAADTQENFSNTLLQAAINRTTPDA
FT                   YNPFNGGCVDRPSIGDCTPNSDATIDSFRIKATRKTRTSLALWDFKVSNANLLGLWADN
FT                   SIGIAAGVEYRRETYHDNRSPYQGGIRGVDTTYTDAVTGIFYGSDLGGASPSPDVRGKR
FT                   NVKSAYAELAIPIFSPEMEVPFFRSLDFQIAGRYEDYSDVGSVAKPKIAGSWELLEGMR
FT                   LRGSWSQGFRAPNLEVINTSTLDRVNTGIDYVLCEADLRAGRIANFSQCNRSISVLRRS
FT                   GGNPNLKPEESESWSFGAVFSPPLGDGWGKVTFTVDRWRIKQKNVVGLLDYQNGLNLDY
FT                   LRRVQGSTNPNVVRRDPTADDAALVAGTGLAPVGELLYVVANFENLLPVTVQGIDFNLD
FT                   YLLPTAAIGTFSLNVNASRLISYYVDAPAGVTAVIDGRSAGLVNAGVPIQGGGDVVGRD
FT                   GQPRWRIAATLDWTLGPVKIGAFTQFIDSVYENAVRDASTNPWIVKGQTTVNLYAQYTF
FT                   KNGGPLNDTSIQIGARNIFDKDPPLASTGYLSNLYQPQARYWYTSIKKSF"
FT   CDS_pept        210944..212818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="SJA_C2-01800"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98543"
FT                   /db_xref="GOA:D4Z7S4"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S4"
FT                   /protein_id="BAI98543.1"
FT                   /translation="MTETARQGLSRRDFAALAVGGVVLAQSPASAQDAAPAAKAPLEPT
FT                   RLVSAGETLRPEIVGNFGIVAAGRHYAVAAGTRMLMAGGNATDAGVAAVFAAAVTEISH
FT                   FGFGGEAPTIIYDAKTKKVSAVNGQGVAPALATPDKFASAGVIPGNGPNGGTVPAMVDA
FT                   MALALQLNGTMTLDQVLQPAIELADGFVMYNFLAEVFASQKKATSKWKDAYDTYYPGGT
FT                   LPKVGEIFRQPNLAKTIRIIAEADRAAYKKTKDRKAAIQAGRDAFYRGDIARRIGAAME
FT                   RDGGLMRYEDLAGYKGRVETPAMTSVFGYEVYKAGFWSQGPAMLMALNIAEAAGIAQME
FT                   PGSAPYLHTVAESIKLAFDDRNAYFGDPDFATVPMKGLLSKDYAAQRAKQIGPKASLEH
FT                   RYGDPWAFEGRARTTPAFTPHMLKAPPRPTADTTAIEVVDKDGNLFSATPSSGWLLGGA
FT                   YIAGDTGVPMSNRLTVFDLDPESPNVLAPGKRPRTTLSPSMVLKDGAPYLAIGTPGGDN
FT                   QDQQIMNVLLRVLAFDQPLQAAIEAPRINSNHFHASFAIKKDEPGVLEIEDRVPQAVRD
FT                   DLAARGHKLDVLGPFAVSTGIVAAGVVPGSFTLRGGADVRRERYVFGW"
FT   CDS_pept        212831..215809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01810"
FT                   /product="putative amidohydrolase"
FT                   /note="imidazolonepropionase or related amidohydrolase /
FT                   tricorn protease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98544"
FT                   /db_xref="GOA:D4Z7S5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S5"
FT                   /protein_id="BAI98544.1"
FT                   /translation="MISHMKLLSVALLSACAAQALAQPANLAQPANLPPPGGEKPIAFD
FT                   VHEGTSMAVSVSPDGKWLAVDLQGSLWIIPAKGGKAKRITDYFNDARQPVWSPDGSRLA
FT                   YFAYRDGGYDLWTIKPDGSDMRKLTQGAWDDREPAWSPDGRTIAFSSDRSGNYDIWTLD
FT                   VASGAVKQVSSNPREDRMPSWSPDGASIAYAGIDGGKTALYATTVADGKESLLKQVAGR
FT                   VDAPSYGPTGQLAYVVQDAKGSHLEVDGKSVSAAENVFPFRISWGKGGYYYVSDGKIRY
FT                   RSGARLSTIDFAATLEAVKPSYARAKRDWDSTAPRKALGIVHPTISPDGSRIAFVALGD
FT                   LYLMSSKGGAPENLTRDAALDADPAWSPDGQSIAYTSDKGGGLPQLWMRDLKTGKDRKL
FT                   TSIDTQPLGAAWSPDGSRIAFLDVDGRWGVAGVCVVDVATGKITRLQASLGQPGSPTWS
FT                   PDGKYVAIALSYKYSNSFREGTNQIYVIPADGKGEPFWQIPQANAGTDTRGGGGPAWSP
FT                   DGTKMAAIYEGLLKIWPVEADGKPMGPPRSYTSEIAYFPTWTADSRTILYQSSDRLKTI
FT                   DTETGVIREIPVDLSYRLAIPTGRTVIHVSNLIDSVRDETQHDKDIVIEGNRIAAIRDH
FT                   DPALHKADRFIDGTGLTAIPGLIEHHAHLQKDFGANLERAWLAYGITTVRDPGNQVYDA
FT                   VEDREAAEAGVRPSPRLYINGPLLEWQRVYYKMGVAVSGPAHLERELERARLLKYDILK
FT                   SYVRMPDIYQRRIVEAAHQMGVPVTGHEIFPAAYTGVDATEHLGATSRRGYSPKQGPMG
FT                   MAYEDVIQLFGRSGRTLTPTNFGALTGYLEKNPSYRDDPRLNLYPIWARKTVTESDPLA
FT                   ALLRPLIAGSLTSLKKLYDAGTLVAAGTDTMIATNLHAEISSYVDAGLTPFQALQTATV
FT                   NSAKSLNLDAGTLEAGKLADITLLEGDPRENIANTFNVRKVIANGQYYDVAELVAAGQE
FT                   SGK"
FT   CDS_pept        216010..216513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="SJA_C2-01820"
FT                   /product="endonuclease L-PSP (mRNA) endoribonuclease"
FT                   /note="putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98545"
FT                   /db_xref="GOA:D4Z7S6"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S6"
FT                   /protein_id="BAI98545.1"
FT                   /translation="MANSSSFRLSLAGIMAAAILSSTAHAAPVEHKQAPGAMIASAAVV
FT                   PPGSSLYFLSGATGSPIDPKDMESPDAFGDTEAQALSIFTKMKAQLADLGLTMGDVVKL
FT                   TVFLVGDPKLGGKMDRDGMTRAYKKFFGTPEQPNLPTRSAFQIAGLARPQQLIEIEAIA
FT                   AKGN"
FT   CDS_pept        216544..218130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01830"
FT                   /product="putative amine oxidase"
FT                   /note="amine oxidase, flavin-containing / monoamine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98546"
FT                   /db_xref="GOA:D4Z7S7"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S7"
FT                   /protein_id="BAI98546.1"
FT                   /translation="MDNSTQPSRRQLLGLIGRVGGAAAMYQAMTALGHAAETRFDGPPV
FT                   LSGAKPGASVVVLGAGLAGMVAAYELEKAGYQVKILEFQDRPGGRNYTLRGGDSFTESD
FT                   GTVQKVQFAPGNYINPGPWRIPHHHNCLLHYCRKFGVAMEPFIQLNHNGFIHSSEAFGG
FT                   KPQRYKAVATDFRGHTSELLAKAANAKALDASISAEDKEKLLEALRHWGVLDANMAYTS
FT                   SVAVSAQRGYDRPPGGGVGGAPTPSQIAKLGDVLDPQVWTAMSFYFNYVMQTTMFQPVG
FT                   GMDMIGKAFAQQVGKLITYNAKVMKVAQNGKGVTVSYRDVPSGQVNKVSADWCVCTIPL
FT                   SIISQVEMQVGPKLAAAMKAVPYAGQLKMGLEFKRRFWEEDDNIYGGHSFTDQSIAQLS
FT                   YPNDRFFSSGPAVLLGAFARDAGAFELTGMTPQERIEAALAQGEIFHPQYRKEFLNGVS
FT                   VPWSRVPWILGCTSRWSEENRAAHYDNLVALDGRVVLAGEHASYYGGWMEGSLLSGLDA
FT                   ITRIHQRTQAA"
FT   CDS_pept        218127..218534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01840"
FT                   /product="putative cytochrome c"
FT                   /note="cytochrome c, mono- or diheme variant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98547"
FT                   /db_xref="GOA:D4Z7S8"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S8"
FT                   /protein_id="BAI98547.1"
FT                   /translation="MTPRRALILIPSLLALLAAPAHGDTPGGVQAKNKTVDGEKVYKQI
FT                   CAACHMPNAMGSGGGAIPALAKNRKMADPAYPIGILMKGKGAMPPMNDMLSPAQVAAVI
FT                   AYVRTNFGNAYPQPVTEADVKRIAKPGRSME"
FT   CDS_pept        218688..220139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01850"
FT                   /product="putative prenyltransferase"
FT                   /note="4-hydroxybenzoate polyprenyltransferase or related
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98548"
FT                   /db_xref="GOA:D4Z7S9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7S9"
FT                   /protein_id="BAI98548.1"
FT                   /translation="MQVAVQSKPQVNTQSCPLVVDLDGTLIKGDLLVECLISAFNDRPR
FT                   TILSSFLRTGWNKAAVKAELADSSDFDPHYLPYDDQVLSLVRAARAEGRRTYLASAADA
FT                   RLVSQIADHLCLFDGWFASDGTTNLSGRAKRDRLVAEFGEGGFDYIGNAMADVPVWEHA
FT                   AQGYAVRAPTAAFRHMQRRGRPLKALAEEGGGPRLWLRQLRVHQYVKNALVFVPPLIGN
FT                   EVTRLALLQSLCAFVAFSLIASSIYIVNDIVDLHADRRHPSKRGRPLASGQLPIGASLI
FT                   VSGLLLALGLLTGAMVSLPLLGVLFGYFALTSAYSFVLKRKFLIDVLALSLLYAVRVIG
FT                   GSAATGIVMSDWLLAFAVMFFTSLALIKRYTELAKRKDADLGDASNRNYKVSDMTMVMS
FT                   MAVASAYVSITVLALYFTSPAVNGSYRHPDLLWIICPIMLYWVGRMLMLAHRRLIHDDP
FT                   VVFALRDRMSSGMVCLVLLIMFAAH"
FT   CDS_pept        220161..220571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01860"
FT                   /product="putative permease"
FT                   /note="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98549"
FT                   /db_xref="GOA:D4Z7T0"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T0"
FT                   /protein_id="BAI98549.1"
FT                   /translation="MPAQALAEHRAAAGLLWPLLVLTCVLLSSGSQVLMKIGMNGAPVQ
FT                   NALARGSAIEIAATIATTPLVIVGMAMFGLSAGAWLMVLSRMNLSQAYPCVALGIVVTA
FT                   ICGFWLLGEAISPARLGGIGLIVAGVLVTGLN"
FT   CDS_pept        220573..221868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98550"
FT                   /db_xref="GOA:D4Z7T1"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T1"
FT                   /protein_id="BAI98550.1"
FT                   /translation="MAATALGAPARRTWPIGVSRVDLVLVILLSMTAMATCLFNGKALS
FT                   PQVYDTFNIYFQADPPRVISNMTERWSPWQNRTVAHPLFSITALSSVKALALLGLPPMQ
FT                   AIGLLLLIAAAVSAGGFHVAMRLMGLAPAAAAGFTLALLASAGFLHWYAFIETYAFSAT
FT                   GIVLMLIFTCSMRSLPRAGWIVASAASVAMLITNWGLGLAAAFFRLPFRQFLLVSGGAF
FT                   LLVSAVSAVQMKLLHRAAFWLDPRIIAKEKTYAGPKMHAAGIEWRPFISARNALLMPGV
FT                   VPSPQRDRMETEIGASTVVTNQFAPLGRWGVAGTVAAAAWLVLLAGGVAGTLADRQRRP
FT                   IGLALGLFLASKILFHSVYGEITFLYAADIAAAALAFAALGWFSPYRKTVVGALVLFIV
FT                   VGSIHNERQFLTAAKLSNQIALDKQHGRASGI"
FT   CDS_pept        complement(221870..222913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01880"
FT                   /product="acyltransferase 3 family protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98551"
FT                   /db_xref="GOA:D4Z7T2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T2"
FT                   /protein_id="BAI98551.1"
FT                   /translation="MRKENRVAHGSVKDDEGRIGWLDVAKGLSILLVVFHHAAQTGASI
FT                   GHGWAVFSTLDALAKPIRMPLFFAIAGLFAAGALSRSWVRLLTGRVANLVWLYSLWTVI
FT                   YWLFFRYFDPTDGLKPLGLSKWQLIYMWIIPPSGQWFLWLMAIYLVLAKAIARFRSPVH
FT                   LSAIFLLCALSAEAAADLPHYPWRNGLLYVPFFIGGAWYGRALAEWAPRHAAMLIVGGA
FT                   AGFAALWMLTRHPGAHIGLSMAGLMAAVGVAPLLNRISWLKRPLLFFGRRTLSIYLGHG
FT                   LVIAALSMPLSVLPLGDHAFLWVTPFLMLFSLFGSLVLHDRVGNLGRMWLYSEEGMRQS
FT                   LPKRLRI"
FT   CDS_pept        complement(222933..224012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01890"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98552"
FT                   /db_xref="GOA:D4Z7T3"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T3"
FT                   /protein_id="BAI98552.1"
FT                   /translation="MSGRHIPALDGLRGFAALIVMLSHFPDVGLPSWVNHRLGDYGVML
FT                   FFVLSGFLMGHLYLGQKPDVAALLRYGVARAGRILPLYLAVSLLSFFLFSYADPAFIYR
FT                   IDGQQLLRLLSFTSAQPIFWSIGPEFQFYFLFPLIWMAFHSSRPNRPVVFLALTTAICL
FT                   SYAISSWTPGFSVFAKLHIFIAGIGTALLMKAAPLRPPLAMLVLGGALAFLAAILLSPA
FT                   WAEPFLFPSTRGDPKHIGYYGDLAKVLLCACVIHSATIDHRLNDWLWGNGAMRRLGAWS
FT                   FSLYLLHMPAFYLAGYVPMPPVPRAVASLLLAVGIAALSHRFIEGPANHYLRRLLARLF
FT                   DRQPKVILLPDLSRAEVRR"
FT   CDS_pept        complement(224009..225232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gumE"
FT                   /locus_tag="SJA_C2-01900"
FT                   /product="xanthan biosynthesis exopolysaccharide polymerase
FT                   GumE"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98553"
FT                   /db_xref="GOA:D4Z7T4"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T4"
FT                   /protein_id="BAI98553.1"
FT                   /translation="MQGAGDMLRAVVPVAAVALLAATVLFNPFLAWVNSHVAPMSGSIV
FT                   SVMQGGIVISALLLGLFQPVALAARWWTLAALLVMAVLLTSAIRAQFNPKILGDVLLIP
FT                   AFILLGTALRADLFRRSVLVMQACILLVGMWELARPDQYGAFFNVVDYYVNTRGYDADA
FT                   FWAGGSLFLSSERPGGRLFLNGFGFHRGSSLFLEPVSLGNWAVVVTIFTAACWRELSRR
FT                   GRAFMVASTFALLVICDGRLAMTVILLFCLYLPLCRYLPDRWSAIYLPVMLGLLWLGDA
FT                   FGLLMPNGDNFAGRLGIGLHALGTMDAAALLGVRPEFARLDDAGWADFIQSQSVLIALG
FT                   LWLALSLAGFGRAPGDRMAKHGIMLFLILCLPISNSLLSIKTAALMWALYGFCFARGRR
FT                   AADSTTPA"
FT   CDS_pept        complement(225258..226382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gumK"
FT                   /locus_tag="SJA_C2-01910"
FT                   /product="xanthan biosynthesis glucuronosyltransferase
FT                   GumK"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98554"
FT                   /db_xref="GOA:D4Z7T5"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T5"
FT                   /protein_id="BAI98554.1"
FT                   /translation="MNIPISAALAPHGVTNARILILSRHDYRTARRASVHFIAQKLAER
FT                   GHDVAFLSIGYSWLSRLRGDSRAGLDPRANRWETVDGLRAYLWRTRWHPVKMPVPDALT
FT                   GWLFHRWAGMACPALDDAAATADLILIESGIAPALIRRVRAIAPHARIVYRATDLLATA
FT                   GVPQCIETTLQRQARNIDMVVVVARSMLPHFDSFDCPRIFIPHGVDLRNLRRPTVSPYD
FT                   GPHNAVAVGSMLFDEGAIRTLAQAVPHFTFHMIGTPKHAFPSNVVLHDEMPFERTLPYI
FT                   QHADVGIAAYLPAEASAYLADSSLKLMQYGAIGLPAICPDFAVGEHGLRFGYRPGDADG
FT                   MVQAFARAAQTRRRPAPTQDWGDVADRLVEVALG"
FT   CDS_pept        complement(226379..227509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01920"
FT                   /product="putative glycosyltransferase"
FT                   /note="group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98555"
FT                   /db_xref="GOA:D4Z7T6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T6"
FT                   /protein_id="BAI98555.1"
FT                   /translation="MVAIYRRGFLPLSETFIADHIRSLRRYRPFVMADDIVGGHYRDGQ
FT                   QLHLLHEPGAGKWKRISSRLTGHYDHLDGQLSSRSAGLIHAHFLQDGAGILPLALRRRM
FT                   PLVVTAHGYDATVTAREHARRTEGLWYLMLKPVLMRYVDGIICVSNWIRQCLLEAGYPE
FT                   SKLRVIRLGIDPAALPQVDSPSLRRGALFVGRLVEKKGVNFLLDAWAKLPPRLREEPLT
FT                   IIGDGPMKPALMDQARKLGIQPVFAGPQPREAVFAAMARHRIFAMPSIRAANGDSEGLP
FT                   IVLMEAQALGMAVVAFDDGPMREAIRPGQSGLLAERRDTGSYAAHLERLLLSADLCESF
FT                   GRAGREWVNNSFHIRSNMAELEDYYDEIIGRRERRH"
FT   CDS_pept        227679..228617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01930"
FT                   /product="putative glycosyltransferase"
FT                   /note="family 2 / beta-D-1,6-glucosyltransferase /
FT                   glycosyltransferase involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98556"
FT                   /db_xref="GOA:D4Z7T7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T7"
FT                   /protein_id="BAI98556.1"
FT                   /translation="MIIAAYNAQDTLVRAVNSALGQQVPVEVLIIDDASSDDTPRVAEG
FT                   LTRLHDNVRLIVSAENGGPSVARNRGLAEAQGEWIAILDADDAFLPGRLQRMTGVARRH
FT                   EADLVADNLLFFDWQAQAVAGRALRLADDHVQQVGAADFVGQCMTGRSPFDYGQLKPIF
FT                   RRRFLHARGLRYPPHLRHGEDFAFVLDWLLAGARFMLMGEGLYLFTQRIGSISSDSSGQ
FT                   SRTILNLQAMRDHTLGLLARPRIRADRALAGLLSKRADAIRDQAIWNRAYPHLRARRPG
FT                   ALLMEMLRDRRSWPMLARHLVRRHRARMLAR"
FT   CDS_pept        complement(228652..229668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01940"
FT                   /product="putative succinoglycan biosynthesis ketolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98557"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T8"
FT                   /protein_id="BAI98557.1"
FT                   /translation="MKLYYYRAPQGNFGDDLNGWLWEELAPGRWSDEDDGDLFCGIGTI
FT                   IGNDMPQAKRIRVFSSGIGYRPVPADFDSGRWKVTALRGPLTAQVVGRPERAVADGALL
FT                   LSTLPRLKPLAEEERHGTIFIPHYEAMDEGPWERACGLAGVELVDPRQCAHRVIERIRS
FT                   ARLVIADSMHAAIIADTMRVPWVPVASSRRINSFKWLDWTLSLDLPYEPVALPSISLRA
FT                   YYEGQVQRCIGQDFRLPRPDRESAMAHYRRMMRREGNGLWQSVRPKVKHHLRALPGRLP
FT                   AQRVARGAMARWDRRRTERMATVLHRLVGAPAFLSGDAIFAQRVEQLSSALDGCWGR"
FT   CDS_pept        complement(229665..230681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01950"
FT                   /product="putative glycosyltransferase"
FT                   /note="family 2 / glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98558"
FT                   /db_xref="GOA:D4Z7T9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7T9"
FT                   /protein_id="BAI98558.1"
FT                   /translation="MPKRISVVIPFFQRKRGLLREAVRSVACQYLPWPAEVELIVVDDG
FT                   SPVAAQLDLDNLALPDWIRLRILRQANAGPAAARNHGLDALSPDSGYIAFLDSDDQWST
FT                   HHLAWGIDTLGTAHDFYFCDSAMPPTTMFAAMAFFQALPTQQGVELLDGTRGTYRFVGT
FT                   SGGSSMVRDYLCQTSSVILRRSAVGSLRFEESLRYAGEDWLMWARIAHRARGICFSLSA
FT                   NSLRGEGINLYRDAHERLGGRNLRRILSMIRANELMGAIDGIDEQSLMLTQQRRRSFQM
FT                   ELAAILMHPRLYLGLMDRLQRAMIARAYRHLWRDLPGYWTEILRRKLRPAGMPEVPA"
FT   CDS_pept        complement(230710..232596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gumH"
FT                   /locus_tag="SJA_C2-01960"
FT                   /product="xanthan biosynthesis glucuronosyltransferase
FT                   GumH"
FT                   /note="UDP-N-acetyl-D-mannosaminuronic acid transferase /
FT                   mannosyltransferase / glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98559"
FT                   /db_xref="GOA:D4Z7U0"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U0"
FT                   /protein_id="BAI98559.1"
FT                   /translation="MKIVHISRQYHPGIGGLENFTRNLCEEQARAGHEVRMVTLNRIFD
FT                   GDGAELPARETIGGVEVVRLPFRGGRRYPIAPAVLRHVRDCDLIHVHAMDFFVDFLALT
FT                   RFLHQKPMVLSTHGGFFHTDYAQRLKQVYFHSISRLSLSRFHATIACSEADQESFARIC
FT                   RQRLTLVENGVDIDKFAAAADPDARAILYFGRIAPNKRIDRLIRWFAAVKALDPAWSLI
FT                   VAGKPMGVALSDLRRIADEQGVSRKVEFHDSPSDEALRALIGRSSIFASASAYEGFGIS
FT                   LIEAVSAGLYPAASDIPAHRRSCEKLGVGTLLHFDDPLSAARLLKDFRAARARGALKDA
FT                   AEPLRSYSWPQVSARIVHIYDQILGHRQRAIGPVKVAVLSQTEALAEIRSHVRAQRPKV
FT                   IAFCNAHMANLARKDDRLAGALGNALVLNDGIGVDLASRLRYGRSFPVNLNGTDFIPAL
FT                   LKDHPEGLRLFLVGAAPGVAERAAVTLRRLCPRLSIVGMQHGFFDPQEEAGLSDRIGAS
FT                   KADLVLACMGNPRQEIWAARWAPEFGRPVLCGGALLDFLAGRVRRAPAWVQRARFEWAW
FT                   RLLQEPTRLADRYLRGNLSFIVHALKDAWRGQDWEDTPPPAPTTALRGADAA"
FT   CDS_pept        complement(232619..233293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98560"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U1"
FT                   /protein_id="BAI98560.1"
FT                   /translation="MVMRLRSTERSEQPGAIFIAAGPGEKPEINAAGPIQVDPLVVAVS
FT                   DPEDRLAVQARDIQSTLAALRLADGRAPSSIAVLTVGAVDEAAILTANVAVSAALSGLR
FT                   TLLVDMKQSDFVQHRLLGQAPVTPTDPEDDLHAFIRPASIPRLSLLAAASDSRGLADMM
FT                   ADFDLCLVDASHVEDLALAAAGAEVAILAVSRDATTTADLKSTINKLSMLGMPLIGTVM
FT                   IV"
FT   CDS_pept        complement(233284..234654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gumC"
FT                   /locus_tag="SJA_C2-01980"
FT                   /product="uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98561"
FT                   /db_xref="GOA:D4Z7U2"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U2"
FT                   /protein_id="BAI98561.1"
FT                   /translation="MLILDIFRAILQRWRLVAGIFCGVMLLTAIWILMTPREYVASATL
FT                   LFDTRAPDPLPGETRAAGEPAAMLATEAQILRGEAITGHVTRALGLDKQPELRRQWFDQ
FT                   TNGTQTFQGWLNRRVQSGLEVTPSPAGSTIDIAYRSSNAARSAEMANAFADAFNKTRLS
FT                   MSNDFAKRYADWFKTRLSESEARMESAQSELAKFQREHGIVSTGAIDAESTRLSELSSK
FT                   LSTAEASAADAGARAAAGASMPEVQSSGVVQGLRAQIATKSAEIRQMSAELGPSHELMR
FT                   AANSQLAQLRAALAQETAKTSGSLSAASSAAAANRGAMQSLLNQHRARMLSLAGDRGKL
FT                   NVLESNVESAKKQYETETQQMAELRAKSSIPSLNVLHLNAAEAPLLPNAPNIPVRLLMM
FT                   TILGLMLAIGTAVLLEWLQPRVRSRDAMTYLTGVPVLGQADLRHIGQQLRLEGAKWS"
FT   CDS_pept        complement(234685..235947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gelJ"
FT                   /locus_tag="SJA_C2-01990"
FT                   /product="predicted ATPase GelJ"
FT                   /note="AAA+ superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98562"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U3"
FT                   /protein_id="BAI98562.1"
FT                   /translation="MPLFSWIARWLRPRRKPKPQSEELARRMAAIRAAAAAEPATPPPP
FT                   TADMLRSAIRKGFNSTQPVTSSSHLHGRQEQLELLVEGVLDRGNHALIYGARGSGKTSL
FT                   ARVFANMADDRGFVVLYSACEPDQDFGALIRPYVDALAGAPVDWLGDRPVNPRDVIEQI
FT                   APRARRRFVLILDEFDRITDGAVQHDVARLMKMLSDAAMPVHIVAVGIAAGVDALIAGH
FT                   ASLRRHMSVIPIARIESQAVFDIIAKGAVSTGMGFTDASRETIAHLACGSPYHVRLFCA
FT                   LACFEVIKRQERKVDLPATLAGVARAVNDWALTNAEDAALFRKVIATNSPHWSMIETIA
FT                   RTAAAHGFITRRALADERGERILSQLRDALIIDAAEDRIAFQDSLAPQFMLAMLFAAQN
FT                   SEKIDENIISMNDLHRPIAAE"
FT   CDS_pept        complement(235970..236767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gelD"
FT                   /locus_tag="SJA_C2-02000"
FT                   /product="periplasmic protein GelD involved in
FT                   polysaccharide export"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98563"
FT                   /db_xref="GOA:D4Z7U4"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U4"
FT                   /protein_id="BAI98563.1"
FT                   /translation="MKPIFPALSILILASLSAAVPAMTADAAPGAALASSYILGANDEI
FT                   RVSVFGAYPFDVKTRIKEDGSVTLPSVGEVVAQGVTANALATKVRDQLKAGGYFVNPIV
FT                   NVEVVSYVSRAVTVFGNLQNPGIYPLDRPQTIAMMLARTGGARTDAADYAILQRQGEED
FT                   RRIPLEDLNSATGTGQMLRPGDSLFVPKAEDVFIYGQVNKPGKITYESGMTLRQMLAQA
FT                   GGPTLGGSEKKISLNRGNQRIKRADLDMLVKPGDVFTVQERIF"
FT   CDS_pept        complement(236778..237977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gelF"
FT                   /locus_tag="SJA_C2-02010"
FT                   /product="gellan polysaccharide biosynthesis protein GelF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98564"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U5"
FT                   /protein_id="BAI98564.1"
FT                   /translation="MKQFSVMSAAATAALMIPQAALSQTEVEVPPDGLRVRPTVRLLYD
FT                   SNILRQNDDLVTAEQDDLRITPSVDVTYRRQFGLHRLTVIGSAGYDFHQRFEFLDRERV
FT                   SLQADADLSVSGYCHVQPRARLNFAQSNLSDQGVVVGNTQRTQDYRVAVDCEKPYGFFP
FT                   VAAMGYLNTSNSASSRRIFDIDTSTAMAGIGYSKASLGEIRATFQYERFRRPNADEAIA
FT                   GLRDGAENYRAGILFRRAVAPRLSWQLGANYFKTKPRAPGIADFSGLGVEAQAVYTPSN
FT                   RLSILLDVDRSSRNQSNTGATYIVQTDFSLRGNLKLGARSGLSIGGSYSRRSFKGELQL
FT                   DTPLLRRSDRTRAVFAGYRYQLRSRLNAGAEIRHEWRTTAVDQFRYKSTSGLLFVGLDL
FT                   "
FT   CDS_pept        complement(237974..239002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02020"
FT                   /product="putative cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98565"
FT                   /db_xref="GOA:D4Z7U6"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U6"
FT                   /protein_id="BAI98565.1"
FT                   /translation="MRVATRLAMAPLLMLLALPLTAEQPAAGQPPLSGVNIAGGEFNSA
FT                   RKPGVFGKDYIYPDARTAQPFIDMGMRIVRVPILWERVQPAPLKPLSTTEMALIDKSLA
FT                   SLAPFRTIVLDVHNYGRYNGQRLDQISNGSAMLADLWQRLAEHYKGNGAVAFGLMNEPY
FT                   GMTPAAWRSLADGSVAAIRRTGAANLILVPGSKYSGAHSWTTGGSNSNALAFADFRDPG
FT                   GNYAFEMHQYLDADSSGTATSCVSPDLIDARLTGATTWLRTNGHRGFLGEFGAPPDDNC
FT                   LRALDVLLAHLRANGDVWMGWTYWAGGAWWGARYPMSVQPTGGPRPQAAVLSKHIVARE
FT                   PR"
FT   CDS_pept        239071..239643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98566"
FT                   /db_xref="GOA:D4Z7U7"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U7"
FT                   /protein_id="BAI98566.1"
FT                   /translation="MMSAKGDLLAKAPAGDAPDMAAADALPWFQGGDSVPTHFGMVGLL
FT                   QEKGMVVDLGAPQPGGTRPIHYRRSSGALLSISVPLSMTIAAGDFLLVKSLTCPDGAVR
FT                   PVAVRPPASPDWIAIADLEGILGHYGAGASRFVRWSAGAGAACGIAALCGVAAPVTALA
FT                   GMVAGVAALGLHRRHRRDRGRVRRLIG"
FT   CDS_pept        complement(239649..240644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02040"
FT                   /product="oxidoreductase-like protein"
FT                   /note="NAD-dependent epimerase/dehydratase / 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase /
FT                   nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98567"
FT                   /db_xref="GOA:D4Z7U8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U8"
FT                   /protein_id="BAI98567.1"
FT                   /translation="MSADGPPIVAVTGATGFTGGALARRLIGMGYHVRSMTRRPPSAAE
FT                   RESGIEWIGGSLTDTDAFAQLVEGATACFHIAAMYRSEGAREEFLSANRDSTAALLAES
FT                   RKAGVARFVYCSSIGVHGDVAETPADENAPFDPRDPYQESKLLAEDLCRDAMMRPGMDV
FT                   VIIRPCAIYGPGDTRMLKMFRMVQQGRFLFIGSRRPNFHPVYIDDLVDGFLLAMTSDAA
FT                   PGGTFIIGGKTYLPLRDYVATAANVLNVPAPRRTVPYGLVNLAAHGCELLCAPLGVQPP
FT                   LHRRRLTFFKHNRAFSIARAEQALGFRPAVGLEEGFRRTVAWYRNEGLLV"
FT   CDS_pept        complement(240641..241369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02050"
FT                   /product="putative methyltransferase"
FT                   /note="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98568"
FT                   /db_xref="GOA:D4Z7U9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7U9"
FT                   /protein_id="BAI98568.1"
FT                   /translation="MTGLLPPPDLETGSVQYARRFAGPSGAYLLNIQDRGLRDLVDDGP
FT                   PLHQSALDVGGGHGQLVGGLLDMGIKTTVLGSTADCAEQLLQGADAGRVDYVTGDLLAL
FT                   PFPDGRFDLVTSIRLLAHIDDPDRLIDELCRVARYSVIVDYPTLMGANALSAATFPIKR
FT                   LIEKDTRTYRSFWPARIEQAFRRNGFAPRRRFKQFSAPMGLHRLAGKPVRMVEEGLRRI
FT                   GVTSLIGNPVLQRFDRERKA"
FT   CDS_pept        complement(241366..243090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98569"
FT                   /db_xref="GOA:D4Z7V0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V0"
FT                   /protein_id="BAI98569.1"
FT                   /translation="MATTSEHLGPPVVLPSQDGRRAFMALPGAAPALAAGLLACLVYGL
FT                   TIQTRPAHIDEFYHLLAGRSWAADGSFAILDGRYERARLFTAIVGGSFDLFGRSDLWVA
FT                   RIPSLLFSGISVGLVFQWLRQSGGIWSAMAGAALFGLAGYTLDIAHFARFYALHALMIL
FT                   AAAGSLFLATRPAGRFRPGWLAATALCLAIAAHLQPVTAIAALALGCWLLFDQRATIAA
FT                   MRPLHLIVLGAIALACATIALSQAGPALESYRHAERWATGSQDDAFYYLREFRAQMPAM
FT                   LLLWPVALAAAWRRNPSLASLCAIMVMLCLALHSFAGMKAWRYSYYVFPFICMAYGLAI
FT                   GALVERFGGGGTMRPALLAGAAMLLLMGGDVAYRHSARLMASTLAQGPAALAAPVPDGE
FT                   WDRAAPELRRIAQGSSLLVTGDDLRTLAHIGPFDLFISHSRLGELKPPTDFNSDFRTGR
FT                   PLIDSRAALSEVIDCTDNGVVIVSDYQWRNPMGVRPEIAREIERRLTPVPTHSSFHVYS
FT                   WRHPTVRRACPHVGKQALPGTKGASVVRPLPPRGRCVPSGQSCPPAFFGIAATAGAA"
FT   CDS_pept        243335..244270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpm1"
FT                   /locus_tag="SJA_C2-02070"
FT                   /product="dolichol-phosphate mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="glycosyltransferase, family 2 / glycosyltransferase
FT                   involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98570"
FT                   /db_xref="GOA:D4Z7V1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V1"
FT                   /protein_id="BAI98570.1"
FT                   /translation="MVDVSIVVPLYNEEDNVQLLHEAISNALADFRPSYEVVLVDDGSR
FT                   DATFVRAAEVAERDGRVRIVKFRGNYGQTAAMAAGIQNARGDIIVTMDGDLQNDPLDIP
FT                   RMVELIHAGHDIVVGWRRKRQDGGLRVFVSKCANRIMARLMGVAVRDSGCSLKAFRSML
FT                   IKQLPMYGEMHRFIPALSRLAGARLAQIEVRHHPRQFGVSKYGFSRIYKVMLDIVSIRI
FT                   LLSFVRRPMAWPRHMIVGITLLGLLSVAAAVWGGGLALPMLAIGVLWLSLALFLLGWAV
FT                   IGQMLASLTGNVSGFASLGAKLSAQIKLGD"
FT   CDS_pept        244274..245251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02080"
FT                   /product="putative glycosyltransferase"
FT                   /note="glycosyltransferase, family 2 / glycosyltransferase
FT                   involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98571"
FT                   /db_xref="GOA:D4Z7V2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V2"
FT                   /protein_id="BAI98571.1"
FT                   /translation="MVATAKLDLVEVMDISVIVPVLKRFDDAARVYAEYRDRVASSGKS
FT                   YEFIFVIDGQPDYPVATLEQLQRDGEPIEIIRFGREFGESACLREGIRQSTGRHLLFLP
FT                   AYFQIGGAAISELLDHLDEADVVAARRDRRADAMFNRLRGWGFQKMARFAGAKYDDPGC
FT                   LVRAVHRSVFDEIPLQDEKQRFLPLLAEVHGFKVVQLTLPQAESDAGRPQHKPGVYFDV
FT                   MMDLMAVGFLVRFMQRPFRFFGTVGAASILSSLVLMAFLLFQREVSNIPLGDRPLLVLV
FT                   VLLLVLGIQIAAIGLIAEIVIFTRGDGKQHYRIEKIVEHVSADA"
FT   CDS_pept        245244..246407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02090"
FT                   /product="putative glycerol-3-phosphate dehydrogenase"
FT                   /note="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98572"
FT                   /db_xref="GOA:D4Z7V3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V3"
FT                   /protein_id="BAI98572.1"
FT                   /translation="MPETVIIGAGIQGATLALAALERGVCPILVDRDDRPSGASVNSYG
FT                   IVHGGLRYLQSMNIPRWVRSRRAQNWYIDRYPHQVRPLRCVMPLYAGAPRSPRLFALAR
FT                   GLDRMLRTALGQHVPLPEDGACSRQEVLQAYDVASHGLLGGAVWYDAQLLNPPALLREM
FT                   LAEVEQRGGVVLRYTEVTGLIEQGGRLQAVQLRNVKDGREQRIAADRLFDCGGAQAGRC
FT                   IGPARRVPSAAVLAFNLLMDIPAPPASDAYALSPTPGRGRSFFFRRYGAATLVGTFYRP
FT                   APGGLSPEPTAEDVRSALASIRQCLPNVELDEGSVLATYAGLLPDRDGSGRALHPGDRH
FT                   LRPGPEGYHMLVSGKLTTAPLLSEQVARRLWPAAPLPRAGGWRPRHA"
FT   CDS_pept        246400..247131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98573"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V4"
FT                   /protein_id="BAI98573.1"
FT                   /translation="MPELMIDAHVHLHPGDDPRDRLMQAHGRMMAAGMKDCLPVFMLAE
FT                   QQGCDAFGMLKASARSTAEPESLWLETGSADMLVLAGRQVVSAERLEILALATAAGFAD
FT                   GAPAEQLVGAMIAADALTILPWGVGKWAGARGRLVDRLLAGDPEGRLLLGDNGGRPAFW
FT                   PERRFRHRTVLRGSDPLPLRGDARRIGTFGTILHGGLSADRPGRDLRALIRSAGRQARH
FT                   YGAPASPLHFLGNQLRLRMAS"
FT   CDS_pept        247128..248318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02110"
FT                   /product="putative glycosyltransferase"
FT                   /note="group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98574"
FT                   /db_xref="GOA:D4Z7V5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V5"
FT                   /protein_id="BAI98574.1"
FT                   /translation="MKILMLAPQPFYEERGTPIAVRMAAEALAAQGHEVALLSFHEGRD
FT                   VPMPGVRHHRIAAPPGVRNVPIGFSLGKLVCDLWMFFAAIGLLRRYRPDVIHAVEEAAF
FT                   FALPLSRLFGTRLVYDADSILSEQIVEKWPKARAIAWIVERCEQFAFRRSDLVIAVCPA
FT                   IQQSASRSAAADRIHLLPDVAMEGPATAAPVEDLRLNAKDRPLALYVGNLESYQGVHLL
FT                   IQAMAALAPAERPALVVIGGKADHVAQHRQLALQCGLEGDVRLLGPRSLDGLSRYLAQA
FT                   DILCSPRLKGRNTPMKIFSYMASGKALLATDIESHSQVLDARCAMLTPATAQDLAQGLR
FT                   RLCADGALRARLGEAAAARARLDYGHAAFVDRLRRAYAVLSPDAGTPPSPTALEAA"
FT   CDS_pept        248315..249532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02120"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="membrane protein involved in the export of O-antigen
FT                   and teichoic acid-like / permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98575"
FT                   /db_xref="GOA:D4Z7V6"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V6"
FT                   /protein_id="BAI98575.1"
FT                   /translation="MTAVGASARATNKAASSLFAALGFGLSGAGFTLGMLLLARELPVE
FT                   AYGRFTLAVALFNIFGLLTPLGVDQLFLRGPMRAGKGLLAFLILSGLVVGGLVGVAAGL
FT                   LGGLHPVEAWLTALAIAGGGLVAATSTGLRARAVPGASMLLAISASFVLLLAGTAAVAF
FT                   GLKDGTAPLAIFAAGNIVFGAIGWGLLRRRAKDGDAVHPARRWREAGSMLGLVALGTVS
FT                   LQVERIIIPIPLDLKELALFGVLASVAIFPFRLLASGVGFTLAPRLIGAQRARRQAVVL
FT                   AEARPLLAVIVAATAGLVACGPWIAAMVTGGLYAIGPALILAACANGVGKVAMAFPRAM
FT                   LTAAGSPADLVLLNGWGVVGLALTVCGALAGAACGITGLLWGATLGGAIPTLFTLHLAW
FT                   RRLGKD"
FT   CDS_pept        249536..251332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02130"
FT                   /product="HAD-superfamily protein"
FT                   /note="HAD-superfamily phosphatase subfamily IIIC:FkbH /
FT                   putative enzyme involved in methoxymalonyl-ACP
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98576"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010037"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V7"
FT                   /protein_id="BAI98576.1"
FT                   /translation="MTTQMGFAEMMQSLHAGSAALDYRKTGRLLREMEAQAGVHVALMG
FT                   NVTLDLLTPFLRVEAAKVGQMSAFHVSPFGQYMQALHGEALQRFDPHVIVLLLSAEAMR
FT                   PDAFERFHQLSVEDRHRLRDDMMAEVEGWIDSAVMRTAATLMVANFPCPSSALGVADLS
FT                   SDYGEREFFLDLNLALLRAVRARPRAMMLDVVAAMGRVGTRQAVDRRMHYVAGLGWTDA
FT                   MMREFGAVFAHALVGALGAARKCLVLDLDNSLWGGVAGEDGPHGIRVGRGDMVGEAFRA
FT                   FQLRIKALKERGILLALCSKNNPEDVEEVFRLRDDMPLQLSDMAATAIGWDSKYTGIGK
FT                   IARQLNIGLDALVFLDDNAAEIAAVRQYCPEVHAVLLPPDPSDYVDILDALPWFEKSRL
FT                   TAEDRARTEHYALAARRDGLCASCDPMDYLRDLDMRAAVRDAGPADLLRVHQLFNKTNQ
FT                   FNLTTGRPTMGEVEAMMTDPAWQLIVANLRDRFGQLGTVAICALRREGAALHIGHFLMS
FT                   CRAMGRGLEHAMMNEVKRRFLESDAASLHGTHVPTAKNGPVRGFFDDQGFAASDGGDRT
FT                   DYALCRADVAFKDCDWIMLETE"
FT   CDS_pept        251332..251562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02140"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98577"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V8"
FT                   /protein_id="BAI98577.1"
FT                   /translation="MAVNMDDLLNLVGDIIEVDPSRIGLRLDRDEVPGWDSLAHLRIIT
FT                   AFEAQYGVRLSMDQIAEIRTVEQLSRTLGEA"
FT   CDS_pept        251567..252097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02150"
FT                   /product="putative acetyltransferase"
FT                   /note="maltose O-acetyltransferase / acetyltransferase (the
FT                   isoleucine patch superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98578"
FT                   /db_xref="GOA:D4Z7V9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7V9"
FT                   /protein_id="BAI98578.1"
FT                   /translation="MRMGVAIRRFAIPGFVHSLYHLFAGRAIVSPRAEVEWSRLLKIGR
FT                   KSQISSFVKIKASEGPVRIGERTDIGCGVFIAGHIHGIVIGDDCLISPNVSIIGVNYRY
FT                   DRADQLIREQGLQSGGPTSIGNNVWIGAGAVILDNSQIEDGAIIAPNAVVSGRVPAMSI
FT                   MSGNPAKLVFTRR"
FT   CDS_pept        252094..252651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="SJA_C2-02160"
FT                   /product="maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="acetyltransferase (the isoleucine patch
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98579"
FT                   /db_xref="GOA:D4Z7W0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W0"
FT                   /protein_id="BAI98579.1"
FT                   /translation="MRLFVTARLDDLYARWTRWRLRAAGGKAGRALRVRGGVPYLAGQL
FT                   ILGEAVRLRNEPVRIRLKTAGSGRIVLGDQVSLNSGVTIFSAASVEIGAFSRIGDHASL
FT                   FDTSFHAVHEGHAARPRPIRIGRNVWIGRNATILPGVSIGDHSVIAAGAVVFQDVPSRQ
FT                   LWRGNPASFVKHVRAGDDFIRQ"
FT   CDS_pept        252662..254122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02170"
FT                   /product="PST family polysaccharide transporter"
FT                   /note="membrane protein involved in the export of O-antigen
FT                   and teichoic acid / polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98580"
FT                   /db_xref="GOA:D4Z7W1"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W1"
FT                   /protein_id="BAI98580.1"
FT                   /translation="MSATAGGIAGKIRSGMAWSLVESWSVQALQFLAFMIVARYVDAAA
FT                   LGVVAMALLAGQFFQMTVLSGISAPMVSAGRDDPDLDDTAFWIAFALGALMLLLTLACA
FT                   GVAERALGQPGLAWVLRWLSIANFLSALNVVPQAWLTRALMMRPLAVRSTLSTMAGALV
FT                   GIPMAMAGYGLTALVMQNLATALVGAAILWAACPRRPRFRFARQKGREIFFYSRHVTLT
FT                   GIANFFNSNSDVLIVGVVLGAAAAGVYTVGKRALLAANLLLARALSRVAFPAFSQLKHD
FT                   PPRLAAAFLKLVSATSLITTPAFVGMALVADPFIHLVFGSRWAGAVPVMQYLSLFGALQ
FT                   AIGIYNQSLMLALGKPQWQTWLAALYAVVNCTLFFATADQGPGAIAAAFTLRAWLLYPL
FT                   SVLGVILLLPIGWADYWRAVRLGFFASAAMAGCVLGARPFLVQMAPAEVLTVTILTGAL
FT                   AYGVALLLLGRNALAQLLMFARGRYGAA"
FT   CDS_pept        254385..256337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02180"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor histidine
FT                   kinase AtoS"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98581"
FT                   /db_xref="GOA:D4Z7W2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W2"
FT                   /protein_id="BAI98581.1"
FT                   /translation="MLATDAGERLQRRFSLAFLRNASRRFAPAAWIAPAAWMGEVRWSG
FT                   VGKYIASLLIVFLASSWIFRNGVASLTAGDYAVLTLIVIFVATLMGIGPGAVTTTGLLT
FT                   VIYAIVDVNIRGGSGEDGLAFLLVMVAANGVALKSTFWRARAERQGAYVNRLTEQLKLL
FT                   TDGSVNYALYMTDVEGRVVHWNRGAERFTGWDSRDILNRPVSLLYSQHPDMEDNMAEAF
FT                   ALAKEHGSCEFDCHFIRNDRTGFMQNCVVTALRDSKGRLQGFAKLVRDVTAERAQEVAL
FT                   QEREAELRSILETAPDAVFVVDISGRIDYMNSTARRMFGYSLCELEGAEFDHLLTGAQP
FT                   PREVRDEPLHVESDRPLSYPRRLIGRRRNGSNFPIEMSFVKMEGAHETHYTAFIRDLTE
FT                   QDATKARLELLQTEMLHGTRYSAMGAMASMLAHELNQPLTALAAYMEGSSILLMRGQEA
FT                   DRQKLNRIFRSAAQEAVRAGAIMRRLRDFASDGEAQLEIHDAQDVVRSSLALIAAMAEA
FT                   ADVTVDMDVAPGTGSIFADPIQIQQVIGNLCRNAIDAMREEPERRLTVRVAAADELTTH
FT                   FLVSDTGSGIPPAIRDRIFDAFVSSKEEGTGVGLSICRTIVEAHGGRIWLEPSVTGSCF
FT                   GFSLRRKKGNAIGTH"
FT   CDS_pept        256351..256950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02190"
FT                   /product="LuxR-family response regulator"
FT                   /note="two-component system, NarL family, response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98582"
FT                   /db_xref="GOA:D4Z7W3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W3"
FT                   /protein_id="BAI98582.1"
FT                   /translation="MDDEDSVRAATAFLLELEGYTVRTWQRGTHFLAAAANEPLGCVIM
FT                   DLRMPEMDGIEVQRRLNEAELYFPIIMLTGHGDIASTVTAMKMGAVDFLVKPFERETLL
FT                   RAVENCWMLFQDTGARRQRAVRAGAMVEKLTPRERDVLSGLTMGLPNKHIALQLGISPR
FT                   TVEIHRANLMSKLETRSLSDALRVAFAAGIGRQLDC"
FT   CDS_pept        complement(257167..257301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98583"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W4"
FT                   /protein_id="BAI98583.1"
FT                   /translation="MEGQDRQAGLPRPPYGGSQLQVVKSRAAPEDALFKIRSPAGRRR"
FT   CDS_pept        complement(257778..257939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98584"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W5"
FT                   /protein_id="BAI98584.1"
FT                   /translation="MRRGRAPSAGRTGRHRQVNSRHAHLILRAWRMLRAVARIRSKRSC
FT                   CRISVPAT"
FT   CDS_pept        257895..259265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02220"
FT                   /product="putative sugar transferase"
FT                   /note="sugar transferase involved in lipopolysaccharide
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98585"
FT                   /db_xref="GOA:D4Z7W6"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W6"
FT                   /protein_id="BAI98585.1"
FT                   /translation="MATRPAGGRGPAAAHRAVRICLCLALALWDMVALTCGLSVGLALA
FT                   PVDAGLRDSGASVAALLMAYLIIAFHNQAYDPRGLTNATTSCRNAARAFAGTVLIFFLV
FT                   LFAVKSTSTFSRSAVLAGLGCAGGLLLAQRLLLSRLIERYFGERLFAELLIVDDCPIPE
FT                   NPGHMALVDAQAIGLRADLDDPYMLHRLGMLLRDHDRVVVACPAERRVTWAQMLKGGNI
FT                   LGEIVSPEVESMAPLTVGRWQDMATLVVARGPLNLANRATKRLLDLFVTVPLLIGLMPL
FT                   MIAVAVAIKLDSPGPVFFRQQRIGRGNTLFSILKFRSMKVERCDMDGIRSASRTDDRIT
FT                   RVGRFIRRTSIDELPQLINVLLGEMSLVGPRPHAIGSTAEDILFWRVDRQYWKRHALKP
FT                   GITGLAQIRGFRGATETRADILQRVEADLEYMNGWSLMRDIVILFGTIQILVHRNAF"
FT   CDS_pept        259392..259712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98586"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W7"
FT                   /protein_id="BAI98586.1"
FT                   /translation="MFDLIESDCRSGFLVFRGYLIGGSAPPFLGSVNKLENVVKWPSQD
FT                   IPLPQAGGARGGRDPGLDPGELLTWPLQNNADVAPAHPLTPSRLREGGCPIPTQITQSG
FT                   KS"
FT   CDS_pept        complement(259780..260751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02240"
FT                   /product="putative xylanase"
FT                   /note="esterase/lipase-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98587"
FT                   /db_xref="GOA:D4Z7W8"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W8"
FT                   /protein_id="BAI98587.1"
FT                   /translation="MKHLSARKASRRPFRFPAARALAIGIAACALAAPALGQAQDDRMT
FT                   PIAAPAQPDAIELGTGALPGATAKESWHRQYGSRFARNVTVATLTPFLPDPAKASGAAV
FT                   VVAPGGGFRTLSMDNEGYDVARALAAKGVAAFVLKYRLRQTPADMAGFERSMQEMFSGA
FT                   ARAPLPAPASAATDLAPQLADSTAAFRLIRARAAQWHVDPDRIGMIGFSAGAMLTMATT
FT                   LSATEAKPAFIGNIYGPLGSMTVPQDAPPMFAAIAADDPLFGNRDFKLIDDWRAARRPV
FT                   EFHLYEQGGHGFGMYPKATTSTGWFDAFVRWIDMHGMLKKVR"
FT   CDS_pept        complement(260777..262345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA"
FT                   /locus_tag="SJA_C2-02250"
FT                   /product="alpha-L-arabinosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98588"
FT                   /db_xref="GOA:D4Z7W9"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7W9"
FT                   /protein_id="BAI98588.1"
FT                   /translation="MIKTLRRTTAALLLCASALAATTASADTDGRPTTATIHADRPGPV
FT                   YDRRIFTQFAEHLGHGIYGGLWVGNDRSIPNTNGFRNDVVAALRNLSVPVIRWPGGCFA
FT                   DEYHWREGIGPKGKRPVKVNTNWGGVTEPNSVGTHEYFELLRQVGAEAYISGNVGNGTP
FT                   QEMAEWVEYITAPAGSLADERAKNGHKQPWALPAFGIGNELWGCGGNMRAEYAADVTKR
FT                   YSTFLKVPAGKTLVRIASGANGGDYNWTEVMMRDAAKQLDALSLHYYTLPQGGWPPKAD
FT                   PVDFDETGWADTLAATWKMDELIAGHSKVMDKYDPQKRVFLAVDEWGTWYAPDPGTNPG
FT                   FLRQQNTLRDALVASVNLDIFAKHADRVRMTAIAQMVNVLQAMILTEGRKMVLTPTYHV
FT                   FEMYKPWQDATVLPIDIDTPWYNKDRFVMPAVSGSAVRARDGKVHVGLSNLDPNQTNTV
FT                   TVKLDGLNAANVSGRILTAPAINSHNSFDAPEVVKPAAFTGAQVSGGTLTVALPPRSVV
FT                   VLDLQ"
FT   CDS_pept        complement(262385..265009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02260"
FT                   /product="putative beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98589"
FT                   /db_xref="GOA:D4Z7X0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X0"
FT                   /protein_id="BAI98589.1"
FT                   /translation="MKTAFALRAAGAILCLATSAIAHAQASDIWAEADGKARAIVDRLT
FT                   LDEKVAQLLNVAPAIPRLGIPAYNWWTESLHGAIGAVPTTNFPEPIGLAATFDAPLIQQ
FT                   VAAAIGTEVRALHTLGRRTGHLGRIGTGLDTWSPNINIFRDPRWGRGQETYGEDPYLTA
FT                   RIGVAFVQGMQGNDPDLPLVVATPKHFAVHSGPEPSRHTDNIFATPRDLEDTYLPAFRA
FT                   AIVEGKAGSIMCAYNRVDGQPACGSHMLLKDYLRGAWGFKGYVVSDCDAVVDIYEHHKY
FT                   APDAATGVAVALRHGVDSECNNATLGGRPDLGDRYKESLARGHIAMGDIDAALVRLFSA
FT                   RYRNGDLPGLSSRKPNAIPPSAIGTPDHQALALSTAEKSLVLLKNDGILPLRPGARIAL
FT                   AGPLADATRVLRGNYSSAKSAPPISVAEGLKQVMGAGAVTVIPFSPSITDGDLVPGTAL
FT                   LTPDGKPGIKAEYFNAAGKDQFAARPVLTRTETSIVSRAAEFKQVSDQHRVRWSGYLVA
FT                   PETGLYRLALTGVKGDVSLNGKPVVSASDYSRWAEPLKLVDVRMTKGERYAIRLQGESG
FT                   VAASPAIFWKRVTDDLDRDLTAGVKDADVVVAVVGLTSDLEGEEMPVKVEGFDGGDRTT
FT                   LDLPADQRAFLEKARALGKPLVIVAMNGSAIDLSWAKENAAAIVEAWYPGQSGGLAVGN
FT                   VLSGRADPGGRLPVTFYRNVNDLPPFTDYGMEGRTYRYFRGTPVYPFGHGLSYTSFRYA
FT                   PLTVEPVDGSVEKGLKVRTAITNTGARAGDDVAQLYITPPRFEGAPRLALRGFQRVTLK
FT                   PGETRNVEFTLSPRDLSFVTMAGERGLIPGDYGLSIGSGQPDDGAQVQQARYSIARMIP
FT                   LPK"
FT   CDS_pept        complement(265111..266241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="SJA_C2-02270"
FT                   /product="putative beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="arabinosidase (EC 3.2.1.55)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98590"
FT                   /db_xref="GOA:D4Z7X1"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X1"
FT                   /protein_id="BAI98590.1"
FT                   /translation="MPIKLRPLEVLPLAALLLAAGCQQPRTANEAEPKAAAKRDASEYL
FT                   SQPLVTDIYTADPSAHVWNGKIYVYPSHDIDGPTPEDDLGGHFEMRDYRILSMDRIGGP
FT                   VTVGPVALDVKDVPWADKQMWAPDAAYKNGTYYLYFPAKDKAGAFRIGVATSKDPMGPF
FT                   KAQPQPIKGSYSIDPAVFTDDDGSSYIYFGGIWGGQLQRNVDGKYDPNGSKTDLGQDDK
FT                   PALAPRVAKLTGDMLEFSETPRAIQILDDKGKPLLGGDHDRRFFEASWMHKYKGKYYFS
FT                   YSTGDTHYLVYAVGDSPYGPFTYKGRILEPVEGWTTHHSIVEWNGKWWLFYADSQLSGQ
FT                   TRLRNVKVTELHYNPDGTIRTINPFVAKAAKDGAAH"
FT   CDS_pept        complement(266354..267940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02280"
FT                   /product="putative tryptophan halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98591"
FT                   /db_xref="GOA:D4Z7X2"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X2"
FT                   /protein_id="BAI98591.1"
FT                   /translation="MSVDIPSLFMGNFDMIHPVRNIVIVGGGTAGWLTAGVIAARHRSR
FT                   IGNGFTVTLVESPNTPIIGVGEGTWPTLRTTLSRMGISETDLFRECDAAFKQGARFARW
FT                   TTGTPDDGYYHPLMLPQNFGQVNLAPHWLAGEGDESFCDSVCSQGRICDDGLAPKTIAT
FT                   AEYDALANYAYHLDAGKFAPFLQRHCTEKLGVRHVLADVEQVLMKEDGDIRAIRTTQAG
FT                   EIEGDLFVDCTGFKALLIEGAMKVPFRDCNDVLFCDTALAMQVPYDRPDSPMASHTIST
FT                   AQSAGWIWDIGLPTRRGIGHVYSSNHISDEEAERELRAYIGPPAEGLSARKIAIRSGHR
FT                   ETFWKGNCVAVGLAAGFLEPLEASAIVLIELSAKIIAEQMPACREVMDIVASRFNATTH
FT                   YRWGRIIDFLKLHYVLTKRTDSDFWRDNVREETIPDRLQELMLLWRYQSPWFLDEFDRV
FT                   EEVFPAASYQYVLYGMGFRTEVDRPALARDAHLADRARRENAAMTAKLRAGLPRHRDLI
FT                   DKIVTHGLQPV"
FT   CDS_pept        complement(267961..270867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02290"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98592"
FT                   /db_xref="GOA:D4Z7X3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X3"
FT                   /protein_id="BAI98592.1"
FT                   /translation="MNKAEQGRGRAALAATASLLVLAIATPVHAQEAAQDAAAPSASEA
FT                   DIIVTGIRGSLQRNLDIKRESSGVVDVISAEDIGKFPDSNVAASLQRLPGVSINRAGSR
FT                   GEPDGITVRGFAGDFNETLIDGRRISTATGGRSVDFTTVGSDFVGQLAVLKTPDVSLSS
FT                   SSIGATVNISYPKPFDRPGTRVAMSAAGSVQDDAGKIVPTIGGLFSTTFADDTMGILVD
FT                   AVYTRRDTQVNRVYVSGWQGGRFAPCQLAGSTAASCSPTSDTESAAWATPTNRQNVVGW
FT                   YQQQYGADQRYTKDERIDGRIAFQWQPSDDVLLTIDDNYSRQKIVTDISGFGMWFNQGD
FT                   LRNVEQDENGTTINFIQAGTPTDFTAGRDSRLLETNQVGVNLKWDATDNLKFEADASYA
FT                   KSRQNPGNRIGSENGDIGYGGLLGTALGVRVTGDSKNSFPELTTYGPAGDQSRWSDPTI
FT                   IGSHVTVRSVQKNSDEIKQFRLGGTWEDGSFRVKFGGRYMEDRFRLENRNTFANNFWQA
FT                   YAGYGTPSGRNTGVPIPTSLYGRPISLNNWIPGFSGNLPPELLAYDPRAYQEYLEGLGN
FT                   PQTTNIPGFNYADPTVGPNFTGAFDLALDPGSVQDIRERTWSAYVSVNFEHEIAGMPFR
FT                   FNAGVREEITNLTSSGVGRLPIALTGSAADPTLLNVTFSESQPISTKSSYSYLLPSLDL
FT                   KLEVTDNFHLRFDASRTLTRPSLNTLTPVLNVGVGQRVGALTATGGNPRLQPFLADNFD
FT                   FAAEWYYQRNSYAAVNFFIKDVSNFIVAGTQRQTINGVVDPTTGQPAVFTVSQRVNGPS
FT                   ATIKGVELAWQHVFGDSGFGFNANATFVDTNKPYDRTDLSQSGFAVTGLANSANFVGFY
FT                   DKNGFQIRAAVNWRDKYLQAFGQAQNNSAFGAEPTFVNEALQVDLSTSFDITKQLTIFG
FT                   EALNLTNETVSTHGRFSNQLLDVYAYGRRYTAGVRYRF"
FT   CDS_pept        271087..271854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02300"
FT                   /product="SapC-like protein"
FT                   /note="peptide transport system permease protein SapC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98593"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X4"
FT                   /protein_id="BAI98593.1"
FT                   /translation="MRRPHGEKAVRSDRPGTSDRMGEDMETVELLNSELHAALRMRPAH
FT                   QGGDPFVRIVVGEFPAAAVACPLLFSKHAETGAFYAGALMGFRKGEWLIDSPDGRPAFR
FT                   PLEADREGFFALGESIAFDPGHDRFAARFAGQEGESLFDAQGAPTASLKAVQSALGRLM
FT                   ANAEETDAFIAEMLTHRLIEPIDISLNFDDGERLRLDGLYTISLDALGDLDDAAALKLF
FT                   RAGHMQSAYAMIGSLRHIALMARRRNERLAVPA"
FT   CDS_pept        271857..272876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02310"
FT                   /product="Pass1-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98594"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X5"
FT                   /protein_id="BAI98594.1"
FT                   /translation="MGDAAPSVEEFASEDMGSADDLRAFAALCRPAVIRGRFSDWPAVA
FT                   AGRQGGTAALSHIARFAAGSSAEYFIAGAELGGRYHYGEGPGGFNFTRETASIGDALAR
FT                   IAANAESGGETAYLGSLPADSHFPGFAEENPCGLLGAGVHPRLWIGNRSTVACHYDGYD
FT                   NLACVVAGRRRFTLYPPDAIGDLYVGPVDHTLSGQPVSMAAGASDAATAYPRFAAARAR
FT                   AVVIDLAPGDALYLPKLWWHQVEALDHVNILANYWWDGFAAGPDAPYAAMLLAMIAIAE
FT                   RPGPERAAWRAYFDHYVFRPGGHPLAHLPEERHGVLGPLAKGNYGRIRTLVMRMLRGG"
FT   CDS_pept        273039..274994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02320"
FT                   /product="putative sialic acid-specific 9-O-acetylesterase"
FT                   /EC_number="3.1.1.53"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98595"
FT                   /db_xref="GOA:D4Z7X6"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X6"
FT                   /protein_id="BAI98595.1"
FT                   /translation="MFSRHIIRDLGLTVSLAALGAVPASAAPRFDPMFGDHAVIQRDHP
FT                   VTVTGRSDPGEAVSVTLAGEVRQVRADREGRFTAQFGPLATAGPVTLDARAPSGSVVAQ
FT                   DVAVGDVFLCSGQSNMELEVRNAQDAVGQIRASADDQLRMMLVPRAVADDPLRDFRQAP
FT                   SWRPAGPDSVADFSAACYYMARELRKTAGVPIGAIASSWGGSRISPWMGARAQAAVGQA
FT                   AQSALVSLHGRDPFAAERAASAEWEKWWRGATGDAVGKEPWQPGSAIAWQDVPRIGPWE
FT                   EWGVPALADYNGMVWFRREIELTAAQAKQPATLSLGLLDDVGRVWINGKPVAMSARSWQ
FT                   PSSFDVPPGVLKAGRNVLIVNVQDNYANGGLSGPAEAMKLGLGQGGELPLGGGWRYAVP
FT                   ASSPAGAPRVPWGDTTGSGTLYNGMIAPLGSIGLKGVAWYQGESDVDLPGYAERMKAMM
FT                   EDWRRQFGAPDLAFVAVQLAAYGPPATQPVESGWAAMRQVQYQAMARDAHGGLATAIDL
FT                   GDPFDIHPGEKQEVGRRLARAMRAVAYGDPVSRTGPQAARAMATTDGGAAVEFTGLTGG
FT                   LHMRSASQAIGFELCGTEAGSCRFVPGRVEGKRVMLAGDGRPATRVRHAWAESPVVNLY
FT                   DEAPLPVGSFELPITR"
FT   CDS_pept        complement(275010..276905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galA"
FT                   /locus_tag="SJA_C2-02330"
FT                   /product="alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98596"
FT                   /db_xref="GOA:D4Z7X7"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR038637"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X7"
FT                   /protein_id="BAI98596.1"
FT                   /translation="MTLHRFLLPLAALCAGTSLSAQMADPLAPTGRWSAYQAGSAQLPP
FT                   MGWNSWNAFFTHVDEEKLMGSAQRIRDAGLARKGYRYINIDDGWWIRRRASDGRLMIRT
FT                   DKFPSARVKGDPSFRPLTDRLHAMGFKAGIYSDLGRNICSQAYADGSEQLPEGSVAERE
FT                   VGLYGHADQDIRLFFADWGFDAIKVDGCGIRAYAPDAERVRSGQYRALAPLIDQHSISR
FT                   SNIPAVKALFAEINQSLARHNPDGDYMLSLCIWGSANVRSWGKDVGNISRTSDDISPDW
FT                   GRMLTNYDSAARRALYAHPGSWNDPDMLFIGKGDFDANHLIEAKSHFSLWAMMNAPLLI
FT                   GADLRTTPQPLIDIFGNADIIALNQDQAGNQAVMAFDADGFQILVKTLAKGEKAVALFN
FT                   RGLAPVDAILTADHLKFRADRPIALANLWTGERSSFMRDMKLRVAPRETVVFRARGDRT
FT                   LADGLYLSEQPGMVNPAVDGVVQPEPDPTIYHSIPNWRGTRGIGERPMYAGWGGAMADF
FT                   TPYNQPLVIAGKTYGSGIGILANSRLEVHNAGFARFAAQVGVDDSALDGDQAVRFFLYG
FT                   DGRPLASTPPMRRGAPAQAIAADVKGIKLLELVARADGVRGNAVPVSWGDAALLR"
FT   CDS_pept        complement(276902..279235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98597"
FT                   /db_xref="GOA:D4Z7X8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X8"
FT                   /protein_id="BAI98597.1"
FT                   /translation="MSLSRRETMMAMAAGTAALAAARRADAEPAAPHPLTLWYRQPAAA
FT                   WTEALPIGNGRLGAMLFGGVARERLQLNEGTLWAGQPYDPVNPEAKANLPQVRELIFAG
FT                   RIAEAEALADKTLMAKPLAQMPYQTLGDLILDFPGVGQATAYHRELDLDSATATTRFTA
FT                   GGVAHVRQAIASPADNVIAVHLSSTGRLDVDISLRSSQIGVQVAADGPNGLLLTGRNGA
FT                   SRGIDGNLRFAARLAARVEGGHATHSADGSLSIRGAKSVTLLLAMATGFRRFDDVGGDP
FT                   VAGTAATLARARDRSFATIATDAADAHRRLFRRVTLDLGSTPAAQLPTDRRIADSQTSD
FT                   DPALAALYFHYARYLLICSSRPGGQPANLQGLWNDSLDPPWGSKYTININTQMNYWPAE
FT                   PAALGECVAPLVEMVRDLAVTGARTARSMYGARGWVAHHNTDLWRATAPIDGAQFGLWP
FT                   TGGAWLCMHLWDHYDYHRDRAYLASVYPLMAGAARFFLDTLQRDPASGFLVTNPSMSPE
FT                   NPHGHGGTICAGPTMDMAILRDLFTRTMEAAAILDRDASLVAEMRAARDRLAPYRIGRQ
FT                   GQLQEWQQDWDADAPEQNHRHVSHLYGLHPSRQITPDGTPALAAAARRTLEIRGDRATG
FT                   WATAWRINLWARLREGDRAHDILRFLLGPERTYPNMFDAHPPFQIDGNFGGAAGIVEIL
FT                   MDSHGDIIDLLPALPRAWPAGRVTGLRARGRCAVDLHWREGRLDRAILRPELGGPRTLR
FT                   LGAGSRTLVLKAGTPVTLTPKDFA"
FT   CDS_pept        complement(279232..280791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="SJA_C2-02350"
FT                   /product="putative beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="arabinosidase (EC 3.2.1.55)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98598"
FT                   /db_xref="GOA:D4Z7X9"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7X9"
FT                   /protein_id="BAI98598.1"
FT                   /translation="MFRAAALALAASLAAAAPAQVWRSDQGDGTYRNPVLFADYPDPDI
FT                   IRVGEDFYFVSTTFANAPGVTILHSKDLVNWRIASHVVDRLDGDPRYDLKDGGDYRRGF
FT                   YAASLRRHNGMFYLAVTPVGHRTRIYRSAKIEGPWTYSELNREAFDPALFIDADGTAYL
FT                   GTSIGSDGTVTLLTLNDDLTAVTAAKVAYYNKGAEGSKIVRHDGWYYLFNAIPGKLAMT
FT                   VSRSRSLWGPWETKASIDDRTGGHQGAIVDMPDGGWYGFVMVDAGAIGRMTNISPIFWK
FT                   DGWPWWGTPDRPDHVPERSPKPIAGYPFAEPPSSDDFSSRKLGLQWQWNHNPDDGKWSL
FT                   KERPGFLRLHATQADGIWTARNTLTQKAQGPKMRAVAKLDTAGIRPGDICGLGSFGKYS
FT                   AQLSVVGGAKGARSLRMMLTESTTDGPRTEVRVPSTSIAGRMLWLRTDMDFDAKVGRVA
FT                   YSLDNRKWTEVGGSFPLAFDWRTGTFQGQQIALSCYNPAPAGGYLDVDSFTLMPLPQGV
FT                   RP"
FT   CDS_pept        complement(280803..282533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="SJA_C2-02360"
FT                   /product="putative beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="arabinosidase (EC 3.2.1.55)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98599"
FT                   /db_xref="GOA:D4Z7Y0"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y0"
FT                   /protein_id="BAI98599.1"
FT                   /translation="MHATVPHGRRFEERLIVTHRTSRFSALPFALLSLFPAAPAATAAM
FT                   AAPARFDRFTYEGTSMEQVAVRPGEYRNPILTGYYPDPSVMRVGDDYYLVNSSFAHYPG
FT                   LPIFKSKDLVNWTQIGNAIDRPEQLDFNGRRISQAVFAPDISHHDGTFYIVNTCVECGG
FT                   NFVITAKDPAGPWSNPVWLPFEGIDPSIYWEGDKAYIVNNRAPDEPPRYDGHRAIWIQE
FT                   FDWRAGRMVGESTQIVNGGVDIGKQPVWIEGPHIFRKDGYYYLTAAEGGTSVNHSQVVF
FT                   RAKELRGPYIPYEGNPILTQRDLDPARPDMIGSAGHAELVQTQKGDWWATFLAVRPYDA
FT                   DDHYNIGRETFLLPVEWKDGWPIILPRGQAIPHALKAPALPAQPKPPLPTSGDFSYVEE
FT                   FDGQSLPMQWIGIRTPRKPFYRLRGGALELESGAAIGDLGGIPAFIGRRQQHSNATFST
FT                   TLRYRPTKDGDRAGLAAVQSDRSNLFFGLTRIAGKPAVALYTRDAADADTLVASAPVAP
FT                   NGPITLTMRVTGGTMAFDYAVGGRTATLKEGLDATLLSTRKAGGFVGTVVGPYRYTPAS
FT                   "
FT   CDS_pept        complement(282619..284283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnbA"
FT                   /locus_tag="SJA_C2-02370"
FT                   /product="para-nitrobenzyl esterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="carboxylesterase type B"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98600"
FT                   /db_xref="GOA:D4Z7Y1"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y1"
FT                   /protein_id="BAI98600.1"
FT                   /translation="MTGRAMLFDRRQALLASSLGGTAALLAGEAAAATRAAGASGSSGS
FT                   CATPRNAIARTRYGPVRGYVAGDVFTFKGIPYGDDTGGENRWLPARPPKAWTDPYPALA
FT                   YGANCPQTLHSFRAKEHTFLQQWTDGFLGEDMLKLNIWTPSLSGNRPVMVYFHGGGFAF
FT                   GSSYELASHDGAQMARHHDVVQVSINHRLNVLGFLDLTEVGGDPYAESVNVSMTDCIAA
FT                   LRWVQENIAAFGGNPDRIMIYGQSGGASKVTTLMGMPSGKGLIHRAAAQSGGGGNIPTL
FT                   EQSREFSRRVVKELGVGPRDIGALQKMDWATLFAAGNKAADQINGPRAAGGPSASPRVG
FT                   WNPTLDGRVITVRSFFDAAPDASRDVPMLIGNTSEEGMRFGQNPTEAEWRAELAGQYGP
FT                   QRADALIAQMKRDHPEKAIRTLSYGVASLGYRNRIQSMVALRDKQPGSAPMFQYLFQWQ
FT                   SPQLDGVAGAWHTADLAFVFDNSALCDQGTGNTPEARKLARTMATAWANFARTGNPSQP
FT                   GLAWTPTDAVRCRTMIFDNQCRMVDDPEGTARRIILG"
FT   CDS_pept        complement(284427..286061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="SJA_C2-02380"
FT                   /product="xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98601"
FT                   /db_xref="GOA:D4Z7Y2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y2"
FT                   /protein_id="BAI98601.1"
FT                   /translation="MTNISNPILRGFNPDPSILRVGEDFYIATSTFEWYPGVQIHHSRD
FT                   LVNWRLVARPLERAGQLDMRGDPDGCGVWAPDLSHADGRFWLVFTDVKRYGATTVHGAK
FT                   GMSLRDFPNHVVTCETIDGIWSDAAHINSSGFDPALFHDDDGRSWMLNMLWDHRPGRGR
FT                   FAGIQAQQLDRATLKLVGEPTLIFKGTERGFTEGPHIYKRGGFYHLLVAEGGTGWDHAV
FT                   VMARSPDLLGPYEVHPDGAVLTSAGRRDVPIARAGHGDLVELADGSTWLAYLCGRPLPG
FT                   RERCIMGRETAIQPMLWGEDGWLRTVAGDARPDPSPPAPNLPPAPWNAPPWDGRFDDPH
FT                   LPQDLQWLRSPAPERLFSLTERPGFLRLYGRETVGSLFEQALVARRQTAFRFTATTSLS
FT                   FAPRSFQQAAGLIHYYNSTKFYYLCVSAEDGRRQLQLVSASPENPAGNSLDIMVDALPP
FT                   GPIDLRADVDGDRLTFAWRADGEADWHRLPDVHDASILSDEVTLPGLPNFTGAFIGMAC
FT                   QDLSGGGTPADFASFVYREEEFDAPPD"
FT   CDS_pept        complement(286058..287302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exuT"
FT                   /locus_tag="SJA_C2-02390"
FT                   /product="hexuronate transporter"
FT                   /note="MFS transporter, ACS family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98602"
FT                   /db_xref="GOA:D4Z7Y3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y3"
FT                   /protein_id="BAI98602.1"
FT                   /translation="MLTLIGKFRWTIIGLFVGAMVINYLSRSVLGVAAPVILAEQKISS
FT                   VEYGWITGAFQLGVMLQPAAGYFLDSIGLRVGFAICVAAWSIITMAHGLVNGWFGFAAL
FT                   RGLLGLAEGSAQPAGQKLVAEWFPARERGVAGGIYNIGASFGAVFAPPLVAWAVMVHSW
FT                   RLAFVVAGGIGLIWAVLWFVHYNSPTRHRRLGQAERDYILNNQEARLAARPEKPSVLAL
FT                   ARRRDLWGIALPRLLADPVWGMLSFWMPLYLARVRGFDLGQIALFAWLPFLAADLGCLF
FT                   GPAVVAFLQRRGIDLVDARRAAFTLGAVLMTGMAFVGLATNPYAAIALLCLGGFAHQTL
FT                   SVTVITMASDLFARNEVATAAGMAGLAGNLGVLIFSLSLGQMVDRVGYEPFFILLGVLD
FT                   LVGAAILWTMVRKPR"
FT   CDS_pept        287594..288943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02400"
FT                   /product="putative Na+/ H+ antiporter"
FT                   /note="monovalent cation:H+ antiporter-2, CPA2 family /
FT                   Kef-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98603"
FT                   /db_xref="GOA:D4Z7Y4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y4"
FT                   /protein_id="BAI98603.1"
FT                   /translation="MVGEVLSSLTSILAPHGPPVGAKLSSYAPGDYSIHFFLQLALIVV
FT                   ACRGVGWFCRKFLAQPQVVGEMIAGVILGPSLFGLLAPGLQAMVFPRETGNVLYAGAQF
FT                   GVALYMFLVGLTLRLDHFQSKVRNAAMVSGAGLFAPFVMAILITPWLLTVPGLFAEGLG
FT                   RGGATLFMGACIALTAFPMLARIINERGLADSPLGTLSLTAGAFDDAASWCVLAVVLAL
FT                   FGGGSGVAVLAIVGAFLYVSFLLLFGRRLFAPLGRAVEMQGEMSATVLAITLALFCLSA
FT                   FIMDAIGIHGIFGGFILGVFMPRGLFVEELKRKVEPLAVVILLPMFFTYSGLNTRLDMV
FT                   NSLPFLLIAIGILVASILAKFGACYAAARLSGEDNRTALGIGALMNSRGLMELIIINIG
FT                   IQKGIIEPALFSMLVLMAIVTTMMAGPLFEIVYGRRARAEGELGRLGAAT"
FT   CDS_pept        complement(288989..290089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02410"
FT                   /product="glucose-fructose oxidoreductase"
FT                   /note="putative dehydrogenase or related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98604"
FT                   /db_xref="GOA:D4Z7Y5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008354"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y5"
FT                   /protein_id="BAI98604.1"
FT                   /translation="MTTSRREILSGLGAGMVLAGVGTRAGAAPTRRIGYAIVGLGSYAT
FT                   RQIMPNFAGCEHARLVALVSGTPAKLDQYGAQYGIAATHRYSYADFDRIRDNPDIDVVY
FT                   VVLPNSMHAEYSIRAAQAGKHVMCEKPMAVSVAECEAMIAACRKAGTKLMIGYRSRFEP
FT                   YNRLAIELARSGHVGPTRLITAEHGFPARPGQWRLDRPLSGGGSLMDIGIYSLNAARYL
FT                   TGEDPVSVSAVETTDRSDPRFKTVEDRIGFLLRFPSGIVANCISSYSSSHNGYRVIGTQ
FT                   GWIDMEPATPYEGQRMSIRKDGVTTPRTLPAAAKNQFAGQLDHMAECIVSGTTPIVPGE
FT                   EGLADMRVIEAIYRSAAERREVVIRA"
FT   CDS_pept        complement(290286..291242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02420"
FT                   /product="AraC-family transcriptional regulator"
FT                   /note="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98605"
FT                   /db_xref="GOA:D4Z7Y6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y6"
FT                   /protein_id="BAI98605.1"
FT                   /translation="MDPLSDIIALLQPSAAISKPITARGQWGVRYDAHDAPGFTIILAG
FT                   EAWVAFEGRAPLRLAQGDFLLMPSTPPFSLSSEPGLPCILVEPRSEAVRHGDRSGDPDF
FT                   VALGGSFAFERANAPLLLSLLPDLIHIPAAQGRATRFGQLVDMLSDECLSSHPGKELIT
FT                   RRLLEMLLVEALRWRRVGGESGLLGAMRDPALARALQAMHQDVPAPWTVARLASVAGMS
FT                   RSAFAARFGEALGCGPIEYLARWRMAVAKQALLRGDKSLGRIAEEIGYDSASAFSTAFR
FT                   KRMGCPPGSFARLHGRGAPDPVPHIPASPHIGHGATG"
FT   CDS_pept        291340..292089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02430"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98606"
FT                   /db_xref="GOA:D4Z7Y7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y7"
FT                   /protein_id="BAI98606.1"
FT                   /translation="MSKTILITGTSSGYGKATALHFLSRGWNVIATMRRPDPALFGQHA
FT                   ERLRLLPLDVTSEDSIAALVEAAGPVDIVVNNAGIGGVGAFEAMPMSLIRQLFETNSIG
FT                   AMAMCRAFIPQMRERGAGAIVNVTSTVALGAFPLAAAYSATKHAVEGFTASLAHELAYF
FT                   GVRVKLVEPGYAPTTRFGANAIIPVTDLLPGRYADFAQPILAAFAAPALTTRESDVAEA
FT                   VWNAVHDRTDQLRFPAGADAVALAERR"
FT   CDS_pept        complement(292035..292970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02440"
FT                   /product="putative permease"
FT                   /note="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98607"
FT                   /db_xref="GOA:D4Z7Y8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y8"
FT                   /protein_id="BAI98607.1"
FT                   /translation="MRAYAMLGMTMALWAGNAIVGRAMRGEIPPLTLAFSRWMLALLII
FT                   APFAWRRVMAQRALIRRHWGAILFLGLAGVAAFNGFLYSGLRHTTAANGLLLQGLIPTF
FT                   VVIISRIAFGDRAPLRQVAGIALSTLGVTFIVFKGELAEILRLRLGMGDLLVLCGCGAW
FT                   AVYTACLRLRPAIDPLAFLFVTFAIGALTMGIGALGEAQAIARMHWSGSVASAIAYVAI
FT                   FPSIIAYMSFNAAVSHAGAGAAGQTISLLPLFGAVLAALILGEPLFGYHLAGMALILGG
FT                   VLLSWGARAQAGDQRLSASATASAPAGKRS"
FT   CDS_pept        complement(293224..293574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02450"
FT                   /product="hypothetical protein"
FT                   /note="peptidoglycan-associated outer membrane lipoprotein
FT                   / 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98608"
FT                   /db_xref="GOA:D4Z7Y9"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Y9"
FT                   /protein_id="BAI98608.1"
FT                   /translation="MTIRKTMLAIAAAAATLSAAVPATSFARDGGWHRYDRHDRVRYSD
FT                   RRDYRDYRSYRDDRGYRCRKSGGTTGLLLGGVAGALLGRAIDTRGDRAPGTIIGAGAGA
FT                   LAGRAIDRNSSC"
FT   CDS_pept        complement(293678..294694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02460"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98609"
FT                   /db_xref="GOA:D4Z7Z0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z0"
FT                   /protein_id="BAI98609.1"
FT                   /translation="MTTVTIKDVAARAGVSPKTVSRVINGEDHVRPEIREAVQRVVAEL
FT                   NYRPNAFARSLSSSRSYLLGLFIDDPVSGYAADVQHGALLRCRERSYHLVVEPVELNQP
FT                   DWKDHVRASIASLRLDGAIVAPPICDSAELIDLFRESGVPHVLIAPSAEPPDSGAVRMD
FT                   DCGAAREMTDYLIGLGHRHIGLVQGPISHSASARREKGFRAAMAQAGIAVDEDAVLRGD
FT                   FSFRSGLELGEALLDRADRPSAIFACNDDMALGVLITAMKLGIAVPQSLSVAGFDDSAS
FT                   SRAAWPQITTIRQPKAEMAAAAVDILVDPSFRKKSAGPESRLMLPHALVVRGSTGPA"
FT   CDS_pept        complement(294691..295929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02470"
FT                   /product="glucose/galactose transporter"
FT                   /note="fucose permease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98610"
FT                   /db_xref="GOA:D4Z7Z1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z1"
FT                   /protein_id="BAI98610.1"
FT                   /translation="MVAVTSSPPLSGPEQVAARLFRLSIGVFFIGGFLTSSVSLLVPRL
FT                   KLMLDLDYKGALLVQLAFHSSYMLFALPITWAIVRAGYMRAIVAGLAVITAGCLALTLA
FT                   QNALSFAMVLGALLLVSAGQTFLQIASNTVVAVIGPSRGAARRLTLLQGFNSLGTVLGP
FT                   LLSAPLLLGELDAQAARHVGATLPFTGTALVTGLLAFAYFRNRTLLEGDGLRRFAAIGQ
FT                   MFRVMQSPRLRWGTAAIFVYVGAEVAIGALLPAVLMRPDRLDAAPVLAGQLVSLYWGGA
FT                   MAGRFLGAWAMRRIAEARLLTAVSLGAVILTMAAIALPGVAGAGALLAVGLCNAVMYPT
FT                   IYALALPDDERQAPVASMWLCMAVVGGAIVPLLTGALADATALLPALVLPAACYAFIAR
FT                   FAALCARPQETRP"
FT   CDS_pept        296093..298543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02480"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98611"
FT                   /db_xref="GOA:D4Z7Z2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z2"
FT                   /protein_id="BAI98611.1"
FT                   /translation="MMKSIALAAGTALASATLWMTPAFAQDAAAPQAAAQPDYGSDIIV
FT                   TATRRETTLQSTPIAVSAFGQAQLDRQQVKDVTDLARFVPSLQFNQQGDQSAVLLTLRG
FT                   IGNDSAYTEVADPEVAIYVDGIYSPRSQGASVLMYDMERVEVLRGPQGTLFGRNATVGA
FT                   LSLISAKPKLGEFGGNVEVVAGNYDRLGVRGAINIPVTDTLAFRVAFVTDRHDGYADFQ
FT                   PAPDVPGINRSAFVTTGKKYYAADQQSGRVSMLWQPGERFSWNLSAEGFLDNGAPVIGL
FT                   LQTPRPGTKRWSTLSDTAPDTDRYSVAVRSTMNYDVTDGIQLSYIAGWSRIGGSTQTDA
FT                   DAGALPPTGQFDADGNDLPLGAFGENRTLSSRYDFQSHELQVKSTGEQAIDWILGAYYS
FT                   HEKNRIRFDIDQRNGYRDGSFSWAGSFIQANRQIDSRAVFGQAVWHVSDAIRVTGGLRY
FT                   TSDKKEDIGGRNVTFSGCPATLPPGACQGGIFGAYPNATADELVALLPGFSISSNDVKG
FT                   KWDKLTYLARVDADLAEDVLGYASISTGFKSGNIQDNAGLTDPETLTNYEVGLKSRFLD
FT                   RRVTLNLAAYYSDFKGYQVNQAVTFRDDQGNVVRSQMITQNAKGAKAYGLEAELSANLT
FT                   DNDRLQFSGTLQKTKLEELESVDGRLYDGGKLSSIAQLKGNELAHAPRFSATLSYEHDF
FT                   ELASGAKITPRFTTHYETKSWLSYFNGDANPFVNPNDPADNMPDRGTNGTDWDRQKAYF
FT                   RSDASIRFLSPDQKYSVEAFVQNIENGKIRTGAGAFGAPRYDPVFLSNLQPPRTWGVRA
FT                   RANF"
FT   CDS_pept        298776..301034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="SJA_C2-02490"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98612"
FT                   /db_xref="GOA:D4Z7Z3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z3"
FT                   /protein_id="BAI98612.1"
FT                   /translation="MTRKLLIASLLLGVAGMAHARTPPSTVAGSNRALPAEARAQALVA
FT                   AMTREEKLAIIHGYFPPLAKPAEPIAMIPSAGHIVGIPRLGIPTLRESDASLGVANQVE
FT                   QRKGDTATALPASLATAATFNPALAYAGGAMIGAEARAKSFNILLAGGVNLTRDPWNGR
FT                   NFEYLGEDPLLAGVMAGEHIRGVQSNHIVSTIKHFALNSQETGRTVLDARIGKAALRES
FT                   DLLAFQIATEIGDPASVMCAYNKVNGDYACENDWLLNSVLKQDWGYKGWVMSDWGAVHS
FT                   TEKAALGGLDQESGQELDDAIHFGKPFADALNAGRIPAARLDDMVRRILYGVIASGLMD
FT                   DPVPESPRQIDYAAHADIAQRAAEEGIVLLKNEGDLLPLAKSARRIVLIGGHADVGVLS
FT                   GGGSSQVRSVGGAPVEIPLTKGAAASFARMTWHASSPLNAIRALAPQAEVSYVDGSDPR
FT                   AAAEAARRADLAIVFGWQWQTEAQDPETMRLPDNQDALIDAVATANRKTIVVLETGGPV
FT                   EMPWIARVPALVQAWYPGQRGGEAIANILFGDVAPSGRLPITFPVRADQAPRPEPAGLA
FT                   ELHAAEARRDAGDKTNYGMTGGVAPFTVDYPEGAEVGYRWYAMKGVKPLFPFGHGLTYT
FT                   RFAYANLQVQDGAALTVSFDVTNAGSRPGADVPQLYVQARGSAGIAAWRLAGFDKISLS
FT                   PGETRRVTMTVDPRLIARFEEGKGWRLDGGDYALAVGHHAGDATLKGVAKLDALSLKP"
FT   CDS_pept        301184..303664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02500"
FT                   /product="glucan 1,4-beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98613"
FT                   /db_xref="GOA:D4Z7Z4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR041443"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z4"
FT                   /protein_id="BAI98613.1"
FT                   /translation="MTTGLSPVSLTALTLLLATAATAQQQPAASVAHPDLWPKVAAQPK
FT                   RDPAVERRVEALLKSMSVEDKVGQIIQVDIGSITPADVRTYKIGSVLNGGNSGPYGDEY
FT                   ASPAKWLQLADEYYDASMARADKGPKIPIIWGTDSVHGNNNIVGATLFPHNIGLGAARD
FT                   PDLIREIGRITALETAAAGLDWTFAPTLAVVQDDRWGRTYESYGEEPQIAADYAGAMIE
FT                   GVQGRVGTKDFLAPDHLIATTKHFLGDGGTGGRDQGDTKVPEEVLRDVHLGGYPAAIEA
FT                   GTQSVMASFSSWNGEKMSGNASLLTGVLKDRMGFDGFVVGDWNSHGQVPGCSNEDCPQA
FT                   INAGLDMFMYSGPGWKQLYDNTLREAKDGTIPAARLDDAVRRILRVKVRAGTFDRGRPS
FT                   ARAFAGKFDAIGSADHRAVARRAVRESLVLLKNEGVLPLKPNADILVAGEAADSISQQA
FT                   GGWSITWQGIDVPNSAFPNAQSIWKGIEEVVKAGGGTARYAPDGRFTQRPDAAILVFGE
FT                   KPYAEFKGDVPNLEYSPGDKRDLETLRRFKAAGVPVVAVFLSGRPLWVNAELNASDAFV
FT                   AAFLPGSEGGGVADLLFAGPDGKPRHDFRGKLSFSWPKRPDQYVLNRRDPGYDPLFPFG
FT                   YGLSYARPGKVGKLDESRPAGMAAATPGTFYGRGQTPPGWSIEAEGVTQSGVDRRAQED
FT                   SRRFVWKGAGQVAFTAPRAVDLSRESNGEISLVVEYRVDAKPAGRLTAGLQGGGKTVEL
FT                   PIANSISSARAGEWTRLAVPLQCFAKRGADMRAVTAPLVLRSDGAADISISDVKLDYVS
FT                   MPMDACGDAVPGGE"
FT   CDS_pept        303759..303956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98614"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z5"
FT                   /protein_id="BAI98614.1"
FT                   /translation="MQNDGQRDESSQDPAEGRNDVPPPEKGSPGGEADQADDEAAERVE
FT                   KAEDSDPNPLAPPVNTEAGS"
FT   CDS_pept        complement(304265..304492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98615"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z6"
FT                   /protein_id="BAI98615.1"
FT                   /translation="MTADKLVELIVARLVRDHGRSKHHWRRLVGPIRLYSRATHPHCNW
FT                   AAAPIGTFQEIAAIETLLDDWRLRYPLLSD"
FT   CDS_pept        complement(304482..304685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98616"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z7"
FT                   /protein_id="BAI98616.1"
FT                   /translation="MTDGIRDILDRLRAPGDNVVARARRMVEAHVPEERRGPGWDRHWR
FT                   ELEAYLALPGQWPCAEGKENDG"
FT   CDS_pept        304879..305532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02540"
FT                   /product="hypothetical protein"
FT                   /note="putative esterase of the alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98617"
FT                   /db_xref="GOA:D4Z7Z8"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z8"
FT                   /protein_id="BAI98617.1"
FT                   /translation="MRPNATELIASATILTVPGLMNSGPGHWQTIWEVELPHCRRAELG
FT                   SWDAPQRNSWIGHLNHAIDRIDGPVILAAHSLGCHAVAWWAAFECREWSEKIAGALLVA
FT                   PPELDSGAVDPRLRGFAPTPKALLPFPSILVASRNDPYISFGRARLLAQFWGSRFADAG
FT                   EAGHINADSALGDWAFGRFLLSRLGQPFEEQDMDSQQIAGERERSAEATLLYGV"
FT   CDS_pept        complement(305559..307544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02550"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98618"
FT                   /db_xref="GOA:D4Z7Z9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z7Z9"
FT                   /protein_id="BAI98618.1"
FT                   /translation="MQWKIMAAGLVAAHAAPALAGTEAAEAEIVVFGRGEAKIGVAHAA
FT                   SEGSVAGSDLLVRPLLRVAELLEAVPGMVAAQHSGSGKANQYFLRGFNLDHGSDFTAYI
FT                   DGVQMNFRSHGHGQGYLDLNGLIPEIIAREDFRKGPYRADGGDFALAGAAYMETIDGFD
FT                   RPWMSAEGGSYGSRRIAAGGTIKGVGPGELTLVAQAKAYDGPWQEAEHLRHYAGFAKYR
FT                   AGAVEATLHAYRATWRPTEQIPERIVGSPVCADIFCSPDPSARGQTTRFVGNVAVTQAD
FT                   WRANAYAQYYDWSMHSNPTYADPDGSSAQIRQYDRRWIFGATAAKRWSLGSALDLSIGT
FT                   EDRYDHIGNVGVSRTADRAFLSSLGRYHVEELSLALYGEATWRPLPGVRLIAGLRGDHY
FT                   RYAVRARDAAAAALGEGEGSDSLLSPKASLAYRLAPMLELYANWGRGFHSNDVRGAVNV
FT                   DTPVPLLVRGTGKELGGRVQIGSASLTATYWWLNVGSELRFVGDSNAVEPTGASRRHGY
FT                   EIVAFWRPLPWLALDGNYTASHSRYDNGDRIPNAFENAASAGAAVVLGRWETSLRLRHL
FT                   GPYPLIEDNSARDKGSTIVSARGAWKGKRIELYGELLNIFDSRDKDIAYHYESYIPAFD
FT                   AAGPQEGRLSRVVEPRTIRLGMKIRL"
FT   misc_binding    complement(307722..307965)
FT                   /bound_moiety="cobalamin"
FT                   /note="Cobalamin riboswitch"
FT                   /note="predicted by Rfam (RF00174), score 117.14"
FT   rRNA            308550..310040
FT                   /locus_tag="SJA_C2-r0040"
FT                   /product="16S ribosomal RNA"
FT   tRNA            310310..310386
FT                   /locus_tag="SJA_C2-t0030"
FT                   /product="tRNA-Ile (GAT)"
FT   tRNA            310396..310471
FT                   /locus_tag="SJA_C2-t0040"
FT                   /product="tRNA-Ala (TGC)"
FT   rRNA            310877..313670
FT                   /locus_tag="SJA_C2-r0050"
FT                   /product="23S ribosomal RNA"
FT   misc_feature    312700..312725
FT                   /note="recognition site for restriction enzyme I-CeuI"
FT   rRNA            313816..313933
FT                   /locus_tag="SJA_C2-r0060"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        313965..314297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98619"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z800"
FT                   /protein_id="BAI98619.1"
FT                   /translation="MSMRSTAQCTPQRAIQRTTTTIRNINTPGLHQGRRSAESSVGRQR
FT                   RGPIIVRCAPELVLRNSSAASRKFRHGHVRRRVLHNQPARQPAFGLGEDQQDQARQSHP
FT                   ILAAGC"
FT   CDS_pept        314469..316340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kup"
FT                   /locus_tag="SJA_C2-02570"
FT                   /product="KUP system potassium uptake protein"
FT                   /note="K+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98620"
FT                   /db_xref="GOA:D4Z801"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z801"
FT                   /protein_id="BAI98620.1"
FT                   /translation="MGHSHPQEKLSLLTLGALGVVFGDIGTSPLYALKESFVGHHPLAV
FT                   DSAHIYGVLSLVFWTMTLIVTVKYVFIIMRADNHGEGGSMALLALISRKLGESRWTPTI
FT                   AILGVLAAALFYGDAIITPAVSVLSAVEGLETVNDGLTPFVLPIAIVILTGLFLIQKHG
FT                   TARVGALFGPIMAVYFLVLAALGILNIARHPGIVAIVNPMWAIHFFALDAKLAFLALGS
FT                   VVLAVTGAEALYADMGHFGRKAISIAWLYAAFPCLLLNYMGQGALLLDLPAAAENPFFL
FT                   LAPEWARLPLVILATIATVIASQAVISGAFSVTQQAVQLGFLPRLKIAHTSAAAAGQIY
FT                   VPLVNWALLFLVVLLVLGFQSSSNLAAAYGIAVTGTMVITTCMMAVLTFSVWRWNRLLA
FT                   AGVTGLFLTVDGAYFLSNATKIPDGGWFPLWVAAVVFVILTTWSTGRKIMNFYLLEGAM
FT                   DVELFIQSVSGSLKRVPGTAIFLNSRVEGVPPALLHNVKHNKILHERVIILTVRTEGVP
FT                   HLPLTGRSEVTDLGSGFYRVVLRHGFMEEVDIPAAMKAVEGCGGPINVSQTSYFLSRQT
FT                   LIPSEKPGMAIWREKLFAWMMRNAVTPMDFFKLPTNRVVELGSQVEI"
FT   CDS_pept        316638..317702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02580"
FT                   /product="putative naringenin-chalcone synthase"
FT                   /EC_number="2.3.1.74"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98621"
FT                   /db_xref="GOA:D4Z802"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z802"
FT                   /protein_id="BAI98621.1"
FT                   /translation="MTDTCARINAIGCAVPALDMHGPFIRWATGQLDDPRERRMFQRMA
FT                   ERSGIEHRWCALPPTAEGGSPVDPGGFYAGDRPPTSLRMRCYADHAPRLAMEAIARLKA
FT                   LVPLDGISHLVVASCTGFVAPGIDQIIAERLGLEGVERTLVGFMGCYAAVAALRTARHI
FT                   VRSEPDARVLVVTVELSSLHFQPERQIERLLMMLQFGDGAAAALVTGEGAGVAIDRPFS
FT                   LNLPDSAELIRWDIGDSGFVMHLSGEVPARIQAALGDPSVRRRLWGSDDMAGIDRWAVH
FT                   AGGRSILDAVEQGLELGRDALAPSRAVLARFGNMSSSTLMFILRDMMEGAGQGVALAFG
FT                   PGLAAEGFRFERLA"
FT   CDS_pept        317699..318832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02590"
FT                   /product="putative oxidoreductase"
FT                   /note="FAD-dependent oxidoreductase/dehydrogenase
FT                   (flavoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98622"
FT                   /db_xref="GOA:D4Z803"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z803"
FT                   /protein_id="BAI98622.1"
FT                   /translation="MTARLPALVVGGGPAGAAAAIALARAGTQVHLIDRQGGPHDGVCG
FT                   GFLGWDALAALADLGVDAFALGARPIRRLRLLADGRRMELPLPHVAAGLSRRVLDEALI
FT                   GRAAQAGAVVQRGRAVRAADPAARSIRFDDGGQLAGDALFLATGKHELRGLARDLAGCR
FT                   EAPCVGLRATLSGSADLAGVIEMHLFDGGYAGLLLQEDGAANLCLSVARDRLSDGVPAM
FT                   MRAIMAQAPHLAERMGGKMPPSFDAIAGVPYGWRAAASVPGIFRIGDQGAVIASLAGDG
FT                   IAIALHSGTSAAQAYLRGGPQAAMGWQGQWRRRSRRPLAIAEALRRGAAGPWGRGLLMR
FT                   LLGLMPGLGVQAALLTRISAPRTGGRKSGARSAHRPG"
FT   CDS_pept        complement(318762..319499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02600"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,
FT                   4-benzoquinol methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98623"
FT                   /db_xref="GOA:D4Z804"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z804"
FT                   /protein_id="BAI98623.1"
FT                   /translation="MKICYDAGEKRGHMADLSIRSRQEEQMDAPDLDPAVYERVLHDLA
FT                   RVNRWTFTAWPAIAFLNRAIGSARHFRLLDVGFGDGDVLRAVARWARRRGIEAELIGVD
FT                   LNEKSLAAARHATPPDLAIDYRAGDYLDQPERFDFIISSQVTHHMTDAQLMTFLRHMEA
FT                   EARMGWLVCDLHRHGFSYWGFPLLARLLRVHRIVREDGRLSIARSFRPGDWAALLPEAG
FT                   ISLDDVRIVRRFSFRLCVERICG"
FT   CDS_pept        complement(319569..321008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprN"
FT                   /locus_tag="SJA_C2-02610"
FT                   /product="outer membrane protein OprN"
FT                   /note="RND family efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98624"
FT                   /db_xref="GOA:D4Z805"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z805"
FT                   /protein_id="BAI98624.1"
FT                   /translation="MRFPQTVLPSAILALLALAACTAGPDYHGPEAARPVSPAAQFARA
FT                   PTDASAQAPASAAWWTALGDPVLDALESRALAANPGVAVAEARVRQARASLRTERANAL
FT                   PNVNASALYVHATVPGVDLGSSEEDSSEGGDSQSLNFYNLGFDASWEVDLWGGRRRGME
FT                   AARAEVEAAQANVADAQVSLTAEIAQAYVNLRDRQQRIALAQQAAARQREMLRLTEQRH
FT                   AQGTASALEVEQQRNQLEQSDAALLPLSAERDAYLNALATLAGEAPGALDAMLAAPAPV
FT                   PLPPAQVAVGDPAALLRRRPDIRAAERRFAAATARIGVAEAARFPSLSFMGLIGIGGTD
FT                   PGDLVDLDTLAAIAMPRLSWSFLDFGRNAARVGQAEGARDEAAAQYRQAVLNALRDSED
FT                   ALSRFGARRLSVASAARSKASADRAAALVRQRFEAGTATRIQLLDAERQSLAAAQALTQ
FT                   GTAAMTADYIALQKALGLGWR"
FT   CDS_pept        complement(321019..322575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02620"
FT                   /product="putative MFS permease"
FT                   /note="probable multidrug resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98625"
FT                   /db_xref="GOA:D4Z806"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z806"
FT                   /protein_id="BAI98625.1"
FT                   /translation="MNATAASAAPPQPERADTAAWLAVIAGSLGAMMATLDISIVNSAL
FT                   PTIQGEIGASGTEGTWIATSYLVAEIIIIPLAAWLERLLGLRTLLLAAAFLFTGFSMLC
FT                   GVAGDLTTMVIGRVGQGFTGGALIPTAMTIIATRLPRSQQPIGNALFGVTAILGPVLGP
FT                   LVGGWLTENISWHYAFFLNLPVGILLITLLLATMPHQKPRLSEFRQADWLGIAGMALGL
FT                   GGLTIVLEEGQREQWFQSSEIVLMSIVSGVGFILLFAGQYFAKRPVIRLKLLLDRQFGA
FT                   VALMGLVIGMMLYGTAFVIPQFLAAIAGYDALQSGRIVLLSGIPSLMLMPLTPLLIRHL
FT                   DIRIAVGAGLLIMATSCWVDTVLTNQAVGHDFVESQLLRGIGSVFGFLFLNQAAIASVP
FT                   REDAGDAAGLFNAVRNLGGSLALAGIATIQDQRSWLHSRRMEESLSANSGQVQDYIGGL
FT                   AHSLGGQDAALRSLSGTIQREALVMTYNDIFTMLAVGIIAVLPLVLFLRPLPKGQAVAM
FT                   H"
FT   CDS_pept        complement(322572..323723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02630"
FT                   /product="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98626"
FT                   /db_xref="GOA:D4Z807"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z807"
FT                   /protein_id="BAI98626.1"
FT                   /translation="MASSSPHGDDSGQSRPSALKSPRTRLILLIAALALIGGGVLWFIR
FT                   FETFGKYQESTNDAYIQADSITVAPKVSGYVDRVFVEENQDVRAGQPLVQIDPRDYRAQ
FT                   AAQSVAQIDVARANAAGVVAQIAEQRAAIAQAEADLNAANANAAFAASEVERYRPLAAS
FT                   GAETRERLSELQNQAIQARARAAAARATLTSAQKRIATLQTQVRQAEAQGEAARAQLSA
FT                   ASTNVEATILRAAADGRIGDKSVRQGQFVQAASRLMTLVPKASLYVEANFKETQLGLMR
FT                   VGQPVKIEVDALPGVELPGRVASIAPGTGAQFSVLPPQNATGNFTKIVQRIPVRIAVSA
FT                   GPETRKLLVPGMSVEVSVDTRSARNAAAQIRREQERHNARIGR"
FT   CDS_pept        323818..324249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02640"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98627"
FT                   /db_xref="GOA:D4Z808"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z808"
FT                   /protein_id="BAI98627.1"
FT                   /translation="MNGADEQLLTDLFRVITLIRRSFDRAMTEQGASLAQTKILMCIKA
FT                   QMGMARAADVAEIMNLAPRTVTEALDGLEREGLIQRVPDKEDRRVKRLAITPAGEAAVA
FT                   VTEPLRVELGARLLNALTPSDRRHFHAALQKLLQGLADA"
FT   CDS_pept        324253..324432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98628"
FT                   /db_xref="GOA:D4Z809"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z809"
FT                   /protein_id="BAI98628.1"
FT                   /translation="MIRAIFSVIIAWSTGISPAAGESAMERMHYSMCQCSVGLLSLCSA
FT                   SALALTGTLYILLH"
FT   CDS_pept        complement(324497..326350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="SJA_C2-02660"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98629"
FT                   /db_xref="GOA:D4Z810"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z810"
FT                   /protein_id="BAI98629.1"
FT                   /translation="MPHYRSRTSTHGRNMAGARGLWRATGMKDEDFGKPIIAIANSFTQ
FT                   FVPGHVHLKDLGQLVAREIEAAGGVAKEFNTIAVDDGIAMGHDGMLYSLPSRDLIADSV
FT                   EYMVNAHTADALVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTELRGKTVALD
FT                   LVDAMVVAADDSYTDEEVKVIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSTL
FT                   ATHADREKLFLEAGRTIVDLAKRWYEQDDASALPRNIATFAAFENAMSLDIAMGGSTNT
FT                   VLHLLAAAYEGGVDFTMADIDRLSRRVPCLCKVAPAKNDVHMEDVHRAGGIMAILGELE
FT                   RAGLVDATLPTVHAPTLGDALNRWDIGRTNSEEVRNFFRAAPGGVRTTQAFSQNARWEE
FT                   LDTDRETGVIRSAEHPFSKDGGLAVLFGNIAPEGCIVKTAGVDESILTFHGTARVYESQ
FT                   DAAVAGILGNEVKAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSKGLGKACALITDGRFS
FT                   GGTSGLSIGHVSPEAAEGGLIALVATGDPILIDIPNRVIRLDLDDAVIAARKAEMEGRG
FT                   AKAWKPLGRKRNVSPALRAYAALTTNAARGAVRDVGQVEKD"
FT   CDS_pept        326443..327357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02670"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98630"
FT                   /db_xref="GOA:D4Z811"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z811"
FT                   /protein_id="BAI98630.1"
FT                   /translation="MNDMDLRQLNHFLAVAEELHFGRAAERLGMTQPPLSQSIMALERE
FT                   LGAPLFTRTKRQVALTPFGRQWLEHVRPAVGAVADLAAAARRLRAGTVGRLALSFVSSA
FT                   DYSILPALVRRYANAFPDVDMTLMEATSDVQVEALVEGRTDAGLLIPPASGLPAAIDYR
FT                   PLLREPLVAAVPENWAKDGRLLVEEGRLAGESWLDQPLLLFPRHVSPTFHDLIVDHYRV
FT                   RGREPHVRQRAIQMQTIISLVSADMGLALVPASLRNLARTGVRYLPLAGPAPLLETGLA
FT                   WRRSDEAPTLRALLGIALDMAEG"
FT   CDS_pept        complement(327363..328160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02680"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98631"
FT                   /db_xref="GOA:D4Z812"
FT                   /db_xref="InterPro:IPR018692"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z812"
FT                   /protein_id="BAI98631.1"
FT                   /translation="MAMAHPSQAASAGKDISVRTITFDDLRIALRQGWDDFLAKRGDLL
FT                   FIGFIYPIIVALAIMSASQMSILPLIFPLVAGAILLGPAFASGFYELARRREAGLDARW
FT                   RHFLDVIRKPGGSALFDLTCVLALLFMAWMAAAWFIYHATLENVPGSTSSPGAFLSALF
FT                   GTSQGWRMIVVGNLVGFGFALLTLAVSVVSFPMAVDKPVNWGVAVRTSCRVAWHNPVTV
FT                   AAWGLIVVALLVLGALPALVGLAVVLPVLGYATWHLYTRAVVR"
FT   CDS_pept        328510..329511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02690"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98632"
FT                   /db_xref="GOA:D4Z813"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z813"
FT                   /protein_id="BAI98632.1"
FT                   /translation="MDKSRRSTRTPCTHIVITGASSGIGQATAEAFAGRGAKLVLAARD
FT                   GEALEAVAERCRRAGAGVLTVPLDIADAEAVRQLAQSARDFCGSIDLWFSNVGVGAVGK
FT                   FVDVPIEAHERTIRSNLIGHMNDAHAVLPVFMAQRHGIFVNMISLGGLTGTPHAAAYGA
FT                   SKFGLRGFSEALRAEMTEWPDIHICDVYPAFVDTPALRHAGNYTGKALTAPPPMLDPRR
FT                   VVAAIVGLADRPRDSVLLGAPTWFVRFAHPLAPSLLSRIGNLAFGRYFASAERAPVSRG
FT                   NLFDPPRDSGGIDGGFRKPAPERRRAVLSAGAGVAAGVLLLGLLSARRSFGR"
FT   CDS_pept        329516..330430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="SJA_C2-02700"
FT                   /product="thioredoxin reductase (NADPH)"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98633"
FT                   /db_xref="GOA:D4Z814"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z814"
FT                   /protein_id="BAI98633.1"
FT                   /translation="MTAPLDCLVVGAGPAGLTAAIYLARFHLRIAIVDAGNSRAALIPH
FT                   TRNHAGYPGGISGRELLALMRRQAAEFGGEVTEGLVTGLEKDGDIFLAHVETGAWQARS
FT                   VLLATGVVNNAPPMSPDIHDAALRQGLLRYCPICDGYEATDRRIAVIGTGERGANEAMF
FT                   LRTYSADISLISPQGDHELSADQRIRLEEAGVALVNGPCEPLRIEGERILVPTPNGAEA
FT                   YDTAYPALGSIIRSELAMMLGAEATDDGCLVVDDHQRTSVPGLYAAGDVAKGLDQISHA
FT                   MGEGGVAATTIRNDLAARISLLR"
FT   CDS_pept        330492..330641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98634"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z815"
FT                   /protein_id="BAI98634.1"
FT                   /translation="MGLSAAETAPRVLVSPSVMAVPGPSPGMPSGTVPAVVLLGAKLES
FT                   PESV"
FT   CDS_pept        331074..331622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98635"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z816"
FT                   /protein_id="BAI98635.1"
FT                   /translation="MFYQPDLFEQSPPPSSPSSRRGAAALPDLVERISTVSKRPRYALL
FT                   VLKLIAQEAGSHDSVGPYVGSGKGRVPVRDWLCQALAPLAQRDCRRRAMIDAVRADLIS
FT                   RAGMVDPEEMERRLEQEVRSRILRSGRTNVSRVVSDLVRAGLLRRHYQGYRVDHPNRGA
FT                   QREAVYTITAEAKRALQRH"
FT   repeat_region   331772..333881
FT                   /note="insertion sequence:ISSj04"
FT   repeat_region   331772..332931
FT                   /note="insertion sequence:ISSj01"
FT   repeat_region   331772..331805
FT                   /rpt_type=INVERTED
FT   CDS_pept        331844..332845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02730"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative, IS30 family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98636"
FT                   /db_xref="GOA:D4YY48"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY48"
FT                   /protein_id="BAI98636.1"
FT                   /translation="MEGYQHLGLDERRDIYRLIGTGRTVKQVADALRRHPSTIYREIKR
FT                   NRHFDEEPLFRGYFPTAAQTMASNRRVRGGKIARQPELAAYIADRLLAAWSPEQIAGYL
FT                   RRHRGQREAVCHETIYQYVYGAEGRHHKLWRHLPVARRSRRQRYGRKPRGLHIPVANTI
FT                   GARPQEIADRSSFGHWEGDLLIFRREYGKANLTSLVERCSRFTFLTRNPSRHSAGVMAG
FT                   IDRHLRDMPPPLRRSITFDRGTEFAAFATLRNRLGITSYFCLPSAPWQKGGVENCNGRI
FT                   RRFLPSDTDLALLSDREIQAVADRLNSTPRKCLGYRTPHEVLGEQIALLKAG"
FT   repeat_region   332899..332931
FT                   /rpt_type=INVERTED
FT   CDS_pept        333268..333795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02740"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative, IS30 family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98637"
FT                   /db_xref="GOA:D4Z0B1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z0B1"
FT                   /protein_id="BAI98637.1"
FT                   /translation="MANTIGARPQEIADRSSFGHWEGDLLIFRREYGKANLTSLVERCS
FT                   RFTFLTRNPSRHSAGVMAGIDRHLRDMPPPLRRSITFDRGTEFAAFATLRNRLGITSYF
FT                   CLPSAPWQKGGVENCNGRIRRFLPSDTDLALLSDREIQAVADRLNSTPRKCLGYRTPHE
FT                   VLGEQIALLKAG"
FT   CDS_pept        complement(333847..333993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98638"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z819"
FT                   /protein_id="BAI98638.1"
FT                   /translation="MRIDPCRRNDRLIQAAKALSRKGQGIFFANHNCLFVIGRFRFEVR
FT                   HPL"
FT   repeat_region   333849..333881
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(334012..334302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98639"
FT                   /db_xref="GOA:D4Z820"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z820"
FT                   /protein_id="BAI98639.1"
FT                   /translation="MAEVHRDRYTDDRVVVHKHRSGRTIAILLIVILAIAGILFATGFW
FT                   KADVSGGDVPEVSVKGGELPKVDVDSKAVVVGSKKETIDVPTVGVKNNGEE"
FT   CDS_pept        334489..334812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98640"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z821"
FT                   /protein_id="BAI98640.1"
FT                   /translation="MKTGFCALALAIGLALLPVPAHADDPNDPTMRSAAARARDRATIK
FT                   RMNQQQLAYVRQRDARIMQNYRQAQGQREGYADARDEYARRMAEWRRAVAACNAGRWEY
FT                   CDD"
FT   CDS_pept        complement(334948..335814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02780"
FT                   /product="OmpA-family protein"
FT                   /note="outer membrane protein or related
FT                   peptidoglycan-associated (lipo)protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98641"
FT                   /db_xref="GOA:D4Z822"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z822"
FT                   /protein_id="BAI98641.1"
FT                   /translation="MSVVSNNPKYLFVLALLAGASSASVAAQTQEAPAADVSATAYLPA
FT                   EKTAGPEIKGIISARSGDKMQVTAADGTKSVIAINDATKISASKGLFGLNRNRLAATSL
FT                   LNGLPVTVKTLQSGEGLVASQINLQNKDLKTASMIHNGTAQGFEEQTAATAALRGRMGE
FT                   IDQYNVKSTTNVNFDTGKAVLSAQAKNDLCATAATAEGMSNALLLVVGYTDSTGDDEFN
FT                   QELSEKRAGRVVNYLQQACGWKPYRMLTPTGMAEADPVASNDTIEGKAQNRRVAVNILV
FT                   SKGLDGL"
FT   CDS_pept        complement(335814..336095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98642"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z823"
FT                   /protein_id="BAI98642.1"
FT                   /translation="MHRSICIGHFHRFVAVCAPIAYATDGMHRIVHVAERSASTGRMSM
FT                   AFIRDVMRHILGRQMEGVLTAEYAITRPAVGRKAAIMQARLTDFGGVT"
FT   CDS_pept        complement(336377..337174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02800"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98643"
FT                   /db_xref="GOA:D4Z824"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z824"
FT                   /protein_id="BAI98643.1"
FT                   /translation="MTGRFHGKSVVVTGAGSGIGRATARLFAGEGARVIAFDLSEGVEE
FT                   TAAGQERIVAMRGDAGSAGDVQALIAAAVRDLGGVDIIAANAGISGGLAGLFEQTAEDW
FT                   AKILEVNLIGPFLAIRHGAEAMINAGRPGSIICTASVAGLRAGAGGPAYSASKAGVINL
FT                   VQTAAQQLTGTGIRVNAVCPGLVETGMTQSLYDAARAKGREEMIGQLNPTQRGGEPREL
FT                   AEAIAFLASDQASYINGHALVVDGGLSTSHPFAKPRKLGVTTF"
FT   CDS_pept        complement(337171..337947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbr"
FT                   /locus_tag="SJA_C2-02810"
FT                   /product="carbonyl reductase (NADPH)"
FT                   /EC_number="1.1.1.184"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98644"
FT                   /db_xref="GOA:D4Z825"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z825"
FT                   /protein_id="BAI98644.1"
FT                   /translation="MDLFDLSGKTAIITGSSRGIGRAIAEAFAEAGANVVISSRKQQAC
FT                   EEVAAAINARCGTERAVAIAASISDKAALHAMVEQTREHFGQIDVLVCNAASNPYYGPM
FT                   SGITDEQFRKIFDNNVLANHWLIGAVAPQMQQRKDGSIIIISSIGGLIGSDVIGAYNVS
FT                   KAADFQLVRNLAVEFGPHNVRVNAIAPGVIRTDFARALWEDPKAEAELRRVTPLGRIGE
FT                   PENIAGTAVFLASKAAEYVTGQAIVVDGGTTIKGAL"
FT   CDS_pept        complement(337977..339014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02820"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98645"
FT                   /db_xref="GOA:D4Z826"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z826"
FT                   /protein_id="BAI98645.1"
FT                   /translation="MSDLDEASLARWMARAVPDFQGLGRIGKFPGGQSNPTYRIEAGER
FT                   TYVLRRQPFGDLLPSAHAVDREYRLMSALHPAGFPVPRPVALCEDRNVAGALFYMMEMV
FT                   DGRSFWNGALPEIGKGERRAFYEAMIDALARLHSLDHEKIGLGGFGRAGNYFERQVGRW
FT                   TKQYRAAQTGHIPEMEKLIEWLPRTVPRQTRNSIIHGDFRIDNLIFAKDRPKVLAVIDW
FT                   ELATIGDPLADFAYLAMNWIMPADGRSWLGGLDLEGEGLMTLDQAMDRYCDAAGCGPLP
FT                   DLSWHFAYNLFRMAGILQGVKKRMADGNASSSEAEVMVAKIEPLASEAWRRACMAGALD
FT                   PTVNS"
FT   CDS_pept        complement(339011..340255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd"
FT                   /locus_tag="SJA_C2-02830"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98646"
FT                   /db_xref="GOA:D4Z827"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z827"
FT                   /protein_id="BAI98646.1"
FT                   /translation="MDFSFTERQTRYRDAVRQFIEGEVRPLVHAHEAELAEGDRWAPLD
FT                   LIETLKRKAQAAGLWNLFLPPSNGHAHVDDSFLFSGERLTNLEYALCAEEMGRIHWASE
FT                   VFNCSAPDTGNMEVLHKYGTRAQKDRWLKPLMDGAIRSAFLMTEPEVASSDATNIRTSI
FT                   DRDGDDYVVNGRKWWSSGAGDPRCKIAILMGKTDPAAARHEQQSMLLLPLDTPGVTIRR
FT                   NLSVFGYDDAPHGHSEILLDNVRVPAGNLLLGEGRGFEIAQGRLGPGRIHHCMRTIGAA
FT                   EEALDMMSRRLLSRSAFGKAIAEHSVWEERVANARIEIEMTRLLCLKAADMMDKAGNKA
FT                   ARNEIAMIKVQAPAMALRIVDDAIQAHGAAGVSPDFELARIWAGLRTMRIVDGPDEVHR
FT                   RAIARAEFSRHRDRR"
FT   CDS_pept        340457..341707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02840"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98647"
FT                   /db_xref="GOA:D4Z828"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z828"
FT                   /protein_id="BAI98647.1"
FT                   /translation="MMTDAKADSAALEGPSAPPLSRFERQRGKILDAATMLLNQRGIAG
FT                   MTLQEVAEQLGLKTTAVTYYFRYKEQLVRAVFEDSLQRLKEMVEQAGKADTPRARVDQY
FT                   LRIHFDHYAAAMQGKTRPLAILSEMRALEGAARAALMQQYQAVFRGVRAFFGPADTAAR
FT                   KLRLTARTQMLNEVVFWSAIWLKQYDVGDFDTVRRQLFDILDGGIATRPSRALPAALGT
FT                   GEAVAAGDSYSQFLRTATRLMNEVGYRGTSIDRIAAELNLTKGSFYHHLPTKDELILQC
FT                   FRNSYQRLRDLREQARKAGLDAWETLISVIAQAMKYQFGEDYPLLRTTAFQALPDSVRQ
FT                   IPYEHAQRTTLLFSGLLVDSVREGAAKNVNPLLASHIIMSTINSASDIRSWAAKQDRDD
FT                   AVADCLSAITRGIFHPA"
FT   CDS_pept        complement(341730..342332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02850"
FT                   /product="putative acetyltransferase"
FT                   /note="histone acetyltransferase HPA2 or related
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98648"
FT                   /db_xref="GOA:D4Z829"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z829"
FT                   /protein_id="BAI98648.1"
FT                   /translation="MTQADLATPLRIERIGRDDMSLRALATLRMTVFRGWPYLYDGSLD
FT                   YEAGYLSDFLSDETAVLVVARLGDIPVGMATASPMATQGDAVKAPFLAAGIDVRSLFYF
FT                   GESVLLPQFRGLGVGHRFFDEREAAARSAGATGATFCAVDRDRDHPARPSETRDLTPFW
FT                   TSRGYRMAPHLAMTMRWKEVGQPEESDHLMRFWLKSL"
FT   CDS_pept        complement(342329..342457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98649"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z830"
FT                   /protein_id="BAI98649.1"
FT                   /translation="MAPMFANGRDGAGAALQAEAGPPLMPIRYQGPDERLDQVRAG"
FT   CDS_pept        complement(342461..343318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02870"
FT                   /product="putative esterase"
FT                   /note="esterase D"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98650"
FT                   /db_xref="GOA:D4Z831"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z831"
FT                   /protein_id="BAI98650.1"
FT                   /translation="MEQVSASKAFGGVQGVYRHASGSTGTDMTFSVYVPPHDEGAKLPV
FT                   VWYLSGLTCTHANVTEKGEFRAACAELGLIFVAPDTSPRGPDRNGGAVADDPQGAYDFG
FT                   LGAGFYVDATQAPFAAHYRMWSYVTRELPALVAANFPADMARQSIMGHSMGGHGALTIG
FT                   LTHAARYKAVSAFAPIVAPGQVPWGRKALAGYLGDDQAAWRRHDAVALIEDGARVPALL
FT                   VDQGTADNFLEQELRPELLKAACEAAGIDLTLNLREGYDHSYYFISTFMADHLRWHAAR
FT                   LGRD"
FT   CDS_pept        complement(343387..344499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="SJA_C2-02880"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="class III"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98651"
FT                   /db_xref="GOA:D4Z832"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z832"
FT                   /protein_id="BAI98651.1"
FT                   /translation="MKTRAAVAFEAKKPLEIVEVDLEGPKAGEVLVEIMATGICHTDAY
FT                   TLDGFDSEGIFPSILGHEGAGIVREVGAGVTSVKPGDHVIPLYTPECRQCKSCLSGKTN
FT                   LCTAIRATQGKGLMPDGTTRFSYKGQPIFHYMGCSTFSNFTVLPEIAVAKIREDAPFQS
FT                   SCYVGCGVTTGVGAVVNTAKVQAGENVVVFGLGGIGLNVIQGAKMVGADKIVGIDINPD
FT                   REEWGRRFGMTHFINSRGLSREETVARILEVTDGGADYSFDATGNTEVMRTALECCHRG
FT                   WGESIIIGVAEAGKEISTRPFQLVTGRVWKGTAFGGAKGRTDVPRIVDWYMNGKIEIDP
FT                   MITHVLTLEEINKGFDLMHAGESIRSVVLF"
FT   CDS_pept        344641..345576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02890"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98652"
FT                   /db_xref="GOA:D4Z833"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z833"
FT                   /protein_id="BAI98652.1"
FT                   /translation="MSNWDGIDEFISVATAGSFTRGARALGVSTTHVSRSIMALEQRVQ
FT                   ALLFHRTTRTVRLTDTGRVFFERCERIAKDRDEAIALIGERSEPQGELRVTCSTAMGER
FT                   FVAPIIRRFAMQHPKLAVSIELSNRVIDLVGEGFDVAVRTGTVNDPRLIATRVASRTLY
FT                   TCAAPSYLASAGRPASVEALAGHECIAGSASTWHFKVDGQEVIHRPKGRFRCNSGHAVM
FT                   EACISGLGICQLPDFYILPYLKHGMVELLLEDVQPDDEPIWAVYPQRRHLLPKVRQVVD
FT                   CLLRELGPAMNPPRREEAIRPGAWAEGSGI"
FT   CDS_pept        complement(345591..346436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02900"
FT                   /product="putative metallophosphoesterase"
FT                   /note="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98653"
FT                   /db_xref="GOA:D4Z834"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z834"
FT                   /protein_id="BAI98653.1"
FT                   /translation="MLIAQVTDIHLGFDPENPAEFNRKRLDQVLRALNDGPNRPDLLLA
FT                   TGDLTDRGDPDSYRRLANAFGQCDFPVWPCMGNHDDRAHFAAHFPHIPQNDGFVHYVIA
FT                   QDGRRIIMLDTLEPGRHGGAFCERRAQWLAARLDEDDVTPTLIVMHHPPVEVGIDWMNT
FT                   HPEEPWVGRFAATIAGRPNLHAILCGHIHRSVVAPWKGTTIAICSSTAPQLALDMRPMD
FT                   PDAPDNRPMIVADPPAYALHRWTGNGLITHFETADDHVMLAKFDAGMQPLVRTLMDERP
FT                   "
FT   CDS_pept        complement(346482..348308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98654"
FT                   /db_xref="GOA:D4Z835"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z835"
FT                   /protein_id="BAI98654.1"
FT                   /translation="MSFLVRQISLTADGREIVRAAMIAKPQLSLGRAAESDIHLPDLAL
FT                   EPDHARIEQVGERAIRVRATGTLGFELEGRTVLRAEIEPAQGAELRFGGHRITVSRDDD
FT                   GEAEGATILSIRRVDAVSEASEEKEETKVFSLRGLLPGKRLTAWALALAILVGFLAVPI
FT                   WSYAGRPADDTRNIYTVVGDKSWSSGPLSQAHHALEGRCETCHQKAFVSVRDSACQTCH
FT                   KDAHDHAPAARIAMARAEEGLGGKLLAGVASAFGKPPEGACVDCHREHEGAGPMQPTPQ
FT                   AFCADCHGTLKDRLKDTKLGDAADFGTSHPQFSALVQTRPGKHPRFARASLDSRPMDDG
FT                   GLKFPHDIHLSATGGVAKMARTMKAQYGFGDALACKDCHRPTADGVRFLPVDMERDCQM
FT                   CHSLAFETIGGTVRTLRHGQPDQAIADLRAYFRSTGPAQPPALGGMARRRPGDYAQGRI
FT                   YHAYFGAAAARPSRADDAVRAVFSKGGACYDCHTITPPGANGNAGWQVLPVHQPMRYMM
FT                   NGWFDHAAHRTEKCESCHAAPKSHDARQLLLPGIDSCRTCHGGEKAKADVPSGCAMCHS
FT                   YHVGDGAPWAPANRSIGKDAADRPRKFDSPSG"
FT   CDS_pept        complement(348316..349194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98655"
FT                   /db_xref="GOA:D4Z836"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z836"
FT                   /protein_id="BAI98655.1"
FT                   /translation="MATRAANPARPAKGEVLHDGFLRHAGFRWLKIATLICVLSIASYM
FT                   LVDITPRHNGGSWYGYAMGTIGMLLILWLTLLGLRKRAMTGGRWSLKAWTSAHVYLGLS
FT                   LIVVATLHTGFQLGWNVHTLAYALMMLVIFSGLFGITVYATLPAALSNNRAEMTQVQML
FT                   DAVRAIDRQLHDAAQPLTHEQAALVRQSLEDDPFGGGLLARLSGRYPRCATARAQAALR
FT                   RWTGEKPDTGNDPLERIDALLERKQAMLARLRRHLKLKALLEIWLYVHVPATFALLAAL
FT                   TAHVVSVFFYW"
FT   CDS_pept        complement(349194..351707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02930"
FT                   /product="iron-sulfur protein"
FT                   /note="putative small subunit of hydrogenase-3, iron-sulfur
FT                   protein / Fe-S-cluster-containing hydrogenase component 2 /
FT                   cAMP-dependent protein kinase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98656"
FT                   /db_xref="GOA:D4Z837"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z837"
FT                   /protein_id="BAI98656.1"
FT                   /translation="MRIAIVGSGPAGLSAAARAAALGLSHLLIEKTDHLSDTIFKYQKG
FT                   KHVMATPSQLVLRSDCDFEAGRRESILDRWNAQAAEQGVNVAYNAEVKAIAGTGDPIPG
FT                   SIQKIVERKRDGTSETKEIQRLAPPYRLTLSDGREVIADAVIMAIGTQGNPNLMRAPGA
FT                   DLPHVQYQLDDPAEYNDEHIFVVGTGDAGIENALGLAADEAQGNVVTILNRSTEFASAK
FT                   AANVKALMAAAEAGRLAIMTETTTAKVEPGFVTLDSRDGEVKLKCDRIIARMGSAPPRA
FT                   FVESCGIEFTSGDRLAFPKLSPVFESTAPGIFVIGALAGYPLIKHCMNQGYDVVEYING
FT                   NRDLKPADEPILAAKFAGLPEKKGVAEWLEHLRANVSILEGLSPLQMREFMLDSEVRAY
FT                   RRGDVIFEKFDPGSSLFGIARGQALVEVAPGVEVPIEQGSIFGEVGLISGRRRGATVRA
FT                   GADSIMVEVSRTAALKLMSSNPPAKRAITRISTERQLLQMFGAGLTPADLADILDTAEI
FT                   RTVKAGEAILTEGDLGNDIYVIRVGSMIVEKKIGGKNVFLSYLPAGSYVGEMALIAGGP
FT                   RTATVKATVKSEVIRLNGDAFARLMAAKPALLERARRDMAARQDVNAFIESRKDSFSTV
FT                   VDMYSETAKFLVDNGIGEATDVLLIDEHLCVGCDNCEKACADSHDGLSRLDREAGRTYA
FT                   HLHVPTSCRHCEHPHCMADCPPNAIHRGPDGEVFIDETCIGCGNCQRNCPYGVIRMDSV
FT                   PPKKPGLLSWMFLGAGPGPGEPSKKWRYKNAEPGVEKPKKAIKCDMCSGIDGGPACVRA
FT                   CPTGAAIRVAPEDFLTVARLGGEAR"
FT   CDS_pept        351876..352781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02940"
FT                   /product="TPR repeat protein"
FT                   /note="cytochrome c biogenesis factor"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98657"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z838"
FT                   /protein_id="BAI98657.1"
FT                   /translation="MGAVGIAAISIGYRVSQAPEETKAPALPSPLANRGVPDPEAAIRA
FT                   LQDRVGANPNDAEGWQRLGWAYFESGRHADAVRAYRHATKLAPGNATFWSSLGEAAVMA
FT                   SERDPMPKEAADAFDRAVTIDPKDPRARYFQAVRKDLAKDHEGAIRDWLALLGDTPPGA
FT                   PWEADLRRTIEQVGKINGIDVAGRLAAVKPSAPHPPMGVGMSVAAAAIPGPSREQMQAA
FT                   AQLPKGQQDAMVEGMVARLEARLKADPGNVDGWIMLMRSRMTLGETGKAAAAYAQARAA
FT                   NPAQAGRIRDEARILGVPGA"
FT   CDS_pept        complement(352791..356768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02950"
FT                   /product="LVIVD repeat protein precursor"
FT                   /note="multihaem cytochrome precursor / cytochrome c family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98658"
FT                   /db_xref="GOA:D4Z839"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z839"
FT                   /protein_id="BAI98658.1"
FT                   /translation="MTVMAVLAALLLPVAILHASDAEKPVERHYTPAPPAPMSQTAEQV
FT                   AAKSDGCYSCHSKTDEPSMHATPAVMLGCTDCHGGNAAVRGDPALGFEDPAYVAARERA
FT                   HVLPRYPKSWHYPSSANPQRTYTLLNREAPEFVRFVNPSDYRVARDACGSCHMQVIEAA
FT                   ERSLMASGAMLWGGAAYNNGIVPFKNYIFGEAYTRDGKPAKIVSPGSPPGTLTADQKAR
FT                   GALAELYPLPTWQVIPPGDVFRVFERGGRNIGTQFPEIGLPNPTGSIQRLEEPGRPDLK
FT                   QSNRGPGTGLRVAIPALNIHKTRLNDPYMWFMGTNDQPGDYRHSGCSGCHVVYANDREP
FT                   RHSLIYAQYGRDGQTATVDPTIAAKTSHGGLKGPHGETVKPDHPASPEHPVGAVKESGH
FT                   PIRHAFTRAIPTAQCMNCHMHQPNIFLNSYLGYTMWDYESDAPLMWPEKQKYPTAAQVH
FT                   ETLERNPEGASPRGKWADLEFLRNVYDLNDKAKDTQFADYHGHGWNFRGVFKRDREGNL
FT                   LDADGKIVSPDDPEKWRRKGEEKFVPVGTNPGKSVHLMDIHAEKGLQCADCHFAQDSHG
FT                   NGFIYGEVANAIEIGCKDCHGTADAYPTLLTSGPAAPPKGTNLALLRNPDGKRRFEWYY
FT                   DASGRQRLIQRSIVDPKLEWEVSLVKDSVDPANPHFNAKAARAKLMSRSGAEDGSFAFG
FT                   PGVAKADRAHGDDTMACFTCHLSWTTSCGGCHLPIEANWKTSLHHYDGEETRNFATYNP
FT                   QVARDEMFQLGKHMTTKGNETAPVRSTSALVLSSTNINRERIYIQQPPVSGIGFSSQAF
FT                   APHFPHTVRRTETKTCSDCHLSAKDDNNAIMSQLLLLGTNFVNFVGLNAWTGLEGGFEA
FT                   IRVTEWDEPQAVIGSYLQKYAYPDYWKLHVEQNKRELKDWVRGKYFDRKASGETQAVEE
FT                   FRNVAKGTAGRVGCLQLRGEYMYVAEGRGGFRVYDVASIANKGFSEPIVSGPFSKLGHD
FT                   AGIRTKNATCMALPTNQPVNPLRNTPELRRINQEQPFLPIYSYAAVTDSVEGLIMVNVE
FT                   TMADGEFRNNFLKRAVTWNPDGVLNGARHIQLAGQIAYITADVGLVVVDLSDPLHPRLA
FT                   AVRPMKDARASAIQFRYLWVTDAEGLKLFDVTKLTDPVAVPSATVPLADARRIYPARTY
FT                   AYVAAKSNGLAIIDITNPLRPAVYAKETFGGQMTDVEDVIVGTTNASLFAYVADGRNGL
FT                   KVIQLTSPASQPNFYGFSPAPKPELIAWARTPSPALALSKGLDRDRAVDETGGQIAVFG
FT                   RLGSRPFTRSEMERLFLTSKGIPYKVSDEADMKGWRPPLLR"
FT   CDS_pept        complement(356882..358705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98659"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z840"
FT                   /protein_id="BAI98659.1"
FT                   /translation="MGLTALLPLFALAQPGEPVPPPPPENWREILDADGQSIEGRRRPG
FT                   YEAPLPDAVTQDNKGAVRAPPPEAFPTDQVPIPDRWRLIESLGVVKERWFDPYHQNTLK
FT                   GDRPIDREKAKWLPIRGDDWFFVANAVSDTVLEPRTFPIPVGVQTTERPGSLDVFGKDA
FT                   SVVFSQTFIGGVALIKGATAFKPPEIEYRLTLALNVNHVNVPERRVLFVQPSRPSHRTD
FT                   HFLGVQEAFVDYHLANTSDRYDFRSVRVGIQPFQSDFRGFLFNDQQLGIRLFGNRDNNR
FT                   FQFNLAAFWRLEKDTNSGLNSVVQSPRRDWIFLANLYRQDFLVPGLTSQITAVYNMNRE
FT                   KRDVEIDDNGFPVRPALLGDLRGREYDVVYLGYNADGRIGRVNLTASLYGALGEDRNSF
FT                   FTSKPAQIRAFFAAAEASVDRDWMRFRLSGLYASGDGDPYDNRENGFDAIFENPVFAGA
FT                   DTSYWIRQTIPFAGGGRVIAINGRNGILNSLRSSKEQGQSNFNNPGTMLLGAGADFDLM
FT                   PELRVSANANHLWFQNTATLQVLRNEGSIPKAIGWDLSTAAIWRPHATQNIVFRLSGAT
FT                   LLPGTGFRDLFTNSERNRNYYSVLANLILSY"
FT   CDS_pept        complement(358709..360688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98660"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z841"
FT                   /protein_id="BAI98660.1"
FT                   /translation="MKGRHHRLGALATIAALILSSCGGGGGGGGGGGSTPTPGPTTPTP
FT                   TSLYAAPAQEALTVADVESVVAHAVAEARARNLPSVIAVTDRVGNVLAVFRMTGARASA
FT                   TTSAAPNGDNIDAQNLTVPAEAGAIAKAITGAYLSSGGNAFSTRTASMIVQQHFPPAPT
FT                   TAGLESGPLFGVQFSQLPCSDLAARFLSSGAMAMIGPKRSPLGLAADPGGFPLYKNGVV
FT                   VGGVGVMADGVYGSDANILDDDNDPEEYIALAGTLGFEAPEGVRANRITVDGTSLRYSD
FT                   AAYSGLMAAGAVSFAAINGSAGSLVAVRGYYGDPAPTILAGVAYGTEASGVRRARTAEF
FT                   SKSDAFVLSDGLGNDRFPIRAGTDAGDVAQPLTAAEATAILEEAFTVMGRARAQIRQPL
FT                   DSRAQVTISLVDTRGQALGIVRSPDAPIFGTDVSLQKARTAAFFSNSHAASDLLASSSA
FT                   DVAAFVGKARTFLNDPAALTGRYAFTDRANGNLSRPYFPDGEVGRPNGPFSRPIAQFNP
FT                   FSTGLQSALVVGDLAAHLAYVTGASASDTPQRCSAVPTVSGQNRVQNGIQIFPGSVPIY
FT                   RGNVLVGAIGVSGDGIDQDDMIGFLGLNNAGARVGGFGNAPAAIRSDQIVVDLGNANVR
FT                   LRYVQCPIAPFLDSSTNDACPVGL"
FT   CDS_pept        complement(360685..362076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98661"
FT                   /db_xref="GOA:D4Z842"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z842"
FT                   /protein_id="BAI98661.1"
FT                   /translation="MGGGKGRAIGRSVGGMALLAMLLGVLLLCLPGGRSDAAPAARTYV
FT                   GVASCAGSTCHGRMEGDGKVVRQDELMRWQEPSTPGGAHSRAFAVLNGRRGQQIAATLG
FT                   LGDAASAPACLGCHSTPARARGARFLAQDGVGCEACHGAASGWIASHYAVGASHAANVA
FT                   AGMTPLDRPQARASVCLDCHFGSAREGQFVDHRIMAAGHPRISFELDLFSSMQAHHDED
FT                   ADYAQRKGRTDSLKLWAVGQAMAVERALTLYAGAKGTEGAFPEFYFFDCQSCHRRIYDQ
FT                   AERSKTWEANPGRPIPAGMPPFNDENMIMLSAAARVAAPGLAVRFDADSRAFHAAIARD
FT                   RTAVVAAAGRLAGSARALADAFAAGGPGGGMQGDMAFAIVREIAGSAISARFTDYEGSV
FT                   QAVMAVDTLLNGMVKSGRVTVGAAAGIRAEVNRAYAAVKEPNAYRPAEFRSALGSAARS
FT                   IGALQ"
FT   CDS_pept        complement(362185..368499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-02990"
FT                   /product="putative outer membrane autotransporter"
FT                   /note="filamentous haemagglutinin family outer membrane
FT                   protein precursor / PE-PGRS family protein / fibroin heavy
FT                   chain precursor / autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98662"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z843"
FT                   /protein_id="BAI98662.1"
FT                   /translation="MTRKHGAFSLWTLLGRTSAVALAVGLGAGAAIGQKAFQGSYSTSP
FT                   DVFISQGALPNTDTVSLNSAQAVIDWTPDDRGPASAGTIDFLPQGSTVTFSSFSDFTVL
FT                   NRILPLDGNGLPVSRVIAFNGTVQSRIGGNPPITGGAVWFYSPGGIIAGANSVFNVGSL
FT                   VLTTNAIDISNGLDRNNIRFAGTAGSTSSVELLAGAQINAPSSGSYVALVAPRVVQGGT
FT                   VTVNGSTAYVGAEAADIRINNGLFDIAITAGTTDADGVVHSGTTTGPESVDGNDMQRVF
FT                   MVAVPKNNALTMLLSGNVGYTPATAVTPDGSAIVLSAGSDIAHDTGGNLVATRNATTTA
FT                   EAGFSIGSGDWQNDLTGTATGDIVIRPTATAHFLGNVALSAERGITLRADQSAAIAADK
FT                   DMILTAGSGAAGGRIDLLAFGGSGAALTNGQIDVTGNLRLNASGDGEAGVSATPLVGGD
FT                   ASGGTINLIATGGSIAAASLVANAVGYAGYGSDRSGNAAGGAITLSALTAAGPSGTEGG
FT                   SLSFGSTTLDASAGTAFQVSVPPVDGGDAIGGTIALNGAAGAVIAGGLDLGAVSATAQA
FT                   TGGIASTGAAGDATGGDIRVAISGGTHEWASFFADTSTAPGHATEGGSYGAAIPGVTGI
FT                   DIDVGGTGSLNILTSVSLYADARAFGGGASGGALRAGRINIAAHDGGSFAIAEDLFATA
FT                   DAYGFAAYPGSSFLTPGTADALGGAIGIGAAGGSFSAAELHVSASGFAGDAPGVAGTGT
FT                   GGSVTLFASASGGRRGSFSLGDCTGSCSIHADGGGGAGANGSNGTGGSVLLYASDADFS
FT                   ALGELSLHAHGIGGGTAYDDAAGRGGDGLGGSVTVESRLGAAGSGDLRFGNLLLSAEGA
FT                   SAPSSEGMSFNGGDAGNGTGGSANVILSGGSLTADLVDAGADGFGGAAGENCPDCEGGG
FT                   TTSFRAGNGQGGSAGFLISGGTATLGALALSAQGLGGEAEGASSPQSAAAIAGAGFGGD
FT                   ALLESRGGTLDLTTLAIDASGVGGAGYPVFQADGADGGAGTGGAAGLLMTAGSSGQVAI
FT                   TGSAIVRASGTGGAGAVAESGGPGNYRAGMGGSGTGGGADVTLAGGALTAPSLQILAEG
FT                   VGGAGGNNGSDDAAGAAGDGLGGAASFSYLSEGHAIGAVTVKADGRGGLAGDSGFLSFD
FT                   NNNNPIFFTGTTPGGAGGRGTGGSATMLVDVDPLFASLTVSADGIGSMGGSGGTGGAGG
FT                   AGTGGAALLDLSFGATTVSGALRVTARGLGGTGGTGHDGSGGRGGDAFGGGATFGLTGS
FT                   STLLDAGDIGVLAEAIGGSGGQSGVRSGAGLAGADGGDANGGAALLDLRSGAAAVTGLA
FT                   LRISGNATGGNGAIGTAGPVGGNGGAGGNALAGSATLQIADARMALGSALPQMPAYSIT
FT                   AVGQGGNGADGSAGGNAGLTGGLGGSGGNGAGGIAAFQAGNGDYALGGLSLVADGRGGL
FT                   GGMGGSGPGGASAAGATGLGSGGTASFANGDGGVLSPGAQRRIGALLMSASGDAGGLVR
FT                   FTDSSTAANGGLIVDGSVALSSLGAPIAGLSGISISAANAVRIGGDADFTSDGPLSFAF
FT                   AGAGGMAATGALTGQSGTHIDLSHDGRPQGSHSLFADSILFTAPGNVSMLSAGAMRAAG
FT                   DLTILAGGHIDLANGSAAVAGGDLTLSGQGIDAFGLTSGGASMLDAGAGNLVVTDIASA
FT                   GAITAAGALVNLGSSGAMNVAQAIASTGPLTLNAGGPLSLSGLASGGIITIGASDIVIG
FT                   GAAQVGSLGGTSRVVFNAVNLQQPAYIGGGDVAGAYSLSMAELARVAAAEIAINAQARG
FT                   IAGSPDLIVQDLTLGAANLASGGVLAIGTGGHLRVQGAVRLTGRSGQGGLTLSAGRALE
FT                   IVAGAGLIDISDGNGGLGGVLTLDSPSIIAASPSAMADIASANSLIARELRLAQNDGWV
FT                   DDAGILRAGTIRVNASQGFFIQNSGLSSAILDRRGFTANELSIASQGTALQIAINGQLA
FT                   LPTGGFAQGLETIPLVAVNGAYALGSKVNGCLIGNPAACTSAGFDSRDTWNGVLDPSVS
FT                   VSRIFTLSLIELRDIVAQGYPPLIDEPVTGAGNEDLWERSCGGPDEPACDAPQ"
FT   CDS_pept        complement(368499..370283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03000"
FT                   /product="putative hemolysin activation/secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98663"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z844"
FT                   /protein_id="BAI98663.1"
FT                   /translation="MRASALGGSAAVALALTAPMAAAQVAPRAPTREELTRGQLTDEAA
FT                   AQASRLTVVGGVERAPCPLADPRYAGVQVDFADVRFDGLRVVDPAALEDSWREYAGREV
FT                   PIATLCEVRDRAATMLRQMGYLAAVQVPPQRIEKGGTVRFDIFMARLVAIEVRGDAGNG
FT                   ERLIAGHMEALKGQPVFNVRDAERHLLLARDLPGYDVRLALRPAGTAPGEVVGEVQVVR
FT                   QRVELDVNVQNYGSNAVGRFGGLARVRFNDMTGMGDSTLFSIFNTVQPSEQTVLQVGHG
FT                   MALGSDGLRLSGDLTYAWSKPGIGGLPLSSETMIATAALAYPLARRQVHTLLATGGLDI
FT                   VNQDLRFGAATPKVPLSRDRLRVLFLRLEGELVDPDSIVSTIGYSGMEPKWRLGGMLEM
FT                   RQGIDGLGASDACGAAFVNCASPRTPISQLDGDPSAFVLRASAQAEYRPTPNVAFALSP
FT                   RVQYSPDALLSYEQMSAGNYTTGRGYDPGVITGDSGVGVAAELRYGRIAPREPGAVALQ
FT                   PFVFFDAAWMWHRSANFVGLDPQKLYSAGGGLRATWDNHARLDLTLATPLRKAGFQTER
FT                   GGTRLLLSLTTQILPWRR"
FT   CDS_pept        complement(370438..371181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98664"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z845"
FT                   /protein_id="BAI98664.1"
FT                   /translation="MVWGRFAAKCALAGCVAGLGAQAAAETMVVRATGPSAATYKPGSK
FT                   LADGGSIALKAGDVVTLLDARGTRTLRGPGSFNVAAANAAPANSVMLSALLDTKRVRRA
FT                   RTGAVRGSVGEAPPAAPRRPNLWMVDVAQSGTLCIADPASVRLWRADASKPATIGISGE
FT                   GVQATASFRMGESVAPWPVAAPVREGAAYRLSDGSRAADVRFALIDPASLGLDGVASGL
FT                   IAHQCMAQLDLLVETATLSDRAARN"
FT   CDS_pept        complement(371168..373207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03020"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="adenylate cyclase, family 3 (some proteins contain
FT                   HAMP domain) / guanylate cyclase (EC 4.6.1.2)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98665"
FT                   /db_xref="GOA:D4Z846"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z846"
FT                   /protein_id="BAI98665.1"
FT                   /translation="MPTRGLMRRGARLVRDTGRWRLAATGALLLLALFLAGWDWNRPLG
FT                   RGTAREIPTADAERGVYDWRAASFAPRVAQDHRILMLVYDDQTLIATRKRSPLDRGLLA
FT                   RALRNIDAMGAKSIGIDILFDQPQDEDGELLSVLRAMRTPVWLGYANLGDNQEQIIFEQ
FT                   QQFLDRFIRAARTDKVRPASIRLETDSDNVARSWPVPTPGQPPLLTLAMQPSPSFRDYR
FT                   GAIRFRLPVRQADGSEEPVIPSLQIDTLADPAMAPALAAMVRGRHVLIGGDIVDIDQFE
FT                   TPLSGRQARSTMIGLEVHATMLAQLLDGARLAAVPEGWRWLAALLVVGAAGLTSLAELR
FT                   WFALLPALAVQAGAIAGVPLWLQARGWDTKGLPAVGWVLGWVLAFTAIGVAARAVTSQQ
FT                   RRFAQAALGKYLPRDIAAQILAEPEKLALHGEKRQIFTLFTDLEGFTKLSHAIAPEMVA
FT                   QLLNRYLDMLSDVVLAHGGTIDKFVGDAVVAFWGAPIARPDDGRNAALAAQAMWQAGEA
FT                   FRRDLPPGVPPIGRTRVGLHHGEAIVGNFGGEGRIQYTALGDSMNTASRLEAANKALET
FT                   NVLASREAMLLSGLDWWRPMGRVRLRGRSTPVDLFEPAPEFPAEERAALARILAAFDGE
FT                   DAVAQDAARERLKAMVNRHPDDAAMANLLYRYEYIGEGGSYGLG"
FT   CDS_pept        complement(373213..376146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03030"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98666"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z847"
FT                   /protein_id="BAI98666.1"
FT                   /translation="MFDRAWTLVCRDAARPVGQIYALRRGADKDDGALQDRLAASRREA
FT                   IECNAPGGVTLPGIGSALMRNCAGAVGAYRILAVKRGKTIYVAQGYAAYASALDLGLRS
FT                   VMAGRIVPGRVDIATVGTNDAGYARLQAATLDPQTVLAEGYRRNASGNYAEAAEFFDSL
FT                   TDRLARDPDAAKLTPAERANRAHEYLVNRGLQLSNLGLFDQAEAAFAEARRIVTADAVQ
FT                   VRLRRNFEAMHHINRQDSAGALAILDRPLTSGATASAGGDGAVSLPPEVAAEMSSGAAQ
FT                   ARALGVRQDNMLTPVERSAILDAQAQQLRGTILRLSGQPGPAREVLTKALASAVAIRDG
FT                   RVTSITRLRAQLLGEIALTHEAQADYGQAERQLNQALALLGAQYPETVALNGARARLGA
FT                   FLIRRGRNEDALKIYRGIIASTMENRATLTGMANQLQPYFNLLAREIPTRPELTADLFA
FT                   ASQTLLRPGAADTLEQLSRELSAGDGEAARLFRQSVSLSRDIERGRIALAQLRQAAQGR
FT                   EALLPDVVQAQADIDQLAADQAHTLAALAAYPQYRALSPQGLTLAEMQATLKPGEGYYK
FT                   LAQLGDALYALWIDGAGATGYRLAASATDVARKVAALRETISIDVNGVQTTYALDVPAA
FT                   RSLYLDLFGPVEQRLAAARHLIFEPDGAMLQLPVNLLVAGQAGVDAYEARVAQGGDEFD
FT                   FRGIAWLGRDHAVSTALSARAFRDARAAAPSGAAQSYIGFGDNAPLAGPVLAASSRGGL
FT                   TSGAADDCGWSPLQWNRPIPATELREAAQAIGGLGNELITGAAFTDEAVMARGDLDRFR
FT                   ILHFATHGLVTPPHPGCPARPALLTSFAPDRKSDGLLQFSEIFDLRLNADLVVLSACDT
FT                   AGAAGAETTRAAGLSGGGGALDGLVRAFIGAGSRAVIASHWPAPEDYRATERLMGGLFA
FT                   APADQPMAEALRAAQARLMDDAETSHPFYWSGFAIIGDGARPLIARR"
FT   CDS_pept        376591..376833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98667"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z848"
FT                   /protein_id="BAI98667.1"
FT                   /translation="MLNMPWDQPATMIDLDGKAPIIGTIRDCAQHFAIFKPHAKEQARI
FT                   LLTQPVHREGRKTRTWVLEPWEIEKLVERLRAEVH"
FT   misc_binding    376989..377219
FT                   /bound_moiety="cobalamin"
FT                   /note="Cobalamin riboswitch"
FT                   /note="predicted by Rfam (RF00174), score 110.58"
FT   CDS_pept        377371..378444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nixA"
FT                   /locus_tag="SJA_C2-03050"
FT                   /product="high-affinity nickel-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98668"
FT                   /db_xref="GOA:D4Z849"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z849"
FT                   /protein_id="BAI98668.1"
FT                   /translation="MTISSHAPAGRLRRRAAGMFAGLLAANLAGWIAAFAIFAGDPVML
FT                   GTALLAWSLGLRHAVDADHIAAIDNATRKLMQDGQRPLAVGFWFAIGHSGIVLIAAVLI
FT                   AFAANALSRVEAAGAIGGTIATIGSATFLFAIAAMNLIILRSVLKTFNHVRRGGAYVDE
FT                   DMDMLLGSRGLLSRLFRPLFRLVTRSWHMAPLGFLFGLGFDTATEVAILGLSAGQAASG
FT                   LSIATVLIFPLLFAAGMALIDTADGALMMGAYRWAFVKPIRKLYYNITITLASALVALL
FT                   IGGIEAAALLGDRLGLRGGAWTLAADLGDHFNSLGFVIIGLFAACWLLSWAIYRWRGFD
FT                   EIEVASIAGHQAQGNPA"
FT   CDS_pept        378441..379481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobW"
FT                   /locus_tag="SJA_C2-03060"
FT                   /product="cobalamin biosynthesis protein CobW"
FT                   /note="putative GTPase (G3E family)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98669"
FT                   /db_xref="GOA:D4Z850"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR012824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z850"
FT                   /protein_id="BAI98669.1"
FT                   /translation="MKKIPATVITGFLGAGKTTLIRHLIEHAGGRRLALIINEFGDVGV
FT                   DGALVQGCGDEACPDEDIIELANGCICCTVADDFLPTMQKLLDRRTPPDHIIIETSGLA
FT                   LPKPLVKAFQWPDIRTRSTVDGVIALIDADALAAGRFAHDEAALAAARAADPTLDHDSP
FT                   IEELFEDQLACADLVLLNKTDLVAADRLAALEQGLAGEIRPGVRILRTARGEIDPAILL
FT                   GLDAGAEDRIDDRPSHHDGEEEHDHDDFESFIVDLGELAGPEPLLAALARSIAAHDILR
FT                   VKGFLAIEGRPARLVLQAVGPRIQHHYDRHWQAGEPRRSRLVVIGQSGMDRAAIEAALG
FT                   ARMAAA"
FT   CDS_pept        379481..383293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobN"
FT                   /locus_tag="SJA_C2-03070"
FT                   /product="cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="cobalamin biosynthesis protein CobN or related
FT                   Mg-chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98670"
FT                   /db_xref="GOA:D4Z851"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z851"
FT                   /protein_id="BAI98670.1"
FT                   /translation="MHLLTATPGAVSNGEEAIDLGQSPGDIVLLTVADSELACFASAAH
FT                   VLAQELGGAAPEIRLANLLQLKHPYSVDLYVEKVVAHAKFVCVVLLGGKSYWPYGIEEI
FT                   ANIARERGIAFAAIADGREDDPELSAASTVAAESCDLLRDYLRQGGIANAVAFLRNAAR
FT                   LAGFDAGVPDAPVPVADAGLYLPGGDRPTLDQVRNRWKAGQPTALFLFYRALMIAGTLD
FT                   AVDGMIAGLEGAGLNVLPVHVRALREPFARDFLQGLMAQAPPDVILNATAFAASAPGEP
FT                   RTPSILEQADCAILQTIFASVDQGAWESSARGLGPRDLAMHVALPEVDGRLFTRAVAFK
FT                   AAARFDERTQCGIVVPQVLQDRVSFVSQLAANWSKLRTTPVDERRVALILANYPNRNGR
FT                   IGNGVGLDTPASAAAILKALSEAGYRTGEAPADGAALMQRMTGGITNAAPDGPGEVALP
FT                   LQAYDATFATLPEGVRQAVRSRWGAPEADPFFRDGAFRLPVHRFGHIALAVQPSRGYHV
FT                   DPRSSYHDPALPPPHAYLAFHIWLAGDFGADAVVHVGKHGNLEWLPGKAIGLSENCFPE
FT                   ICAGPIPQIYPFIVNDPGEGTQAKRRIGACIVDHLTPPLTRAETYGPLKELEALVDEYY
FT                   LAAGMDPRRLETLRKDILTLAASQGLDKDAGVQGGGDDALAAIDNYLCDLKEMQIRDGL
FT                   HVFTRSPEGALRRDLLIALARCPRGLDEGRQSLLRALADDLELGFDPLDCIMGTPWTGP
FT                   RPEALRHVTSAPWRTAGDTVERLELYAIELMDRHSRKSGNPSPISSPKRNIQEMDPRLR
FT                   GDDDWALQRTAAVLTVIEQDLAPRVDACGEAEKTALLKALDGRFVPPGPSGAPTRGRPD
FT                   VLPTGRNFYSVDTRAVPTVAAWNLGQRSADLIVQDYLQREGDYPRAIALSAWSTANMRT
FT                   GGDDIAQALALMGVRPRWDWASGRVIGFEVMKIAELDRPRVDVTFRVSGFFRDAFPEQI
FT                   DLIDSAARAVMALDEPEEDNPAAARHRAETAALIAEGIPEKAAQRRAGSRVFGSKPGAY
FT                   GAGLQAMIDEKIWHDRADLANVYLDWGGHAYGGGVEGDAERSLFAKRLTQADALIQNQD
FT                   NREHDLLDSDDYYQFEGGLAAAVEHLSGRRPLSYHNDHSRPDRPVVRTLEDEIGRIVRA
FT                   RVTNPKWIAGMMRHGYKGAFEIAASVDYLFAFAATTHAVKDHHFDAVHAAFIEDEAVRA
FT                   FMAEANPAALRETAARLREALDRALWKPRSNSAAMLLSQLKDAPQ"
FT   CDS_pept        383290..383895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /gene_synonym="btuR"
FT                   /locus_tag="SJA_C2-03080"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="ATP:corrinoid adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98671"
FT                   /db_xref="GOA:D4Z852"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z852"
FT                   /protein_id="BAI98671.1"
FT                   /translation="MIERTPEQHAEKMKKKQAAHDRIMATKTQEKGLLIVHTGKGKGKT
FT                   TAALGMVVRAIGHGRKVGVVQFVKGAMTTGEKRVFDAFPDNVEFKPMGEGFTWNTQDRT
FT                   RDIALAREAWDEVKRMIADPAYDMVLADELNIVLRYDYLPVEEVLEAVTARGEMKHVIV
FT                   TGRNAPDALMEAADLVTEMTLVKHPFRSGVKAQPGIEF"
FT   CDS_pept        383952..384521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bluB"
FT                   /locus_tag="SJA_C2-03090"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98672"
FT                   /db_xref="GOA:D4Z853"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z853"
FT                   /protein_id="BAI98672.1"
FT                   /translation="MRHFLTDPLEESEVERLLALAHSAPSVGLSQPWRFVRVETPALRE
FT                   RLAVHVDAQVAKAGKMYEGEEDRLYRSLKLHGLREAPVLFAVYCDEGTETGHRLGAITM
FT                   PEARRYSCVMAIHTLWLAARTRGIGMGWVSILDRATVDAMLAIPENWRCLGLLCLGYPV
FT                   SEEATPELERRGWEHRTDWHSTIVTR"
FT   misc_binding    384609..384826
FT                   /bound_moiety="cobalamin"
FT                   /note="Cobalamin riboswitch"
FT                   /note="predicted by Rfam (RF00174), score 115.81"
FT   CDS_pept        384999..386063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobG"
FT                   /locus_tag="SJA_C2-03100"
FT                   /product="cobalamin synthesis protein CobG"
FT                   /EC_number="1.14.13.87"
FT                   /note="precorrin-3B synthase/sulfite reductase, beta
FT                   subunit (hemoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98673"
FT                   /db_xref="GOA:D4Z854"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z854"
FT                   /protein_id="BAI98673.1"
FT                   /translation="MMAGDGLLVRVRPPQGRLAVTQAIALAEAARLHGNGLIDLTNRAA
FT                   LQLRGVTEQSHGPLLRQLVALGLADADPAREARRNFLLAPDSTPGDDSESIALGLIAHL
FT                   DDLPQLPSKIGIAIDAGPAPCLAGVPADFRFERSQAGALLLRVERRPMGSPTSVETAAS
FT                   DLIALARWFLATGGAASGRAARHGAPLPMAAEMAPAPSRALSQVLASASGPFHAVPFGQ
FT                   IDADGLIALTRKRNVAALRLTPWRGLVLEGGAQRAGHAPPDGLLRIDACPGAPACPQAS
FT                   VETRGLASRLAPLVEGSLHVSGCAKGCARQGTAQLVLTGRQGRFDLSRNARAGSPPEKT
FT                   GLTARQILALFGRP"
FT   CDS_pept        386063..386692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="SJA_C2-03110"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98674"
FT                   /db_xref="GOA:D4Z855"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z855"
FT                   /protein_id="BAI98674.1"
FT                   /translation="MPHSYETDGAAIYRQSFRTIRAEADLARFSTEEERIAVRMIHAAG
FT                   LVDLATHIRFSPSFALAAIAALRAGAPILCDARMVSEGISLKRLPAANPILCTLNDPQV
FT                   PALAARMSNTRSAAALELWRPHLGGALVAIGNAPTALFHLLDMLEDPACPRPAAIIGCP
FT                   VGFIGAAESKQALWQSQPVPCCIVEGRLGGSAITVAAVNAIASPAE"
FT   CDS_pept        386689..387408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /gene_synonym="cbiL"
FT                   /locus_tag="SJA_C2-03120"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98675"
FT                   /db_xref="GOA:D4Z856"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z856"
FT                   /protein_id="BAI98675.1"
FT                   /translation="MMGGTIHGVGLGPGARDLMSVRADRLIRDARHIAYFRKKGRPGHA
FT                   RGIVEGMLHPDAVEFAMEYPVTTEIPLSDPRYNDLLSAFYADCAAHLDGLSAGGEDVVV
FT                   LCEGDPFFYGSFMHLHSRLAGPVKIVPGITGMSGAWTASGAPIGWGDDVLTVLMATLPE
FT                   EELVRRIHDSHALVVMKIGRNLPKLLRAVEAAGKQDSAWLVEYATMADQRIVPLAQATG
FT                   AAPYFSILLVHGQGRRP"
FT   CDS_pept        387405..388154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobJ"
FT                   /gene_synonym="cbiH"
FT                   /locus_tag="SJA_C2-03130"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98676"
FT                   /db_xref="GOA:D4Z857"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z857"
FT                   /protein_id="BAI98676.1"
FT                   /translation="MTGWVAAAGLGPGADALITPEVSDALAQATDVIGYIPYVARVAQR
FT                   PGLTLHASDNRVELDRAVHALTLAAQGKRVAVVSSGDPGVFAMASALFEALEAGPEGWR
FT                   DLDIRVLPGITAMLAAAARAGAPLGHDFCAINLSDNLKPWPLIERRLRLAAQADFAMAF
FT                   YNPRSRSRPEGFGRALAILREECGEDRLILFARAVSTPEEMLRVVPLSRATPDMADMRT
FT                   MVIVGSSRTRLIDRSGPPILYTPRSAA"
FT   CDS_pept        complement(388130..388879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="SJA_C2-03140"
FT                   /product="precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98677"
FT                   /db_xref="GOA:D4Z858"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z858"
FT                   /protein_id="BAI98677.1"
FT                   /translation="MSNILILGGTTEASALAAALAERGMRAVLSYAGRTDKPRAQPVPV
FT                   RVGGFGGMAGLARYLREEGVTHLVDATHPFAATMSEHAVAAAREAGVKHIMLTRPPWIA
FT                   ADGDRWTHVPDLAGAVAALAGARRNVMLALGRMHVDAFAAQPQHHYLLRFVDMPAAAPG
FT                   LPDHALVIDRGPFTVEGDMQLMRAHGIDCVVSKNAGGSGAQAKLVAAQTLGLPVVMIGR
FT                   PACPAALVTHEVAGVLQWLGHAAERGV"
FT   CDS_pept        388878..390086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /gene_synonym="cbiE"
FT                   /locus_tag="SJA_C2-03150"
FT                   /product="precorrin-6Y C5,15-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /note="precorrin-6B methylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98678"
FT                   /db_xref="GOA:D4Z859"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z859"
FT                   /protein_id="BAI98678.1"
FT                   /translation="MADTPDAPWLTIVGIGEDGLNGLSPAARDALERAALVAGSPRHLA
FT                   LLPGLRAESLAWPVPFSAGVPMLLARRGDPTVLLASGDPFWFGAGSSITRHLRPDEWTA
FT                   HPAPSTFSLAAARLGWALQDVECHGLHAAPLTRLRPGLAPGRRAILLLRDGPAVGQLAA
FT                   WLTEQGFGGSTLHVLEALGGPRERIRQCTAEAPDLADIAHPVAVGLSVAGEGRTLPCAS
FT                   GIPDDWFDHDGQITKRPARALTLSALAPRPGETLWDIGAGCGSVAIEWLLAHGSTQAIA
FT                   FEVDPDRAGRTRANALHLGVDRLTVMEGRAPDILTGRTRPEAVFIGGGLSQSLLAALFA
FT                   LPGGPTRLVANAVTLESEALLARWHADKGGDLLRIELAQAMPLGSRRGWRSAYPLVQWS
FT                   VTL"
FT   CDS_pept        390083..390448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="SJA_C2-03160"
FT                   /product="cobalamin biosynthesis protein G"
FT                   /note="precorrin methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98679"
FT                   /db_xref="GOA:D4Z860"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z860"
FT                   /protein_id="BAI98679.1"
FT                   /translation="MIVAGFGFRHGASLASLESALERATGGMIAVDALATLDGKTQQLA
FT                   PLARKLALPLIAVGVGRLADQPVATRSPASMAAYGAGSVAEATALAALTQKGRLLAPRA
FT                   FSSDRFASCALAESPAP"
FT   CDS_pept        390445..391227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /gene_synonym="cbiF"
FT                   /locus_tag="SJA_C2-03170"
FT                   /product="precorrin-4 methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98680"
FT                   /db_xref="GOA:D4Z861"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z861"
FT                   /protein_id="BAI98680.1"
FT                   /translation="MTVHFIGAGPGAPDLITLRGRDLIAGSPVCLYAGSLVPAALLDHC
FT                   PPGARIVNTAPLTLDEIVAIIVQAHRAGQDVARLHSGDLSVWSAMGEQLRRLKAIGIPF
FT                   SITPGVPSFAAAAAAIGAELTLPELGQSVILTRTPGRASAMPSGESLSAFGATGATLAI
FT                   HLSIHNLVQVVRDLIPHHGADCPAAVVWRASWPDQRIVRATLGTIGEAAADGPERTAII
FT                   LVGPVLGSQDFPESSLYAPGYDRRFRPASADSPFIDKP"
FT   CDS_pept        391224..392543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /gene_synonym="cbiA"
FT                   /locus_tag="SJA_C2-03180"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /EC_number="6.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98681"
FT                   /db_xref="GOA:D4Z862"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z862"
FT                   /protein_id="BAI98681.1"
FT                   /translation="MTPGLLIAAPRSGSGKTTVTLGLLRAFSRLGVRVQPFKSGPDYID
FT                   PAFQQAASRRPSFNLDSWAMSAPQMAAIAGRADAELIVAEGVMGLFDGAPAIGEAGTGA
FT                   SADIAALFGWPVLLVMDVSGQSQSAAAIASGFRDLRSDISMAGAVLNHVASQRHERLIR
FT                   AAMEEAGIPVLGAIPRSAALRLPERHLGLVQAAEQADLDQIVDCMADIVATYVDLNAIR
FT                   RAARFATPQNHAAMPILSPPGQRIAIARDEAFSFTYAHLLSGWRDAGAEILPFSPLADE
FT                   APAADADAVWLPGGYPELHAGRIAQAARFLSGLRRHALDRPIHGECGGYMVLGEALIDA
FT                   DGQAHAMAGLLGLVTSFAERRLHLGYRRARLLAPMGGMPAGAMLNGHEFHYSTIVEQPD
FT                   SPLAHVTDAEGQAVPSTGSHRGRVTGSFFHLIAPSSKASS"
FT   CDS_pept        392540..393286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobF"
FT                   /locus_tag="SJA_C2-03190"
FT                   /product="precorrin-6A synthase deacetylating"
FT                   /EC_number="2.1.1.152"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98682"
FT                   /db_xref="GOA:D4Z863"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z863"
FT                   /protein_id="BAI98682.1"
FT                   /translation="MIGIDLIGIGTGNPDHLTRAAAKAMNDADLILLPRKGAAKSDLVD
FT                   LRRAICAELLTQAVKIVEFDMPRRADRTDYVGAVLDWHDAIAALWMEQIARHLPDGGRL
FT                   ALLVWGDPSLYDSSLRIAGRLPGVKVRVIPGITSIQALTAAHGICLNDLAEPVLITTGR
FT                   RLAERGWPDCADTLAVMLDGNCAFQAVAAEGIDIWWGAYLGLPQEAIMRGALTEVGADI
FT                   VRRRAALRKEHGWIMDIYLLRRQRSG"
FT   CDS_pept        complement(393335..393538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98683"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z864"
FT                   /protein_id="BAI98683.1"
FT                   /translation="MTNALTPEECLDRARMHDQLAATTADASARMMHQAMAAEFRRRAE
FT                   TASSGMRQTASRPIIELMPNVA"
FT   CDS_pept        complement(393702..395243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03210"
FT                   /product="SpoVR-family protein"
FT                   /note="stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98684"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z865"
FT                   /protein_id="BAI98684.1"
FT                   /translation="MTGELASAPLFTGSDWDFSLINRIYETVEPIALQEMKLDIYPNQI
FT                   EIISAEQMLDAYSSIGMPLFYKHWSFGKQFVTNEMMYRKGLRGLAYELVINSDPCINYL
FT                   MQENSATMQTLVIAHAAFGHNHFFKNNYVFKQWTDAEGILDYLEFAKRYIAQCEERYGQ
FT                   LPVERVLDAAHALMNQGVHRYPRVRPRDLKAEAAREAERQAYRDRIYDDLWRTVPTGAK
FT                   ADAIPSDARRAALGLPQENILYFLEKSGPRLESWQREILRIVRLIAQYFYPQRQTKAMN
FT                   EGCATYTHYRIMTTLHERGWITDGSFMEFLSSHTNVVYQPTYDSGQFGGFNPYALGFGI
FT                   MSDIERICREPTEEDREWFPEIAGSGDAMEVLKDIWANYRDESFVSQFLSPHLIRQWRL
FT                   FKILDKQGESELRVDAIHDERGYRRIRRSLAREYEIGRQEPDIQVVDVDLAGDRKLIVE
FT                   HAVLDGVQLDAGDAAMVLQNLANLWGYEVLLKEVDSETRKELKSHSAQPNMAWLR"
FT   CDS_pept        complement(395257..396564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03220"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98685"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z866"
FT                   /protein_id="BAI98685.1"
FT                   /translation="MHIVDRRLNPGGKSLVNRQRFLRRVRAYVQQAVRDSLKDRSIKDL
FT                   DKEGQISIQRDVIHEPTLHRAAQGGSRERVFPGNHDYMEGDKIKRPDGGAGAGSKAGQG
FT                   EGNDDFQFALSREEFLDLFLDDLELPDLAKRRLIGGAVDGIRRAGYSTVGNPSNLSVPR
FT                   TMQKAMSRRLALRRPKGADLARIEEEIALIEARTSPLPDDATRLEALREERSTIIRRRN
FT                   LIAYIDPVDLRYRRFETVPKPVAQAVMFCLMDVSGSMTEHMKDLAKRFFALLHLFLSRC
FT                   YEHVEVVFIHHTDRAAEVDEQTFFYSTVTGGTLVSSALDKLIEVVQERFRPDDWNIYVA
FT                   QASDGDTMQSDNGRVVSLMQQEILPFSQYFAYLEVGREEFADIESIGTTTGLWQAYAPV
FT                   SEANRNFVMRKVHHRREIYPVFRELFQRKGVAERSS"
FT   CDS_pept        complement(396584..398527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="SJA_C2-03230"
FT                   /product="serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98686"
FT                   /db_xref="GOA:D4Z867"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z867"
FT                   /protein_id="BAI98686.1"
FT                   /translation="MTKNELFSSFTRKFDDRRQAEMSIEDYLLGCRNDPLMHASAPERL
FT                   LAAIGEPEIIDTSRDQRLGRIFMNRTIRRYKSFTNFYGMEGTIEHIVSFLRHASQGLEE
FT                   RKQILYLLGPVGGGKSSLAERLKALMEVHPIYVLKAGEEVSPIFESPLALFDAETHGDF
FT                   IEENYAIPRRRLTGMISPWCRKRLDEYGGDISQFRVVRMMPSRMRQVAIAKTEPGDENN
FT                   QDISSLVGKVDIRKLEMLSQNDPDAYSYSGGLNRANQGMLEFVEMFKAPIKMLHPLLTA
FT                   TQEGNYIGTENIGAIPYTGIIMAHSNESEWANFKNNKNNEAFIDRIYVIKVPYSLQATE
FT                   ERHVYEKLLRESDLNKAPCAPGTLDMLARFSVLTRLREHENSNLYSKMRVYDGEMLREI
FT                   DPRAKSLQEYRDAAGVDEGMSGISTRFAFKALSATFNHDTNEIAADPVHLMYVLEGMVR
FT                   QEQFPAEVEARYLEFIKGELAPRYAEFIGNEIQKAYLESYHDYGQNLFDRYVAYADAWI
FT                   EDLDFKDPDTGQLLDREVINQELSKTEKPAGIANPKDFRNEVVKFALRMRASNDGRNPS
FT                   WTSYEKIREVIEKRMFSQVEDLLPVISFGSKKDGETATKHDEFVARMIERGYTERQVRR
FT                   LVEWYIRVKQAG"
FT   misc_feature    398616..398623
FT                   /note="recognition site for restriction enzyme SwaI"
FT   CDS_pept        complement(398990..400360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03240"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98687"
FT                   /db_xref="GOA:D4Z868"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z868"
FT                   /protein_id="BAI98687.1"
FT                   /translation="MMIPVVARARNFFRSLVGRIFLLLTVGMTVAAVLALLVAEQARHL
FT                   DFERWRLQRVVASAVDIAQRLSHDPVRIEAMLKDQQIMGARTAPEGVALADPDPTLADA
FT                   LEVRFGPYSNPEAGQVPVGLCFPANKVDPNNRAAGLIDAPRPDCWVVRFTDSTGQRRSL
FT                   ALYLPRVAKPPSNLARPIYLLLILLSSAGLAIVVARFVAKPLRRLERAAEAFSVSVDPE
FT                   EIPERGPEEVRAALSTFNLMQRRVRAGFAERTQLLAAISHDLQTPLTRLRLRLELVENE
FT                   ELRARLLHDHQAMMTLVREGLDLAASTEAQEDWSMIDIDSLLTSMAEDAQDLGSPVRFL
FT                   SGCGGTVRVKPNALTRCISNLVNNAVKYGGSADVSCMRQGGRVLIEVRDHGPGIAPDQL
FT                   DQMFEPFTRGVAGQPGGRPGTGIGLTIARSLALSFQASVRLANAPEGGLVATIDMRA"
FT   CDS_pept        complement(400379..401107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03250"
FT                   /product="response regulator"
FT                   /note="two-component system, response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98688"
FT                   /db_xref="GOA:D4Z869"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z869"
FT                   /protein_id="BAI98688.1"
FT                   /translation="MPDMPPSRPFRVIVVDDDEDIRGLIVGQLAQEHYEVLAAGSLSEL
FT                   HGIMAARPADLIVLDLNLPDGDGLSLCRELRAQGSGVQIIMVTARGSAIDRVLGLELGA
FT                   DDYLTKPFEPRELLVRVRNLLRRSRSEDRARQKAARIARFGSWRLDLFQRRLIASDDRL
FT                   IMLSSAEFRLLSRFIEEPNVVLSREALVPERRATAAFDRSIDLQVSRLRQKLADSPGGD
FT                   GLILTVRGEGYVLASTVTYE"
FT   CDS_pept        401350..402480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03260"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98689"
FT                   /db_xref="GOA:D4Z870"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z870"
FT                   /protein_id="BAI98689.1"
FT                   /translation="MPSRLPALRTALLALCVLVAACGQREAPKKGPVEVGVVTLATQDV
FT                   TVSTELPGRTASTMMSEVRPQVAGVIQKRLFTEGSTVKAGQPLYQIDPSLYRASRDEAQ
FT                   ATLASAQATAAAAQARASRYRTLGQSEAVSAQDRDDVIATARQAAAAVQQARATLQTAG
FT                   INLNFTQVRAPIGGRIGRSAVTPGALVTASQATPLAIIQQLDPIFVDVTQSSAKLLQLR
FT                   RALAAGKALPASATIRLKLDDGTDYPLEGRIEFAEPIVDPDSGTVTLRARFPNPDGLLL
FT                   PGMFVRVVAPQSVVPNAILVPQQGISRDPKGNATALVVDKGNKVERRTVTAAQAVGDQW
FT                   LITDGLRRGDRLIVEGTDKVQPGDAVKAVPVDRAAR"
FT   CDS_pept        402493..405636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03270"
FT                   /product="HAE1-family efflux protein"
FT                   /note="hydrophobic/amphiphilic exporter-1 (mainly G-
FT                   bacteria), HAE1 family / cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98690"
FT                   /db_xref="GOA:D4Z871"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z871"
FT                   /protein_id="BAI98690.1"
FT                   /translation="MLSRFFIERPIFAWVIAIGIMMAGLGAMLTLPIAQYPDIAPPSVN
FT                   ISANYPGAAAETVETSVTQVIEQQLTGIDGLMYFSSSSTANGQARITVTFKKGTDPDTA
FT                   QVQVQNKVQQALSRLPNAVQQQGLTVTKSQTDFLMVVGLYDRTDAASQADISDYLVNHF
FT                   QDAIARVDGVGSSQIFGSQYAMRVWLDPYRLATVKLMPSDVQSAIAAQNVEVSAGQIGA
FT                   DPAPEGQQLNATVTARARLQTPEQFRNIIVKTQSDGSVVHLSDVARVELGNESYTSSAR
FT                   LNGHPASGMALQLAPGADALKTAELVKARVEELSADLPHGYTVTYPRDTTPFIKLSVEE
FT                   VVQTLIEAVGLVVVVMFVFLQSWRATLVPAIAVPVVLLGTFGVLALFGYSINTLTLFGM
FT                   VLAIGLLVDDAIVVVENVERIMEEEGLSPRDATIKSMEEIGSALIGIALVLSAVLLPMA
FT                   FFGGSTGVIYRQFSITIVSSMLLSVVVALILSPALCATILKPVSHEHRDRGWTGRFNRW
FT                   FGRVTDGYMTRLNGFIGRRTLFWIGYAAMLGLLWLLFVRLPTSFLPVEDQGQVMVQVTL
FT                   PAGAKSSRTSAAVDQIQNYFTNDEKDNVDFIFVTQGFSFAGQGENTAQGFVSLAPWDKR
FT                   KGAANGATMIANRATKQLAAIRDAKALATTPPSIRGLGQSNGFTFELLNTGGLSRERFL
FT                   EMRNRLMKAATGSPKLAGVRAATLEDTPQLKVDIDSEKLAVLGLTQNSVDNVLSAAWGS
FT                   TYINDFVDRGRVKRVYMQADAPFRALPTDLDNWQVRSAATGEMVPFSAFATTHWAMGPT
FT                   TVSRYNGQSAYEIQGQAAPGSSSGEAMDEMVRLQKQLPPGTGYAWSGLSYQEQLSGGQA
FT                   PLLYGLSVLVVFLCLAALYESWSIPLAVLLVIPLGLIGAVLAVTLRGLENNIYFQVGLL
FT                   TTMGLAAKNAILIVEFAELAYLQGKDAMSAALEAARLRFRPILMTSLAFIAGVIPLAIA
FT                   SGAGAQSRVAIGTAVVGGMLTATVLAIFYVPLFFLTIVRIFNRKNPPSPTAPAAEVPA"
FT   CDS_pept        405633..407009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03280"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98691"
FT                   /db_xref="GOA:D4Z872"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z872"
FT                   /protein_id="BAI98691.1"
FT                   /translation="MRRALCALASAAALSGCNMAPTYVRPAPPVPASLPSGPAYAPATA
FT                   TEKPGLPWTALIGDAGLKTVIGRALDNNRDLRAALANVEAARALYRVQRAERLPAVTGE
FT                   AAAGFTRRNDARQNSYSADIGFSAFEIDLFGRVKNLTRSALESYLATEEGARATRIALI
FT                   AETATAYATLAADQDYLDLSRRTLANAERTLALTRSLNGAGLIGKLDVHQAETTVEQAR
FT                   SDIAANLTQVAQDRNALDLLVGAPVEDALLPRSLQELTPDVAKVPAGLSSDVLLQRPDV
FT                   LQAEHQLKAANADIGAARAAMFPRISLTAAIGVASSALSSLFTGDGFAWSAAPSASMPI
FT                   FGGAARGNLSYSKAQRDLSLARYEKAIQTAFQEVSDALAREGTIDEQQAAQQRLVLASQ
FT                   RSYKLAEERYRAGIDTFLNSLTSQRSLYNAQQSAIATNLAMIRNRILLYRVIGADFREG
FT                   "
FT   CDS_pept        complement(407043..407546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU/cobP"
FT                   /locus_tag="SJA_C2-03290"
FT                   /product="cobalamin biosynthesis enzyme"
FT                   /EC_number="2.7.1.156"
FT                   /EC_number="2.7.7.62"
FT                   /note="bifunctional cobalamin biosynthesis protein /
FT                   adenosylcobinamide kinase / adenosylcobinamide-phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98692"
FT                   /db_xref="GOA:D4Z873"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z873"
FT                   /protein_id="BAI98692.1"
FT                   /translation="MLVLGGCRSGKSRYAQERCEAVGNGSLAYIATAQAFDAEMEERIA
FT                   RHRIERGSRWLTIDAPMDLPAALSEAACRAEAILVDCLTLWLTNLMLADADLAGARAVL
FT                   AEALRACPVPVVLVSNEVGLGIVPDNALARRFRDEAGWLNQQMAALCEDVMLMAAGLPL
FT                   RLKG"
FT   CDS_pept        complement(407552..408487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /gene_synonym="cbiB"
FT                   /locus_tag="SJA_C2-03300"
FT                   /product="cobalamin biosynthesis CobD/CbiB"
FT                   /EC_number="6.3.1.10"
FT                   /note="adenosylcobinamide-phosphate synthase CobD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98693"
FT                   /db_xref="GOA:D4Z874"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z874"
FT                   /protein_id="BAI98693.1"
FT                   /translation="MGEPAALAALMLDAALGWPGWLHAQIGHPVGGFARIIGAAERRWN
FT                   REAWSGRVRRWTGLALLLLLLGVGGGAGLALEWAIRRWGGGTAWPWLALAAWPALAQNS
FT                   LYVHVAPVVRALAKGEMDAARQAVARIVGRDTAALDEAGVARAGIESLAESFCDGVVAP
FT                   LFWLLLLGPPGIWAYKAVNTADSMIGHKEAPYTDFGWAAARFDDLLNWVPARLSGLILC
FT                   VAGGGGWAVLRRDRRKHASPNAGWPEAAMAGALGIRLAGPIRYDGVLHDKPWIGTGGEA
FT                   DVRAMKAALRIYVLACLLLWGLAAIWEGVG"
FT   CDS_pept        complement(408480..409457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="SJA_C2-03310"
FT                   /product="cobalamin biosynthesis CobC"
FT                   /EC_number="3.1.3.73"
FT                   /note="alpha ribazole-5'-P phosphatase /
FT                   histidinol-phosphate/aromatic aminotransferase and cobyric
FT                   acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98694"
FT                   /db_xref="GOA:D4Z875"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z875"
FT                   /protein_id="BAI98694.1"
FT                   /translation="MSGFAWHGGRLAEARAVYGGKEWIDLSTGISPFPWPGADHLAVDW
FT                   RHLPDPRDLAAMEAAAAACFGVDPDHLCTLPGSEAGLRLVGRMLDMPARWLVPSYRTHA
FT                   EIFAQGAPLPDGEEPPREAVALLLANPNNPDGRILPPARLLQWLAGLEEGGGWLIVDEA
FT                   YADAVPSCSLACEVGDGRRLILLRSFGKFFGLAGVRLGFLLGPREVVARARRMLGEWPV
FT                   SAAAIAFGGAAYRDRSWIDATVTALGERAAQLDGVLARHGLAARGECPLFRLVEAEDGW
FT                   TLFDRLARRSILTRPFEEDRRWLRIGLPADAAALARLDRALADG"
FT   CDS_pept        complement(409454..410164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="SJA_C2-03320"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98695"
FT                   /db_xref="GOA:D4Z876"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z876"
FT                   /protein_id="BAI98695.1"
FT                   /translation="MKRLVLALQLMTRLPLPAQHVDERDFAAAVRWLPATGIAVGLAVA
FT                   GGVGLGMRIDPWAGALFGLVAWVAVTGALHLDGLGDIADAAGAAHGDRTRLSAVLADPH
FT                   VGSFGVVAIGLQLLAKLVLLRLWLESFSPWMLAAVAMVARIGPLFWTRWLPPLHEGLAS
FT                   RFRAGWRAEAFILWSMLALAASYRAPALLAAVPLIPLWGLWLRSRIGGISGDGHGAGIE
FT                   LLESALLLAMVAAR"
FT   CDS_pept        complement(410161..410724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03330"
FT                   /product="phosphoglycerate/bisphosphoglycerate mutase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98696"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z877"
FT                   /protein_id="BAI98696.1"
FT                   /translation="MNAFPLHLMRHGAPQLAGRLLGHLDAPPEAEGIALCVDRARHLDF
FT                   ARVVTSDLARARTPGAAIAAERDVELGVDPRWRELHFGDWEGADPTRLPAEDLARFWDD
FT                   PDGFPPPGGESWTDLCNRIGDGLAALGEPVLVVCHAGAIRAALSVLCGFDARRGWAVDL
FT                   PYGAVLSLRIWPEGPSGQITGLIA"
FT   CDS_pept        complement(410721..411737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="SJA_C2-03340"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98697"
FT                   /db_xref="GOA:D4Z878"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z878"
FT                   /protein_id="BAI98697.1"
FT                   /translation="MIRFVDRAAFAAALAELPAPDAGAAAAAAERQRVLTKPAGSLGRL
FT                   EEIALFMAGWQRRERPRAERIRAAIFAGNHGVAARGVSAFPAGVTAQMVANFRHGGAAI
FT                   NALAQACGAELAVVALDLERPTGDICAEAAMSEADCLSAINAGAAAAEEGLDLLLPGEM
FT                   GIANSTPAAALCAQAFGGAAAHWVGRGTGVDGEGLARKADAVSLALALHGAHCADAFET
FT                   LRRLGGREIAALAGAVLAARMLRVPVMLDGFIGCAAVAPLAKDNPAIVDHCMAAHMSAE
FT                   AGHERLLAALALEPLLRLDMRLGEGSGAAVAAQIVRSALAAHGGMASFAEAAVAGAL"
FT   CDS_pept        complement(411734..412141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03350"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98698"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z879"
FT                   /protein_id="BAI98698.1"
FT                   /translation="MLRAVGPGASVVVCSTCRLSAEQREDAAGRRGGALLVEALHRVRD
FT                   GDPAYAAVAVQDMPCLFACDRHCAVHVRGTGKVGYVLGDFTPDEEAARAILDYAARHAE
FT                   SEEGVVRYADWPQGVKGHFIVRTPPDGFVCS"
FT   misc_binding    412333..412524
FT                   /bound_moiety="cobalamin"
FT                   /note="Cobalamin riboswitch"
FT                   /note="predicted by Rfam (RF00174), score 124.36"
FT   CDS_pept        412517..413149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03360"
FT                   /product="MgtC/SapB family transporter"
FT                   /note="putative Mg2+ transporter-C (MgtC) family protein /
FT                   uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98699"
FT                   /db_xref="GOA:D4Z880"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z880"
FT                   /protein_id="BAI98699.1"
FT                   /translation="MLIKPASINRKAGNGRVATRSGLGFRFRPSWRERQPPFAGFMAML
FT                   ANDFGTTLVRLVLATLLGLALGFERERNGHDAGLRTHGLVSLSSAMLTLSALELVEVHP
FT                   DGDPIRVVQGLAQAIGFIAGGLIFVRGGDVRNMTTAASLWMAAAVGITAGAGQYVLVLV
FT                   GSLIALMLLSLLLLVEKRIARRSRKADRLEGDAMPNRRGSVVRDREG"
FT   CDS_pept        413300..414481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /locus_tag="SJA_C2-03370"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98700"
FT                   /db_xref="GOA:D4Z881"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z881"
FT                   /protein_id="BAI98700.1"
FT                   /translation="MNKDIIIAGYARTPMGGFQGALASVSAPELGAVAVKAAVERSGAA
FT                   PEAIDRIYMGCVLPAALGQAPARQAALGAGLPQSVEATTVNKMCGSGMQAAIMAAEALS
FT                   AGTVDIVVAGGMESMTNAPYALPKHRSGARIGHDRIIDTMMMDGLEDAYDRGKPMGAFA
FT                   EDTARDYQFTRAEMDAYAIESLARANAAIDSGAFAGEVVPVIVRTRGGEVQVDKDEQPG
FT                   NARPEKIPSLKPAFASDGAITAASSASISDGAAALVLTRADVAEKLGLAREARIVAAAA
FT                   HAHAPALFTTAPVFAIRKVLEKAGWSSGDVDLYEVNEAFAAVAMIAMRDLDIPRDRINV
FT                   NGGATALGHPIGASGARIIATLVAALKARGLKKGVAALCIGGGEATAVALEIL"
FT   CDS_pept        complement(414600..415886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03380"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized membrane-anchored protein conserved
FT                   in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98701"
FT                   /db_xref="GOA:D4Z882"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z882"
FT                   /protein_id="BAI98701.1"
FT                   /translation="MDDMTSDPFAALSRRDHPLRASLSREMHIRGLPRFDAPALALQFV
FT                   LLVDEQQAEKGIALLSDRFPALKPGDRFLAARIGDLHFSWERHTEFMTYSFLAAVEGAT
FT                   LFDLSPFGDVPAWMADMPGRVIRSTQIAMVMNEPPPAAIAAHFATDDLIISDVADGQAR
FT                   IWSDFRLHADGFGRLLIHDKGLQGGESSQLVQRLQELGNYRKIALLGLPEAQQATPLLT
FT                   ALEQRLTAITSRVAQKDADADQVLEQLSALSAELAGIVARTRYRMSATQAYAEICRDRI
FT                   RRLAVAPVRGYRSLDDFTERRLLPAMRTCDAFTRRLEDLAQRTAWTSALLRTRVDTALA
FT                   RRNRDLLASMDRRTALQLRLQHTVEGLSVVAISYYALGLWHHLKEALELQGWHLPAWID
FT                   VALFPVTIVTVFLGIGQIRKVKRPSGSGH"
FT   CDS_pept        complement(416039..417274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03390"
FT                   /product="putative esterase"
FT                   /note="lysophospholipase L1 or related esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98702"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z883"
FT                   /protein_id="BAI98702.1"
FT                   /translation="MRLTLAAFLLPLAACVATPAWAASCPVHWTAAWASAQMAPTGDNA
FT                   LAPGMLADSSLRQIVRPSIAGDRLRVRLSNLAGTAPLHIRGASIARALRAGSPAIDAKT
FT                   LIPLRFDGRGDVTIPAGAEYLSDPVALPVRAFDDLAISIAFDEEPSGQTSHPGSRATSW
FT                   LLKGDHLTDPAMAGAQTVEHWFSLAGLEVERCAAAQLIVALGDSITDGRGSTTNGNDRW
FT                   TDNLARRLQADPATRHLAIVNQGIGGNRLLNDGLGPNALARLDRDVLAQPGARFLILLE
FT                   GINDIGTLTRETQVSDAEHARLVSRIIGAYRQIVMRARARGIKVIGGTILPFVGNDYYH
FT                   PDARNEADRQAVNRWIREPGNFDGVIDFDRAMRDPAHPDRLLPRYDVGDALHPSPEGYR
FT                   AMAEAIPLDLFK"
FT   CDS_pept        complement(417344..420274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03400"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98703"
FT                   /db_xref="GOA:D4Z884"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z884"
FT                   /protein_id="BAI98703.1"
FT                   /translation="MADSHIRSFRMALCAASAFGALTLAQAAIAQDSAAQPAAQPVAQQ
FT                   DEAADIVVTGIRGSLQSATNAKKNAVAFGDSIFAEDIGKLPATNLAETLNRMPGVRLNR
FT                   DISGEGTQVAIRGLGPSFTRVLLNGSQLQVASDGGTNGGSANREVDLDFFPSELFTRLD
FT                   LAKTPSPSTLEGGIAGTVNLRNARPFDKPGTHVTVVAQGQYTDSNEKLSPRGAIVASHT
FT                   TDTFGILVGVAGVKTKTRIDGFDTVGWTDGNLGPVNGVPDAGGNNFFWASTVPANAGHG
FT                   LIPGQPVDVVATSGLTRDQLSTALLPRLGRNTLTDGDRSRISALASLEWRPSDTMHFAL
FT                   DGIWARSKRDYSRINMNWQVRNSGPGTGAQATGGMIPIDLTVDDNGVVTSGTFANSSFF
FT                   LEASQFKQTTKFWNINPSLSWQPTDTLKVDLSANYSKSRFFREQPTFAFQTPPNSGVDV
FT                   YYDNMQGYYPSITTNVDLNDPNLGWQWYRQNIALVRRKTETKGAHLDVMLGDAAFNVKV
FT                   GAAYDRATRSIRAYDNSQAYQLSVCGTGCTGATGSIPTSAIPQYLMPMTVGNFGHLANR
FT                   NIGYNAFIVPDFGAIKDATDYYSYRDSAPETRGAVTGGATGDMDEKVWGAYFELNGVTT
FT                   IADRDLHINAGMRYAATDQLVVGPSQVGTAIVDITSRSKYDNFLPSINLTYDIADNVKL
FT                   RASASRTMTRPDASQILPGVTFTDPSALVATAGNPTLKPYTSDNYDLGGEIYTGGIGYV
FT                   GLSLFQKNVQGFTVTQSQDVAFGSLNIPYDSLIATQQQALTNRAASTGVAINDLIVSVN
FT                   RPINLSDLKIKGVEATWVQPLDFLVKGLGFSANGTYLKQSSKLMPGQATRLVATGVSKW
FT                   SYNLQGFYENNGLSVSLNYVWNDKSIAVNAPQNGITGAALRNDARGQLDLSAGYQLPFL
FT                   NKAMRLTLDVLNIANEPIRTTFEYDNAPYSIYYPGRTILAGIRANF"
FT   CDS_pept        complement(420614..422086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03410"
FT                   /product="D-mannnonate oxidoreductase"
FT                   /EC_number="1.1.1.57"
FT                   /note="mannitol dehydrogenase /
FT                   mannitol-1-phosphate/altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98704"
FT                   /db_xref="GOA:D4Z885"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z885"
FT                   /protein_id="BAI98704.1"
FT                   /translation="MRRLSSATLGTLPADVIRPAYDRAAVRAGVVHLGIGAFHRAHQAA
FT                   VFDDVLNAGDLRWGIVAASLRSSQVRDQMAPQDGLYAMLVRDGSSEGARIIGAVQRVIV
FT                   APEEPQALLNALASPDTHVVTLTITEKGYRLDPATGALIEDDPQLAADLASLARPQTAP
FT                   GYLVAALAMRKALGLPPFTAISCDNLPHNGQRLRNAVLALARRHDPALAEWIGEEGAFP
FT                   ETMVDRIVPATTLDDVAALAARLDVEDRAMVKTEPFIQWVIEDRFCGPRPKFGAGVQLT
FT                   AAVAPWEEAKLRLLNGAHSGIAYLGGLAGIDHVHEALALPAIRAFVEALWDEAQTTLSP
FT                   PPELDLAAYRDALMARFDNPTLRHRTRQIAMDGSQKLPQRLLAPIAARLAAGQGIEALS
FT                   LAVAAWMRWQAGRDDLGNAHGVDDPLAGAIAARLADADTAEERVAAILRLDAVVPPALA
FT                   ANAAFRMALIRWLAILETQGALAALSTFQERI"
FT   CDS_pept        complement(422083..423495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="SJA_C2-03420"
FT                   /product="glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98705"
FT                   /db_xref="GOA:D4Z886"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z886"
FT                   /protein_id="BAI98705.1"
FT                   /translation="MKPLKLHTDRLFPAEPRTRDIARALHATVRDLPIVSPHGHTDPRW
FT                   FAYDDPFPNPSELLIVPDHYVFRMLMSQGVKLEELGVPTRDGSPTETDPRAIWHRFAAH
FT                   YHLFRGTPSRMWLDWVFAETFGIDVRLGADTADHYYDVIDAALKTPAFRPRALFERHGI
FT                   EVIATTEGPLDPLDHHRAIRASGWGGRVITAYRPDPVMDPAVRGFADNVRAFCAMAGED
FT                   AGSFAGYLRAHERRRADFRAAGATSTDHGHPTAFTAHLGKAEIEALYASVMSGPVSDRD
FT                   AELFRGHMLVEMARMSIEDGMVMQLHPGVHRSHNAAVLARFGRDKGGDIPAAGEFVQAL
FT                   KPLLDLYGNDPRLTLILFTLDEDVYSRELAPLAGHYPALRLGPPWWFHDSPEGMRRFRE
FT                   RATETAGFYNMVGFNDDTRAFLSIPARHDMARRMDCAWLARLVAEHRLEEDEAFELARA
FT                   LSYDLVKQAYKL"
FT   CDS_pept        complement(423492..424769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03430"
FT                   /product="putative MFS permease"
FT                   /note="MFS transporter, ACS family, hexuronate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98706"
FT                   /db_xref="GOA:D4Z887"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z887"
FT                   /protein_id="BAI98706.1"
FT                   /translation="MTRSIPKPSGKVRWIVCALLFAAVVLSYVDRLVLPTLKPDLQARY
FT                   GWSESGYADLAIWFQAGYGIAYVFFGRLIDRIGARAGYALAVGLWTVGHVMHIFFTSTA
FT                   GMLLARIPLAVGEAGTFPAAIAATNEWFPKKERAFAIGIFNAGSNVGAILTPLIVPVIA
FT                   VTMGWRWAFILTGLLTVAWLAAWLGFYRRPREKKGLSQEELAWIEADPQEPQRPVKWRT
FT                   LFRHRQTWAYIAARFLIDPVWWTFLFWLPDFFNKQYGVKMLDFGPPLIAVYLLADVGSV
FT                   TGGWLSSRLMGRGMSINRARKTAMFCAALCALPIAFAAQAPGLWVAVGLIGLACAGHQG
FT                   FSANVYALPGDLFPRWMAGSVIGLGGLSGAIGGMLMAKFAGMILESVGSFQPIFIVAAC
FT                   AYLVALLVVHLIVPRYAPVTLSEPRS"
FT   CDS_pept        complement(424897..426108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspA"
FT                   /locus_tag="SJA_C2-03440"
FT                   /product="starvation sensing protein RspA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98707"
FT                   /db_xref="GOA:D4Z888"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z888"
FT                   /protein_id="BAI98707.1"
FT                   /translation="MPKIIDAKVIVTCPGRNFVTLKIITDEGVHGVGDATLNGRELAVG
FT                   SYLADHVVPCLIGRDAHRIEDIWQYLYKGAYWRRGPVTMTAIAAVDMALWDIKGKIAGL
FT                   PVYQLLGGASREGAMVYGHANGTTIEDTINAALEYQAQGYKAIRLQCGVPGMASTYGVS
FT                   KDKYFYEPADADLPTENVWNTSKYLRVVPELFKAAREALGWDVHLLHDIHHRLTPIEAG
FT                   RLGRDLEPYRPFWLEDATPAENQEAFRLIRQHTTAPLAVGEIFNSIWDAKDLIQNQLID
FT                   YIRATVVHAGGITHLRRIAALADLYQVRTGCHGATDLSPVCMAAALHFDLSVPNFGIQE
FT                   YMRHTPETDAVFPHAYTFSDGMMHPGEAPGLGVDIDEKLAAGYEYKRAFLPVNRLEDGT
FT                   MFSW"
FT   CDS_pept        complement(426123..428495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="SJA_C2-03450"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98708"
FT                   /db_xref="GOA:D4Z889"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z889"
FT                   /protein_id="BAI98708.1"
FT                   /translation="MSGFARRQALGLLASTSLLAAAPAIAKGKGGPLYKDAAAPIDLRV
FT                   RDLLARMTLEEKVGQIIALWATKAEVMDDLTFSPAKASKAYPDGFGQITRPSDRRGAPN
FT                   GSTQAGGVGARWRTPAETVAFITAVQKWAMEETRLGIPVLFHEESLHGLMATEATMFPM
FT                   AIGLAGSFDRQLMEDVQSVIAREVRARGVHLALSPVVDIARDPRWGRIEETFGEDPYLC
FT                   GEMGVAAVRGLQGGSRQIGPDKVMATLKHMTGHGQPQSGENIAPAPISERELRENFFPP
FT                   FREVVKRTGIAAVMPSYNEIDGVPSHQNRWLLNDILRGEWHFDGAVVSDYGAVHELDTI
FT                   HHVQPDPEAAARAALRAGVDCELPDGQAYRTLVEQVRAGKVPLEAVDLACTRMLTLKFR
FT                   AGLFENPWPRKDHERLAGNAEARALALKAAQRSIVLLGNDGTLPLTPGAHKRVAVIGPN
FT                   AAIARLGGYSSVPRQTVSLLEGVQAKLKGKAEVVHAQGVFITRSEDRSADEVLLADPAD
FT                   NRALIAQAVEVAKAADIVLLAIGDTEQTSREGFAKNHLGDRTSLDLLGEQNELFAALKA
FT                   TGKPVVVCAINGRPPSYPTVAEGANALLECWYPGQEGGTAMADILFGDVNPGAKLPVTV
FT                   ARDAGQIPIFYNRKPSARRGYVFEDISPLFPFGFGLSYTRFEFGPPRLSSPRIGTGGEV
FT                   TVEVDVRNMGQRPGDEVVQLYVRDRTASVTRPIKELKGFERVTLAPGESRTVRMTLKPA
FT                   AFALWNLEMEEVVEPGLFDIMTGPDSENLQKTTLEII"
FT   CDS_pept        complement(428492..430867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="SJA_C2-03460"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98709"
FT                   /db_xref="GOA:D4Z890"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z890"
FT                   /protein_id="BAI98709.1"
FT                   /translation="MIRLRKLLGAVSLLTLAVATPAAPIAAAPASTGARPLYKDANASI
FT                   ESRVDDLLSRMTLEEKIAQITAVWTEKVRIFDDSLQLDPSKLAQRFPHGMGQFTRPSDA
FT                   KGAFSPREVPGRNPRQTVALVNALQRWATTQTRLGIPILFHEEGLHGYAAVGATSFPQS
FT                   IAMASSWDPDLLREVNAVIAREIRSRGVSLVLSPVVDIARDPRWGRIEETYGEDPYLVG
FT                   EMGVAAVEGLQGKGRSRLLPPGKVFATLKHLTGHGQPESGTNVGPAPVSERELRENFFP
FT                   PFEQVVKRTGIEAVMASYNEIDGVPSHANRWLLRDVLRGEWGFRGAVVSDYSAVDQLMS
FT                   IHHVAADLEQAAGRALDAGVDADLPDGLSYATLGRQVREGKIGEALVDRAVRHMLELKF
FT                   RAGLFENPYADAAASEKITNDARARALALKAAQRSIILLKNDGMLPLKPEGSIAVIGPS
FT                   AAVARLGGYYGQPPHSVSILEGIRAKVGNRAKIVFAQGVRITENDDWWADKVTRSDPAE
FT                   NRRLIAQAVEAARHVDRIVLTLGDTEQSSREGWADNHLGDRPSLDLVGEQQELFDALKA
FT                   LGKPIAVVLINGRPASTVKVSEQADAILEGWYLGEQGGHAVADVLFGDVNPGGKLPVTI
FT                   PRSAGQLPMFYNVKPSARRGYLFDTTDPLYPFGFGLSYTSFDLSAPRLSAAKISVGGMT
FT                   RVSVDVRNSGRREGDEVVQLYVRDKVGSVTRPIKELKGFQRVTLKPGEVRTVTFTIGPE
FT                   ALQMWNDHMDRVVEPGDFEIMTGNSSVALKSATLTVAP"
FT   CDS_pept        431026..433158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="SJA_C2-03470"
FT                   /product="alpha-glucuronidase"
FT                   /EC_number="3.2.1.139"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98710"
FT                   /db_xref="GOA:D4Z891"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z891"
FT                   /protein_id="BAI98710.1"
FT                   /translation="MFARLFCWTVATAVMTAPALAEDGYDLWLRHEKVRDGGNLARHAA
FT                   AVVAPGRSATALAARDELMRGLAGANGAAPALVEKPMNGAIWLATPASAPDLPVKLDGL
FT                   GEEGYAIRSVTLDGQSVTVIAANGDAGLLYGAYAYLRLAETGASLDRLDIRSAPRMKLR
FT                   LLNHWDNLDGTVERGYAGQSIWDWWRLPDWKGPRYTDYARANASIGINGTVLNNVNARS
FT                   DSLTAPYIAKAAALADVFRPYGIKVYLSVKWTAPMELSGLRTADPLDPAVAAWWKAKAA
FT                   EIYRAIPDFGGFLVKANSEGQPGPQDYKRTHADGANMLAAAVKPHGGIVMWRAFVYAHD
FT                   NPDDRAKQAYSDFKPLDGQFADNVLVQVKNGAIDFQPREPFHPLFGAMPRTPLMMEFQI
FT                   TKEYLGQSTHLTYLGPLFEETLKSDTFARGKGSTVARVIDGSLEGHKLTGIAGVANIGA
FT                   DRDWSGSIFNQADWYAFGRLAWDPDLSAEAIAREWAAQTFSTDAKVVDPIVAMMMGSRE
FT                   AAVDYMTPLGLSHVMGTGHHYGPAPWISELARPEWNPVYYHKADAQGIGFDRTKTGSNA
FT                   IAQYAPPVAKMLADPKKTPERDLLWFHHVGWDAKLKSGDTLWNGLIRHYDAGVAYVAAM
FT                   RRTWDGLRPHVDAERFAQTQAFLGIQHREAKWWRDASIAYFQTLSKRPMPPGTAAPEHD
FT                   LNWYKSLAFPYAPGNP"
FT   CDS_pept        433256..434239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03480"
FT                   /product="LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98711"
FT                   /db_xref="GOA:D4Z892"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z892"
FT                   /protein_id="BAI98711.1"
FT                   /translation="MMTVSRVANKQSWVSPQTRARVEQAIAELNYAPNVSARALAGGDD
FT                   RRVALLYRNTTTSAYLGELLLGGLDEAAKHHLHLVVEQCETGATAEDIIAQILQARVSG
FT                   VIVPPPLCDWDELAQALTRQDIPWVAIAPDESHGMMVVAIDDRQAAGEMTRHLIDLGHR
FT                   RIAFIQGNPQHRSSARRLEGFRAAMTAQGLAVEEDYIVEGDFSYRSGLEAASHLLSLET
FT                   PPTAIFACNDDMAAATITIAHQRQISVPADLTVCGFDDTPLAAAIWPTLTTIRQPIRDM
FT                   SRAAMTLLAEAMKRGDEMNGRGLARLDYSLVRRQSDAVPRLNHRRA"
FT   CDS_pept        complement(434358..434771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03490"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98712"
FT                   /db_xref="GOA:D4Z893"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z893"
FT                   /protein_id="BAI98712.1"
FT                   /translation="MEADGAMLQDGDYAALAEFRFALRQFQAFSSERAAQMGLTPQQHQ
FT                   ALLALRAVPAQDATVGYVARRLLLKPHSATGLVDRLEKLGLVTRHASATDRRRSQLQLT
FT                   PRALDLLAKLSATHRDEIRRLRPLLNELLARFA"
FT   CDS_pept        435109..435984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98713"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z894"
FT                   /protein_id="BAI98713.1"
FT                   /translation="MRRHAALAAMAVAFLCPAAAGTAPLPPVRILLFAGPKQHGAPGRH
FT                   EYEKDMRELAWLLEHSGAARQVKTQVIVGEKPRDQAMLETADAIVIDGNGDWLKRETGA
FT                   IFQQYAETDGLGYNAETTAALKDFDALLKRRKTGLVVYHYTMFVDNRAGRLYLNDWLGG
FT                   VWIPYVSHNPVDTWAIRPIPGRHPILRGVKPWTPREEMYARYFLPDNSRRTPLLTARPS
FT                   QAANGTGGPVAWAYERPDGGRSVVWGGNDFHDNMHLYPQQRRFLVNGILWAAGVEVPRG
FT                   GANDQMPPEF"
FT   CDS_pept        436056..437042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03510"
FT                   /product="putative demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98714"
FT                   /db_xref="GOA:D4Z895"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z895"
FT                   /protein_id="BAI98714.1"
FT                   /translation="MGFDRRLMGAALALSAMLLSQPALAEDGFFTREQVIRHTPAWTGE
FT                   RFPDGRPKVPDDILERMREVTLEEAWATLRSAGFNHQYEDGWLSIFPGKVLVGRALTSQ
FT                   WLPGRPDIQTVLEKQGIADKRKGAMNAWPVDMLQRGDVYVSDHFGLKQDGPSIGDNVGN
FT                   AIYARSGNGIVYDGAVRDINGLKELPNFVSFVRSYDPSHHFGAMATGARLNSTMVGING
FT                   PIRIGKATAMPGDVVLGRDGGVLFIPPQLAEKVVKLSENTRLRDLFGHMRLREGRYTAG
FT                   QIDTRWTDAIEADFFAWLQANQNKLPVKPEAVRQIIRDHEAGIPYEG"
FT   CDS_pept        437113..437550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98715"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z896"
FT                   /protein_id="BAI98715.1"
FT                   /translation="MDFRLPFAAALLGLSLAGAAQAATPAEVVARHVESMKLGKLQPIM
FT                   DDYSADTVVVTPQGLVADQAPARGPGIYSGQAQARRVFATLTDKDHHPGIKAMETTIEP
FT                   AGPDSVILHWVQFKGQPQQVSGKDAFIVRDDKIVFQAIFVD"
FT   CDS_pept        437636..438652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03530"
FT                   /product="fatty acid desaturase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98716"
FT                   /db_xref="GOA:D4Z897"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z897"
FT                   /protein_id="BAI98716.1"
FT                   /translation="MEEVAKERPPGYRYSRRGTLALVRELSVIDNRRNALLLVLQWAIA
FT                   IAAGAVAIHVDRIPVYLLAGFVIGSRIQCLAVMMHDACHGMLFSNRRLNDLIGDIFVAY
FT                   PLGFSIDLYRANHMYHHRYTNTLRDRDYRVQRRDSDQHFPKSAAAMAWLLVRSVTGLNF
FT                   YRMARDSRVWAPFANFHNPGRFGYDFSLGLRIRYVLWALLFYGLILLSPFRWKILGLLL
FT                   IPQFIWANVFNRIRAMAEHNGVADERELNGTRTVIPTLLDRFLIAPFNVSYHLEHHLFP
FT                   SVPWPNLRRLHAHLMTDPTYAADAHITRGYWGMIRELMPPRASAGESGPVVPSEAKS"
FT   CDS_pept        complement(438711..439421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03540"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98717"
FT                   /db_xref="GOA:D4Z898"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z898"
FT                   /protein_id="BAI98717.1"
FT                   /translation="MSYEPRKSPPAESAFATHTEAAARLLSDAILSGDIAPGTRLNIRA
FT                   LSEGTGLGPTPIREALANLAGRGLVTFAGQRGFRVVPVSPQDLQSIMTARTVVEQGALA
FT                   LSMDRGTEDWEVEIVASLHRLKMFTDNPPTDIDKRIDTFERVHWRFHLSLIGACGSDHL
FT                   IAIYQDLYEQTRRYRSLMLKTDVDPDQAYEKHSLLAQFCLSRDKRRALEMLSGHNNMLL
FT                   STIYGPVAEAAEKV"
FT   CDS_pept        complement(439476..440780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03550"
FT                   /product="putative MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98718"
FT                   /db_xref="GOA:D4Z899"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z899"
FT                   /protein_id="BAI98718.1"
FT                   /translation="MDGRSTGAINPDIGLFGAAGEAEGEAELRHGWPIILVAFLGITVG
FT                   ISSTFLFSTGLFLKPVADAFGWGRGTVSIAPFVASMLTALCAPFVGRCVDRFGVLPVLL
FT                   PSLLGLAAGLLLLGMLSADFFSYVALMALVALLGAGTAAPVITKMIIAGFKRRRGLALG
FT                   LSLAGSGLGGGLIPLFLTPIIAAHGWRAGYMALAGIELAGFAVIGALIWLWRRTILPPA
FT                   RPTGARVPRQEAAVSADGPPLLRDRTFLLLALAFFLSAWGILTTVVHFVPMLTDAGVDA
FT                   TRAAGMAGTIGAALIFGRIVVGYLLDRLPAVALAQCLFAMVAAGMLTLVAGGAHVAVVA
FT                   LIAAIAAGIGIGSENDIMSFLVGRYYATSRFGSVNGALFAVFLVGGSIGPAASGYMYDA
FT                   TGSYTLALLLSAGALVTAALLLFALPKLPSSAASG"
FT   CDS_pept        440911..441867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apbA"
FT                   /gene_synonym="panE"
FT                   /locus_tag="SJA_C2-03560"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KPAreductase / Ketopantoate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98719"
FT                   /db_xref="GOA:D4Z8A0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A0"
FT                   /protein_id="BAI98719.1"
FT                   /translation="MGGHFAARLAAAGHEVSIVVRGAALAAIRARGLTLLSGPERLDVR
FT                   VKASDDPADLGHQDLVISTLKSSSLHVLAEGVQPLLAPDTPVVFAQNGIPWWYTHGLPQ
FT                   SPLLPRLRWLDPGGALEEHVGLRRTIGGVIFSSNEVMEPGVVRNDSPEYNALFVGEPDR
FT                   SESDRIVKLRTILADARLASPSHHDLREVLWRKLIANMTVSVLCMITGQTAREAVEDPI
FT                   FGDTVPRLMAEAVAIAAAQGYSIPPMPPGYRAPDHKPSLLQDFLLGRTLEMDALVKAPM
FT                   AFARAAGLASPTLDMLGALAQRLAANAGLYRPVAAAG"
FT   CDS_pept        441964..443493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03570"
FT                   /product="putative AMP-dependent acyl-CoA synthetase"
FT                   /EC_number="6.2.1.-"
FT                   /note="AMP-acid ligase II"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98720"
FT                   /db_xref="GOA:D4Z8A1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A1"
FT                   /protein_id="BAI98720.1"
FT                   /translation="MTATLLSGNRVMQPAAFEREIERAAAAMQSSGVAPGDAVALLLRN
FT                   DFAFFVASLAARWIGAFATPINWHATPDEIGYILEDSGARLLIAHDDLAAPLADRLAGM
FT                   TLVCVPTPAEIAAAYRLPPSTAPAGAMAWDAWLPDEASPAPPRGPGGASSLIYTSGTTG
FT                   KPKGVRRRPFEPGHLAAQAQIAVHGYGLDPAETIRVLMTGPMYHSAPNAYGLVSAELAE
FT                   KIVLEPRFDAEELLALVQQHRITHMHVVPTMFVRLLKLPEKVRAGYDLSSLRFVVHGAA
FT                   PCPTQIKRQMIDWWGPVIHEYYGSTETGLVTGHGSSDALARPGTVGRALPGVTLRVIGE
FT                   DGKHAGTGEAGDIHVRSEAVPDFTYHGHPDEKSALEQAGFVTVGDIGWLDEDGYLFLCD
FT                   RRRDMIISGGVNIYPAEVEAALLGIGGVRDCAVFGIPDPEFGEAVCAYVEPDEEATLDA
FT                   AGIQRSLAGSLSRYKIPKVVRFETHLPREDSGKIFKRRLREAYWANEGRAI"
FT   CDS_pept        complement(443531..444334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gip"
FT                   /locus_tag="SJA_C2-03580"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98721"
FT                   /db_xref="GOA:D4Z8A2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A2"
FT                   /protein_id="BAI98721.1"
FT                   /translation="MTMKISASVSTMFRELPLLERFAAAARAGFDGVEIQVIDEGDPAE
FT                   MAQAARAAGMPVVLMNLPLGDLFAGGPGLSGVPGREAEFASAAERGLRAAREMDARFVH
FT                   VGPSRIPPGHDREACLETYRRNAGQALALAGRLAPDAVLLVEPMNRVEMPDALFASIDE
FT                   AADMVRLIGSAGFGLLFDLYHVAMNGDDIARAWAAHGHIAPHVQFSDAPGRNEPGTGSI
FT                   DFAAAFAGFRASGYGGWHGAEYRPAGPTTAGLGWLAEMRRLHPSA"
FT   CDS_pept        complement(444342..445232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garR"
FT                   /locus_tag="SJA_C2-03590"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98722"
FT                   /db_xref="GOA:D4Z8A3"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A3"
FT                   /protein_id="BAI98722.1"
FT                   /translation="MIDRVALLGTGLMGAPMARNLARAGYAVSAWNRTADKAAALAEDG
FT                   VSVADTARLCVADADSVFIVLSDGPACDRLLFGDDDGVARWIRPGATVVMMSSIDPPSA
FT                   RRQADRLSALGIDYMDAPVSGGERGAIDARLTIFAGGVPATVEKMRPLLETLGRVNPVG
FT                   GVGSGQLVKLANQMIVGITIEAVAEALLLIERGGGRPAEAFAALEGGFADSTVLRQHGA
FT                   RMLNGNHVPGGTVATQLKDLRMATAMAADLGLSLPLLAGAEDMFARAADGPDRSLDHSA
FT                   VHRALRAMQSIGDAI"
FT   CDS_pept        445332..446294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03600"
FT                   /product="putative FAA hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="fumarylacetoacetate (FAA) hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98723"
FT                   /db_xref="GOA:D4Z8A4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A4"
FT                   /protein_id="BAI98723.1"
FT                   /translation="MRFVTYEHGGNRFVGALVGDDAVKNLTAASAASGRGDPAWFTGMQ
FT                   ALIEAGDAGIDEARRLMESDGHVVPLADVRLLAPLPRPQSIRDFFTFPDHIRQSYAGMQ
FT                   RLGARLAGMPAPTAPPLTELPALYLEKAIYHKGNPLTVVGPDTEILWPRYSKFMDFELE
FT                   LAIIIGRPGADIKAERAAAHIFGYTIFNDFSARDAQMAEMPGMMGPAKGKDFDRSNAIG
FT                   PCIATPDEFADVHDIRMRALVNGELWAEGSNSAMLHRFEDIIAYVSRDETLHPGELLGS
FT                   GTMGNGCGVEHDRFLEDGDEVALAIDGIGVLTNRVRRQD"
FT   CDS_pept        446464..449520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03610"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98724"
FT                   /db_xref="GOA:D4Z8A5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A5"
FT                   /protein_id="BAI98724.1"
FT                   /translation="MTRIFIRKRTGFLLGAAMAGLIAPSVAQAEEASKSAPPAAEGGGR
FT                   ASAPASVIDIVVTAQRESQSLQSVPISVSAFTAETLQRQQIDNSLDLQLSLPNTIFTKN
FT                   NFSKSSFTIRGIGDLCVGSSCDSATGITNNELPLFDTRLFEVEYFDLERVEVLRGPQGT
FT                   LFGRNATSGVVNFITAKPDLNGVHASGEIEYGNYDSRKVKGMLNLPLTQSLGARFAGIY
FT                   VNRDGYTKNLHDGARLDGRDIYAVRASLRWEPSSSTTIDLLGYYFHEKDNRLRIQKQKC
FT                   LRDPTGVLGCLPGRLGNDYTNNNATFGGTLTSREYLTMQGGPGIGALALGSLYGPDSNL
FT                   GNPLIADPRTVNTDFHPTFFSDEIQAQLRIEHDFGPVTLKVSGQYQRTRTAASQDYNLS
FT                   VNNAALFLPGLSTLQAYGNGVAGPSLAQFGRVAAALIPNGPAGPYCTSIVEPSATGAFG
FT                   GHSLCSATPQDFDRTSLFGRAFTGEAIVASKFDGPFNFLVGGIYSDYRNHNADYNVNAF
FT                   NIDYAAGVLGVLTSLGQQGGQAAAGQPVTYPTVFLASPYVRNNSQLFQLKSYGLFGEAY
FT                   FEPNDRLKLTAGLRYNHDDKSNRARNTIISFPVPYGTANAFDSPFFAAYDADAGRPGIQ
FT                   PVQQRDATFGEFTGRAVIDFQVTPRNLLYASYSRGYKSGGINPPLLPIFNISDSFEPEF
FT                   VNALEVGSKNSFLGGSLRLNASAFYYQYKGLQLSRIVSRTSVNDNVDADIYGIELEAIA
FT                   RPIPALTVNINASYLHTKVSSDRYITNPRDPSGGRSDAVIVKDISNGSNCTVVPNTAGN
FT                   SAASNNFVNFVNGEINAGRVVNSSTGRPLFRPGAGLQGTTPFPADSGLNGATGAYSICS
FT                   ALASYVASAGAGPSGVSVLTDGVPVNLRGNRLPQAPDFKVSAGAQYVVDMGTGGSTLVP
FT                   RVDVILTGGSYGSVFNGNANRIPSYVIVNAQLQLNGRDDRWFVRAFVQNLTDSNAITGL
FT                   YVSDQPSGLFTNIFTLEPRRYGIAAGVNF"
FT   CDS_pept        complement(449590..450720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03620"
FT                   /product="beta-lactamase-like protein"
FT                   /note="putative Zn-dependent hydrolase of the
FT                   beta-lactamase fold"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98725"
FT                   /db_xref="GOA:D4Z8A6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A6"
FT                   /protein_id="BAI98725.1"
FT                   /translation="MPRNPYYAGPPSDHFDGLRFFNPGQASTDRGLGDLLRWRLGKRAA
FT                   PWPRSVPVTPTRPAQSSQALVVTMVGHATVLIQAAGCNILTDPVWSDRASPVAFAGPRR
FT                   VTAPGVAFEDLPRIDAVLVSHCHYDHLDLGTLARLHARDRPLMVMPLGNDAIVRAHIPD
FT                   ARLATGDWWDAITLAPGIATTLTPAVHWSNRSLADRRMALWSGHFLATPAGTVWFAGDT
FT                   GFGDGAIFARIAHLGSPDLALLPIGAYAPRWFMAAQHVDPAEAVRIFQIVGARRALGIH
FT                   WGTFRLTDEPRDEPVLRLGEALAAAGVDPARFVAARPGEVFTDSQGSVDEFEMSGIGQL
FT                   RTSVFRHPGLDPGSRFSLKRRLDQGSGTPGQARGDE"
FT   CDS_pept        complement(450725..451354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03630"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98726"
FT                   /db_xref="GOA:D4Z8A7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A7"
FT                   /protein_id="BAI98726.1"
FT                   /translation="MPAEPNAAPAYHHGDLRRVLVDAATAIVAEEQNWEFSLREVARRA
FT                   GVSHNAPYRHFPGKLDLLGAIAIKGFVDLRAAMLAAAQQSECIEEALIAIGAAYVAFGL
FT                   DNPARYRLMFGTALAASRAALPYPVGEAAAGSHAVLLSVIAQGIAEGVFDAPPDDEEAA
FT                   AIVALAAWANVHGLVLLLLDGLSVVPPVPSLAERVGRILLGGIKRR"
FT   CDS_pept        451438..452415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03640"
FT                   /product="thiJ/pfpI-family protein"
FT                   /EC_number="3.2.-.-"
FT                   /note="thiamin biosynthesis / intracellular protease I /
FT                   putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98727"
FT                   /db_xref="GOA:D4Z8A8"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR032633"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A8"
FT                   /protein_id="BAI98727.1"
FT                   /translation="MRPAPHAGPGPPLDGAEAVRSPSIEESIMAHILFPLPSRDFDPTE
FT                   VGVTWRVLTAAGHGVSFATPDGKAGAADPIMITGRGLDPWSPIPLIGRITVIGRVLRAN
FT                   KDARRAYAEMIASPAFRSPRRWDELSVDGHDAIVLGGGHRARGMREYLESPVLQKLVAD
FT                   FFAADKPVAAICHGVLLAARSKRADGRSVLHGRKTTALSWRHERTASAFAHVGRFWDRN
FT                   YYRTYLEEDGQPKGYMSVEQEVIRHLADPGDFIDVRPEDPHFRRKTSGLVRDSFIDHSP
FT                   ALVVEDGNYVSARWPGDTHCFASTFARLLARSPAEEDARRARVA"
FT   CDS_pept        complement(452471..453394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03650"
FT                   /product="putative metallo-beta-lactamase"
FT                   /note="Zn-dependent hydrolase/glyoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98728"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8A9"
FT                   /protein_id="BAI98728.1"
FT                   /translation="MIATMTIAASLAISPAAAATGPEPEAMAAADRAGGARPSDDPLTR
FT                   PMAVERAKEWLAPLPPERIFGNSYLVGFAGLSVALIDTGAGLVLIDGALPQAAPMILSN
FT                   VRKLGFDPRDIKFILSTEPHYDHAGGIAALARDTGATVVASRRGAEGLRAGAHAKDDPQ
FT                   FDYGGAWPAVSRLRVVKDGEVLRIGRASIAAHATPGHTMGSMTWNWNACEGKRCKAIVF
FT                   ASSLNPVSADRYRFTAPSSAPIVKGFEASYRRMGALNCDILISAHPDNAGAGRYGSGSG
FT                   ACRSYAERSRRLLAKRLAEERRETSK"
FT   CDS_pept        453490..454413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03660"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="glycine cleavage system transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98729"
FT                   /db_xref="GOA:D4Z8B0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B0"
FT                   /protein_id="BAI98729.1"
FT                   /translation="MDRAQLPLNALRAFEAAARHLNFTRAAIELCVSQGAVSHHVAQLE
FT                   RRLGVRLFHRLPRGLSLTDEGRALVPVLAEAFDRVGATLDQYAGGRFREVLKVGVVGTF
FT                   AAGWLLPRLDAFARAHPAIDLRVSTNNNRVDLAGEALDFAIRFGDGAWHGTQAEPLIEA
FT                   PMTPLCAPALAARLRSPADVLHERLLRSYRPDEWALWFEAADIPVPLFRGPVFDSSALM
FT                   VSAAMAGFGVALAPPAMFIRELASELLAQPFPIMIDAGRYWLTRLMSRPETHAMRCFRE
FT                   WLGEEITAPIASWPYVREQGGGANFP"
FT   CDS_pept        complement(454374..454877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03670"
FT                   /product="flavin reductase-like protein"
FT                   /note="FMN-binding protein / conserved protein/domain
FT                   typically associated with flavoprotein oxygenases,
FT                   DIM6/NTAB family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98730"
FT                   /db_xref="GOA:D4Z8B1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B1"
FT                   /protein_id="BAI98730.1"
FT                   /translation="MTLAIEPATFRRILGHYPTGVCAITAMPPDGRPAAMIVGSFTSVS
FT                   LDPALVAFFPDKASSSWPRIAEAGRFCVNVLGDDQEALCRTLASKDPDKFAGIAHRPSA
FT                   LGSPLLDGAIAWIDCTIYAVHDAGDHHLVLGSVHALDVHHPGAPLLFHRGTYGKLAPPP
FT                   CSRT"
FT   CDS_pept        complement(455016..455390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98731"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B2"
FT                   /protein_id="BAI98731.1"
FT                   /translation="MFKLLVSMRRKPGMSLDEFIRYYEEKHAPLARRILPPIGVYRRNY
FT                   IRADDPLLASVGDGRASAASVDFDVITEAVYPTRAHAEAGIQAFFDADIMQVIRADEDE
FT                   FVEAGSVKMYVVEVHQSAIP"
FT   CDS_pept        complement(455433..456191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03690"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98732"
FT                   /db_xref="GOA:D4Z8B3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B3"
FT                   /protein_id="BAI98732.1"
FT                   /translation="MSEGVESASNGRLGGTVAIVTGAASGMGAAIARKFVEAGASVVLA
FT                   DRNPAGERLAAELGAAARFQLLDVASESQWDDACSTALAAFGKLTALVNCAGIFIPLPM
FT                   LETDREQFARSVDVNQLGVFLGMKAAAPLIADAGGGSIVNISSGVALRGIAGMFAYSAS
FT                   KWAVRGMTRCAALELAKHGIRVNGIYPGAIDTPMIQLNPAGFNDAIVATMPLARMGTPD
FT                   EIADAVTFLTSAEAAYITGAELPVDGGGAI"
FT   CDS_pept        complement(456188..458563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03700"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98733"
FT                   /db_xref="GOA:D4Z8B4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B4"
FT                   /protein_id="BAI98733.1"
FT                   /translation="MAKVHLITALVATTILSSPAYASADEQTGSVAASPQSSADGAPFA
FT                   SIPDIVVTAQKRSESINAVPMSITALGGAELAQRGIANVADLAKVVPGLTFAPSLNNTP
FT                   VYSLRGIGFNDSGFGSAPAVAVYIDESPLPFPVMTEAAALDLERIEVLKGPQGTLYGQN
FT                   STGGAINYIAAKPTPIFEAGGQVSVERFGKTSVEGFVSGPISSTLQARVALRTVQGGAW
FT                   QYSLTRPGDKRGEQNQLAGRLLLDWTPAERLTLRFSANAWRNRSDTTATQLVQIVPDNP
FT                   GPVSPEVAASPIAPNNPRAADWDPSWPKAMNDRYWQVGLRGEYELSDQLKLISITSYQH
FT                   QDLDRFQDYDGTAFVDFTGRAFGRIKTFNQELRLSLDTDRFRGLIGANYDYANVDDRHQ
FT                   YRIFDASASTPFPDLPPISAAISQALQKTRTYAVFANAEYEVVDGLSIKGGIRYTKQNR
FT                   SAYQCSYDGSVENATGRIFTRLQEIFAAFGLKNTPVEVVDQNQCYSLTPAPELLPAGNQ
FT                   SSLNEDNISLLAGMSYKAPSGALLYATFSRGYKAGAFSNISASSTSQYVPARQERVDAY
FT                   EAGAKLPLFDKHLQFNLAGFYYDYRNKQERARIEDLVFGLLELLVNVPKVRSVGAEASL
FT                   VARPYPGLSLSAAATYIKTKVVSDFTTFNGAGDFGNFRGSRVPFTPTWQGSADAQYEWN
FT                   AGSFKAFVGSSLNFQSASNSTFTLPDNPETLYRLRGRALLDLRAGVAGHDDSWRLTLFG
FT                   RNVTNKLYETSVNFANDTIARRVGTPATYGISLTVRTR"
FT   CDS_pept        458831..460060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03710"
FT                   /product="putative dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /note="Rieske (2Fe-2S) protein / phenylpropionate
FT                   dioxygenase or related ring-hydroxylating dioxygenase,
FT                   large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98734"
FT                   /db_xref="GOA:D4Z8B5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B5"
FT                   /protein_id="BAI98734.1"
FT                   /translation="MSRNSATPVESPIRPATAEGTGGGLSVPLEPYRSPEFFAAERERL
FT                   FGRAWLLMGRIEELPTPRSHVVKRVDICNASILITRDGGDIVRAFHNICPHRANLLVRT
FT                   ESGSGGTLVCNYHNWSFSLDGSLKGVPGESMFGGLDKKKCGLKPIALSVWEGWIFINLD
FT                   PEPAMTLEEFLGDMAPYLSGLSYPYADTPVVLEVKVKCNWKVVMDAFAEAYHLPALHRN
FT                   TICEWFSDRSNAFGKPLTTRIMGLHAVNSMYGNPDYAPGDRNAFERIVENPAHMASDHV
FT                   ETLNHYRAHAAVNPTKTARWSMDVNYIFPNVHIDSIRTGFLVHHFWPVSVDEAIQETRM
FT                   YVRRPRTIRERIAFEFHLARAFDVYLEDLSNVEYTQVGINSRATDTIPLSEAEILIHHS
FT                   ITKLQEWISG"
FT   CDS_pept        460101..460433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98735"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B6"
FT                   /protein_id="BAI98735.1"
FT                   /translation="MLLPEKFAEWEGFVSAWCLPDTHARFQARYEGDPADLRHFYDSLM
FT                   PRVEEALAYLDDFPLEAMEEPERNLMNLLMSLSHVAYGLERHGAPRAPNAVYPSRIRLV
FT                   RSVSPA"
FT   CDS_pept        complement(460473..461285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03730"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98736"
FT                   /db_xref="GOA:D4Z8B7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B7"
FT                   /protein_id="BAI98736.1"
FT                   /translation="MTFEGKVAIVTGAGTGLGAAVARRLAAQGAKVVVNYSRSRNEAQG
FT                   VADEIVAAGGEAAAVQGNVDQDEDCRRLVAETVDRWGRVDILVNNAARTKLVAHDDLDG
FT                   LSAEDFLAIYRTNVVGAYQMVRACRPLMKAQGFGAVVNVSSIGGLLGVGSCMAYSASKG
FT                   ALNTMTMAMARSLGPEIRVNAVCPGFIASRWFSDPFGQEGLQQMIEAQQCLTPLARAGT
FT                   PEDIAKAVVFLAGEGAEHITGVTLISDAGLHLSTGATTPRKEEMTSGR"
FT   CDS_pept        complement(461582..462193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03740"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98737"
FT                   /db_xref="GOA:D4Z8B8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B8"
FT                   /protein_id="BAI98737.1"
FT                   /translation="MEAGQQLLMSEGIAGMRLTKLTKRLKVSTGSFYHHFSDMDDYLGA
FT                   LADYFNVAQVQGLVAELAAESPDPMVRIRHLASRSLKSSLFALDRAMRVWSASDPRAAS
FT                   SVKQAEKIVLDFIADAFEHIGFGRKEARTRARILLTAAITPLLSSTKEEEKLFREEVLA
FT                   VLLESEPGGSRQAAPKSGSPPRQGARGGKRSTAKNSAAAA"
FT   CDS_pept        462291..462602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98738"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8B9"
FT                   /protein_id="BAI98738.1"
FT                   /translation="MDYPRSAGKPRRLLAGKRPARSDEPPTAEENAAKASPIPVRDRRG
FT                   RTGKPCAGKEIKDGGCIRARNASRKSSRMPGLQQEISYFMLRLKHVDGTARAGHPCNA"
FT   CDS_pept        462622..463197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03760"
FT                   /product="BphC-like dioxygenase"
FT                   /note="2,3-dihydroxybiphenyl dioxygenase, BphC /
FT                   lactoylglutathione lyase or related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98739"
FT                   /db_xref="GOA:D4Z8C0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C0"
FT                   /protein_id="BAI98739.1"
FT                   /translation="MAEAKAKQAGDGKARRKVVPTHMAHFVVKTAQYEKMIDWYLTFFD
FT                   GEVVFSNEIATFLTFDQEHHRVAIVNMPGLLPQRDDTAGVHHVAFSLASLEDLLENYKR
FT                   LKERSILPWWCVNHGPTTSMYYKDPDGSQVEFQTDNYETFGETAEFMKSQAYADNVGGV
FT                   DFDPEELVRQFEAGIAVDFLLKRPDVRG"
FT   CDS_pept        463348..464994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03770"
FT                   /product="putative FAD-monooxygenase"
FT                   /note="2,4-dehydroxybenzoate monooxygenase /
FT                   2,4-dichlorophenol 6-monooxygenase /
FT                   2-polyprenyl-6-methoxyphenol hydroxylase or related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98740"
FT                   /db_xref="GOA:D4Z8C1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C1"
FT                   /protein_id="BAI98740.1"
FT                   /translation="MDVPVLIAGGGPVGMILSLELAHQGVRSILIERNPTTTRHPKMDL
FT                   TNGRSMELLARLGVVDILRAAGVPSGNCFDIVRVSHGLPGVGKELFRFAYPSPDEVRRM
FT                   SRETNDGTLTREPPLRISQILLEPALLEVIGQNPLIDARFGWTVQSFEQDEDSVRVAIS
FT                   ETDGTATETIECAYLAGCDGGGSNVRRGLGIKYEGDFAVGSFYMVHFRSDALDALQPDG
FT                   PWWHWLTNAGGMVAQNDRDLWTLHTPVPEGIAPESVDPRALLRNWAGRDFDFEILVANP
FT                   WTPHMVVAERYGEGRVWMAGDSVHQFMPTGGYGMNTGVGDAVDLGWKLAAVIHGWGGPA
FT                   LLRSYEEERRPIAIQNRAASRRHLDVNIAIWSASPATTDDDKAWDHMAEEIERLGNAEN
FT                   ESWGIEHGYRYAGSPIIAPDGTPEPPFDPDSYRPTTWPGARLPHYYLEDGNALHDILGP
FT                   GFTLINCRGADTGPLEDAAAQMGLPLKIVGLHDPKVCAAMERPLLLVRPDQHVAWRGTE
FT                   LPADCLALLRRVTGWQSALEREIPERSHARA"
FT   CDS_pept        465050..465472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98741"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C2"
FT                   /protein_id="BAI98741.1"
FT                   /translation="MDNPTEIKAACGDIIAAFAHHVDHREFGDAVALFAEDGAFLRPDL
FT                   EARGSDQIAALWADRPASFVTKHLCHASFFHDVGEESARAVTPFLLYTAEREGDETAPL
FT                   EGPAAIAEYHDLFVKTDEGWRIAERRAIPIMLPRRA"
FT   CDS_pept        465517..465858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98742"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C3"
FT                   /protein_id="BAI98742.1"
FT                   /translation="MPRYIAVALTNPVEGKEAEFNHWYDTVAIPSYRKIPGLVPLGRFR
FT                   HHSRGDDSDMPTYWKYASFYEIETDDFDGFVATVKKTLDNIPEYHLSEFLDRKSWFEPV
FT                   YEALSGDAK"
FT   CDS_pept        465855..466694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03800"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98743"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C4"
FT                   /protein_id="BAI98743.1"
FT                   /translation="MTLEPAMSLEGRVALMTAAGSGIGRASALAVASLGASVMVTDINA
FT                   DSARDVADRIVSAGGRARHMALDVAQEEQIAAAVAAAVSAFGRLDILHNNAAYQGADAI
FT                   EGDIDVVSMTVDFWNRMMAVNLTSHMLGCKHAIPAMLENGGGSIINTASMYGLAAYQAM
FT                   PCYGISKAGVAMLTKYVAASHGKRGIRCNAIAPAVILTEGVKRFLPQELVDMNESHAAL
FT                   PYLGKPEDVASMVAFLASDAARFISGQVIAIDGGTTAQLPTVTAARALAEKARTHGR"
FT   CDS_pept        466713..467441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98744"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C5"
FT                   /protein_id="BAI98744.1"
FT                   /translation="MHMWRQIMFLQRAAGTSRAEFLARWPDVTDAIAKGHGPKPRRIVE
FT                   NHPLDPMEQGLCGDVIPAAYDGVYEFWFCSEKEAMDALPSWNASRDLRLKMDGWIDKDN
FT                   SLQWLAEIHMRIDLPGTTATLILAGKAADGYDVERAQQYWRDIHPKVFLAEKDFAEYIT
FT                   GYVQNHGRDRAALQGLDLFGRYEFMPLCGHMGLRSLRDILTAYTLPSYAGPIRADEAVF
FT                   GKPDGALAFASTKSRSTEPR"
FT   CDS_pept        complement(467564..468973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03820"
FT                   /product="aromatic ring hydroxylase"
FT                   /EC_number="1.14.14.9"
FT                   /note="4-hydroxyphenylacetate-3-hydroxylase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98745"
FT                   /db_xref="GOA:D4Z8C6"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C6"
FT                   /protein_id="BAI98745.1"
FT                   /translation="MARKTPQQYIESLNDGRVTYWDGERIDDITTHPRFQVPLALTASD
FT                   YDDGDPEVNEFRFYRDEEGNEHHRIFQIPTTKEHLVERVEMMKQTTIGTLVTGVFMALM
FT                   SVKDDVAKVNPRYAHNIERIYKYARDNDLRGAEVITDPKGDRKRRANEQDDPDLYVRIV
FT                   ERREDGIVVRGAKLHITAASLVHELVVMPTKGMRPEEADYAVSFSIPVNTPGVSIINRS
FT                   FAPAELNEFDYPASSHHSMPEGFVVFDDVFVPWDRVFLAGEVELASVLARSLGLWERTG
FT                   GLVESVRNGELYIGLAQLVSEMQGKDKDPVVQSSLSELIVYQEMIRMGLDYACEHYETS
FT                   QPSGMVFPNTLAVNATKYYLAANFHQTIKYLHDLAGGLVITVPMEADLRNEESGKFIRK
FT                   YLYTRKDVDIEARMRVYNLIRDLTADAYGGWWFVVALQSGGGLPAQRTMMNRTFDMEKA
FT                   KAAARKAAGIS"
FT   CDS_pept        complement(469086..470207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="SJA_C2-03830"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98746"
FT                   /db_xref="GOA:D4Z8C7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C7"
FT                   /protein_id="BAI98746.1"
FT                   /translation="MAERMPSSGAMASMEDIVDDAGRGEPCVLVDSDDEDAEGSILWPA
FT                   AFADAAAISFMATHARGLICLAITAQRAGELRLELMAPRAPSSEGRPFTVSIEAREGVT
FT                   TGISAHDRARTIQVAIAADSLPSDLVSPGHVFPMVARDGGVLARADHVEAAVDIARLAG
FT                   LAPAGVVCGVLNADGSTARLRDLRGFAARHGLRIGSIADLIEYRRRLECQVEEVRRGPF
FT                   KSLYGDFTMHVFRNRIDDTEHVALTRGRIGPGMPTLVRMHQVDMATDLLAHAEARQAYL
FT                   PSAMRMIANQEGPAALVLVRDPDQDWLSRRMAGMQDKAAKQMALRDYGVGAQILLALGV
FT                   RDMILLSSSRVKLAALAGYGLNIVERRPIQTIL"
FT   CDS_pept        470501..472564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="SJA_C2-03840"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98747"
FT                   /db_xref="GOA:D4Z8C8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C8"
FT                   /protein_id="BAI98747.1"
FT                   /translation="MTEVAKLEKHGSIAVLTIDSPPVNALGLDVRRALLKYISMAEADP
FT                   EIEAVILACAGQTFSAGADISEFGKPFQAPDLGVVCRHIENSSKIIVAAIHGTALGGGL
FT                   EVALCCHYRIAVPSARLGLPEVALGLLPGAGGTQRIPRLIGARKALEFITGGAPVSASA
FT                   AREMGIVDEVADEGALVGSALEYVRKLIAGGAPLRRVRDLEDRIAADRQQPELFDEFRR
FT                   SNARAFRGKDAPESIVKAIEAAVALPFEEGLAREFELFVELEKGLQAKAQIHAFFAERT
FT                   ASKVKDVPGDTPVLPVRTVGVVGAGTMGGGIAMNFLNVGIPVHIVETAQANLDRGIATI
FT                   RKNYEISLKRGKLTAEALERRMSLLHATLDLGDLRDCDLIIEAVFESMPLKQEIFAKLD
FT                   AVARDGAILASNTSFLDLNQIARATSRPDHVIGLHFFSPANVMPLLEVVRGDATAKPVV
FT                   ATAMKLARKIGKVPVLSGVCDGFIANRAMRARTEQADLLLLQNLSPDAIDAAIYDYGFA
FT                   MGPFRMLDLVGLDVIGRDSTERSVAKDLVAAGRMGQKSGGGYYDYDEARAARPSEAALD
FT                   IIRAHAAWKGIAQRSFSQEEIVARLLHPVVNEGAKILEEGIAMRASDIDVAMIKGYNWP
FT                   VQTGGPMFWADAVGLPRIVETMKALEAEQGEAMRPSRLLVELAESGRTFGSL"
FT   CDS_pept        complement(472623..473342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="SJA_C2-03850"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98748"
FT                   /db_xref="GOA:D4Z8C9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8C9"
FT                   /protein_id="BAI98748.1"
FT                   /translation="MSNMVLIERKAGYAIVTLNRPEALNALSDRLRADLNAAMRSLAED
FT                   GDVRVVILTGSGRAFCAGLDLKEIAEKGFPKFGDADLADPVRSVASFPGPVIVAVNGHA
FT                   ITGGFELALAGDVILASENASFADTHARVGAMPGWGLSQRLSRLIGVNRAKELSLTCRF
FT                   VPAQEAERWGIVNRVVEPDRLLETAEEMAQAMLATAPGMIERLKAVIDDGYLLTLGEGL
FT                   ALEGERAQRFNEGARPA"
FT   CDS_pept        complement(473415..474578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="SJA_C2-03860"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98749"
FT                   /db_xref="GOA:D4Z8D0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D0"
FT                   /protein_id="BAI98749.1"
FT                   /translation="MVEAYIVAAARTAGGRRGGKLAGWHPADLAGKLLDALVDRAGADP
FT                   AIVDDVIMGCVGQASEQSTNIGRSAVLSSKLPESVPGTSVDRQCGSSQQALHFAAQAVM
FT                   SGTMDVVIAAGVESMTRVPMGTASNGPGFGSWSGEEMKARYPGIVFNQFDGAAMIAKKY
FT                   GHSRDQLDQFGYESHRKAIAAVEAGAFDAEIVPIPVEGPDGEAALHVRDEGIRFDVTRE
FT                   AMAGVKLLAEGGIITAATSSQICDGASGVMVVNERGLKGLGVEPLARIHHMSVRGGDPV
FT                   IMLEAPLEATSHALRKAGMSIDDIDLFEVNEAFAPIPLAWLSHCGADPKRLNVNGGAIA
FT                   LGHPLGASGTKLMTTLIHALRARGKRYGLQTMCEGGGMANVTIVERL"
FT   CDS_pept        474717..475580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03870"
FT                   /product="MaoC-like dehydratase"
FT                   /note="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98750"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D1"
FT                   /protein_id="BAI98750.1"
FT                   /translation="MPLDYDLVKAWPIADMRQRFDVRDTMLYNLGVGAGIPDEDGHVDL
FT                   RFVWERRLVPVPTMAAVLGEGASWMLDPATTISAGNMVHAEQSVTWHAPLPASGEVIAR
FT                   TAVEEIYDKGADRGAILVTRRTLHEADGDRTLATIRGSVFLREDGGFGGSAIAPKPAFP
FT                   APSRPPDRRIAMPTRPEQALIYRLSGDYYPLHVDPEFARRIGFDGTILHGLATYGFAAR
FT                   AIIALAAEGDPERLAQLDVRFSAPVYPGETLEFDLWQVDRSTVAFVCRAGNRVALSNGL
FT                   AKIRAS"
FT   CDS_pept        475683..476357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03880"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98751"
FT                   /db_xref="GOA:D4Z8D2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D2"
FT                   /protein_id="BAI98751.1"
FT                   /translation="MTSASAKAESIVAGAKGRPAATRKRRPEEVRARVLTAALHAFATV
FT                   GFEGASTRAIAADAQVSLSLLLYHFQTKDDLWKAVVVDLAERYSISGLDAIVAPDATSP
FT                   KDRLKAMIRGIVNMSAEVPELHRLMTLEAHQPSKRLTWMCENFIGKDFEYMSGLISEAQ
FT                   KQGAVRRVDPGRLRFAILGMAAIPFSVSAEYQHLTKRNPFSKIEIEQTIELINALIFAE
FT                   PD"
FT   CDS_pept        complement(476415..477869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03890"
FT                   /product="putative acyl-CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="acyl-CoA synthetase (AMP-forming) / AMP-acid ligase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98752"
FT                   /db_xref="GOA:D4Z8D3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D3"
FT                   /protein_id="BAI98752.1"
FT                   /translation="MTLLSISRCISFWAGRKGASPAITCGDESIGWRELEERSNRLARH
FT                   YQSLGLGRGDFATIVLPNDIEFYCAAIAVWKLGATPQPISCHAPLVEQCALIELGQPKL
FT                   VIGWSHAQPPNGVATVPPGFATPDLSAEPLPDMVADKWKALASGGSTGRPKLIVSIAPG
FT                   RFDPLDPSYLMEPEGVMLASGPLYHNASFMFSMHALFCGAHVIVMPRFDPAEALALIDR
FT                   HGVTWALLVPTMMHRIWMLPPEVREGHSLKSLRIVLHTGAACPAWLKQCWIDWVGPEVL
FT                   QEGYGGTEGCGAHWISGTEWLAHRGSVGRSLEGFDVRVAGPSGEILPPGEIGEIWSRPR
FT                   SGPGSTYEYRGGQSRRDADGYESIGDMGYLDAEGYLYLADRRTDLIVSGGANIYPAEVE
FT                   AQIDSYPGVRASAVIGLPDMDMGAIPHAIVEADAGLDVDELRGHLAVRLSRNKIPRSFE
FT                   IVDGPLKDEAGKLRRSALRAARIEQG"
FT   CDS_pept        complement(478127..478912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="SJA_C2-03900"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98753"
FT                   /db_xref="GOA:D4Z8D4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D4"
FT                   /protein_id="BAI98753.1"
FT                   /translation="MAFETILFDVEDGVATLTFNRPERLNAIDEQMVGEAYEAVSAIED
FT                   DDSIRVLVITGAGRAFSSGADLAGGDLEPGEVDAGRVLETLFNPLLEKLFALSVPVVAA
FT                   VNGPAAGAGCSLALAADITVAAESAYFLQAFINIGLVPDVGSTWVLPRQVGRARATAMM
FT                   MLGERIPAPQAADWGLIWKCVPDAELHDEVRKIARKFAAGPTRAYAMVRTGIRDALEGP
FT                   LSKALHAERRNQWLAGRTADFAEGVAAFQQKRPPNFRGS"
FT   CDS_pept        complement(479088..480020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03910"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /EC_number="4.2.1.17"
FT                   /note="carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98754"
FT                   /db_xref="GOA:D4Z8D5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D5"
FT                   /protein_id="BAI98754.1"
FT                   /translation="MLQGGRRPPSQGYCHGSNLYHRCGMDRMCAPAARIRRHRHHLHRR
FT                   AALIDMAVPQTVGGRIRIEIDQGIADIRLVRSAKRNALDGAMFGALAEAIDIVRESQAR
FT                   AVVLSGEGSDFCAGLDLGMFAEMQAGLSPSGIPADLVPRTHGSSNLPQYCVMGWRSLSM
FT                   PVIAAISGSAIGGGLQLALGADIRIVHPDARLMLREVHWGLVPDMGAFVLLPRLVRDDQ
FT                   LRRLIFASAPVNGREAVEIGLATQCDESPLAAAHALARQIAGSDAAAVAAAKRLCNDPD
FT                   SGTDAMLLKESAAQQQRIEAVIRANAANP"
FT   CDS_pept        complement(480052..480342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98755"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D6"
FT                   /protein_id="BAI98755.1"
FT                   /translation="MIFFSWAAVTIRSILSPRMPHLRSMASQGDERGQGSCPYAHLAQV
FT                   RLIRKGRGSFQRFRLVPRMEFMFVHHTDLERLYNNSCRVETVAACNITVRD"
FT   CDS_pept        480363..480851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98756"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D7"
FT                   /protein_id="BAI98756.1"
FT                   /translation="MIDSATEDQIKWLVDQAEIQKLISAYTNCLDDRDFSAWQDLFADE
FT                   GGYGAPPNRLAKHLLAKGSEELLSSYEKTHHFLGLPAIAIDGDEARARCPGITHHVTVQ
FT                   AHPSQSRTVGGWLRFTFRRTESGWRIVDAFPEVAWTEGEDYFAGATRIVEHLASAQRG"
FT   CDS_pept        481258..482499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03940"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98757"
FT                   /db_xref="GOA:D4Z8D8"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D8"
FT                   /protein_id="BAI98757.1"
FT                   /translation="MLPVSTISHIEADIALAEQPHGKQPLDAETLVARAREIAPRLAER
FT                   AQATELNRAPLDESIRELVDAGLMAILTPTRFGGHGLHLDTMARVVSILAAACPSTAWV
FT                   ASFYIGQAWRAALLPMEGQEELFRSRNYALGAGQAAPVAKVEIVPGGYRITGRTAWSSG
FT                   IVHADWVIFGGLVYPPGGPPEARTFTIPRDQVEMIDTWHVTGMKGTGSHDVAVHDVFVP
FT                   AHRSLSLADLLAGVAPGAAIHADQPLYALPLMPALFVEPLPVFVGALRGATDIFLSQVR
FT                   ARHNTNTGEAVSAKSSARMRLGRVLAQTRLAEQMLDAYVADLLTPGAPDRLRPLEARAA
FT                   AKMNAVLIIELAADTMRLIMQGVGANGYREANPLQRYARDLEILRLHAFLDSDTASESL
FT                   GTLAFGATPNDPLL"
FT   CDS_pept        complement(482557..483390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03950"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98758"
FT                   /db_xref="GOA:D4Z8D9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8D9"
FT                   /protein_id="BAI98758.1"
FT                   /translation="MPPVGHDDALCPARRLARMAGAGMTSPPASGHSRISNRELYAVAG
FT                   MTSASAPMFERRRRILRETQHMLAEQGLGGFSTMELSRRSGVAQRTIFNAFGNRDNLVA
FT                   LAIRFYFEEFNLALADRFDVSTLDGALGKLTATTLRNLQLRNYMTAIVSLHFSPSAPAQ
FT                   VRAVTLAIGAGFFRDWLDNQRNRSLLPAEIDLGRLTRHIAHLEYAVINDWLVGAVEEAQ
FT                   VVDNMLQAVLEMLVGALDGDVRARLEQYLADVRESGPLSLQLKADGANAIAALSL"
FT   CDS_pept        complement(483634..485829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="SJA_C2-03960"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98759"
FT                   /db_xref="GOA:D4Z8E0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E0"
FT                   /protein_id="BAI98759.1"
FT                   /translation="MQHISIETGADGIALVRFDVIGRTMNTITAAFSQELEQLVERLKG
FT                   DAAIKGAILTSGKDNGFIAGADLVEMEGDIARWRVASTQEELAGAVADCASLSRRLRAI
FT                   ETLGKPVVAAISGLALGGGMEVALACHYRVVADNPKIQLGFPEATIGLLPGAGGTQRLP
FT                   RLIGLQAALPLLLQGKPVSPTKALELGFVDAVVPAADLIETAKAWLLSVGDPVARWDRK
FT                   GFKLPGGAPYSSAGQQIMAGANAMLRSTSYGNYPAQEQILKAVFEGTQVPMDAGLRIES
FT                   RRFLNTVQTPQAEAMVRTLFLSMQALGKGQGRATGRERFDPRKAGVLGAGMMGAGIAHA
FT                   HALAGIDTVLIDVDQAAADKGKAHGDNLLDKAVRQGRLSQEKADAAKARICASTDYGDL
FT                   AGADIVIEAVFENRALKAEVTRKAEAVLGSNAIFGSNTSTLPIDGLADASQRPESFVGI
FT                   HFFSPVDRMRLVEIIRGKRTSDATIEAATDYVLRIGKVPIIVNDSRGFYTSRVFGTYIA
FT                   EGYEMLAEGIAPAIIDNVGRMTGMPRGPLELSDDVALDLLDKVTKQTAADLGSAYVAKA
FT                   QDGIVDRLVNQLGRLGRKNGRGVYDYAQDGSGKTLWAGLADLAPPSIVSSDAALVERIR
FT                   LRLLYRQAIEAARCVDEGVIGDPRQADVGAILAWGFPAWTGGPLSFIDSVGAATFAAVA
FT                   DELARDHGDRFAIPPLLRKLAEERGRFYEAPIRQKAA"
FT   CDS_pept        complement(485840..487045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="SJA_C2-03970"
FT                   /product="acetyl-CoA acyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98760"
FT                   /db_xref="GOA:D4Z8E1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E1"
FT                   /protein_id="BAI98760.1"
FT                   /translation="MPEAFIFDAVRTPRGRGKPDGSLHEISALELAAQTLGAIRDRHRL
FT                   DTSLVDDVILGCVMPVGEQGADIARLAVLAADYAQSTAGVQVNRFCGSGLEACNMAAAK
FT                   VVFGEAEFAIGGGVESMSRVAMGADGGAMAVDPSFAYDSYFTPQGIGADLIATLDGFSR
FT                   EDVDGYAVESQRRAARAWAEGRFSRSVVPVVDQAGVTRLDHDEHIRADATIDSLATLKP
FT                   SFKAMGETLFDPVAIQRYPEISQVDHVHHAGNSSGIVDGASAVLIGSREAGEKAGLKPR
FT                   AKILGAASIGSEPTIMLTGPSYVTEKLLKRLGMAVADIDLFELNEAFAAVVLRYMKMLD
FT                   IPHDKINVNGGAIAMGHPLGATGGMILGTVLDELERSGKETAVINLCVGAGMGTAMAIA
FT                   RV"
FT   CDS_pept        complement(487102..488193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03980"
FT                   /product="putative L-carnitine dehydratase"
FT                   /EC_number="2.8.3.-"
FT                   /note="putative acyl-CoA transferase / bile acid-inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98761"
FT                   /db_xref="GOA:D4Z8E2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E2"
FT                   /protein_id="BAI98761.1"
FT                   /translation="MSGPLAGVRIIEMAGIGPGPFCGMMLADHGAEVIRVERPGAVVDR
FT                   HDALARSRRSIVLDLKDADAIAQLRGLVATADGLIEGFRPGVMERLGLGPDVLLADNPK
FT                   LVYGRMTGWGQTGPLAQAAGHDINYVALSGALHGCGRAGERPTPPMNLLGDFGGGAMML
FT                   AFAMASALFHVSRGGSGQVIDCAITDGSALLNAMTMSFVTAGEWRDERGVNLLDTGAHF
FT                   YDSYECADGKYISIGAIEPKFYALLREKLGLEDDAAFDRQLDATAWPLLKTRLEALFRT
FT                   RARDEWCALLEGTDACFAPVLSVAEAPGHPHNAARDTFIDVDGLMQPAPAPRFSVTRAD
FT                   RPRAARPVGADTVEILQSANVAG"
FT   CDS_pept        488643..489029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98762"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E3"
FT                   /protein_id="BAI98762.1"
FT                   /translation="MKSAMLAVAERFTQAFSNRDAAGFVSTYGPDATVWHNDDRIVQAR
FT                   EENLAKLQGFFSICSAVEYRNIERDVTDAGTLVQQHVVWGRLNDGREFEVPVCMVIKFK
FT                   DGLIHHIAEYCDPAPFHQLLHGAD"
FT   CDS_pept        489091..491166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04000"
FT                   /product="putative alcohol dehydrogenase"
FT                   /note="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98763"
FT                   /db_xref="GOA:D4Z8E4"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E4"
FT                   /protein_id="BAI98763.1"
FT                   /translation="MRHFRKAALMSLALAMVAGTTQQCSAPRPAEPYLDGSDGKDWPGY
FT                   GRSFGEQHYSPLTQIDGKTVGDLGLAWWFDLGPENSATQPIAVDGVLYFGVGHSIVHAI
FT                   DAKTGKLLWRHDPHAAEAAGPNLRLGWGSRGIAWGNGKIYTGTQDGRLIAIDARTGKEV
FT                   WSVQTFDKNQPTYISGAPRYYAGKVIVGFGGDMGKVRGYVTTYDADTGKQLWRFYTVPG
FT                   NPADGFENKAMEMAAGTWSGEWWKYGGGGTVWNAISYDPETDTIFLGTGNGYPWNHKVR
FT                   SGGKGDNLFLASVVAVSGSTGEYKWHYQQNPGETWDYNAAMDMALADLTIAGKPRKVLV
FT                   TAPKNGIFYVIDRVTGKLISAEPYTKVNWASKIDLATGRPVENPDARYPDGKTFTIWPS
FT                   SAGGHSWQPMAYSPATRLAYIPVINAGMTIRDEPDLAHYKPPLDRSSGGSFIPDFDVKD
FT                   PKQATGALVAWDPVTQKKKWSVEHPTLANGGVMATAGGLVFQGTVDGSFKAYDAATGKT
FT                   VWSFATGTPIVAPPISYRVGDTQYVTIITGLGTGLAMWAPILSRYNIDPRSQKRRVLTF
FT                   AIGARAKLPADKHSVQPIAADPEFAPNPASAAAGAVIYMKHCVVCHGFGAVSGSHAPDL
FT                   RRSTIPTSPEAFASVLREGALVSGGMPRFEEFTDRQREDVRQYIRTEMQKGRAGTR"
FT   CDS_pept        complement(491235..492935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04010"
FT                   /product="putative dehydrogenase"
FT                   /note="succinate dehydrogenase / fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98764"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E5"
FT                   /protein_id="BAI98764.1"
FT                   /translation="MEAATGEGSSVIECDVLVAGSGAAGLSAAIVAAKAGLSVVVAEKA
FT                   SVFGGTTALSGGGVWIPASRAMRADGFDDSIADAAAYLKAVLGAQYDDSKVEAYLAHAN
FT                   EAVDYLSEHAGLELISAGLPDYEMHLPGAGHSRCLLSPDFDGRKLGPLLGKLRPALREM
FT                   GGPLGFQIGFADMEPLLNLHRSFAAFRKSVRIVARQVADLLVHGRATRLANGNALAARL
FT                   LLAAADSGVSLWSDAPVKSLRTADNRVIGAIVERSGQTMEVRTSKAVIMATGGFGADAA
FT                   MRREHIPLAATSYSLAPRENRGDGIRLALGAGGRLAEGNAANAIWTPMSAMPAGDGSPR
FT                   PFPHLAGDRLKPGSIIVDADGRRFTDEANHYQAVGNDINRVGAERMFLVGDAQFLRRYG
FT                   MGLARPAPWPHGALLRKGYLKRAGTVAELAGQLGIDPARLERTVATFNEHARQGHDPEF
FT                   GRGAHAYSHFMGDPGRDNPSLAPLEHAPFYAIELRPGDLCTLLGVVTDARAAVLDAAGQ
FT                   PIAGLYAVGLDMNSPWRGAYPGGGAALGPAIVFGYLAARDIVRAGQAAA"
FT   CDS_pept        492978..493103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98765"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E6"
FT                   /protein_id="BAI98765.1"
FT                   /translation="MGTGSSHHVGLRGPGRMDERGPGRRANPRPAACLSIIFPVP"
FT   CDS_pept        493235..494212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04030"
FT                   /product="putative epoxide hydrolase"
FT                   /EC_number="3.3.2.9"
FT                   /note="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98766"
FT                   /db_xref="GOA:D4Z8E7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E7"
FT                   /protein_id="BAI98766.1"
FT                   /translation="MTTPPADRQIHAASFEVRRTTVRDNAEIAYIREGVGGLPLLMLHG
FT                   WPSTKRIFYRNIGPLAEAGFEVIAPDASGWGDSPPRADRWTDQVMAGRDSVALMEALGH
FT                   ERFVLAAFDQGTIVGLDLVNRFPERILRQVLWSGVVPFMWDVYAAAGIGGDMIEEVVAA
FT                   TDHILEHGNHADRLCAELDTAEARRDYVKGFYTTRVWKAGRPATGIAGPGAFDEDMASF
FT                   HAEPFGDARMFRDSLRWYETPLHPETFSEPPLLAQASDVETLFLLGAHDFTTANANTAR
FT                   RIAVAYRNLVGPFFVDGAGHFLSWECPRLFNNAVISFCRDLLAQ"
FT   CDS_pept        complement(494264..495055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04040"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98767"
FT                   /db_xref="GOA:D4Z8E8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E8"
FT                   /protein_id="BAI98767.1"
FT                   /translation="MKDRVAIVTGGANGLGAAVAKGLAGRGARVLVNYAHSRDEAEETV
FT                   EACRLLGADALAVQGDVGEDADCRRMVAAAAERWGRVDVLVNNAGTTRIVAHADLEGLG
FT                   SDDFLSIYRTNVVGAFQMIRACTPLMKQGGYGAIVNVSSIAAIAAIGSSIAYAASKAAL
FT                   NNMTVSLARALGPEIRVNAVCPGFIATRRFSDALGEAGMRELIETVEGMTPLRRAGTPE
FT                   DIATAILFLADEGAQHITGTSLVTDAGQILNPSPSVVSAKD"
FT   CDS_pept        complement(495077..496570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04050"
FT                   /product="putative acid-CoA ligase"
FT                   /note="acyl-CoA synthetase (AMP-forming) / AMP-acid ligase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98768"
FT                   /db_xref="GOA:D4Z8E9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8E9"
FT                   /protein_id="BAI98768.1"
FT                   /translation="MDYRQMQYSIGDCIRYWAERLADEPAIVDEAGEISWRDLDRSTNR
FT                   LARAYRDAGVGEGDFVTIMLPNGREFYQASIAAWKVGAIPQPISARMPPAERSAIIDIV
FT                   SPRLIVGSEGEQTSVPQLPAGFLPDPALSDEAMDYPVPPYWKAVASGGSTGRPKVIVSR
FT                   QPGIFDPLAPEFRMSVQGRQLVAGPLYHNASFMCSSRGLFCGNRLIVMERFDAERALDL
FT                   IDRHRIDWTIMVPTMMHRIARLPAEVRDRHDMSSLRTVVHTAAPCPPWLKAEWIEWLGA
FT                   DVVQEAYGGTEGCGTTWISGEEWLARPGSVGRAVEGCAIKVVDDAGRPVPAGVIGEVYM
FT                   RPDSGPGSTYFYLGGESRRSEDGWETIGDMGHVDEEGYLFLADRRTDLIISGGANVYPA
FT                   EVEAAIDAFPGVRSSAVIGLPDDDLGNRVHAIIDAATQIDPEALKRHLAERIVRYKIPR
FT                   TFEFVADSVRDEAGKVRRSALRAARMDGSDNKAGAANRA"
FT   CDS_pept        complement(496599..497891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04060"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98769"
FT                   /db_xref="GOA:D4Z8F0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F0"
FT                   /protein_id="BAI98769.1"
FT                   /translation="MESGTVGYFGDSPELSAYLAKMDAFIDAEIKPLEQRDDNIRFFDH
FT                   RREWARTDFEGGGLPRPEWEALLRQARDLADRAGYLRFGLPRAFGGQDGSNLWMAAIRE
FT                   HLAARGLGLHNDLQNEHSIVANFPQVLMLQEFGTQEQKEKFIGGMLDGDLSLAFALTEP
FT                   EHGSDATHMQTRAVRESRNGASGWRIDGEKMWTTGMHSASHVIIFARTHGERGDGKGIT
FT                   GFLVPSDTPGLKIEEWLWTFNMPTDHPRISLTNVWVRDEDLFGEPGDGLALAQTFVHEN
FT                   RIRQAAASLGAASYCIEESVRYARERKPFGKPLATNQAIQWPLVEMSTQAEMLRLLIRK
FT                   TASDMDRMSRAEVTATLSHKVSMCNYWANRLCCEAADRAMQVHGGIGYSRHKPFEHIYR
FT                   HHRRYRITEGSEEIQMRKIAAYMFGLGGARK"
FT   CDS_pept        complement(497984..498328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98770"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F1"
FT                   /protein_id="BAI98770.1"
FT                   /translation="MNGPSALPRGFEDLEPFVEQWALEDFQARNEHRFAAGMAQVQAFY
FT                   DAVAPRAPAILDHLDPLPLDALSPDEKRLYQLLMAVAHCALSVEFHGQLAPPNSTYNPA
FT                   VRIVKGPSPP"
FT   CDS_pept        complement(498325..499572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04080"
FT                   /product="putative dioxygenase"
FT                   /EC_number="1.14.12.12"
FT                   /note="Rieske (2Fe-2S) domain protein / phenylpropionate
FT                   dioxygenase or related ring-hydroxylating dioxygenase,
FT                   large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98771"
FT                   /db_xref="GOA:D4Z8F2"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F2"
FT                   /protein_id="BAI98771.1"
FT                   /translation="MVDRPGSASSFAARGGMDNGMVSLETYRSPEAFELERERIFRRAW
FT                   LFAGRVEEVPNKADFVVKEFAICKASIIIIRGKDDVLRAFHNVCPHRANLVESRPNGNA
FT                   PVLVCRYHGWSYSTDGRLRGVPDQEMFLGLDKAGCGLTPVALEIWDGWMFVNLAETPEV
FT                   SLDEFLGDWKSFYEGVEYNNLDHPIVVETRLNCNWKIVADAFVEAYHIPSIHSTTLKTL
FT                   FSNDENKYGRLLDARFFGPHRFVSMFGNAAAEFKPGHAIAKLVNDPEKVPQQVMDAAMA
FT                   YLNHPAVNPTKQPDWSMDIATIFPNVNIAARISGPFVHEYWPLSATETLHRATFYFPKP
FT                   ATVGERFAMEHTIAWLVDIIYEDLGNVERTQRGVESGATRGMNLSESEVSIRHSVQQVE
FT                   KWIGSATVAEALGRGQ"
FT   CDS_pept        complement(499634..500128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04090"
FT                   /product="MaoC-like dehydratase"
FT                   /note="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98772"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F3"
FT                   /protein_id="BAI98772.1"
FT                   /translation="MVARTIDYSELESFQGQEIGVSRWFEVTQRSIDLFAEATGDRQWV
FT                   HVDVERATRENGGTIAHGFLTLALLPVMLADVLEITGINHALNYGLNKVRFTNPVRAGG
FT                   NVRVRQKLLSTEPKAGGLLMISEMTIEIEGEDRPACVAEGMGLLFPGTGRLDTTAKAEG
FT                   A"
FT   CDS_pept        complement(500142..501140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="SJA_C2-04100"
FT                   /product="NADPH2:quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="NADPH:quinone reductase or related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98773"
FT                   /db_xref="GOA:D4Z8F4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F4"
FT                   /protein_id="BAI98773.1"
FT                   /translation="MKAVISREAGGPDTLLLEDVPDPRPAAGEVVIDVKACGVNFPDVL
FT                   IINDQYQFKPSRPFSPGGEVAGIVSEVGEGVDPALIGQRVIGLVGWGGMAERVATSAGK
FT                   LVPIPDSMPFDEAAAFIATYGTSYHALKQRARLAPGESVLVLGAAGGVGLAAVELATAM
FT                   GARVFAAASSEEKLNVARARGAGTCILYPGDVPGVPEMRDLAEQFRAPVGAEGYDVILD
FT                   IVGGNYSEPALRTIAWKGRFLVVGFPAGIAKMPLNLALLKGCDIAGVFYGLFTEKEPDE
FT                   NRRNNAELFEIYEAGRIRPHISARFGLDEAARALDLLAGRQAQGKIVVTVG"
FT   CDS_pept        complement(501124..501591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98774"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F5"
FT                   /protein_id="BAI98774.1"
FT                   /translation="MQDEPGASELLDAVARFLRDDLGRLGQGETRFHALVTANAVDLAR
FT                   REIDLAPGFDEAERQRLSVLLGEDGDCRTLNALLCARLRSGALTADDPLVGEHLWLTTM
FT                   EKLAVDQPHYSANLRARKMVRPTRFTDSHLRAADEKGGATNARKTKHESSH"
FT   CDS_pept        complement(501581..502573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04120"
FT                   /product="putative aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98775"
FT                   /db_xref="GOA:D4Z8F6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F6"
FT                   /protein_id="BAI98775.1"
FT                   /translation="MSDAFENALHAVVERRWNGRIGTLRRLTAGASYETWALDVVAEGA
FT                   TEEFILRRAPGGALREGATTTPEQEAALIQLADDAGAPVPAVRYVLQPSDGLGRGFFME
FT                   RLKGETLARRILRDEQFAGARARLAGESASALAAIHRIEAGGVGVRSSTPASEIALLWE
FT                   SHCSLDQPRPVFEAAFRWLREHVPDPVAPRLVHGDFRLGNLLVDPQGLRGILDWELAHL
FT                   GDPHEDIAWISVNSWRFGNIDLPIGGFAEREDFYLAYEAAAGVAIDRQRVKFWEVLGSL
FT                   RWGLMCAGMVGWIRSGEDASVERTMIARRASEAEIDILGLIMAETAHAG"
FT   CDS_pept        complement(502570..503415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04130"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98776"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F7"
FT                   /protein_id="BAI98776.1"
FT                   /translation="MSDFAGKTAIVTGGGSGIGRATAQLLAQRGARLVVADIREDAARA
FT                   VAEEIRSAGGVAEAFHCDVEKEGDIIAMVAHAVATFGGLHILHNNAALVDLEVNIQDQN
FT                   VLTIDASLWDRIMAINVRSVMLGCKHAIPEMIRAGGGAIVNTSSTYGVAAYANLCAYGT
FT                   SKAALIQLTRYVAVAFGRQGIRCNAVAPSLVATPGVLELFPQELLDANRNGAAMDLLVT
FT                   PTDIAEAVAFLASDAARHITGHLLPVDAGTLAHLSTAPAGRAFDEKMAAAGGGEKAVPQ
FT                   "
FT   CDS_pept        complement(503513..505855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04140"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98777"
FT                   /db_xref="GOA:D4Z8F8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F8"
FT                   /protein_id="BAI98777.1"
FT                   /translation="MRNNRLLLAGVGLMSLVQAAHAQDAAAPQADVGIGEIIVTAQKRA
FT                   QSLNDVPITVAVASGEQLAQRGITDTADLGKVVSGFVAVPAPFGQPVYVLRGIGLYDSG
FT                   LGSAPTVSVYVDQVSLPFSLMTQGAALDLERVEVLKGPQGTLFGTNNTGGAINYVAAKP
FT                   TEDFQAGGSATYERFDKATLKAFVSGPITDTLRARVAVQGASGGAWQRSLTRDDELGNA
FT                   RQIMGRLLLDWTPTDRLKVAINLNGFRDRSDTQASQLKAITPSDPAFAYPEMLAAPLAE
FT                   DNARSADWNPLASNRKNEKFYQLSGRVDFEATDTVTLTSISSYSDLKSSRYLDIDGAAP
FT                   VGLEFQTFGRLKDFGQELRLQLTTDALIGLVGVNYQHSNTKDNNFNFVDKLSTNRVGGL
FT                   LAATPFTRPTSYVNQQVDNYAIFANAEYKITPQLTFQAGGRYTWSERDAQACAYDRTPG
FT                   APLNIFFTGLQSILAPGVVQDPITKCYQLNPYDNFSAGEFDLRLREDNFSYRGALNYKF
FT                   DGGTMIFGSVSRGYKGAIISNITASSAQQFLPVKQERLDSYEIGIKAPLFDRAAFLNVS
FT                   GFYYDYKNKQLRARILDPIFGLVETLVSVPKSRIWGIDADLNFAPAEGLTLTASGTYLN
FT                   SKINGDFTTSNGAAVYDQAGQSGNFRGSPLSYTPKFTGNLDVQYEWPLSDSFKAMLGAA
FT                   VTYHSRDNASLVLQGNSRDRNFDIPRYALLDLRAGISAADDRWRVELFGRNVTNKYYIT
FT                   TVFQDLDNRHQYAGMPATYGITFGFKY"
FT   CDS_pept        complement(506034..506924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04150"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98778"
FT                   /db_xref="GOA:D4Z8F9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8F9"
FT                   /protein_id="BAI98778.1"
FT                   /translation="MNRGPERRAAVLIDYADGVLTLTKNNPDTGYGMTCAVLDAMEDAL
FT                   LHAGDREDLRAVVIDAGGDGFHEAAVMVFELKPDYHDMDREDTREIVRRGQSLGELISS
FT                   LPVPVIGLAAAGARGGGLEMMTRVDMLYCTDAALFCLPEVQLGFYPGWGGLQHGARMMQ
FT                   WRRAQEFILLGEEIDGREAERAGLVTRSFGSVEDMRARAAAVCKRLQYCSPHAVARVKA
FT                   ELRKVWREAVEVGEKRDYESHAEVMETRDFVKAMDALQKGRAWNYLKRVDEPPLATGRA
FT                   FPQLEGVTAGAAPVE"
FT   CDS_pept        complement(507107..508306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04160"
FT                   /product="putative cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98779"
FT                   /db_xref="GOA:D4Z8G0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G0"
FT                   /protein_id="BAI98779.1"
FT                   /translation="MDDMIISAPPILEFDPYAEDVILDPAPFLESVRNAGVAYLPANEA
FT                   YAVGGMDEAVQLSKDFDSFTSSHGIGLLDITKPGLLRPTNALQECDPPQHSQLRKVVQK
FT                   ILSPSRVRGFQELLAERARILVDDLLEKGSVDGTRDIAQAFILDVFSSVAGIDLPAEPA
FT                   IATSNMMLNLMGPVNAVSQRAMAAAEPHLPWFNEAITRRNAAPGGLVDLAYQAEEEGLL
FT                   PEGIGGNMAIVFVGGGFDSTIAGIANALRLLALHPAEWARLRSDPTLVPAAINEAIRFD
FT                   PPFRVYYRMTTRPVKLGAFDLAPQTKIGVWMGAVNRDPRHFDRPDEFDVSRRGAHAGLG
FT                   FGTGPHNCVGQILAKAETEAIISALVRKVARLELTGTPQYEAHNQVRMPGKLPLRLHPG
FT                   "
FT   CDS_pept        complement(508392..509147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04170"
FT                   /product="LinC-like SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98780"
FT                   /db_xref="GOA:D4Z8G1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G1"
FT                   /protein_id="BAI98780.1"
FT                   /translation="MAGLTDKSVLVTGGGSGIGRATALLLAGAGAKVTVADVNHAAAQA
FT                   VADEILAGGGVAQGIVADVASEADVRAMVDAAVRSFGPLHGAANVAGVPWKGVPTHELA
FT                   LEDWDRCQAVNARGLFLCNKYEIAAMLEAGGGSIVNVLSSAAVAAFENGVEYCASKAGG
FT                   LGLTRGAAVEYGGKGIRINAVLPGATLTPMLEGAMGDGEYREWAMNQHPLKRFGQPGEI
FT                   GNAVRWLLSDEASFVTGAAFTIDGGLTAV"
FT   CDS_pept        complement(509289..509711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04180"
FT                   /product="putative aromatic ring hydroxylating dioxygenase
FT                   beta subunit"
FT                   /note="small subunit of phenylpropionate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98781"
FT                   /db_xref="GOA:D4Z8G2"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G2"
FT                   /protein_id="BAI98781.1"
FT                   /translation="MMSGNDEAYRACTALISAFAHHVDHREFDKAVALFAADGCFERAD
FT                   ITARGHAEIAALWADRPVSLITRHLCSLPHFTKLEADAAESITGFTLYHVNHEDGGLPR
FT                   FEHAAGVGEFHDRFVRTPGGWRIAHRRGVPVLIGGH"
FT   CDS_pept        complement(509708..511183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04190"
FT                   /product="putative FAD-monooxygenase"
FT                   /note="2,4-dehydroxybenzoate monooxygenase /
FT                   2,4-dichlorophenol 6-monooxygenase /
FT                   2-polyprenyl-6-methoxyphenol hydroxylase or related
FT                   FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98782"
FT                   /db_xref="GOA:D4Z8G3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G3"
FT                   /protein_id="BAI98782.1"
FT                   /translation="MELFRRLGVADKLRAAGVPASEPLDVVWATSGSGSILHRFAYAAP
FT                   DAAREAARVRNDGTDTLEPAMRVSQIVLEPVLKKLVDANPLVDVRFGWAYEAFEQDAEG
FT                   VTATIRNGGTGETASIRALYLAGCDGGGSRVRRDAGIDLEGMHAIGEAYMVHFRSTDHQ
FT                   ALAKFGIAYHLQTAHGTLIAQNGHDIWTLQTLAPPDSDPDELLRNFMGRSFDYEILVAN
FT                   PWTPHMVVANRLRNGRIFLAGDAAHQVIPTGGYGMNTGIGDAVDLGWKLAAAVKGWGGE
FT                   ALLESYEVERLAIARRNREAAQRHLEVRLAIINLFMEAQAEGDLEGAEASERRLELGRR
FT                   IAELGNAENESWGIEHGYRYRSPVICPDGPEPALDPMRAAPTTFPGSRLPSLHLADGRP
FT                   LFDLLGPEFTLIATGQANIGGFEAAAAAAGVPATVVRLDREPVLDLLERPLLLVRPDQH
FT                   VAWRGVAAPDDWASILATVTGRAGEADRREKAA"
FT   CDS_pept        511214..511417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98783"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G4"
FT                   /protein_id="BAI98783.1"
FT                   /translation="MGRRRRIALQKYRAHAMMGEFQGKRHTDRSAAGDQDLRLNPRHST
FT                   LLQTVDRRWSTSSSPSPPRPGH"
FT   CDS_pept        complement(511738..512412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04210"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98784"
FT                   /db_xref="GOA:D4Z8G5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G5"
FT                   /protein_id="BAI98784.1"
FT                   /translation="MTSKTIGAKSPAKQQEESAPTGRTRQRRPQEVRERVITAALHAFA
FT                   TVGFEGASTRSIAADAQVSHSLLIYHFQTKDDLWKAVVVNLAERFAISRVDEVVASGGA
FT                   SARDRLKRAIRKIVTMSAQYPELHRLMTIEAHQPSKRLTWMCENLIGEQFEFMRDLISE
FT                   AQREGAVRRADPERLRFSIIGMAAVPFSVSAEYQYLTKRNPFSKIEIEQTIDLINALIF
FT                   VD"
FT   misc_feature    512531..512538
FT                   /note="recognition site for restriction enzyme PacI"
FT   CDS_pept        512579..513145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04220"
FT                   /product="BphC-like dioxygenase"
FT                   /note="2,3-dihydroxybiphenyl dioxygenase, BphC /
FT                   lactoylglutathione lyase or related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98785"
FT                   /db_xref="GOA:D4Z8G6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G6"
FT                   /protein_id="BAI98785.1"
FT                   /translation="MVSATESSGRRVRPHYMAHFVIRTSRYDESLAWYQRFFDTETVYA
FT                   QDGLTFLTFDDEHHRIAIGRIPDLEDHRENIAGVDHIAFSMQNLEDLVTAYERNKAAGI
FT                   VPFWCINHGPTTSIYYKDPDGVKIELQVDNATFPGGARAFFSSDEFARNSYGIEFDPDD
FT                   FVARFRAGESTAALLARPDTLSAGE"
FT   CDS_pept        513291..514145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04230"
FT                   /product="putative FAA hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="fumarylacetoacetate (FAA) hydrolase family protein /
FT                   2-keto-4-pentenoate hydratase / 2-oxohepta-3-ene-1,7-dioic
FT                   acid hydratase (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98786"
FT                   /db_xref="GOA:D4Z8G7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G7"
FT                   /protein_id="BAI98786.1"
FT                   /translation="MKLARYSVNGTVEVGLVEEDRVVRLTGRLPQVGQDMLALISAWDG
FT                   LRDAAEKLRGEKDFSLAEVELLAPIPRPGKIWGIGLNYADHAEESGLPIPEHQMWFVKA
FT                   STAVAGPYQPIERPAVSQALDYEAELVAVIGRGGRHLSGARAAEAIFGYCVGNDVSVRD
FT                   WQVRSGQYSIGKSFDTHAPFGPWIVTADEVDASALPIRSLVNGEVRQQSNTRHLIFDPV
FT                   AQVEHLSQAMTLETGDILFTGTPGGVGAAMSPPKFLSPGDRVRVEIDGIGFIENEVMDE
FT                   PGR"
FT   CDS_pept        complement(514282..514734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04240"
FT                   /product="AsnC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98787"
FT                   /db_xref="GOA:D4Z8G8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G8"
FT                   /protein_id="BAI98787.1"
FT                   /translation="MLDSIDRKILRSLQQDSSRGLAEVAEEVGLSSSPCWKRIRRLEAE
FT                   GYIQRRVAILDRERLDLAVTVFVAVKTNQHHEGWLADFARTVSDIPEVVEFYRMSGELD
FT                   YMLKIVCKDIADYDRIYKSLIKRTTIYDVSASFAMEQIKCTTQLPI"
FT   CDS_pept        514855..515073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98788"
FT                   /db_xref="GOA:D4Z8G9"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8G9"
FT                   /protein_id="BAI98788.1"
FT                   /translation="MIKRLFIAHPASVGETYGQHFAHALSFSAAMFVGAMACLVHALIP
FT                   SMFKKTGSGIITRLHDRMVVNRARASR"
FT   CDS_pept        515081..516103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04260"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98789"
FT                   /db_xref="GOA:D4Z8H0"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H0"
FT                   /protein_id="BAI98789.1"
FT                   /translation="MNNPVLRQRLHFGPRQLAVSGVVICAAIAWLSTLAGNATGIPPVL
FT                   LALIGGAALAHRFDVAPLGEGVNFTVRTILRTGIALIGVRLSVAQIAELGISTVLVAAG
FT                   GVLLMLSAGTVIAMAFGLPRGRSILSAGAVGICGASAALAISTVLPPHPAQERQTVTTV
FT                   ALVTALSTAAMLIYPLIGRMLGLGQLETGIFFGASIHDVTQVAGAGAMVSPATTTAAVA
FT                   TKLVRVSCLAPVVAAILFLGARRGVAAADAGAPPAIPVFLVGFALIAAAANFGLLPPAL
FT                   RSFLSASATFCLVAATAALGMKTSLRLLMAEGWRPLAAMTAQTLLLAAYVIGCIFLFKM
FT                   "
FT   CDS_pept        516118..517356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04270"
FT                   /product="aspartate/aromatic amino acid aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98790"
FT                   /db_xref="GOA:D4Z8H1"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H1"
FT                   /protein_id="BAI98790.1"
FT                   /translation="MFETMRPPAPDSLMEVGRLFRADMRDEKIDLGVGTYRDGEGRIKI
FT                   MAAVKQAEERQLKSQMGKGYLGPGGDQLYCERLMEALFPDLPAMADRRLSFVQTPGGTG
FT                   AYRLGLELAAFRSPASRLIVGAPTWPNHIPVAERAGLRSVTYRHYDPATGTVDFDAMME
FT                   AVSDARPGDLFLLHGCCHNPTGAALSPAQWAELADALLEAKLLPLIDLAYAGMARGLVE
FT                   DAAGTRRLLDRLPEAIIAISCSKSFGLYSERTGMLAVMAASPSAADACRLTAETFARSL
FT                   WSNPPDHGAAIVRTILGDEGMRANWLAELDAMRHRLAGIRSRLAASGLPGTEPIAAQEG
FT                   LFAMMPFDSGQIAAMREKHAVYMDMSGRINIAGLNAGNIDRFLHACRDMSHPANRRAEP
FT                   NSSLRDVASTMQV"
FT   CDS_pept        complement(517375..518163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04280"
FT                   /product="putative aldolase class II"
FT                   /note="ribulose-5-phosphate 4-epimerase or related
FT                   epimerase or aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98791"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H2"
FT                   /protein_id="BAI98791.1"
FT                   /translation="MATVLKDDRFRQPGVSEAEWKVRVDLAAFYRLSALYGWDDLIYTH
FT                   ISARVPGPDHHFLINPFGLMFDEITASSLVKVDLDGNVIGESDYGINYAGYVIHSAIHG
FT                   AREDAHYIAHFHSADGMAVSAHAEGLLPLNQRALSLIPRLSYHDYEGVALNLDERERLV
FT                   ADLGDTKVMLLRNHGTLALGSTPGEAFSGIYHLEEACKAQVRSLAVGRDNVLIAPEAAQ
FT                   EEVRRQMSERKPVEGARSHHDLVWEAALRKAQRHSPGFDN"
FT   CDS_pept        complement(518232..519191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04290"
FT                   /product="ABC-type transport system periplasmic component"
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98792"
FT                   /db_xref="GOA:D4Z8H3"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H3"
FT                   /protein_id="BAI98792.1"
FT                   /translation="MAKNRGAIVAVALVAAAGFGLAAAKFGGGDDKVLRVANQKGQVKS
FT                   MMIASGVLKDAPYTVEWSEFPAAQPLLEAVGGGAADLGLAADAPFIFAYQSGSPVKAIG
FT                   IQAPAAQAGEALAILVKNGSPVRSVQDLVGKSVAATRGSIGHHLLLQALERAHIPADRV
FT                   RVTFLPPGDAKAAFDSGAIDAWSTWTPYTNVAIKEGARAVVDAKDYGLPIYIDIAHAES
FT                   IGPKRALLADFLQREAKAVQWARAHPDEFAQVLAKETGLPLDIARASFDRNNRMAQPID
FT                   DKIIAHEQAITQRFQRAGLTDGKRPVADAFDASFSKGG"
FT   CDS_pept        complement(519297..520571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04300"
FT                   /product="rhodanese-like protein"
FT                   /EC_number="2.8.1.1"
FT                   /note="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98793"
FT                   /db_xref="GOA:D4Z8H4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H4"
FT                   /protein_id="BAI98793.1"
FT                   /translation="MTTETLDRTSDRTLTATPQDIRRALLVGSEIALIDVREEHEFAQG
FT                   HPLFAAQIPLRRIDEEARWRIPRLDTPIIVYDDGEGLARKAAVRFEGLGYTDVRELEGG
FT                   LNAWREAGYELFEDVNSYSKAFGELVEHRRHTPSLAAEEVQALIREKADIAILDARRYD
FT                   EYNTMSIPTGTSVPGAELVLRARTIAPDPDTTIIVNCAGRTRSIIGTQSLVNAGLPNPI
FT                   FALRNGTIGWTLAGQELETGQTRVAPEVDNRSAEDARAHARDVAYRAGVKRIGWEELEE
FT                   LKADKARTLYLYDVRQPREYESGHLPGFRNAQGGQLVQETDHNAPVRGARIVVTDDIGP
FT                   RADMTASWLAQLGWEVFVLDVDWSAVTLEKGPDGAPGPRGPEGRYKRPYEGTDNKAAAM
FT                   QAYLDWEYGLVAQLERDGTHGFFVI"
FT   CDS_pept        complement(520568..521194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04310"
FT                   /product="putative cysteine dioxygenase type I"
FT                   /note="putative metal-dependent enzyme of the
FT                   double-stranded beta helix superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98794"
FT                   /db_xref="GOA:D4Z8H5"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H5"
FT                   /protein_id="BAI98794.1"
FT                   /translation="MNAVAAMAQPVEGAADIGRLRGFVTAFADLLAATRDEGAILEGGR
FT                   ALLSRLIARDDWLPEEFTRPHPDRYQQYLLHCDSRERFSVVSFVWGPGQSTPIHDHTVW
FT                   GLVGVLRGVEKVERFRQSPDGRLIPHGEQFLREGEVDAVSPRIGDIHRVTNGLADRPSI
FT                   SIHVYGANIGAVERATYAPDGTPKTFISGYANGVIPNLWDRSRNA"
FT   CDS_pept        complement(521191..521991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04320"
FT                   /product="ABC-type transport system ATPase component"
FT                   /note="sulfonate/nitrate/taurine transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98795"
FT                   /db_xref="GOA:D4Z8H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H6"
FT                   /protein_id="BAI98795.1"
FT                   /translation="MDARLGFSALQSAADHRDPPHPEPVVRLRDFTRRFGPNTIIDGLD
FT                   LDIAPGEFIALLGRSGSGKTTLLRTLAGLDEVRGQDVEVPDSRAVVFQDARLLPWKPVW
FT                   KNVALGLKGDRVRDRSEAALKEVGLGHRLDAWPLTLSGGEAQRVALARALVREPKLLLL
FT                   DEPFAALDALTRYRMHDLVLSLWRAHRPAVLIVTHDVEEAIALADRVLVLDKGRIVAQE
FT                   RIAVPRGDRSAISGRLREKLLSYLGGDDHGEGVLPFAPVAEAAE"
FT   CDS_pept        complement(521994..522812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04330"
FT                   /product="ABC-type transport system permease component"
FT                   /note="sulfonate/nitrate/taurine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98796"
FT                   /db_xref="GOA:D4Z8H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H7"
FT                   /protein_id="BAI98796.1"
FT                   /translation="MTVLTVDRSGAGHVGARGFSLSRFGGRWLSPVVLLLLWELGSRSG
FT                   LIPERTLAAPSAVIGTLLEMLLSGELPSNLLVSFARVAAGLLIGVSLGLILGLVAGLSR
FT                   AGELAVDPLMQIKRTIPALALTPLFIVWFGIGETPKVALIAFGTVFPVYLNLYSGIRSV
FT                   DLRLLDAAKSFGLSRWEQIWHVVLPSALPSLLVGLRYALSVAILVLVVAEQINASAGLG
FT                   YLINNARDFMRTDIIVVCLMVYAILGLGADWLVRTVEARALIWRPSIVEQ"
FT   CDS_pept        523105..523941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04340"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98797"
FT                   /db_xref="GOA:D4Z8H8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H8"
FT                   /protein_id="BAI98797.1"
FT                   /translation="MPVNLPTNLLRSFVAIVDTGSMLNASEQVFVTQSALSLQIKRLEE
FT                   LVQQTLFLREGRRLNLTTAGEVLLDYARRVLLLHDEAVAAVSAGRFAGPARIGMVQDFA
FT                   DSLLSGLLSRFSELHPDAQIYARVAGTAELQTLLDRRELDIVLGFAAPNDPHAVTVAPM
FT                   SWYGEQALVEREVIPLAVLEEPCRFREAAIRALEDSGLQWRIAVETPNLATLKAAVGAG
FT                   LGITCRTHLFLEDSQALEHERLPHLPRVAAILRAGEKLDKAAHRLAELARETVQTL"
FT   CDS_pept        complement(524151..525095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04350"
FT                   /product="putative dehydrogenase"
FT                   /note="phosphoglycerate dehydrogenase or related
FT                   dehydrogenase / D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98798"
FT                   /db_xref="GOA:D4Z8H9"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8H9"
FT                   /protein_id="BAI98798.1"
FT                   /translation="MSLIIASQLDPDFNRSLGLHPSAPTLIDVAEDEPWTAAREADILL
FT                   IRPSPAWRQSARIRPDIWPGRLKWVYSASAGVDFYPGWLLEAPLVTCGRGVASEEIADY
FT                   VIAAIYAHAKNLQAAEAHSREQWIPRPLGRVSGTTIGIVGLGAIGAAVARRGLALGAQV
FT                   IGLRRSGAQSGISGVQHVSDLATLAAEADHIVVAVPGTPETRHLFNEALFARIKPGAHL
FT                   INVARGSVVDQEALIDALDRDRLGFATLDVTDPEPLPEGHPLYTHPRVRLTPHISSNYS
FT                   LVRHRLLEKVNDDLSRFVRGEKPSDIVDPARGY"
FT   CDS_pept        complement(525097..526275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04360"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98799"
FT                   /db_xref="GOA:D4Z8I0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I0"
FT                   /protein_id="BAI98799.1"
FT                   /translation="MASHAFAVETPSREPIGPELLDRITRKLAETAEAYDRSAEFPRAN
FT                   FDLLAREGLVGLTVPVEYGGRGASLSEGLRVLGAVAKGEPSTALILFMTYHYHAAPARA
FT                   QGWPPGIYERLARQAVQGRGLIGGLRVEPELGTPVRGGLPATVARRTADGWAISGTKIY
FT                   STGSTGLDWFAVWARTDEEQPRVGNFLVRSDSPGIAIEPAWDHLGMRATVSHAVHFTDT
FT                   PVPLDHAVDIRRPEQWASGAGDFSLAIWNALAISTIYDGVARAARDWLRAYLNDRVPSN
FT                   LGASLATLPRVQEKFGKIETLLQVNRTLIRDAAARHDAGDAPGAVEVNNIKYLATANAI
FT                   RAVEIGLELTGNPGISRKNPLERHYRDVLCSRIHSPQTDTILIAAGRAALGN"
FT   CDS_pept        complement(526281..527267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04370"
FT                   /product="ABC-type transport system periplasmic component"
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98800"
FT                   /db_xref="GOA:D4Z8I1"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I1"
FT                   /protein_id="BAI98800.1"
FT                   /translation="MVAEGWSRRAVLAAGAATGLLLGGCGAGRHARPRLRVSLTGKGEV
FT                   DSRLLFKAAGIAPKGFDIHYSEFQSGHLVVEALNGGSLDYGGMSEIPPIFAAASTIQSF
FT                   RQVAVVHGDVNNQVVLLPKGSKARSIADLKGKRVGYVRATTSQYFLIRMLEEAGLGWDD
FT                   IRPVAMGVSDGAAAFSQGALDAWAIYGFPIQRAIAIEGARILRTAQGILSGNYLISVHV
FT                   DALADPEMSRIIREYLALAQQAYGWAAANQDEWAGIIARNIGVPRQYVTDQFRRRSAIY
FT                   ELRPVTDAAIASQQEVADLFFAQKLLPRAVDVRPLWDARFNDSIGKG"
FT   CDS_pept        complement(527257..527391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98801"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I2"
FT                   /protein_id="BAI98801.1"
FT                   /translation="MKPLQALKEYWIRLRAAARREFLRDPDVILFERAAPQQESAGGR"
FT   CDS_pept        527456..527794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98802"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I3"
FT                   /protein_id="BAI98802.1"
FT                   /translation="MLGGLLDFLSGGFRRSTSRRARAACPSAMKNWPGSQSRQLLDYLE
FT                   LDFQPSRRLPGGHWRRRARRPAADLSPRDGNSPVKSAPFRPRIGKAAKATGAAAVALLQ
FT                   SSRKEDSH"
FT   CDS_pept        527812..529152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04400"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /note="uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98803"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I4"
FT                   /protein_id="BAI98803.1"
FT                   /translation="MTGEAMAFDDHPTVRALREQESIEPVEKVSAALLKQIARECGAAD
FT                   AGLVELTRPALAPQIPYIRKVYGRTKTLLAIVCRMNEWPVRSETRSVANEEFHATYDHV
FT                   NEACREIVRELARRGIPACNAIAAFPMELDQPKIMMVQHKPVAVEAGLGHMGVHRSVIH
FT                   PKFGSFILLGTVLLGVEVDEYDQPVDYNPCLGCKLCVAACPVGAIKADGAFDFMTCYTH
FT                   NYHDFTGNFLNWVENVVEAKDKADYRKRIPPSETQLMWQSLSFKPQYKAAYCISVCPAG
FT                   EEVISPFLRDRKTYVEDVVKPLLDKKETLYVIKGTDADESVPRKFPHKQIKHVRAGRIT
FT                   TSLMGHIFSLRLSFQRGAARKLNLTSHWTFEDAKPHLVTVRIAGKQLDISDRSHVGEAD
FT                   FKVWVRLERWYDYLNMLCELDDLFEEGSIRLEGERSQLDAYLACFPF"
FT   CDS_pept        complement(529282..530565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04410"
FT                   /product="putative secreted phosphoesterase"
FT                   /note="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98804"
FT                   /db_xref="GOA:D4Z8I5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I5"
FT                   /protein_id="BAI98804.1"
FT                   /translation="MKPNHLFRAVAASFLAMAAPSAAQAPDRGFTIAVIPDTQNYLDYS
FT                   HQREAGFPIDAREIFLDQMEYIARNARSAGGDIVFATSVGDVWQHGSRSMDAEHAAKGL
FT                   KAIPNPVFGNYLKPEPRTLTVEMPTARAGYSILAGKLPFSVVPGNHDYDAVWSDSRWPA
FT                   TMKGNDPMRYGMLHYGGLDNFRSVFGSGSSFFKDKPWYVASFNGGADSAQIFEAGGYRF
FT                   LHIGLEMAPEDDVIQWAQGVLKSHPGLPTIISIHDHLNIAGERKPIPAVDFDAVHKEHN
FT                   SPEELWRKFIARNDQIFMVLSGHQHGQAHATDSNAFGHDVHQILADYQDRGQILPMIAP
FT                   GAPKAALGDGWLRLMKFDFSGEVPTVSVSTYSTYFHSSSDRMTSYPALYKEHEKPAASD
FT                   AAFGAEDRFTLTLSDFRERFAKAAVAAR"
FT   CDS_pept        complement(530595..531809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04420"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98805"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I6"
FT                   /protein_id="BAI98805.1"
FT                   /translation="MAGHEESDRTLDGAPGAPLRINQFIFTDQVKQTSLEARLSNAQEG
FT                   GFNWVAGAYYLKDKTDFGTTLFYEDSRFTQIETDYHQKRDSFALFGQVDWRLFDRLTLT
FT                   GGLRYTTESSNYFGSTIDANPYGISLGVGLPLPVFFDNDFDDDNLSGRASAKFDLTRSL
FT                   SIYGAYGRGYKAGGFDGTSIFSAPEALSFKSETVDSFEGGIKWFPASNLFNLSVDGFHY
FT                   SFKNLQSSTATPNGNVRTNIAAAKLKGVDVTGTLNLVRTETQQLTFDVGATFLDSEITR
FT                   FESSNPVLVTLNLGNNLPAAPKASGHARLAHSIALMPDWRLRSSVDVTYKGSEYKRLDN
FT                   SLSSKTEAYALLNLRLELQNAASGISLYGYVRNVTNERYYVDIAGPSRLIGAPRTFGAG
FT                   ARFAW"
FT   repeat_region   531841..531842
FT                   /rpt_type=FLANKING
FT   repeat_region   531843..535623
FT                   /note="transposon Tn3 family"
FT   repeat_region   531843..531864
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(531876..532469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="SJA_C2-04430"
FT                   /product="resolvase"
FT                   /note="invertase/recombinase like protein / site-specific
FT                   recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98806"
FT                   /db_xref="GOA:D4YYF2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYF2"
FT                   /protein_id="BAI98806.1"
FT                   /translation="MALIGYARVSTADQKLSLQLDALNAAGCDRIFDDHASGAKADRPG
FT                   LAEALAYLRSGDTLVVWKLDRLGRSMSHLIEKVGELATRGIGFRSLTENIDTTTSGGML
FT                   VFNIFGSLAQFERDLIRERTHAGLKAARERGRPGGRRPVVTPDKLRKAREHIASGLTVR
FT                   EAAARLKIGKTALYKALEATEKNTKSQRSRSVRS"
FT   CDS_pept        532609..535566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="SJA_C2-04440"
FT                   /product="Tn3-family transposase"
FT                   /note="transposase or inactivated derivative, TnpA family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98807"
FT                   /db_xref="GOA:D4Z8I8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I8"
FT                   /protein_id="BAI98807.1"
FT                   /translation="MARRRLVSAEIWAGHYGAPLDEREIARHYTLTGDDLEIVGRRRGD
FT                   ATRLGYAMLLLYMRWPGRALEAGEVPPAPVLAYVAQQLGVAPEAFADYAHRDQTRREHL
FT                   VEIRRSHGFRIFDRKAFHEVVAFSIPIAQTIVHPGQMAGVIVDELRRRQILLPSSSVLE
FT                   AVLRRARQQAEQLTYEVLTNGLRPDTLQGLDDLLARRTGQAATWLSWLRNAPQSPAARN
FT                   ILRLIERLTHIRALDLDRARADMIPALTFDRLADEGSRITPQHLGELNALRRHATLAAQ
FT                   GIRLEESLTDATLTMFDKLLGSMSRRAENRTRDKALKTVRELQGHLRTLTGSCRILIEA
FT                   RTNGVDSLAQIEALDWQRFAVAVARAEVLGRPETVDRTAELIERHRTVKLFAGAFLNTF
FT                   EFRGAGAVQGLLSALTIIAELYRTGKRRLPDRVPLRFVPSAWRPFVLRDGIVDRAAYEL
FT                   CALSQLRERLRAGDIWVSGSRQFRDFDSYLIPPATFDALREKGPLPLAIETDFDRHIEE
FT                   RRARLDTAIEQVTVLARQGELPQVRLDESGLIISPLKAATPPATEIARRAAYDRLPRVK
FT                   ITDLLLEVDAWTGFSECFIHRRSGREADDRNALLTVILADGINLGLTRMAETCRGASLR
FT                   QLAHLHDWHISEAAYGEALGRLIDAHRAMPLAALWGDGTTSSSDGQQFHAGGRGAAIGD
FT                   INARSGNEPGVAFYTHVSDRYDPFATRVIAATAGEAPYVLDGLLYQQTGLTIEEHYTDT
FT                   GGASDHVFGLMPFFGYRFAPRLRDIKQRRLHLLPGQEAGPLLAGMTAEPIALGHVAAHW
FT                   DELLRFATSIRTGTATASAMLRRLSAYPRQNGLALAMRELGRLERSIFMLDWLRDIDLR
FT                   RRTQAGLNKGEARNALARALFFNQLGELRDRRFENQTYRASGLNLLVAAIILWNTRYLE
FT                   VALADIGTPDEIARHVAPLGWEHISLTGDYSWNVEDRPDPDVLRPLRAISSLLAA"
FT   repeat_region   535602..535623
FT                   /rpt_type=INVERTED
FT   repeat_region   535624..535625
FT                   /rpt_type=FLANKING
FT   CDS_pept        complement(535903..536139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98808"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I9"
FT                   /protein_id="BAI98808.1"
FT                   /translation="MAAATTDGARPWAAQTIAVALRRRTSGGVGALRQWEDRSDLRQLH
FT                   SRRLASVLIQRGELRRAHQPPASVYDNREGTCS"
FT   CDS_pept        536368..538122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB1"
FT                   /locus_tag="SJA_C2-04460"
FT                   /product="putative plasmid stabilization protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98809"
FT                   /db_xref="GOA:D4Z8J0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J0"
FT                   /protein_id="BAI98809.1"
FT                   /translation="MTIQTIQLNKLALSDLNVRKVKPKEIEALAADIQARGVLQNLIGY
FT                   DEDGKIRICAGGRRYRALKLLQKAKAIPGTFEVPVEIRSKDEALEISLAENAQREDMHP
FT                   ADAIAAYRAIIDSGKDVDDVAASFGVSPAYVRRVLKLAALHPTILKAFQKDEIGMGAAQ
FT                   AFALTDDQDRQLEVFKRTGDNAHQIRAMLTQEKVADTDKHFRIVGEEAYCAAGGTFTTD
FT                   LFGERRYCDDAGLVMDLVQDRLDAIAKAAREDGWRDAEGQLYRPDSYWMRGHLEPAGER
FT                   DPTEEETAQLVEIEAAIAKRESEVDEDDHDYDDELRALTRKQDAIVSACRVFTAEQKAE
FT                   HSLIVFIGHDGIEQVAFTRTAKGTAADGPKPPRPDYSQKVMDQLGGIRTMAVREALASD
FT                   PELALDVLLTGLLGQVRGNAYSWQQAAEITAEKNRFHVDDAVMGHSTIADIDEIARADL
FT                   DRLAETPTLDDMRQMDSEAKLRLLAYCVASQITSLSFHSDRDRQLAQIVGAAQINMADK
FT                   WEPNQVFYDQLSKATLLKLLAEGCGNDAVENCQTMKRSDLAVTVNERLAGRRILPPAST
FT                   LCLARCRR"
FT   CDS_pept        538625..539497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_C2-04470"
FT                   /product="putative antirestriction protein ArdC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98810"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J1"
FT                   /protein_id="BAI98810.1"
FT                   /translation="MAKETNRIDIYQAVTDDILAMLEAGTKPWVKPWSGGPTIPLRHNG
FT                   VAYRGINVLSLWASAMRQGFASPYWLTFKQALELGGNVRKGSKGTTVVYANKLVVKDSE
FT                   TDDERAIPFLKRYTVFNADQVEGLDGKYPAPAPIITNPETRDVELEVMFSRIDATVRIG
FT                   GSQAYYHTRDDYIQMPAFEAFHSADDYYATLAHEAVHHAGHESRLNRKTLISTSRADYA
FT                   RDELVAELGASFIGAIVGFKVEEREDHAAYIEHWLTALRNDKRAIFEAAREAQNAADYL
FT                   LAMMTDQAD"
FT   CDS_pept        539645..539905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98811"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J2"
FT                   /protein_id="BAI98811.1"
FT                   /translation="MENIIDTYRNRIKAMGYEPRRQEEIPDVMAAYCEAIANCKIEGLE
FT                   LVSDDHSFCLLLVETQIPVDVAIGLAQDYNRDVLSRQKLAA"
FT   CDS_pept        539909..541189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fic"
FT                   /locus_tag="SJA_C2-04490"
FT                   /product="cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98812"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J3"
FT                   /protein_id="BAI98812.1"
FT                   /translation="MSDPYTWRNSDVLRNKLGIRDDNILKEREAFFSVVRHGELVVQRA
FT                   APATNAREYRELHNHLFQDVYDWAGRFRTVDISKPGSTFARAHFIARSMEHEFKQLPDL
FT                   QTLKSMDRDRFADTMGRHISELNAVHPFREGNGRTMRLHLQLHSLAAEKFVSIQAMGPK
FT                   DWMEASRDSFHTGNHASLAKVIRDAMPLEQNRVEPARGPAGIAFPPSMESLMPVGERRA
FT                   MSIEQAKDQISRYLPTAQTVASRQHEQLNRIAETSADMRQLAARSAQELAFFRDPKGPM
FT                   HHLQLIEQRRYHQIEVNWSEGMDPLQRVRAISAGAADFLSKMTDRDIQAADRALRLQVM
FT                   PPGVSQVDLRLAAQFEKNSPEQNRADARFAQFQLAIDKRVATATERGASKEQLAQIVES
FT                   AKAHVAATLREGKSPTPAAEKSKDRER"
FT   CDS_pept        541517..541906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98813"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J4"
FT                   /protein_id="BAI98813.1"
FT                   /translation="MEATTDQIATVAALNDIARRTMGVTCRTVITQGIAALDENTQSDI
FT                   LKMIEGFEDFTPDNDPHGEHDAGFLYRDVIGQWHTRWTDDSTRPALSVMWKFDYYDRDL
FT                   EFGSAEPWNPDATTRVLTILLTSEY"
FT   CDS_pept        541918..542205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98814"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J5"
FT                   /protein_id="BAI98814.1"
FT                   /translation="MTKSPPVIELSWRDENYGSVCAVAAFRNYAGTLDWSDRTHQRFRG
FT                   CLKRAGFAFHDGRCSYIATSGTREDRQRALCDELARAGFQIDSGDVRAEA"
FT   CDS_pept        542202..542468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98815"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J6"
FT                   /protein_id="BAI98815.1"
FT                   /translation="MNRERRKQIAAARVLIDKGKALLDEARDMLETVKDDEQAARENLP
FT                   PSLEDSERAQAMDAAVSELESAISALEDFDADEIGTQLDTASE"
FT   CDS_pept        542481..542690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98816"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J7"
FT                   /protein_id="BAI98816.1"
FT                   /translation="MQPMRHLDRDTRRARLLAARTRPVGGINRRGIFTGHWDGGDVVRQ
FT                   FRGDNGSWIGLAAYKAKEEPEPQP"
FT   CDS_pept        542687..543220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98817"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J8"
FT                   /protein_id="BAI98817.1"
FT                   /translation="MKISNTASAVRVTLSPTEISDLQFVIEAAERAGHYMPARVLNIMA
FT                   ALTRSADDVRMKQAMKRAEKDRVTRIEQDRRARERQFMLGDRYSVIASRTDYADASSDP
FT                   DARQWVDLVFHEIMQRPLPDQYELRRDVWRVHVVQLDGGTLGAVVGGDCTQTADPAEIT
FT                   SVAEQLIARFEARA"
FT   CDS_pept        complement(543262..543552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98818"
FT                   /db_xref="GOA:D4Z8J9"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8J9"
FT                   /protein_id="BAI98818.1"
FT                   /translation="MGLVSQVSADDRESAWRIIRHREIMERLIPLWAVLGVALVLMGVD
FT                   LGGRLLWTLPMIGYVFGVMAVDHGPDYRAANYWVPVLGSQAAALLPLIARF"
FT   CDS_pept        544018..544254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98819"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K0"
FT                   /protein_id="BAI98819.1"
FT                   /translation="MAANYNRPKPIDPIWYRQGCYLRIYCACGRRVVAPLGDFARSRRI
FT                   SFDTRIYELIARLRCSQCRRKPYADVSRNRSGN"
FT   CDS_pept        544654..544914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98820"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K1"
FT                   /protein_id="BAI98820.1"
FT                   /translation="MTDIPLATILRINAARTIPLARYEEEGNFDRFGYIKDLAENHGAD
FT                   LPAVIEIADLLGPDEDFDGLVTTIEDAAEGFGFGALILGGA"
FT   CDS_pept        544932..546368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04580"
FT                   /product="putative DNA methyltransferase"
FT                   /note="N6 adenine-specific DNA methyltransferase, N12
FT                   class"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98821"
FT                   /db_xref="GOA:D4Z8K2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031339"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K2"
FT                   /protein_id="BAI98821.1"
FT                   /translation="MTPAQIADICDGRDKAIALWLGLYDTYHATRDEAARLTLGGPLSL
FT                   SCGRDWTEDTLTRAFIQSQPIDQRDKETGARQTIDARDNFERVLTHTMDRRCWAALMEQ
FT                   LGFDQLLDQQARKEFHDGLRDDPVPFTPDNCAATFGNIWTNRRDLYLRGIANVFAKLDR
FT                   RFRSHNGFKIGARLIIDRALNEWGSWDRYERRDTLRDVERVFLELDEKPPVSEGHSIAS
FT                   QVADAARVRGSLPTVIEGDYFRVRVFKNGNLHIWFERDDLLQSVNLLLAEYYGEAIGDG
FT                   YETTEAEAAPAYHITPAKNFGAFMTSPEIAAQVIEHARISKGQRVLEPSAGKAALASAA
FT                   RNAGADVTCVELQPGFAHELRVIHGFADAIEGDFLALDPAHYAPFDAVIMNPPFDRGRD
FT                   CDHVRHALAFLKPGGVLVAIMSARAEYGEDQRHKALHRMIAGCEAIYFHGRKWIDLPPG
FT                   SFAHAGTNVNTVLLAIRKPG"
FT   CDS_pept        546686..546934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98822"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K3"
FT                   /protein_id="BAI98822.1"
FT                   /translation="MKIRIYRQTEQDFDRIEIEGATFETIVNRAAVEGFQCSGYNSNPS
FT                   QRLELQGAPKFKGICGPMWDGDAIRYECSATYAELSA"
FT   CDS_pept        546931..547740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98823"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K4"
FT                   /protein_id="BAI98823.1"
FT                   /translation="MSAAPAIRTAQADELGDQIIAAGFATSGFLLDINGALDVPRDFPL
FT                   SAPWNLPSRLFQFPIEVIRAEQDEPRKIGLRHPLLAAHPFVQHVERALGIEIARDGVTN
FT                   RHGYSNRAHSLWHHAVDLISAGKWRELLETQEFTEPRNIFKAVAYGLRYSHHEDKRASG
FT                   HINTAEARQIMRAMDATEPTDRAALILSLSAPSPCKQDRSAEYWAINAHGICAEDEAWA
FT                   FIVGIEDGWFSYDRAGFLQWSPKGRDRYAAGDSASFTEASGQTAFAF"
FT   CDS_pept        547752..548375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98824"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K5"
FT                   /protein_id="BAI98824.1"
FT                   /translation="MARHCIREPRYVPPVQRIGEQPDLFGGPTLSHVAERKGPPKGWQR
FT                   QLQKWGRCTVIADLESAPLPAINPAPSPAPVFLVACVAAKLDRPAPARDLYASPWFRKA
FT                   RAYVERQEGQWFILSAKHGLIAPETVIAPYDETLGAMKASARRLWGVRVIEAMADQIDA
FT                   AAPLIVLAGRHYRDPLWPQIERRASAPMEGLGIGQQLAWLAQKW"
FT   CDS_pept        complement(548598..549263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98825"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K6"
FT                   /protein_id="BAI98825.1"
FT                   /translation="MPAPPASAGLTALRLGLKDKGDKLRVETLAALNVADAGTVQHIID
FT                   AIRNDLRQLVGHSLNVGARFADEHRIFRPHAFGLKMVLIVDRISQGVDRSISKRALESQ
FT                   LGEQTMRHNNLLVAGIGKAKGRVAPGRVRDREAAALAGGGGADLRSKLGGPPILDAAWC
FT                   VPHARKTLTGGFNKSTPARRADRYLGASLARTMALYSSSACRTFSSSVTVRAWLVADA"
FT   CDS_pept        complement(549233..549553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98826"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K7"
FT                   /protein_id="BAI98826.1"
FT                   /translation="MMCIRFSFSLVTGDTRHGHRRRLSGTAKRPRQRAVGEPICAANWG
FT                   NRRSLKAGAHPCQNASTHREKRLRGAGFDAPPPAPCSTEIIGFAQRAKRGGPCPPLRRQ
FT                   PD"
FT   CDS_pept        549636..549764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98827"
FT                   /db_xref="GOA:D4Z8K8"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K8"
FT                   /protein_id="BAI98827.1"
FT                   /translation="MKVQEANKGIESKLTAQTWVIGSVGFVLAVIGLAPAFIKLFQ"
FT   repeat_region   549762..549764
FT                   /rpt_type=FLANKING
FT   repeat_region   549765..550669
FT                   /note="insertion sequence:ISSj12"
FT   repeat_region   549765..549782
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(549781..550578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04650"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98828"
FT                   /db_xref="GOA:D4Z8K9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8K9"
FT                   /protein_id="BAI98828.1"
FT                   /translation="MAQIAKKTKRYPSDLTDEEWDRLAPLMPKPGRRGRPREVDFREVI
FT                   NAVRYLVRSGCGWRMLPIHFGAWQTVYGWFRELARRFLFQTIHDIELMLDRERQGREAS
FT                   PSAAVIDSQSVKAPSAEKRGFDAGKKVVGRKRHIAVDTDGRLLMVNLTTADISDSAGAQ
FT                   TILDGIRKRWPWIKHLFADGAYDRLKLMDKASYLDFVIEVIRRSDQQQGFKVLPRRWVV
FT                   ERTFGWMIRWRRLVRDYEKRIDVSQAMILVAMGGNLLRRNAHP"
FT   repeat_region   550652..550669
FT                   /rpt_type=INVERTED
FT   repeat_region   550670..550672
FT                   /rpt_type=FLANKING
FT   CDS_pept        550765..550995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98829"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L0"
FT                   /protein_id="BAI98829.1"
FT                   /translation="MFESGVFGQGNAFWRWIATVEARPYLAAFAADRAPPSEREFFAVD
FT                   LAAEDLLDSDHLAELAQQIEATHGGRHTRQG"
FT   CDS_pept        complement(551285..551542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04670"
FT                   /product="Xre-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98830"
FT                   /db_xref="GOA:D4Z8L1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L1"
FT                   /protein_id="BAI98830.1"
FT                   /translation="MPTIYLKRTSPLMTQLGANIARELKKLGITQGELSERSGVAASHI
FT                   SYMVRGQGNPTLDTLESLAGVFRLSVVELLAEDSISDDQS"
FT   CDS_pept        551698..552432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04680"
FT                   /product="ECF-type sigma factor"
FT                   /note="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98831"
FT                   /db_xref="GOA:D4Z8L2"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L2"
FT                   /protein_id="BAI98831.1"
FT                   /translation="MDGQDDAMKSAMELFAARLAKRDVERPITDHRTVERLIAMLEPHE
FT                   QQVVRLRIGLGPSPALTLAATAKIVGVSPSRIGQIEDKAFRRIRWVCNNIDIHDRSALD
FT                   ALIARRRDEAAEAERIRKRDALQKALDQERKRKAKQDRDEVRRAKARDSAWNRKLRVAQ
FT                   AELDRMRSDAQFFAEQIAQIEQRANWLRAILPRDRQLAALREQADEIRDAIASAEASIS
FT                   NMLASPPDGPQLGKEASTNDGH"
FT   CDS_pept        552422..553120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04690"
FT                   /product="ParA-like protein"
FT                   /note="site-specific recombinase, DNA invertase Pin
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98832"
FT                   /db_xref="GOA:D4Z8L3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L3"
FT                   /protein_id="BAI98832.1"
FT                   /translation="MATDIEPSPAFAPQIGRVYLRVSTDAQDLRRQDAIVAEAKAAGYY
FT                   VAAVYREKASGARADRPELLRMIADLQPGEVVIAEKIDRISRLPLAEAEQLVETIRARG
FT                   ARLAIPGVVDLSDLAADAEGIARIVLESVQAMLLKIALQMAHDDYTDRRERQRQGIALA
FT                   KAAGRSGGRKGDRATHARIVALREAGKSIAKTAELADCDRSTVKRVWAAHRAAQVQEPS
FT                   PQRNHRERNR"
FT   CDS_pept        553514..553828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04700"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98833"
FT                   /db_xref="GOA:D4Z8L4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L4"
FT                   /protein_id="BAI98833.1"
FT                   /translation="MQNIAEFRIIGRVGSVDTTDKVTHVSVAANYNRKDGDEWKTDTHW
FT                   NRVTFFRQLAERAADLGKGDLVHITGRVRQNSYESNGETRYSVDLIAEGLGILVRGGAD
FT                   "
FT   CDS_pept        554254..554544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98834"
FT                   /db_xref="GOA:D4Z8L5"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L5"
FT                   /protein_id="BAI98834.1"
FT                   /translation="MLWASLALWLAIAATALIVVLAVGLAAYFAFGWLGVGAVAVFVLI
FT                   VFFGKDPPTEQTGPRRKGKGLNLNDDPNPWYMQSQYRFGSGNSAAHNRWHK"
FT   CDS_pept        554590..555333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04720"
FT                   /product="IncC-like protein"
FT                   /note="ParA-like ATPase / ATPase involved in chromosome
FT                   partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98835"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L6"
FT                   /protein_id="BAI98835.1"
FT                   /translation="MTNERGGIGKTTLTCHIAWHLAEQGKRVVVLDLDKQCHSAGMLKA
FT                   EFEQIGPVQSILDFDPNEEPPALACFKNTRQIVELTTDSPQQGQHIGAYVRAIRAGLAK
FT                   HYDYCVIDTAPAWDGRNLMALIASDYVAVPLDPDKTARQSLNEISQSISLANKVRGEGN
FT                   ATRFGIVFNRVQTTSEVSKMLMDRIGQALPANVVPHTIPHREHMREAALLEIPVWRLAK
FT                   DTRRSAPIVREVVSYIVDQAEREAA"
FT   CDS_pept        555330..556355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04730"
FT                   /product="ParB-like protein"
FT                   /note="chromosome partitioning protein ParB / putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98836"
FT                   /db_xref="GOA:D4Z8L7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L7"
FT                   /protein_id="BAI98836.1"
FT                   /translation="MSKAAVKPAKKSFADFDMDAMDFSAVPANTEFKAAGRFQRLPLDD
FT                   IDPDPTQVRREFDQAEIDALAATIKDRGLLQPIVVAPTSNGRYIIRYGERRYRACRQLG
FT                   FDQIDTVLDQADAERDIGLDQFLENEQRQALSLAERVSFIASRVSDTLSTKDLAARIAK
FT                   PHSEVKRLYSLRTLPEDILAALKNCSPRAAVAIKHAIELDEQATRNFVAANENPTAAAC
FT                   EQFLATLQGSPEEETAQAGAAKAIDDPASPQESRALVAAATSATDDRRERPELDAHDDE
FT                   REGDGAVLADPSDHKPRAPRQPKEATDAPAIIIQGRRGIVLSGQVTVRFDGEAAPQTFD
FT                   F"
FT   CDS_pept        556546..557097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98837"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8L8"
FT                   /protein_id="BAI98837.1"
FT                   /translation="MEKTLGFKIEATKLAKIDALAQTRGGRGPFMRQLVDAVLRQSGAA
FT                   SEAAPLVDREAAGEHRLYLRPTETELAVIRHRAKERRMTPATWAMALVRRHIGIAAPVD
FT                   RELREELLNCRQALQRIGRNVNQIARAANKMALADNAAEIAGELQKVNDLRAAIGAAVE
FT                   GIGAATKADLSYWEVSSERL"
FT   misc_feature    557231
FT                   /note="may be target duplication site"
FT   mobile_element  557232..558111
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   557232..557248
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(557286..558050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04750"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98838"
FT                   /db_xref="GOA:D4Z6Y2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y2"
FT                   /protein_id="BAI98838.1"
FT                   /translation="MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHT
FT                   TIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFY
FT                   LSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDQETAHRQ
FT                   VKYLNNVIEADHGKLKMLIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIR
FT                   GEVRLVERAFGIGPSALTEAMDMLNHHFAAAA"
FT   CDS_pept        complement(558090..558650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04760"
FT                   /product="type IV secretory pathway VirD2 component"
FT                   /note="relaxase"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98839"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M0"
FT                   /protein_id="BAI98839.1"
FT                   /translation="MVKVTGRPKGKNHAAAHFDYIGRKGDVPLETRDGDILTDKEARAE
FT                   LARDWGDPVYWRDNSTVAAVSMVFSMPAGTDPDKVLSAVREVARSEIGHEWDYVLALHT
FT                   DTPRPHVHVTVAARGDTGQRFNPRPQTLHHYRERFAEELRARGVTAEATPRAARGVGRA
FT                   GQSMALNRMRQRYMAGTALLQKS"
FT   repeat_region   558095..558111
FT                   /rpt_type=INVERTED
FT   misc_feature    558112
FT                   /note="may be target duplication site"
FT   misc_feature    558696
FT                   /note="may be target duplication site"
FT   mobile_element  558697..559576
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   558697..558713
FT                   /rpt_type=INVERTED
FT   CDS_pept        558758..559522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04770"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98840"
FT                   /db_xref="GOA:D4Z6Y2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y2"
FT                   /protein_id="BAI98840.1"
FT                   /translation="MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHT
FT                   TIYRWVQRYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFY
FT                   LSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDQETAHRQ
FT                   VKYLNNVIEADHGKLKMLIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIR
FT                   GEVRLVERAFGIGPSALTEAMDMLNHHFAAAA"
FT   repeat_region   559560..559576
FT                   /rpt_type=INVERTED
FT   misc_feature    559577
FT                   /note="may be target duplication site"
FT   CDS_pept        complement(560011..560637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="SJA_C2-04780"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98841"
FT                   /db_xref="GOA:D4Z6Y3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y3"
FT                   /protein_id="BAI98841.1"
FT                   /translation="MLKLYYNPGSCSLASHAALEEAGLPYEAELIDLTQNAQFSDAYRQ
FT                   KNPWARVPALQIGDDVLTENIAILNHIAELVPEKALLPTEGLARARALEWLALLSSTVH
FT                   VAFRPIFRPGRLAETAEGQKDVAATGLNSLKSVLALLDERLGKGPYVLGDTFSLCDPYL
FT                   FVFVFWARRPILEGKLDPLPNLDAFAERMRARPSISAALAQEGLA"
FT   CDS_pept        complement(560782..560985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98842"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y4"
FT                   /protein_id="BAI98842.1"
FT                   /translation="MDPSIADRITSLSTMRNNEEIFETFGFSYNTLRKVSNGMPLRRSL
FT                   ADRIEERARKVFEADGFLNISA"
FT   CDS_pept        561126..561362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98843"
FT                   /db_xref="GOA:D4Z6Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y5"
FT                   /protein_id="BAI98843.1"
FT                   /translation="MLRMGRTRSERASGRRGRERIATDAPRIARRSKHRNILSMRRYGS
FT                   APVLSGTSVIIMLIGPSGKDRSFRLRRKLLQMN"
FT   CDS_pept        561603..562220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04810"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98844"
FT                   /db_xref="GOA:D4Z6Y6"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y6"
FT                   /protein_id="BAI98844.1"
FT                   /translation="MSRDNAIVMRYDNPDIPSGRDIVYLHGRGSTEREAGFALPLFGRA
FT                   NVRSYRGPLPQGPGFAWFENAGIGVALPSSLSGETSKVGDWIAADTGRQRPWLCGFSNG
FT                   AAMAASLLLSNPGAYSGLIMIGGCFAVEDGDLPDNGLLDKPVLFCRGQFDDVIPRHKFE
FT                   QAEAYLSGPSGARATFIPYEGGHELPLPIKAAVQGWLGAESR"
FT   CDS_pept        complement(562332..563390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linF"
FT                   /locus_tag="SJA_C2-04820"
FT                   /product="maleylacetate reductase LinF"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98845"
FT                   /db_xref="GOA:Q5W9E3"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5W9E3"
FT                   /protein_id="BAI98845.1"
FT                   /translation="MQFVYDPLPYRVIFGAGSVRRVADELSHVGSRALVLSTPEQAGSA
FT                   QELAATLGDKAVGLFSKAVMHVPVATVDAAAAVARELDADCTVAIGGGSTVGLAKALSL
FT                   RLDLPSLVVPTTYAGSEVTPIWGLTEDGIKTTGRDKKVLPKVVVYDPDLTLSLPAEMSI
FT                   ASGLNAIAHAMEGLYAFDGNPIVSLMAEESIRALARSLPLIKADPTDAKARGDALYGCW
FT                   LAGSVLGAASVALHHKLCHTLGGTFDMPHAQTHTAVLPHAIAYNAPSVPEAMERASRAL
FT                   GGGDPATKLYELAVGLGAEMSLAKLGMPKDGIAKAAALAVANPYPNPRPITEEGIVQLL
FT                   SRAVEGLPPITA"
FT   CDS_pept        complement(563411..563716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98846"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y8"
FT                   /protein_id="BAI98846.1"
FT                   /translation="MPRRAPPEGEPCGRRAKDGAGREKEKHYKIHMLAGIFFMSGPARS
FT                   GRCDSPAEQGAGGSRTGMGGPGPLCVCPISPFIGRLGSWRSAGSRQRSSAPDIRQF"
FT   CDS_pept        complement(563717..564706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04840"
FT                   /product="LysR-family transcriptional regulator"
FT                   /note="PcpR homologue"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98847"
FT                   /db_xref="GOA:D4Z6Y9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Y9"
FT                   /protein_id="BAI98847.1"
FT                   /translation="MISFMHLTVFQALMRAKSVGVAAEMLDMPQPTLSRHLKQLREHFG
FT                   NQLFVRTSRGLEPTSLAITAAPAVSQTLELYHSRLSGEPTFDPATSNRDFHIAASDVGH
FT                   LLVLPRVLQWVRDLAPGVRFKAIPLGGEKLIARLETGEVDIAIGSFPALYAGVVEQTLF
FT                   PEEYVCVVPRSYLPAGRLTMNRFKAARHVLVDGRHLGHIHEDVEKLLRKIVGPSNITVM
FT                   AESFLLSAHIAEQSELILTTPSRLTGLLNTKSVRILKPPVALPGFTVKQYWHERFHDDP
FT                   GNRWLRGILSRMRGLSEEGEGPSLPEFAGGAAEGDGASNPDIRNSPHE"
FT   CDS_pept        564928..565890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linEb"
FT                   /locus_tag="SJA_C2-04850"
FT                   /product="2,6-dichloro-p-hydroquinone 1,2-dioxygenase
FT                   LinEb"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98848"
FT                   /db_xref="GOA:D4Z6Z0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z0"
FT                   /protein_id="BAI98848.1"
FT                   /translation="MDTNHITSLHHITICTGTAQGDIDFFVKVLGQRFVKRTLFYDGSI
FT                   PIYHLYFADELGTPGTVMTTFPTRRTGLKGRKGSNQFTVCTYSIPKGSLEWWIGHLNKH
FT                   GIETSAPGTRFGQRFVSFQHPDCGIEFEVLEDEADTRAPYDSPYVPLEYAQRGFHSWTA
FT                   SVRELEDMDFFMENCWNFEKIGEEGNRHRYRVKGSTEAGTIIDLLHEPDVRQGSWTIAE
FT                   GIIHHGAFAVPDMDVQARIKFDTEGVGFTDFSDRKNRGYFESTYVRTPGGVMFEATHSL
FT                   GFTHDEDENTLGMDLKVSPQFDDKKHLIQQAMEDDPIVV"
FT   CDS_pept        complement(566108..566341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98849"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z1"
FT                   /protein_id="BAI98849.1"
FT                   /translation="MGHPIHHRRAGEQSSNFRRSCCSVRADVARIRRLIGIEAPALGQR
FT                   HPPLGAVSIAWKSLQRTPALNHRSSRQVIRQA"
FT   CDS_pept        complement(566425..567621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04870"
FT                   /product="putative Na+/ H+ antiporter"
FT                   /note="monovalent cation:H+ antiporter-2, CPA2 family /
FT                   Kef-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98850"
FT                   /db_xref="GOA:D4Z6Z2"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z2"
FT                   /protein_id="BAI98850.1"
FT                   /translation="MIISVIALACAGSAIAAILARWMPRALLPALVLEIAFGILIGPNG
FT                   MALLAPGPAMEMLAKLGFGVLMLIAGLEIDLGMLLARGQKAKQASPLMLAVMMSLMTVV
FT                   MAAFGAWLLLDSSTPLLHLAIYAVILSTTSVGIVVPTIQERRLADGAYGQTILSTALLA
FT                   DFFTMIAISSLAGIVVSGRAEGALGSLALVGIAGLAIWLLPKLLARVPAAQLDSRTSLP
FT                   LVRLSLALLFMVAWLAERLESELVLAAFLAGLLLGQIIPRNSHRRETLEAIGYGFIVPF
FT                   FFINVGLKFDIPALFASPKALLLVPGFVAVAFANKIIPALLLVPAHGRKMAVAAGLLLS
FT                   ARLSLIVAASDIATRIGVLDTATNAAMVLVAIISAALAPLLFNILVDRKAPILANAEA"
FT   CDS_pept        complement(567780..568760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04880"
FT                   /product="putative hydrolase"
FT                   /note="metal-dependent hydrolase of the beta-lactamase
FT                   superfamily III"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98851"
FT                   /db_xref="GOA:D4Z6Z3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z3"
FT                   /protein_id="BAI98851.1"
FT                   /translation="MKHLLPILIFALAGTVAARAETPPAQPPRLILLGTAGGPIARLER
FT                   SQPANAIVVGGQTYLIDAGDGLLRQMAASKLGLGSVKALFLTHHHIDHVADVPVLMIDR
FT                   WLLANAPPLEIYGPPGSAQLVAGTLAAFRPVELAPVTVGGPVKPPLTGSAVGHDLPLDL
FT                   NEPRLVYKDDRVRVFAIGVDHYHYPAGSIEARSSRSYAYRVEAGGKVYVFSGDTGPSER
FT                   LKILAKDADYLVCEVIDIARMEKLLRSYPGFSADQIPPLMEHMREDHLTGEQIGEIAAA
FT                   AGVKKVILTHFAPGNDGETDVESYAAGISRHFHGEVAHGRDLDQY"
FT   CDS_pept        complement(568829..569791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04890"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98852"
FT                   /db_xref="GOA:D4Z6Z4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z4"
FT                   /protein_id="BAI98852.1"
FT                   /translation="MGLLVDGVWRDAWYDTKSSGGRFVRKESQYRDGLDGRFQAEPGRY
FT                   HIYAGFACPWAHRVLIMRALKGLEGLISVSMVNAFMGEKGWTFLPGEGVVPDSVNGAQY
FT                   LYQVYLAGDPTYTGRVTIPILWDKFEKRIVNNESSEIIRILNSAFDHVGALPGDYYPQE
FT                   LRAEIDAINARVYETLNNGVYRSGFATTQEAYEEAVHPLFETLDWLEEHLTGREWLVGD
FT                   RLTEADIRLFTTLVRFDAIYHGHFKCNLRRIADYPNLSRLTWKLASHERVAPTIDLRHA
FT                   KAHYYRSHTSVNPTGIVPVGPAEPLGPGHSLTGIQPLPA"
FT   CDS_pept        complement(570161..570553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04900"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98853"
FT                   /db_xref="GOA:D4Z6Z5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z5"
FT                   /protein_id="BAI98853.1"
FT                   /translation="MKHYVDSMAGSPVNPVQMSLLMRVYYLRNATMQTLAQHMETDRTT
FT                   TTRNVDVLVRDGFLEIGEGKDRRQRLVRLTERGHEALEVSIPKWRKAQDELKNALGDEL
FT                   WNNILREARTLIELGGIACDRTAQAA"
FT   CDS_pept        complement(570795..571082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04910"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98854"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z6"
FT                   /protein_id="BAI98854.1"
FT                   /translation="MAVYTVAQVKINDGERYEKYRERFGAVLQQYDGRLVAADDNPVVQ
FT                   EGQWSYEKIVILEFADLDAFNAFADSESYREIAAHRHAGADSLILVAKGR"
FT   CDS_pept        complement(571166..572281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04920"
FT                   /product="putative oxidoreductase"
FT                   /note="NADH:flavin oxidoreductase, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98855"
FT                   /db_xref="GOA:D4Z6Z7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z7"
FT                   /protein_id="BAI98855.1"
FT                   /translation="MTQSALFQPLRIGRLELSHRVVMAPLTRMRAGPGMVPRDIAVEYY
FT                   RQRATPGGLIVAEASQVMPTGQGYPQTPGIHTAEQIAGWKRVTDAVHEAGGHIFLQLWH
FT                   VGRISHSSYHGETPVAPSAVAAAGDHFTASWKLEPFQTPRALELEDIAAIVEAYRTGAR
FT                   NALAAGFDGVEIHGANGYLIEQFLQSRSNRRQDIYGGSIANRTRFLLDVTRAVVEEAGA
FT                   DRVAVRLSPFGTTNDSGEDDPLPLYRHAIAALSGFQLAYLHLIEPRIAGTGKADVLNDS
FT                   APSAAELFRDSWPGVLIAAGGYEGASAQEEVGKGLADAIAFGRPFIANPDLVERIRLGA
FT                   PLNPWDRPTFYGGDAKGYTDYPTLETLNAAA"
FT   CDS_pept        572297..572524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98856"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z8"
FT                   /protein_id="BAI98856.1"
FT                   /translation="MLAEERGRGPRDFIPVVRLSPQGSRARTIRRGRAMADVLVRANRS
FT                   SDTLLQDGMAASFDQARPAPRYGLILQPCG"
FT   CDS_pept        complement(572721..573371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04940"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98857"
FT                   /db_xref="GOA:D4Z6Z9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z6Z9"
FT                   /protein_id="BAI98857.1"
FT                   /translation="MSESPVIPLRERRRQETMNEILDLSIEVIRQQGVAGLNLTTVARL
FT                   LGVQPTALYKYFPSLMAVYDALYRRAENDVLHEVENAVASAEPGMAAIRDAMLAVDRWA
FT                   TVNPEMAQLLIGRPIPGYIPAPDALDPSIRILGIFRQSLDQAVARRQLDAGAAGSRHVL
FT                   MLAALLTGASTLRMLHAEEPPCQADMEGLIPDLVSMFFRAFPPQDAPVPATDL"
FT   CDS_pept        573803..574018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04950"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98858"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z700"
FT                   /protein_id="BAI98858.1"
FT                   /translation="MMQVKTLPERCVSSGQCVMLAPGVFDQDDDGVVLLLRDTVDDGDE
FT                   ASVAAVRSSANVCPAAAIRLSATPKA"
FT   CDS_pept        574061..575161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04960"
FT                   /product="putative aryl-alcohol dehydrogenase"
FT                   /EC_number="1.1.1.90"
FT                   /note="Zn-dependent alcohol dehydrogenase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98859"
FT                   /db_xref="GOA:D4Z701"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z701"
FT                   /protein_id="BAI98859.1"
FT                   /translation="MHASAAILRHAQAPFAIEPLDLPEPSGNEILVRVAGVGMCHTDLV
FT                   VRHIPAEWAPLPAVLGHEGSGIVEAVGPSVTRFAVGDHVVLTYDSCGWCDNCHGGTPSF
FT                   CSEFSERNELGLRPGSHRSGRDSDGVELQTRWFGQSSFATHSLATERNAVKVSPDLPIE
FT                   LLGPLGCGIQTGAGAVLNALQVRFDSSVVIFGTGAVGMAAIMAARIAGARKVIAVDLHE
FT                   NRLQLAQELGATHRISGRDPELVEQIMSITGGGATHALDTTAAPAVIAAALASLRARGK
FT                   LGLVGGGGAPLDLPQEALMKGQQISFIIEGNSVPQLLIPQLIELWSEGLFPFDRLIARY
FT                   PLEKINDAERDLASGSVIKPVLLPGR"
FT   CDS_pept        575205..576437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04970"
FT                   /product="putative cytochrome P450"
FT                   /EC_number="1.14.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98860"
FT                   /db_xref="GOA:D4Z702"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z702"
FT                   /protein_id="BAI98860.1"
FT                   /translation="MTTETQIQEKPVPETTFPWERGTYDPPPAYAWLREHEPVRRVVLH
FT                   DGTPAWLVTRYNDVRSILADPRVSSNQNLPGFPQIELVPRPSEEESTFLNMDAPRHTLF
FT                   RRLISKHFIVKKLEVMRPRIQALVDEHIDHIIDRSEPFDFVEEIALPVPSTVIAWLLGV
FT                   PPSDHPFFNRETEALLAASLGTEEAIERATEAYANINDYVDRLIAEREKLDDPGDDILG
FT                   DLVRASREGQIERRDVLNTAWLLLVAGHDTTANMIGLGMLTLLEHPDQLAQLQAEPALI
FT                   PDAIEELLRYLTVVHLIILRIATEDIEIGGVTIPAGEGIIPLNFAANRDDGHFPDAAKF
FT                   DIRRRPRDHVAFGYGVHQCIGQALARIELQIVFETLLRRIPNVRLATDPADIQFKSHAS
FT                   INGIARLPVAL"
FT   CDS_pept        576458..576964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98861"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z703"
FT                   /protein_id="BAI98861.1"
FT                   /translation="MEEATTLVTPQMEASKGVWHSFETSFPITATDIRRWAIATYWGQM
FT                   PPRLFWDEEYARTTRWGGIVAPEDFNPFAWQLPRELTEEELRLQGAIPGQETKKGDNIL
FT                   NGGQVDRFSARMRPGDVISSRSRLTHWEEREGRNGLTLYTYNETEWTNQRGEWVKSRVM
FT                   TLIHY"
FT   CDS_pept        576975..577403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-04990"
FT                   /product="MaoC-like dehydratase"
FT                   /note="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98862"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z704"
FT                   /protein_id="BAI98862.1"
FT                   /translation="MSIFFEDIAVGDQIPAFTRKTTMMEWSRFAAVNEEFVYVHMDDEA
FT                   GQAAGQPGAFGMGNLRWAYMLNALRDWAGDESEIRELAMQFRAINQKNDILSTRAVVVE
FT                   KSVADDGAALIHLQIDVENQDGKGTSPGRAIVAVPSRA"
FT   CDS_pept        577448..579754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05000"
FT                   /product="putative formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="putative acyl-CoA transferase / carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98863"
FT                   /db_xref="GOA:D4Z705"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z705"
FT                   /protein_id="BAI98863.1"
FT                   /translation="MDALGDIRVIELATGVAGPIVGMFCADFGADVVKVETPDGDPERG
FT                   RPGFPMWNRGKRSVVIDPGSAEGRAWLRNRIGGADMLITRDGEELAAFGLDGDELLASH
FT                   PRLILLEMPVYLPGHVPWADGVESAALLGAFGGQFARQSSVSGEPVESVYQTLLYAHGL
FT                   WASVCAVAALIEREGSGFGQRVTVSGINALQQLTMISLVVDPNAPDPSTAVGGAGRHPT
FT                   YSRMIAGDGKWFTSGALGPRFEAMFMEVIGLGSIVEDERLGGSLANMVAPENIGWVQKA
FT                   VEEAVLKQPRQYWLDRLDAVGIPSGPIDGREGWLDHPQVAAMGMRVEVDDPDRGPVVMP
FT                   GVPINLTATPGAVRGPAPALGEHNDRVAPWPAQPRPAADARPLVRSGPLSGIRVVNSGP
FT                   FLASPYAGCLLSALGADVIKVEPREGDPFRKPAYGANRGMRSIAIDLKHPDSIRAFHKI
FT                   IEGADVFIDGLRPGVTKSLGIDYDSLKAINPGIVTMSLSAFGQTGPLGGRGGVDMVLQG
FT                   MVGMMSAEGGDGEPIVNTISVCDISTASMSSLTIALALFHRLRTGEGQRTWDTLLGTAT
FT                   YLQSAEIIRFEGRPPAIVGGVDFQGDGAFDRMYRAADGWVRIAAPDAPAKIASALEIPE
FT                   EKLADKDGAIAAIAAAIIDLSREEATRRLNRAGVPSASVRKVTEVLRDPRLCEAGFAHV
FT                   YPSDNGGFIATPGRIASFSRTEWRGVLKPPGIGEHSVRILEDAGIDPATIDQLIERRAV
FT                   AVGGPMPQILPHAYR"
FT   CDS_pept        579788..581209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05010"
FT                   /product="putative betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98864"
FT                   /db_xref="GOA:D4Z706"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z706"
FT                   /protein_id="BAI98864.1"
FT                   /translation="MNAIAMTINGRSVGTGATFPVIDPSTGEAFAEAPAASPEQLEEAM
FT                   ATAQGAFASWSRDEGLRRRALKEAAGLVMEMAADLGPILAQEQGKPLADTGIEFEASAE
FT                   WLRYYADLELPREIVQDDAAAYAEIVRRPLGVVAGITPWNYPIALAFWKIAPALRAGNT
FT                   LVLKPSPYTPLSTLAVGQALQSVLPPGVLNVISGPDPLGAAMTAHAIPRKLTFTGSTAT
FT                   GRKVMASGANDLKRVTLELGGNDPAVILDDADISAIADELFWGAFANNGQVCVAIKRIY
FT                   VHESRHDELVEALAERARSVAVGAWNEEGALLGPLCNRPQFERVKELVAEAIGMGARVA
FT                   AGGAPMDRPGFFFQPTILADLDEKARIVSEEQFGPALPILSYSDVDDAVARANAGPFGL
FT                   TASVWSSDPIRAANVGLGIEAGQVQVNGHAMGLQPHLPFGGLKSSGIGVENGPWGLHGF
FT                   TDIQLLYAPPRRAAA"
FT   CDS_pept        581256..582170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05020"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98865"
FT                   /db_xref="GOA:D4Z707"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z707"
FT                   /protein_id="BAI98865.1"
FT                   /translation="MGALEGRVAIITGAGRGIGAAIARRYAAEGAKVVINDLGGDTTGE
FT                   GSDLGPAAAVASDIIAAGGQAIADGGDIADVATGERLVGLAIEKFGGLDIVVNVAGILR
FT                   DRMIFNLDEKDWDAVIRVHLKGHYSTIKPAAAYWRSLRNPQGDFRIVNFTSASGLHGSP
FT                   GQPNYAAAKMGVVGLTMSLANGLARYGVTVNAIAPGATTRLTETAPEDKNVDGPARADD
FT                   PYTPDRVAPIAVFLGSKESGWMSGRTIGAAGGELMLYNVPEMIKTLNGMADLDAATFAA
FT                   MVEREFRPLADGLAPSIYFDSQM"
FT   CDS_pept        582196..582606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98866"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z708"
FT                   /protein_id="BAI98866.1"
FT                   /translation="MMSIGPIPELTPETAPFWQGAAEGELRIQRCVRCGSFYFYPRPFC
FT                   PKCNSDEVEWKPVSGRARLASYIINYRPSPEFESKDPQIIALVTLEEGPRLCTNIVGVE
FT                   PEPDNLPLGMELQVAFEPRGDQFLPVFKPVRI"
FT   CDS_pept        582609..583772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05040"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /note="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98867"
FT                   /db_xref="GOA:D4Z709"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z709"
FT                   /protein_id="BAI98867.1"
FT                   /translation="MPLSSPNGGNIAIVGASETERVGVVPDMSMIQLHADAARRALKDA
FT                   GLTPADVDGIATAETQVIEVAAMLGIRPRWMDGTTIGGCSFMAHVRHAAAAIATGQASV
FT                   VLITHGESGRSWVGMPNYSMNPRGPDGQFEQPYGAIAPYSLFTLPALAFLKARGMGQRD
FT                   LAEVVVAQREWAIPNERAQRRTPVTVEDVLAGPRVAYPFTRDMCCVVTDGGGALVLVSA
FT                   ERARDLPSAKRAVYLMGSGESCESVLVSQMDDLTSFGSFRRASAEAFETAGVTHADIDH
FT                   AMFYDAFAHLPLYMLEDTGFVGFGESGAFHAEGHTRPGGRLPINTNGGGMSYTHSGMYG
FT                   MYAIQEAVRQLRGEAVVQVPDMKLSFVQGVGGLFWSAASLILSNQAP"
FT   CDS_pept        583855..586149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05050"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98868"
FT                   /db_xref="GOA:D4Z710"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z710"
FT                   /protein_id="BAI98868.1"
FT                   /translation="MNGLGYKLLGGVCAFAFAQPALAQDSGPDQAAAERSASGPVSTSD
FT                   IVVTALRRSERLQDVPVSVTALGSAALSQQRLQQVSDLAGSVPNLQASTVAGDGLPIFS
FT                   LRGVSMSDFSFNQQGPVATYFDEVYKGSFPLLGLGMFDLERVEVLRGPQGTLYGKNTTG
FT                   GAINFISKRPGHDSEAYLKLGYGNYNRYDADGAVQAGLGDTLAARIAFTFSRADGWFKN
FT                   LMPGRPDGSAVRQYGVRASLLFEPNDKLDFILRLTTSLQNPIEYGVLGEPVGSLGIGNG
FT                   VYEMFGASSYFRTGLGRREMEADNIGRHRHRTYGASLTGNWHVADALTVTSVTSYDYGR
FT                   LRVIDEADGTPLRVLEADLKGRGKQLSQDLRLSSDFDGPFNFIFGAYYNIEKLWNETSA
FT                   GFYSDIDVNGDGALTWEDCVDSGFAVSCIYRNNYKQVRKSAAVYTDMNYKLSDRLILRG
FT                   GIRYTQDRGKVVGYRAQIEGPDGVPIVNTIPGDDPFDFDASTSARFKKGTVTGKVGVDF
FT                   KTADNDLIYASFSRGYRANAFNAQAYFSPAELNVAEPETVNAYELGFKSQFLDRAVTFN
FT                   GAAFYYDYRDQQAISVNSVTHIQTLINIPKSRILGAEFELTVHPVQALRINVGVGILDT
FT                   KIKEGSLNGTSLRGNQLPNAPKLSASAGFDWDIVETGGGKLSWGVNGSFTSKQYFDLFN
FT                   TERTAQKGYALVNSQLSYRFADDRYGVSLWGKNIFNKYYARYSLDLSGNGFDYTHLADP
FT                   RTYGISFDAKF"
FT   CDS_pept        complement(586321..587820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="SJA_C2-05060"
FT                   /product="succinate-semialdehyde dehydrogenase (NADP+)"
FT                   /EC_number="1.2.1.16"
FT                   /note="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98869"
FT                   /db_xref="GOA:D4Z711"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z711"
FT                   /protein_id="BAI98869.1"
FT                   /translation="MTAATMQQQALAEAADMVSSVPTGLFIDGAWRAAADGQQFSVHDP
FT                   ATGDVVARLANATPSDAMDALDAADRAFPSWSRTPPRERAELLRRTFDLVMRDRERIAR
FT                   IITLEMGKPLRESHAEVSYGAEFLRWFGEEAVRISGRFGSSPEGTGDMIVSRHALGPAL
FT                   LITPWNFPLAMATRKIAPALAAGCTVVIKPAALTPLTTLYLVKLLEEAGLPAGVVNVIP
FT                   TTNSGGATGPIIADSRLRKISFTGSTQVGRVLLEKASANILRSSMELGGNAPFLVFDDA
FT                   DLSRAVEGALVAKFRNIGQACTAANRFIVHASVAQEFSRRVAEKVAQFKLGSGFDPDVA
FT                   IGPLIDEAAVAGVDELVQDALSRGATLVTGGKRRGGAGTFFEPTVLTDVARDSRLLREE
FT                   IFGPVLPIVTFDTDDEAIAIANDTEYGLVGYAFTASIERGQRLINELQTGMMGWNVGVL
FT                   SNAAAPFGGVKMSGLGREGGAEGIDEYLTTKYTLLPSVFRP"
FT   CDS_pept        complement(587817..588806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="SJA_C2-05070"
FT                   /product="esterase/lipase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98870"
FT                   /db_xref="GOA:D4Z712"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z712"
FT                   /protein_id="BAI98870.1"
FT                   /translation="MTEAIELRVPLEPGAQGVVDQYRAAALPPLEQGTAQQAREGYRAT
FT                   SLRAGFEPERDVRARDLTIGAGGNPLRTRIYEPEAAIGPRPLIVYLHGGGWVMGDLDTH
FT                   DSTCRLLARQAGAILVAVDYRLAPEHPFPAAVEDAVAALRHVPEAVAGLGIETAGLAVA
FT                   GDSAGATLALVAALALRDEATPSALALFYPAGDMGRRTASMDEFSSGYPLTSSTLRWFR
FT                   DLYLDDVALAGDWRASPARHPDFGALPPTLILSVGHDPLRDDTIALAGRLKREVRGSEH
FT                   RHLPDQMHGFLTLGGVIAPARGELDHAARFLRQAMGLGPLLEREGESA"
FT   CDS_pept        complement(588803..589540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05080"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98871"
FT                   /db_xref="GOA:D4Z713"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z713"
FT                   /protein_id="BAI98871.1"
FT                   /translation="MSRLTGKTALITGAARGLGAAYVRRFVAEGARVLVTDVIDEEGRL
FT                   LAEEMGADAADYLRLDVSCGESWGTAADRCVERFGRIDILVNNAGVGGGGALETTSDDQ
FT                   WERQIAVNLGGVFYGMRACIPRMAAAGGGSVINISSINGVRGNRERYGYVASKFGVIGL
FT                   TKAAALDFAAAGVRVNAVLPGMISTPMTAGLKVDTSLIPLGRPGGMDEVAQVVAFLASD
FT                   EASYVTGAEFLVDGGVVQKVVGQ"
FT   CDS_pept        complement(589537..591516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05090"
FT                   /product="putative flavin-containing monooxygenase"
FT                   /note="putative flavoprotein involved in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98872"
FT                   /db_xref="GOA:D4Z714"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z714"
FT                   /protein_id="BAI98872.1"
FT                   /translation="MSANPIDHADAFDTYLPIDIDDAELERILEKAELPALLAALAKLT
FT                   GDTSLVPPSLKPPHTRKSFIPMPQGGLDEAQQKEARRLAFDAIRRYRDGEIQTPGHTDD
FT                   AELRAIVSFLITRDFDDYRDLLIHEVADHDVGAPQWTLSELDPDRPFKVLIIGAGITGV
FT                   VAAYRLKQAGVEHVVLEKNPEIGGTWWENTYPGCRLDTSNYAYSFSFAQKTDWPQKFSR
FT                   QSEIQDYVLKVAHDYGVRDRIVFNTLVRSVIYDEEAGEWEVTAVTDGEVRVHRANVVIS
FT                   GTGQLNSPKLPNIEGMDSFAGASMHSARWNHDVSLKGKRVAIIGTGASAYQIAPAIADE
FT                   VGKLEVFQRSAPWLLPTADYLDDISPELMWLFRHIPGYARWYRFWQFWLATEGRMPTVT
FT                   ADEGWSEEGSIGAINHAFRQELEAEFRRQLADRPDLIDKVIPTYPAGAKRLLRDNGQWS
FT                   ATLRKPHVDLVTEGIERIVPEGVVTADGVLHEVDVIAYATGFRADEFLADMEVRGRDGV
FT                   EVHEYWDGDPRAYATMTVPGFPNFFICGGPNSAVAANGSAIFIVECSIEYILECIRTLV
FT                   VKRLKDMEPTDAATDAFVGKIDRANRARAWGAEGVTSWYRNKTGRVSAVWPFELLEFWN
FT                   MTRGPAEGDYRFTPLGELTTQAAE"
FT   CDS_pept        complement(591581..592714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="SJA_C2-05100"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Zn-dependent alcohol dehydrogenase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98873"
FT                   /db_xref="GOA:D4Z715"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z715"
FT                   /protein_id="BAI98873.1"
FT                   /translation="MDGRSDGSMTIRGAILETSDAPRPYADSRPIRIGTLDLTPPGPGE
FT                   ILVKVEAASLCHSDLSVINGNRRRPLPMLLGHESSGRVVALGPDVDDLALGQRVVLTFM
FT                   PRCGACDACRTEGRIPCTRGTAANGAGTLLDGDVHLSECGHPVLHHLGVSAFADHLVAH
FT                   RSSAVPVGDDVPPDVAALLGCAVLTGGGALLNEARPTEADVVAIIGLGGVGMAALITAK
FT                   ALRPRRIVAIDALPDKLALARSLGADEALSPQDAVDRGIRADIVMECAGHPKAFETAFA
FT                   ITAPGGTTVTVGLPAPGAMAQISPLQVTAEARRIVGSYLGSSVPRRDIPFLERLWREGR
FT                   LPVERLISRRIGLEDINAAFDALASGDQLRQVIMFDA"
FT   CDS_pept        complement(592740..593489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05110"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98874"
FT                   /db_xref="GOA:D4Z716"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z716"
FT                   /protein_id="BAI98874.1"
FT                   /translation="MQDKSVLVTGAAGGVGKAIARRFAEQGASVLVTDIDARAAGQVAE
FT                   AIGGQGRARAATLDVGDAASIEFAVASIVGWTGRLDVVVHAAGMWAGGTVLDIDEARWT
FT                   RVLEVNTTSAYLIARHCVPHLRQTRGSIINIASVAGLKGTPGAVAYNSSKSAVVGMTKC
FT                   MALDFAASGVRVNCICPGVIDTPMVDAVLAHHGEAFTREDLARRHPLGRLGTPEDIAGA
FT                   ASFLASDDASWITGTALVVDGGSMAGV"
FT   CDS_pept        complement(593638..595959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05120"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98875"
FT                   /db_xref="GOA:D4Z717"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z717"
FT                   /protein_id="BAI98875.1"
FT                   /translation="MMKMLKTALYLAGAAILPHAAHGQAAPADQGNGLNSVSDIVVTAQ
FT                   KRAQSLSTVPMSVTALTGEQLAARGINDVQDLAKVTPGLNFVQSGSGVPVYSLRGVGFY
FT                   DTAVGARPTVSVYVDEAPLPFSVMTTGAAFDLERVEVLKGPQGTLFGQNATGGAINYIA
FT                   AKPRDELGAGVTASFARFNTLDAQGYVTGPLARGLNARLAVRGVRGDGWQQSYTRNDSL
FT                   GRQRMLQGRFLLDWQASDRLRLSLNLNGFIDDGDMQAGQLLAVVPLFGAFAGTIPLVTN
FT                   YPRAPQTPRAADWNANTPYRKDNSFYQAVLRGDYELTDDITLVSLNSYAHMSMDQRIDL
FT                   DGTSLTNGDQSIRGRISSFSTEERLTGNFGPATIILGVNYAHDKTRENAIWATYYSTQN
FT                   SFFTPLTNDVAAAPYGYQDFNTYAAFGNVDYDIGRLVTLHAGARYTKADLDYEGCGLPA
FT                   NQNSAVGLTRLFNNIRAAAGLGPIPVIPMDGCSTLDANLNYASHIEGTFNEDSLSWRFG
FT                   VDVKPADRVLLYFNASRGYKAGSVPVLSGTSVDQYVPVKQESVVALEAGFKASLFGRLV
FT                   DVTGAAFNYDYSDKQLQGRIITLMGPLIALVNVPKSRVRGFEGQVTVYPTNGLSLTAAA
FT                   TYLDSKVTSDFINYTIIGTRQNFKGNDFPYTPKWQVNLDGAYRFPISSRLDANLGVNYS
FT                   YRTKTNAGFGNEPLLYMKDYGVLDLRAGFGGSDGNWQVSVFGRNVTNSYYWTNVAKLYD
FT                   VVRRLAGQPATYGIQFNWRF"
FT   CDS_pept        595988..596317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98876"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z718"
FT                   /protein_id="BAI98876.1"
FT                   /translation="MGCLEITGLNGTARRPPPGDTARQGATGFPLTAFHEATQPDSIHS
FT                   GIPTRCVMCIYTFCNVNHVPPRSCQGAEKPWAGRIGDAQQGGDQNRPAAARHIDSSQGT
FT                   VFRKF"
FT   CDS_pept        596401..597405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05140"
FT                   /product="2-nitropropane dioxygenase family protein"
FT                   /note="dioxygenase related to 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98877"
FT                   /db_xref="GOA:D4Z719"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z719"
FT                   /protein_id="BAI98877.1"
FT                   /translation="MRTRITELFGIEHPIIQGGMHYVGFASLAAAVSNAGGLGLITGLT
FT                   QRTPELLGQEIAKARELTDKPFGVNLTFLPTFNAPPYAEYIQVIAENGIRIVETAGRSP
FT                   EEYMPLFKQAGIKVIHKCTSVRHALKAERIGCDAVSVDGFECGGHPGEDDIPNMILLPL
FT                   AAEALSVPFVASGGMADGRSLVAALALGADGVNMGTRFVATQDAPVHENVKRALVEATE
FT                   LDTRLVMRPLRNTERVLNNPGVERIRQIEREKGDAIKIDDIFEQVAGVYPKVMVEGEVD
FT                   VGAWSCGLVVGLIRDVPTVKELVDRIMNEAEQIITDRLGRSLGATVQNALETA"
FT   CDS_pept        597410..598045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05150"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98878"
FT                   /db_xref="GOA:D4Z720"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z720"
FT                   /protein_id="BAI98878.1"
FT                   /translation="MPSGTARWEGGVDLQQVRATYRDETRSAILAAAARILSEEGPAAL
FT                   TVRRVAEVVNASTKMIYTCFSGKAGLLDALYIHSFDGLGREFGKCLAEPAPVARLRAIC
FT                   KAYRAYALAEPAFYNVMFGDLGRAYEAPLESRRRAWSTFRAMREAVAACLPEDRRDEAR
FT                   QLSQMLWATLHGVVSLELRGLLGEKTDAGDLYDRTSELFLQGSGLIPS"
FT   CDS_pept        complement(598064..598534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05160"
FT                   /product="HxlR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98879"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z721"
FT                   /protein_id="BAI98879.1"
FT                   /translation="MAMKGKRTNLGNADCGIARSLEVVGDWWSLLIVREAFKGRERFGE
FT                   FQKAIGLAKNILSARLKKLVEHDIFRIEPDADNGVGHRYVLTAKGEGLYVVLMALWQWG
FT                   ESTCFKPDEARYAMVDRQNGEPLARIELKARDGRVLGPRDFVASRMDDKAAA"
FT   CDS_pept        complement(598672..599682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05170"
FT                   /product="putative dehydrogenase/oxidoreductase"
FT                   /note="putative NADP-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98880"
FT                   /db_xref="GOA:D4Z722"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z722"
FT                   /protein_id="BAI98880.1"
FT                   /translation="MVTTHRIVLAERPQGAVTPANFRAEDAALPPIGDGQFLVGANYLS
FT                   LDPYMRGRMDDRKSYAAPTPVGGVMEGEIIGTVLESRHPGFSVGERVAGRLGWQTHAIS
FT                   DGTGLVKLDDRFKPITTAVGVLGMPGLTAYSGLLTLGKPQPGETVVVAAATGPVGSLVG
FT                   QIARLYGARAVGIAGGAEKCAYAKQELGFDAVVDHRSPTFADDLAAACPDGIDINFELV
FT                   GGAVWQAVLPLLNNFARVPVCGLIAQYNGSSGEQVDHLPAAMRIILSRSVMMRGFIVGE
FT                   FWDQRPKFLDEVSQWISEGKIRFREDIVEGLDNAPAAFMGLLEGRNFGKLVVKID"
FT   CDS_pept        complement(599833..600552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98881"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z723"
FT                   /protein_id="BAI98881.1"
FT                   /translation="MSELLDLAIGAHGGWDRWEQINELKAHFHAEGTVWHVKQWPGAYA
FT                   DMHCSISTRKPHTEFTPFLKEGQHCVWEPDSTAIVADSGELIDKRENPRSFFEGHSIPT
FT                   PWDEQHLVYFTGYAMWTYLTTPFLFRLPGFTSEEVEPWDENGETWRRLKVTFPEGVPSH
FT                   STQQTFYFDQSGLLRRHDYSVEIMGGTTSANYATDHKAFDGLIFPTKRRVYAAGADNRP
FT                   ILDRIAIAIDIWDVQAA"
FT   CDS_pept        complement(600921..602132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linJ"
FT                   /locus_tag="SJA_C2-05190"
FT                   /product="acetyl-CoA C-acetyltransferase LinJ"
FT                   /EC_number="2.3.1.9"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98882"
FT                   /db_xref="GOA:D4Z724"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z724"
FT                   /protein_id="BAI98882.1"
FT                   /translation="MTLRRAAIVSPLRTAVGKFGGGLSALTAGQLGATIIKALVERSGI
FT                   DPERVDDVVFGHGYPSGEAPSIGRWSWLAAGMPQNVPGFQLDRRCGSGLQAIIEAAMMV
FT                   QTGAADVVVAGGAESMSNVEHYSTALRKGARMGSLELHDRLTRARLMSQPIERYGVITG
FT                   MIETAENLARDYGITREQSDAYAVRSHQRAAAAWREGKFADEIVPVAVPQKRGEPVIFD
FT                   RDEGFREDASLETLGGLKPIEGGVVTAGNASQQNDAAAACLVVAEDQLAKLGLEPSGWF
FT                   VGWAAAGCDPSRMGIGPVGAVQRLFARTGLGWDDMDLIEINEAFAAQVLALLKAWEWGE
FT                   DDSRLDKLNVNGSGISLGHPIGVTGARIAATMLNEMRRRDARYGLETMCIGGGQGLAAI
FT                   FERS"
FT   CDS_pept        complement(602168..602971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linI"
FT                   /locus_tag="SJA_C2-05200"
FT                   /product="IclR-family transcriptional regulator LinI"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98883"
FT                   /db_xref="GOA:D4Z725"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z725"
FT                   /protein_id="BAI98883.1"
FT                   /translation="MPMADDSQAADPNFMLSLARGLGVLRAFEGQSSLSITEAARLSGL
FT                   NRPSAGRCLHTLTCLGYVRERDGRYSLTPKLLPLAAGFLTSTPLASASQAVANALRDSL
FT                   QETVSVGALDPSDPGRIIYIARAERNQVIAAPLMVGSTLPSHCTSMGRVLLASLAPCET
FT                   ERWLARAALEPRTERTIVSPDALRTELVAVGERRWSLVEEELEVGLRSLAVPVRDREGQ
FT                   VLAALNVATFSDAHSREDLIERYLPDLRAAAGQLERAIQSHRPNP"
FT   CDS_pept        603108..603755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linG"
FT                   /locus_tag="SJA_C2-05210"
FT                   /product="3-oxoadipate CoA-transferase alpha subunit LinG"
FT                   /EC_number="2.8.3.5"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98884"
FT                   /db_xref="GOA:D4Z726"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z726"
FT                   /protein_id="BAI98884.1"
FT                   /translation="MSGGFGLSGNPEHLIAGLLRNGVKELTVISNNCGADGFGLWTLLN
FT                   NGQIRKMVSSYIGENKLFAELYLSGQLELELNPQGTLAERIRAGGAGIPAFYTKTGVGT
FT                   VVAEGKPVEEFEGSLYVRETWLRADVSIVKAWKADPEGNLVYRKTARNFNPNMATAGKI
FT                   TIAEVEEIVPAGALDPDQVHTPGIYVDRVIQGPSYEKRIEFRTTRPRTEEKA"
FT   CDS_pept        603755..604393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linH"
FT                   /locus_tag="SJA_C2-05220"
FT                   /product="3-oxoadipate CoA-succinyltransferase beta subunit
FT                   LinH"
FT                   /EC_number="2.8.3.5"
FT                   /note="gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98885"
FT                   /db_xref="GOA:D4Z727"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z727"
FT                   /protein_id="BAI98885.1"
FT                   /translation="MPWTREEMAARAAGELQDGFYVNLGIGIPTLVANYVPADIEVVLQ
FT                   SENGLLGIGPFPYEDEVDPDLINAGKQTVTTLPTSSFFSSADSFAMIRGGHIDLAILGA
FT                   MEVAGNGDLANWTVPGKMIKGMGGAMDLVAGVKRVVVVMSHSDKAGNSKIVERCTLPLT
FT                   GTGVVDAIISDFGRFVLDRDRGELIVQELASDLDIDFVRARTGIPIRSA"
FT   CDS_pept        complement(604509..605639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05230"
FT                   /product="putative Na+/ H+ antiporter"
FT                   /note="monovalent cation:H+ antiporter-2, CPA2 family /
FT                   Kef-type K+ transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98886"
FT                   /db_xref="GOA:D4Z728"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z728"
FT                   /protein_id="BAI98886.1"
FT                   /translation="MPKALLPALVLEIAFGILVGPHGLGFLSPGPSMELFAQIGLAIPM
FT                   VIAGLEVDFGALLARPQGAQRARPLILAILISLLTLAMAGLGAWLLLDPGTPLVHLAIY
FT                   AAILSTSSVGIVVPMIQEKGIASDIYGQTILSAALLVDFFAMIAISALAGIVVSGSAQG
FT                   ALGSLALVAIAVPAIRLLPRLLARVPAARLDNRTSLPFVRLSLALLFLTAWLAEMLNSQ
FT                   LVLAAFLAGLLLGQIVPRGSHRRERLEVIGYGFIVPFFFINVGLKFDIPALLGSPKTLW
FT                   LVPGFVAVAFANKIIPSLLLVPIHGRRKAMAAGILLSARISLIVAASDIATRIGVLDTA
FT                   TNAAMVLVAIISAALAPILFNILAAPHRQPPMRVQA"
FT   CDS_pept        complement(605913..607310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05240"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98887"
FT                   /db_xref="GOA:D4Z729"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z729"
FT                   /protein_id="BAI98887.1"
FT                   /translation="MTTNRSLAALIGLALLGGCAAGTEYRRPALPLPAAFHNAPLIVEP
FT                   GGRPWWRDFADPMLDDLVARGLKGGFDVEAAMARVDQARAAAGSARAARMPSGSLDGSA
FT                   VRTRQSLRAGLGQIADYVPDFDRTQDSFELVGGASWELDLAGGLKRGREAAVAELEAAV
FT                   ADSQAVRLTVAAEIGDAYILLRSAQRRRSIAVDQAAAAQKLENIVRARFVHGAAARFEL
FT                   DQSRASTAAIRAGIAEFDQAAQAQLARLAVLAGGLPDSVVQALERPEPVPVAGFAAMGL
FT                   PADLMRRRPDLVAAERRVAAGHARLGVALAEYYPKFTLSGLLGFQGNDAGRLFSGPASV
FT                   VQGGLGLRWRLFDFGRVDAEVARAKGAEREAIAQFRNAALRAAEDVERAVVAWRTARER
FT                   EAVHAEEVRAATAACDALDRAYRAGHVSLAELVEAQRRVLQAADALALAQGDAARATVA
FT                   GWRAFGG"
FT   CDS_pept        complement(607307..610357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05250"
FT                   /product="ArcB-family membrane transport protein"
FT                   /note="cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98888"
FT                   /db_xref="GOA:D4Z730"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z730"
FT                   /protein_id="BAI98888.1"
FT                   /translation="MGFNPAAFLIRRSRLTLVLTGLALAVGIASWISVARSEDPQFPVP
FT                   GMSIRIAMPGATPADLEQLVIKPVENALYGIDDLKDVQASATDGAATIQAEFDWSSSAE
FT                   RKYEEVVREVTALRPTLPDGVTRLDVVRNRTSETAIFQAALVSDRLPMRRLEKFADDMG
FT                   EDIARIPGVRRAEYWGAPPMEVRVAIDPGRLAELRLPASLVVDALKRASDEAPVGSVNA
FT                   GQRRLIVRTGGAFRSLDDVRRVPVLSREGAVARIGDLARVEWANGEPEHVVRFNGRRAL
FT                   LLTATAKEGVDIGVLTQAIRTELARFERMVPGGVKLEYGFFQASNVERRLNGLYRDFLL
FT                   ALAIVSITLLPLGLRAAGVVMFAIPLSLLAGLAILQALGFGLNQLSISGFVLSLGLLVD
FT                   DSVVVVENITRRQRSGEDRVTAAMEGSRQILLAVAGCTACLLLAFLPLLALPEGSGAFI
FT                   RSLPVSVIATVSASFVIALTIIPFVASRVLPAREDEKGNRMLAMIERGIHRFYAPVLHR
FT                   ALDRPGLALALLGGLCLFIAPLIAAIGTSLFPPADTPQFLVRIELPQGASLPATDAVLR
FT                   QVERRLARASEVEWFAANLGRGNPQIYYNVRQHDPDPAFAEVAVSLRDGRPAHSARLLS
FT                   DLRREFAAFPGARITVLGFVQGPPIAAPIEIRIAGEDLATLSALARQAEAAMAGTPGIR
FT                   DVDNPVRQDRADLALEIDEAKAAALGVPAGAARQAARLALDGEFSGRLRDAEGDDYPVR
FT                   VRLPMAQRNRVEALDRIHVPSVDGRAVPLRALADPGMETGPARIERHDRERSVTLTAYV
FT                   GAGHLTGAVTQAALDRVRGAVRLPAGYTIALGGEAEEQESGNAGMTAAAIVACLGILAV
FT                   LVMEFGRFRLVAVVASIIPLGLLGAVLALWLTGNSLSFTAMIGLIALIGIEIKNSILLV
FT                   DFTEQLRGQGIAMREAIEQAGEMRFLPVLLTSVTAIGGLLPLAMGGSGLYGPMAVAIIG
FT                   GLIASTLLSRVATPVVYLLLARTGEAS"
FT   CDS_pept        complement(610361..611443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05260"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98889"
FT                   /db_xref="GOA:D4Z731"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z731"
FT                   /protein_id="BAI98889.1"
FT                   /translation="MTDHSPAGLPAMDVRAGRLMAVAAALAALLLPGCGAARRDEAEPG
FT                   PTAVRVALAAPASARQGVSASGTAAYERQSTLSFRVGGVISRLTVDMGSRIRVGQPLAR
FT                   IAGTDIQQQLASRDAELARATRTLARLEALAQSGSVASAAVQDQRDTVEQARAAAAAAR
FT                   YDQQSATLVSPFSGVVLERLSQLGETVGAGQAILRVADYDSPLVIRVPLAERDADGIAI
FT                   GTPAEVRFEGRQALAGRVAKSQPLVDGATGTRMVEVRLPSGGHGQSGAIASVRFPSSAA
FT                   PAQPSLAAVPAEAFVPRSGREGGVFTVGANGRARFVRLRLVRFEADDAVVAGLSPGTRV
FT                   VTAGAGYLKDGDPVLVAGGN"
FT   CDS_pept        complement(611490..612335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipA"
FT                   /locus_tag="SJA_C2-05270"
FT                   /product="MltA-interacting MipA"
FT                   /note="outer membrane protein V"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98890"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z732"
FT                   /protein_id="BAI98890.1"
FT                   /translation="MKRLVIRPLLALFTIASAPAAAQEALGDTAESGRKMEDGREGKGP
FT                   SGFIALGPGTTPAYDGAKSYQLIPFGIADLRWKGMEFELRGLRARLDLLGDSPVQFGPA
FT                   INLRFKRNSSSDGDGRVKLLDDVGQAVELGGFVGYRFGGDEKGQGEVAVDLTVLKDVND
FT                   GHDGLVATAQLSYAAYRGGRVFVNVDAQANYSDGKYMRSYFGLTAEESLRSGLAAYRPG
FT                   GGLRDVGAGATLGYRLSRRWGLIARAGANHYLGDAGDSPIVEEGSKVQAIAGLALSFSF
FT                   "
FT   CDS_pept        612479..613318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05280"
FT                   /product="LytR/AlgR-family transcriptional regulator"
FT                   /note="response regulator of the LytR/AlgR-family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98891"
FT                   /db_xref="GOA:D4Z733"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z733"
FT                   /protein_id="BAI98891.1"
FT                   /translation="MHDFAKLHVEDWAKRHGLLAGIALLFAATLAWLGAFGSHDFEPFA
FT                   RVGYWTVIFLVQYGLAAVTMPLLRAWPPLAAGSMVHRVALGTAITSVPMFFVTAAASMS
FT                   EGTWTPVPSEVFELILAIWIIGGAYLFLWEKLSSAPFPAGRSVEAATPPIPNPPAEAAS
FT                   RHAPATDGLLFERLPPELGRDVICLGNEDHYVRVHTTLGNALILMRFADALDSLSAMEG
FT                   QRVHRSWWVSRSAVVRIDRFGRTARLQLRNGLTVPVSQPYLALAKRLWGPTHGTVAA"
FT   CDS_pept        613315..613965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05290"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98892"
FT                   /db_xref="GOA:D4Z734"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z734"
FT                   /protein_id="BAI98892.1"
FT                   /translation="MTAGDGRHPRWQGGEAFASSQAIFRNAAHAMIRAGSLSTLSMRGL
FT                   AAAVGASAMTAYRYYPDKHALIADVREEVWRQFAACLDRATASISGAEDRFRRACDAYV
FT                   RFALDREHEFRLLFETDKQETAARPEGSSDAASWTLLTGLVRQLMPDADRDEVLEQAHW
FT                   IWASLHGMTMLHLSGRLMLGRSLDQLAAKVIEAHLQALRQSAGGRASPVAPLP"
FT   CDS_pept        614025..614264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98893"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z735"
FT                   /protein_id="BAI98893.1"
FT                   /translation="MSEAESLALARSPAVPCRKEDAVSDKIVSIGLLTARDLELLGQGF
FT                   RRHFPIRDDDLFKDLLAKLDELPARPDPRADGKR"
FT   CDS_pept        614261..614437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98894"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z736"
FT                   /protein_id="BAI98894.1"
FT                   /translation="MNGRPRRLGLCLLLAAMLLILAAIVGLMVHSSIEAPDPASRTPKG
FT                   AMPPEGEPMRPAD"
FT   CDS_pept        614491..614712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98895"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z737"
FT                   /protein_id="BAI98895.1"
FT                   /translation="MLVEEEKMIRMFLVAGSLLAAACSGEPASDRNALDGAAINRADDA
FT                   PGNGAAVPPPTSGSGAVPPNAPGANNSP"
FT   CDS_pept        complement(614780..615460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98896"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z738"
FT                   /protein_id="BAI98896.1"
FT                   /translation="MQAREFIGSAQVPGGEELTLYRRGGDFMIVLDRNELMSSRMSGSE
FT                   EALANLSCERLRGRARPHLLIGGYGMGFTLRAALAALDGTATVTVAELVPEIIQWARGP
FT                   MAELAAGCLDDPRVRLVQADVADVIGAARGLYDAILLDVDNGPDGLVRQANDRLYSAQG
FT                   IAAAIAALRPGGILAIWSAAPDASFARRLSRAGLAVEEVAVRARSNGKGPRHVIWFAAK
FT                   RASR"
FT   CDS_pept        615531..615983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98897"
FT                   /db_xref="GOA:D4Z739"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z739"
FT                   /protein_id="BAI98897.1"
FT                   /translation="MRYFLDTEFNGFGGDLISLALVPEIGDQDFYVSLPLPAEIHPWVE
FT                   KNVIPYLRFVPPGVDHQLNRVEAAQHLEAYLAHDRDPLIIADWPDDLAHFCALLVTGPA
FT                   EMIRLDGLRLELINGAGFSAASNSRMPHNALHDAHALKDFYLNWAV"
FT   CDS_pept        616049..617194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="jmjC"
FT                   /locus_tag="SJA_C2-05350"
FT                   /product="transcription factor jumonji JmjC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98898"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z740"
FT                   /protein_id="BAI98898.1"
FT                   /translation="MHLARFDIDLFLRDHWQKRPLLIRNPWSAWRNPLAPDDLAGLACE
FT                   EGVESRLITRQADRLAMESGPLPEDRFTELRDAWTLLVQAVDHHAPDVAALIPPFRFIP
FT                   DWRIDDVMVSYATDGGGVGPHFDQYDVFLVQGLGRRRWRVGPRCDSATPLLPHDDLRLI
FT                   PDFEATEDHILEPGDILYVPPCFAHDGVAVGGDCMTYSIGFRAPSRAELVENWCRHQAD
FT                   AMTDEDRYADPDLIRQSNAGEISASAIDRMHAMAMEALSDRNAFARWFGLHNSLPKYAD
FT                   MDWRPDEPADRRTVRAMLAQGVPLGRNPASRFAFIRPGEPELLLFVDGHGFDCDGDAAL
FT                   LAEALCREPMTVVDAKLAASPAVVALVAALIDQGSLAFDAD"
FT   CDS_pept        617201..617740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluE"
FT                   /gene_synonym="rsu"
FT                   /locus_tag="SJA_C2-05360"
FT                   /product="ribosomal large subunit pseudouridine synthase E"
FT                   /EC_number="4.2.1.70"
FT                   /note="16S rRNA uridine-516 pseudouridylate synthase or
FT                   related pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98899"
FT                   /db_xref="GOA:D4Z741"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z741"
FT                   /protein_id="BAI98899.1"
FT                   /translation="MALILFNKPYGVLCQFSDERTGPPRPTLAAYIDRPGFYPAGRLDL
FT                   DSEGLLLLTDDGRLQARIADPRFKMPKTYLVQVEGDPDEAALAALRHGVRLKDGPTLPA
FT                   QVERIEAPALWPRDPPVRFRKSVPDRWLRLTIREGRNRQVRRMTAAIGHPTLRLVRWRI
FT                   GDWTLDGIPQGQWRDA"
FT   CDS_pept        617745..618020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98900"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z742"
FT                   /protein_id="BAI98900.1"
FT                   /translation="MARRTAAQDWPGRGLIWVIPFAVARNGRGPHSDGMDANTTTLIMT
FT                   ILSRAPQWIRHDLLSKDAGVKQRAEETLAAMIANALATGTDESTAS"
FT   CDS_pept        618052..618399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98901"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z743"
FT                   /protein_id="BAI98901.1"
FT                   /translation="MTCRPFFGALLPAAALWAAAATPAPAGAQGPATDMEVRCAAGRRF
FT                   FLRADADRATIVWKDGQLTLERGALPLGLYYRSPRAALIIDGDYVSFVPRGDRNWRDCR
FT                   LLPRTDAVERN"
FT   CDS_pept        618485..619201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05390"
FT                   /product="MucR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98902"
FT                   /db_xref="GOA:D4Z744"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z744"
FT                   /protein_id="BAI98902.1"
FT                   /translation="MADEDKNDITALTVQLLSAYVSRNSVPSDSLADLIRTTRAALTEN
FT                   AAAAVAEPAAETFTPAVSVRRSLASPDRILSLIDGRPYKTLKRHLAAHGLTPEQYRERY
FT                   KLPSSYPLVAQSYSEARRAVAEKAGLGKKPVAAASPTAAPQAKAAAPKAPAKAAAPKKD
FT                   KAKDAPAPIISNRGNRAATSASAKKAPAQEKAPVKKAAPKANGTARPKSPKAALQAAGS
FT                   HLGGGEKAPEAATAKS"
FT   CDS_pept        complement(619268..620020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05400"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98903"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z745"
FT                   /protein_id="BAI98903.1"
FT                   /translation="MIVLLSPAKTLDFESAPPPLPVTAPHFLEEAHSLARSAANLSQKR
FT                   LSELMHISPRLAKLNAGRFRDFPHLPERQALFAFAGDVYAGFEAQTLDEAGIAFAQDHV
FT                   RMLSGLYGLLRPLDAIRPYRLEMGTRWAPRHSKLTDWWGDRIAALLRGQVAQEGSGVIL
FT                   NLASQEYFAAVEGKLAGIRVIDVDFREPGPDGPRFVSFNAKRARGMMARWMCEHHITDV
FT                   EAMRGFDSDGYRFDAGESEPDRWRFTRA"
FT   repeat_region   620105..620948
FT                   /note="insertion sequence:ISSj05"
FT   repeat_region   620105..620123
FT                   /rpt_type=INVERTED
FT   CDS_pept        620175..620528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05410"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98904"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX10"
FT                   /protein_id="BAI98904.1"
FT                   /translation="MEAERLVLRDDQWAKMAPYCLGKASDPGRSGHDNRLFLEAVLWIA
FT                   RTGSPWRDLPAAFGKWNTIFKRYRDWVKADVFQRLFDAASDDPDMEFAMVDGTIVKVHR
FT                   HGQGAKGGLKARP"
FT   CDS_pept        620546..620932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05420"
FT                   /product="putative transposase of IS4"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98905"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX11"
FT                   /protein_id="BAI98905.1"
FT                   /translation="MTTKIVALTDALGNLVRFVLLPGQRCDIIGVPPLIENLAFAGFMA
FT                   DKAFDTNAIIAELDARGARVVISQHPGRASKRRIDAELYKWRHLIENFFCKLKEFKRIA
FT                   MRSDKTDQSFSAMIYLASAVINSR"
FT   repeat_region   620930..620948
FT                   /rpt_type=INVERTED
FT   CDS_pept        621586..621912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98906"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z748"
FT                   /protein_id="BAI98906.1"
FT                   /translation="MRRDARKLLEKLNRRDFAYREFEDRFSETELWPIFAAVLGDQKVV
FT                   GDDAARLPVPQVRQQDERPAPRAPQPPAAPGQIFARYDAQPRRAAPKANVDLKEFFNRF
FT                   SELD"
FT   CDS_pept        621912..622649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05440"
FT                   /product="putative ATPase"
FT                   /note="putative cellulose synthase / ATPase involved in
FT                   chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98907"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z749"
FT                   /protein_id="BAI98907.1"
FT                   /translation="MAVVLVQSPKGGTGATFLAAQLALHLAGKGYEVNALDCTFQDSLK
FT                   MHFGFMPAQAVPEWGAAGGEPLVAFGVSVMQGHGQSRSAAFAARADREYERMFDPGHIW
FT                   VVDVASEDRRLLELLMPRCALHICPLLPTAASLATLNRLSETAPAMKLDRTVFVLNQLD
FT                   DRQKLSRHSHSFVRDLFGDQLLATIRRDEAVNEALARFELIGKYAPTSAALQDLRLFAD
FT                   AVEERIGLRPVPEDASIQVTGDA"
FT   CDS_pept        622649..626974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05450"
FT                   /product="putative cellulose synthase"
FT                   /EC_number="2.4.1.12"
FT                   /note="UDP-forming / glycosyltransferase, probably involved
FT                   in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98908"
FT                   /db_xref="GOA:D4Z750"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z750"
FT                   /protein_id="BAI98908.1"
FT                   /translation="MSLPSRFAPQALLRLAAGLLVAAVVIVVVTVPLDLESQWIFALTT
FT                   MAGVILFNRSPGKRSTIAIGLLSLLVSTRYLFWRTTHTLDFDSLPAALLGTGLYLAELY
FT                   AWVILVLGLLQTSWPLDRPVVEIEGEPDQWPVIDVYIPTYNESLAIVQNTVFAAMDMDY
FT                   PRDRFHVYILDDGRRPEFRAFARQAGCGYLTRADNLHAKAGNLNAAMKKTDGELIAIFD
FT                   CDHVPTRAFLQMTVGWFQKDARLALMQTPHHFYSPDPVQRNLGNVKELPGEGDLFYGAV
FT                   QKGNDLWNATFFCGSCAVIRRSALEQTNGFAGETVTEDAHTALKLQRMGWNTAYIGIRL
FT                   SAGLATERLVLHVGQRIRWARGMTQIMRIDNPLFGPGLNWHQRLCYLNAMLHFQFPLPR
FT                   IVFLTSPLAYLIGGQNIIHASAALIFAYALPHLFISTMSSERIQGGDRRPFWGEIYETL
FT                   LAFHLVKPTLFTLLNPRKGKFNVTDKGGLLDQTYFDGTTVRPHVITALLLVFGVVFGFM
FT                   KLNFPLLFDAQWDTVLLNTAWASFSLLILIAAISVAREQRQVRENIRITAQMPVTLYFD
FT                   DGYVVDGTTVDISLGGLAAELPDGFALQGRKVTDISLPMGDETLTIPVDTVRLDNGRAK
FT                   LRFQPLDMVRARHLVRAVMGRADAWQSDKPLAPVAGLKSIRDIFSVGIDTIIDIWRLPR
FT                   RRKKAMRAMAAAAAAGALATTSANAVPAVPAISPVAAAPVPASTGRPQRLPLKDLQVRN
FT                   PIRLAGTRGEYGIPFGLRSNQVVTAASLTLAFNFSPSLLGDLSQIVVLLNGEVVNALPL
FT                   RPSDGTTQTVNVPINPALFLPGDNSLNLRFIGHYTRDCEDPFHSSLWANVSNTRSVLNI
FT                   TTQSLPLKPDLARLPAPFFDRNDNVALKLPFVFAGKPTNGELEAAASTASWFGGMASYR
FT                   GYSFKPSFGQIPAGNAVLFVTPGRRIPGIDLPAGPAATVIANPVDSEGQLLVVSGSDEK
FT                   QLKQAAAALAIGRGMLGGASASLDGVRLPSFPRYSAPRWLRTDRPVRLGEIVPRYALQG
FT                   IGLPPGPLSAGFHVAPDLFFWPRQGAKLDLRYRYPSAPWLDKSRSRLDLSMNGQYLTTL
FT                   PLTGEHWWDKWFGGGRPAAYTSRADVVLPRYDLFGQNSLVFDYNLLVQSKQRCEGMLPD
FT                   NVRVSILPESSIDLSHAYHALHMPDLASFAGGGYPFTVRPDMAETVVLLPGDPTPAVVE
FT                   AFLNVMGRFGDATGAPAIRASVTRSVDAARMAGKDILVIGPIQIAQSESLFSGAPVFYQ
FT                   DGRLRVTERTPVERAFDLFSPYERSDSATVDGFFSGSDSFSGIVGFQSPFDAERSVVAL
FT                   LASDPEALPTLVNGLNDTRINAQVQGDLSVVDGEGMASFAVGDGYWVGSLPVWMKIAYW
FT                   MSQRPFLIALGGLLVAFLISAPVYLLFKRQETQRLEAVK"
FT   CDS_pept        626971..630348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05460"
FT                   /product="cellulose synthase protein C precursor"
FT                   /EC_number="2.4.1.12"
FT                   /note="FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98909"
FT                   /db_xref="GOA:D4Z751"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z751"
FT                   /protein_id="BAI98909.1"
FT                   /translation="MNMKKTISLLGLPLLAIATMPMAQAEVQGVAPLLKQARYWQSKGR
FT                   GDLARQAYNRVLAIDPSNAEARRGLAGNAPQARPAPQARPAPQPKAAPKASPAPAQAAS
FT                   APARTASARPARTDRGGDARAAGFRALEAGQLDSAAARFRAALSANPNDADALGGMGIV
FT                   RLRKSEFAQARDLLTRASRIGGAGKWAEALQSARFYADLDSARTALDKGDLAQAERIAT
FT                   ALTQSDFRDKGPAVSVLASVYERQGRYNEAAELYRQLGKAGAGAATAQASATRNEARAA
FT                   LDAGDAARAEQLLRAAMGNAPDDPWVAYDLAGLLQQQGRVAEQDALVRQLSYSEKAEPL
FT                   YAAALILDRAGRTGDAQAVAARIPEGQRTAEMRNFIAGLGISATIAQAKAAGARGAQGQ
FT                   GLAMLRQASEMRGLSADRMGALAQGMLELGDARGAGQLAAQALDAPANDAGAYDAAVRV
FT                   LAQTGQDGMAMSAVQKASALAGPSLQGQRSLGNLKATLAAAQADRMRQAGQFAPAFDLL
FT                   QAAWNDAPGNEEILSALARLYQSGGLNAQAAQTFRMLLAQKPADRDAMVGLIDTASASG
FT                   DMETARAVAQQAIQTHPADYRVYMAAARMAQTRGSDGDAARYLKTARALYMRETGMAPG
FT                   AVMANGNPFAAAPQSANPFRAMAAPQPVNPFALGSNPAALPAPYAPPMGFAPQQPAGSA
FT                   YAPPAPAAMPAYPPAPGYAAAGLPGMAAPAPYYGDPAVGMANLPADPVLAEIDRQLQQS
FT                   AEESGPRVDVDTGYRSRSGETGLSKLREMTGGASLSAPVAGGRAGIKATAVVLDSGRPT
FT                   GSGLARFGTNATPEAQGIVDEQPSQLADAETQHQSGVAVTASYVSKLLKLEAGVTPLGF
FT                   PKEHVTGRIELTPRLSTNATARIWADRKPVTDSIIAYAGTEDPRSGAFWGAVMKSGGGL
FT                   SLSYDRNGNGVYADGSFYHYDGTAVRDNDSVEINAGGYLRAWQNARSGVSVGFNVNYQN
FT                   YDNNQNYFTYGHGGYFSPQSFLSVNFPIRYWTNDGPMSIQASVAPGYQSYDQQGEPVYP
FT                   TEPGAQGVLDFLKSQNSDVRSSYDSISKTGFGLSASGAISYRVSPNTRLGGELNINTFG
FT                   EYKEFKTLIGLKQNIGGN"
FT   CDS_pept        630348..630824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98910"
FT                   /db_xref="InterPro:IPR022798"
FT                   /db_xref="InterPro:IPR038470"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z752"
FT                   /protein_id="BAI98910.1"
FT                   /translation="MLFVKDFPVAGDQDIAMLASGAEAAQRFVSLILAEIASAATAEQM
FT                   QGFFRAVGARLAKSHPIVNAKDMDRLTQHGNMVWDRLHWGSVRFELDDEGIDIFHDGLP
FT                   ERLEGDADGIWAGVAPFILEGAYDAWFRQMGSGERLSTRISRSQGGHVELRHGI"
FT   CDS_pept        630799..631824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05480"
FT                   /product="putative endoglucanase/cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="endoglucanase Y"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98911"
FT                   /db_xref="GOA:D4Z753"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019834"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z753"
FT                   /protein_id="BAI98911.1"
FT                   /translation="MSNCVMGFERRAILTALAFALTTGCARARPSDGLMLDPTLWQGYK
FT                   TRFLTPEGRIVDNGNGGVSHSEGQGYGMALAQAAGDGAAFEGMARWTAQTLLRKDVALH
FT                   SWRYTPGRADPVADPNNATDGDLLIAWALLMAGRRWGKPDYLQQSAAIRGAVAQKLIVQ
FT                   RHGFTLLLPGLVGFAKADRVIVNPSYYVWPAIDAFARLEPRIWGPLAADGMKILKAARF
FT                   GPSGLPADWLDIKGKGVVEPAEGRDPVFGFEGIRVPLYCLMSGRRGACDAIARYWLALV
FT                   RAGKPLPAWVNVVTGETAPYALSAGATAIAGRLLNRNLPAGGVDQDYYAATLGLMNQMR
FT                   I"
FT   CDS_pept        632040..632429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98912"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z754"
FT                   /protein_id="BAI98912.1"
FT                   /translation="MITSPDLAIRMRRADFNRALAEADLNAIGPLLAPQAVLVTGSDSA
FT                   VISGRKAQLQAWKREFAAARRTVYTRTPENIVASSVEPIAMEHGRWQGVTAGSGHPPAS
FT                   GSYSAKWRQVGADWVIEAEIYLTLA"
FT   CDS_pept        632514..634550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="SJA_C2-05500"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="Zn-dependent oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98913"
FT                   /db_xref="GOA:D4Z755"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="InterPro:IPR034005"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z755"
FT                   /protein_id="BAI98913.1"
FT                   /translation="MTADNPLLADSDLPDFAAIRPAHVVPAMETAIAAHRAAIEGIAAG
FT                   GKDDFDAVILTAERADFLLSRVWSPVGHLASVADTPELREAHAAAQALMTAYLMEAGQN
FT                   RAHHDAVARLAARPDFASLPPAARRAVDLALRGFRLAGVALEGEARQRFLDIGVELSDL
FT                   STKFGNAVLDATEAWSEHVTDEAALEGVPDSDRAILAAYAREKGLPGWLITLRQPSVLA
FT                   ILYHARDRALRERVYRAYNTRASDQADDKSHDNSERIDAVMALRHEAAQILGFADSAAH
FT                   SLETKMAADAGEALAFLADLARRARPVGERELAEARAFAAEHLGLDDVRPWDLSYVAEA
FT                   MRRTLHGVDQEALKAYFPLPRVLAGTQALIERLFNLRLVARQDVSTWHPDVLFYDLLDA
FT                   DGAVVAGVYLDLFARAGKRGGAWMDVCRSRFRDADRLHLPIAYLTTNFAPPAADRPSLV
FT                   THNDVVTLFHEFGHVLHHLLTEVDLPSIGGISGVEWDAVELPSQFMENFAWDGDTLIGL
FT                   SGHVDSGEPLPRAMFDRLLAARQFQAGLAILRQIEFATFDLLLHRDYDPARGARVNAML
FT                   DQVRKAVAVVHPPEWNRFAHAFSHIFAGGYAAGYYSYLWAELLSADAFEIFAHADIPGG
FT                   GATAFRREILAAGASRPAAENFRAFAGRAPEVDALLRMRGLAA"
FT   CDS_pept        complement(634771..635502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="SJA_C2-05510"
FT                   /product="gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98914"
FT                   /db_xref="GOA:D4Z756"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z756"
FT                   /protein_id="BAI98914.1"
FT                   /translation="MLQGKIALVTGAGRGLGREIALGLAGAGAHVLLHGRRGEPLQATA
FT                   AAIAALGGTSAPLIFDLEDGEALRAALGACGPVDILVNNAGHRDRRPIGELDRPAARRM
FT                   LEINLVAPFDLARTVAAGMEAGGRIVNITSIAGQIARSGDAAYTMAKGGLDALTRALAA
FT                   ELGGRGITVNAVAPGYFATEANEEMTADPAVADHLARRTSLGRWGRPEEIVGPVLFLAS
FT                   DAASYVTGQVLAVDGGYTAHF"
FT   CDS_pept        complement(635526..636815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05520"
FT                   /product="putative MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98915"
FT                   /db_xref="GOA:D4Z757"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z757"
FT                   /protein_id="BAI98915.1"
FT                   /translation="MLSATLARQMGARHIHYGWAVLAATFLTMLVVAGAVGAPGVFIIP
FT                   LQREFGWSAADISGALAIRFLLFGGMGPFAAAFMNRFGVRRMMLVSLAIIVVGLLLSMG
FT                   MTRLWQLVLLWGVVIGIGTGLTAMVLGATVATRWFTHRRGLVMGLLSASTATGQLAFLP
FT                   LLAALTERFGWRASVLLVCGAVLLAALVVLLLMRDRPADLGLPPYGESAVHPAPPQPAG
FT                   LGALLMSPLRILADAARVPSFWILFFSFYICGASTNGLVQTHFIALCGDYGLAAVGAAS
FT                   MLAMMGLFDFAGTLGSGWLSDRFDNRWLLFCYYGLRGLSLLYLPFSDFSLYSLTVFAMF
FT                   YGLDWVATVPPTVKLTAQRFGPERANVVFGWIFAGHQLGAASAALAGGLSRTVWQSYMP
FT                   AFVAAGILCLIGAGMVLLINRGRSKTFALA"
FT   CDS_pept        637328..638179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05530"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98916"
FT                   /db_xref="GOA:D4Z758"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z758"
FT                   /protein_id="BAI98916.1"
FT                   /translation="MPDTEEMIHEDGLPGHESRLEPKPEWEPRYPGSGRLAGKVAIVTG
FT                   ADSGIGRAVAALYAREGADVAIFYLCEHDDAEKTADIVRAEGQRALTIAGDLGDRDFCH
FT                   RAVARVVEEFGRIDILVNNAGEQHPDSDITDISEEQLRRTFQTNIFAMFFLTQAVRPHL
FT                   KRGAAIVNCTSVTMYQGSKELLDYSSTKGAITAFTRSLSENLVGDGIRVNAVAPGPIWT
FT                   PLNPSGGASPEKLEHFGESTPMGRPGQPNEVAPSFLFLACDDASYMSGQVLHPNGGTIV
FT                   NG"
FT   CDS_pept        complement(638299..640473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05540"
FT                   /product="putative sensor protein"
FT                   /note="putative signal transduction protein containing a
FT                   membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98917"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z759"
FT                   /protein_id="BAI98917.1"
FT                   /translation="MADQISSRSPDEFQGRQDPMDGDQQILASAGVLRWSVDGDGLCHP
FT                   DAATASRFGVRDGQPLLRWFRGVHRIFRKPVLQLARAVLRMGRAEATLTLEDREGIMRN
FT                   MRVVARIRRDGAGRPAADLVMIDVTTEHAEIGRLRRSTENLRLIVEYNPQLPWLADPDG
FT                   RIIDFTDRWLESSGLDREEAEGNGWLAATHPDDIGPLTQRITHSLTTGESFDVRVRLMV
FT                   NDQYRWMRAQAYPRRDEEGRIIRWYGYTEDIHESVLIEEQIRWNAEHDSLTELPNRAMF
FT                   NACLDKALAKALTEFRKVGVFLLDIDNFKDVNDLMGHHAGDDLLKSFASRLKDIFAGEG
FT                   VVARLGGDEFAILIENVESRQQLADLANRVLTIRETLFAAGRSLECGVSIGVAAFPEDG
FT                   RVATELLRHADLALYRAKSLGRGRMQMFEQSLLEDMQERVAMINRARTAVRDGTIISYY
FT                   QPKVSLQTGELVGFEALLRWRDSCGTIRSPAEIYAAFDDHDVADMIGQTMTSQVFADMA
FT                   AWRARGLPVGHVAINVSSAELRRERFAGRLIETMDRYSIAPDSIEIEITEGVFLGAASD
FT                   TVRRSIDELHMCNIPLALDDFGTGFASLSHLRSLPVSTLKIDRSFVSGVTARESDGAIV
FT                   SALVTLGRALNMKVVAEGVEEADQSIKLREMGCDYAQGFYFGRPAPSENIPALIQSWGE
FT                   NSAIVTLNRRAAAWPPPGIRGESRTGSRSA"
FT   CDS_pept        complement(640588..642780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05550"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98918"
FT                   /db_xref="GOA:D4Z760"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z760"
FT                   /protein_id="BAI98918.1"
FT                   /translation="MTNFGYRRRWKWALLVSATIELAASGTAWAQAPADADMRADITVT
FT                   ARKVPEPLLKAPLAVTSISGDSIVAAGLQTITDLTRMAPNVDISGGIAGQLQGQISIRG
FT                   ISTLVRNIGLETGVGIYVDDVYVGRPENFVQHLLDVDRVEIVRGPQGTEYGKNTIAGVV
FT                   NVQTKQPDADPGASIRLDAGNYDYRRGEAVLGTRLNERLSVRGAVAYARQDGFYKHLSG
FT                   GKDAGSTDLLTWRLSAKYAPTDQLSFIARWEGLRDRGTPAFFQADALAGYPADFPSREP
FT                   LHINNNRPNRLHRDSQGISMRTEWASDAITLTAITAYRDSSYHASLDDDQEQVDFVSAD
FT                   NFSDDSHFFSQELRLAGGTGKLRYLLGAYYFDQMVRTDRGLGLGADTGVPGEPMLTTKG
FT                   SVKTESGALFGRLDYELTDRLSLSAGLRYTREKKRAHFVQDDASGTGIFTYLGFPNLTF
FT                   DGRSTDDDLSPSATISYEVVPDANVYARFSRGFKSAAYNVDLASSLGGLTASPEKATSY
FT                   EVGLKMLTLDRRMRLNLAAFHTDYDRLQVSQVLGSGLALTNAGRAQVEGVEGELSLQLT
FT                   SRLQLEGNAAILDAHYKRFDNCGVPASVIPSVGSPSTDCTGNDLVLAPHFTGYGAVSYE
FT                   VPVRIGTIFVRADVDHRSTVYFEPTNSDAFKAGPRTLVNLRFGLRRGQWDIAAWVQNLT
FT                   DRIYKTYADDRSGLGVYRTAAYGPPRTYGVSLSATF"
FT   CDS_pept        643024..643572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98919"
FT                   /db_xref="GOA:D4Z761"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z761"
FT                   /protein_id="BAI98919.1"
FT                   /translation="MSEYIPSTQLRAGSSTTAADFIAGIDDTLGIDSLVTRFSQALGLQ
FT                   AASHACYAVGDGERRFLFGETGWCGPIAQPEVLPQICFPITGWDERSYEVEIRLISMLE
FT                   SPEERANLHAMATLYLCRGIALLDARDDLTASSLTETEQFCLDQRQAGLCDLDIAEALD
FT                   RSVQAVKVHVQRARRKQAA"
FT   CDS_pept        643770..644483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="SJA_C2-05570"
FT                   /product="putative autoinducer synthesis protein TraI"
FT                   /note="N-acyl-L-homoserine lactone synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98920"
FT                   /db_xref="GOA:D4Z762"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z762"
FT                   /protein_id="BAI98920.1"
FT                   /translation="MFVNQLGWDLRVRDGLEHDEYDDARASNIIGFSTENRVVMGLRFR
FT                   PTDDCSMLLDHFSHVLPAGIRPIDDGRTWELSRGFCIERGMRRHNLRRKAACMIAPLEL
FT                   AYEAGIDRCVGFTDVRMLSFCYGVGWKLTLLGSAMDYGQGEAVAYEVEVSQAALDEMRQ
FT                   MWGLPRPSHVTVDRLLPGEENAHVAAARLAREHPELQKIAAQPEIGSATHPSATTGADV
FT                   YYGRFGTTRSASGGH"
FT   CDS_pept        644483..644785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05580"
FT                   /product="putative polyketide synthase module"
FT                   /note="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98921"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z763"
FT                   /protein_id="BAI98921.1"
FT                   /translation="MNSDLIRQASAGEIESWIIARIAEIVNVAPAAVSPDAPFDSFGID
FT                   SAKAISLMVELENWLNLPDELPLELLFEAEAIRDAAAGIAAAVSDMAAQQGGVQP"
FT   CDS_pept        644782..645648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05590"
FT                   /product="putative cyclopropane fatty acid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98922"
FT                   /db_xref="GOA:D4Z764"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z764"
FT                   /protein_id="BAI98922.1"
FT                   /translation="MIQDEQIEFGGSAAAIRHHYDVGNDFYSAWLDPSMTYSSAMWDGL
FT                   SKDAPLEEAQQRKLDYHAQSVGAGEGMRILDVGCGWGGMMRNLRRTHGVAECVGLTLSE
FT                   EQLAYIRQLGDPGIGAVLSNWHDYRPDRPFDAIISVGAFEHFAHPQQSVEERRGVYREF
FT                   FQACRDWMAGKGRLSLQTIAYGRMSPEDANPFIANEIFPAAELPTLEDIVVASKGLFRI
FT                   ERLRDDGLDYARTCEMWSNRLRGAVRGGVVDPAIHPVEKYSRYLRMSAAGFRMRKIGLL
FT                   RIAFATE"
FT   CDS_pept        645770..647572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05600"
FT                   /product="putative nonribosomal peptide synthetase"
FT                   /note="acyl-CoA synthetase (AMP-forming) / AMP-acid ligase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98923"
FT                   /db_xref="GOA:D4Z765"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z765"
FT                   /protein_id="BAI98923.1"
FT                   /translation="MQMDFSRSIVDIVLDHGNSDPDRPALIFDQGDGPQSSLTYAEAAA
FT                   RVRQLAGALEARGLAARGLAAEGQAGPRVALLFSAGTDFALALLACLAVGGVAIPLAPV
FT                   GRRKARLQNILNMLGDIRPDCILLDDGMAGLFGQELSAALSAGPVRYLEFAALAAESHA
FT                   FSPLALAPDRLAVLQFTSGTTSNPKGVMISHGNIIANETMIRAAFGHDRDSHFVGWVPH
FT                   YHDQGLFGNILQPLFLGSTCVITSPAAFINRPMSWLQLISRHRAHTSGGPNFGYDLCVD
FT                   YATRRGMPDELDLSGWRVAFNGAERVRPATLDRFAECFADAGFDRRAFLPCYGLAESTL
FT                   VTIAVPPRSDPIVKSYDSRALAAGRAEESAGGDAVLDLACCGPAMAGGEARIVDPETGD
FT                   PLPDGAVGEIWLRGPHITAGYVDNPAATQASFGRLDEGGPFLRTGDLGFSTADGFYIVS
FT                   RLKDVIIVRGRNHAPSDVEQIWSELSGTVGQASAAAVEIEVGDTQHIVLIAEMKRDEAR
FT                   SLSEEKLQDIAARLRALAMERLELAITDLAMVPASAIPRTTSGKVQRKQAGRMLMDGEL
FT                   TVLGMAGPLAQAFGPSGQGMSAAR"
FT   CDS_pept        647746..648357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98924"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z766"
FT                   /protein_id="BAI98924.1"
FT                   /translation="MTGMSPSRRSGSWIAAIPLMLAAAGPAALAQSTILPEGMAIQLET
FT                   RQDISSKSARVGDRIELAVARPVTIGGVTLIPAGSPAVGEVSRVRDNGLLGRSGKLDIK
FT                   VSTVRTGGMDVPVRGQRSSQGKSGTLGAVGAGIVFLPLAVIVRGKDVKLPAGTLFEVYV
FT                   DREVSLGPTAPPEPAVAAPPEGREAPGGIRTVDPNQALGS"
FT   CDS_pept        complement(648551..650260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05620"
FT                   /product="signal transduction histidine kinase"
FT                   /note="two-component system, NtrC family, sensor histidine
FT                   kinase HydH"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98925"
FT                   /db_xref="GOA:D4Z767"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z767"
FT                   /protein_id="BAI98925.1"
FT                   /translation="MDRKLASERGAEQKALAARWSIATEAMEALAGARSLEAITHVLRA
FT                   FARRAVGADGIAVVLRDEDQCHYIAEDSMEPLWAGQRFPASSCVSGWAMENNRTAVIPD
FT                   VFDDERVPVEAYRTTFVRSMVMVPIGGVEPIAALGAYWSEFAQPTDNEIALLEALARAA
FT                   STALENGRLFASLEALNEQLERRVRERTAELERSQDSLRQVQKLDMLGQLTGHVAHDFN
FT                   NLLMPIVGGLDLILSGKRTPESIERHATIAMQAAESAQTLVQRLLTFARRQPLTATAVD
FT                   LPDLLGGMGALLASTLGPRIALSVDLQPLLPPVRADAHQLEVALLNLAVNGRDAMPDGG
FT                   ALSIRAEARQSRLPSALAPGRYVCLTVSDTGAGMTPAVRAAAMEPFFTTKPSGHGTGLG
FT                   LSMVHGLAAQLGGTVEIDSVVGQGTSVRLWLPVERTPAERPDPPVVEEGAKARSGRVLL
FT                   VDDNDLVRNSTREMLVEMGYEVVDTDRAERALGMIESGDRPDILITDHIMPGMTGVELA
FT                   LRLRADHPQIALLIISGYEGVDLIAPDITRLSKPFRQNHLQACIAAARAQAA"
FT   CDS_pept        complement(650458..652410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="SJA_C2-05630"
FT                   /product="acetyl-CoA synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="acyl-coenzyme A synthetase / AMP-(fatty) acid
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98926"
FT                   /db_xref="GOA:D4Z768"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z768"
FT                   /protein_id="BAI98926.1"
FT                   /translation="MLTTAPHVYPVPPAWSAEAKVDAAAYAAGYRRSLDDADAYWLEQA
FT                   KRLDWLREPTRADESSFAEGDFGISWFSDGMLNASANCIDRHLAERGDQAAIVWEPDDP
FT                   EEPARRFTYRQLHEEVCRFANVLKRAGVGRGDRVTLYLPMIPEAAFAMLACARVGAIHS
FT                   VVFGGFSPEALAGRITDCDSRIVITADEGRRGGRTVPLKRNVDAAAALAPVLKRVIVVR
FT                   ATGGDVAMDPARDAYYDELAAAVSADCPAEAMAAEDPLFLLYTSGSTGKPKGVLHSTGG
FT                   YLLWAAMTFDLAFDHRPGEVFWSSADVGWVTGHSYIVYGPLANGGTTLMFEGVPNWPTP
FT                   SRIWEVVDRHRVTTLYTAPTALRSLMKEGDDHVTRTSRASLRLMGTVGEPINPEAWRWY
FT                   HEVVGEGRCPIVDTWWQTETGGHMITPLPGATDLKPGAATKPFFGVEPLLVDGNGVAVE
FT                   GEGEGNLCIARSWPGQARTVWGDHERFFQTYFTTYPGLYFTGDGCRRDADGDYWITGRV
FT                   DDVINVSGHRMGTAEVESALVLHEAVAEAAVVGFPHDIKGQGIYAYVTLNSGEEASDAL
FT                   RQALVKWVRGEIGPIATPDVIQFAPGLPKTRSGKIMRRILRKIAEGEVSAQALGDISTL
FT                   AEPAIVEELIRGRAG"
FT   CDS_pept        complement(652420..652872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05640"
FT                   /product="putative pseudoazurin"
FT                   /note="pseudoazurin (blue copper protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98927"
FT                   /db_xref="GOA:D4Z769"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR012745"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z769"
FT                   /protein_id="BAI98927.1"
FT                   /translation="MTEIRITLGGLAAAALLTLAPLSAQAREIIVHMKNQGAEGAMVFE
FT                   PSFVKAAVGDTIRFQPTHPSHNAETMATMLPAGATPMKGAMNKEAVLTVTKPGLYGIKC
FT                   MPHYSMGMVALVQVGKVAPADLAAARAVKLPPFAAKRMTAALAKVK"
FT   CDS_pept        complement(653199..653744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05650"
FT                   /product="rhodanese-like protein"
FT                   /EC_number="2.8.1.1"
FT                   /note="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98928"
FT                   /db_xref="GOA:D4Z770"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR022376"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z770"
FT                   /protein_id="BAI98928.1"
FT                   /translation="MRKTIWAGALLLCAAPVAAEPLFGPDGYRIAAYRAPVSRPPDGVG
FT                   RIAPSAAAALRPGRDALFLDVLPAEGGHRESDGRWRLAAPHESIPGARWFPEAGRGVLA
FT                   PGIAAWFAGAVHRLTRGRRDRMLVVFCRSDCWMSWNAARRLRAMGHRNVWWLAEGTDGW
FT                   RDLGRPLVRVMPEGGLAP"
FT   CDS_pept        653850..654623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98929"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030831"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z771"
FT                   /protein_id="BAI98929.1"
FT                   /translation="MTLALLALAARAGASVPADPLGSPMWEAHAKLLFGDDPVRFDPRV
FT                   KVGFPEIAENQRSFPVAIDARAIAGVRRIVLLADLNPIPIAIDYRPTDGEAYLATRIKL
FT                   DQRTPVRGAVQLASGEWLVSGGWIDAAGGGCSTPPVSRVKGDWAQHLGEIRGEAWPVAG
FT                   PVPASRLRLNFRHPMDTGLVDAIPTYHLERLTVSDAAGRELGRMEIWASVAEDPAITLI
FT                   PHAAAGDVLAVDARDTNGRDYRATLSVARQSPLPR"
FT   CDS_pept        654620..655567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05670"
FT                   /product="putative Zn-dependent hydrolase"
FT                   /note="glyoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98930"
FT                   /db_xref="GOA:D4Z772"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030811"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z772"
FT                   /protein_id="BAI98930.1"
FT                   /translation="MMLTRRRLIAGSMALAVTPAQARGSYAIAPIAVADGIWMIHGADA
FT                   PMGPANGGAIANIAVIATPAGTVLCDCGPSLAYGQALRKVAEGLTGQPVVRVYVTHLHP
FT                   DHGMGIAAFDPQIVAALPGTIEALAREGRGYSDAMYRLLNDWMRGTELVLPGLTITAGR
FT                   EEFGGRGLRLLALSGHSGADLALLDERSGLLIGGDLVFHDRAPSTPTADLPGWRASLDR
FT                   LAREPHGGLVPGHGPFDPGGRAAIAQTRDWIDWLEDALTQAVQSGLDMVEAGELPIPPR
FT                   FATMAAARYELQRSVSHLYPGLEARLLPRIDRPD"
FT   CDS_pept        complement(655607..657913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05680"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98931"
FT                   /db_xref="GOA:D4Z773"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z773"
FT                   /protein_id="BAI98931.1"
FT                   /translation="MRKGMWLAGTALAILAGQASVQSAWADNADAVEAERQPIVVTAPG
FT                   GAIDADDALRLTGADIGRAGTPDLLGALTRSIAGVTLQDAQGNPWQPNLVYRGFTASPL
FT                   QGQAQGLAVYIDGARFNQPFGDTVAFDLLPEAAIRSVTLFDSSAVYGLNALGGAMVIDT
FT                   RTGLSDPGLEASLTGGRFGSREASVAGGFRKGDFSAFGAFQYSHEDGWRDHSPSTLYNG
FT                   YADLGFDTATGGLHLKWIGADTDLTGNGVAPVELLAADRRAVFTWPDNARARYGRVSLH
FT                   PWVALGEGTRIEGTLYAQQLKLRTVNGDAADIEGCEDGLLCLETVEGADEALLTDADGR
FT                   AIADVLGREGYGVLNRGRLDSRAMGALVQIIDERPLMGGRNHLAVGLSHDTSRSLFGAA
FT                   TELGALTEDRGVEGLGPAIVQADGAIGPVGLVAHASYWGLFAQDRLPLTDRLSAEIGLR
FT                   YNHVSIAMRDRIGTALNGDHRFRRLNPGLEFDYRLSQGLNLRVGYAQSNRAPTPAELSC
FT                   ADENAPCSLANFFIADPPLKQVVAKSWEAGAGGQGRWGGFRLEWLLSAYRTRNRDDIQF
FT                   VASDIRGRAWFRNIGATRRQGVEFTLKAMRGGLSGAFSYAFTDATYRHDLALSSPANPA
FT                   ADEDGVILVRPGDRLPGIPRHSATLSLDYAGRGWSVGGDLIARTGQYLVGDEGNDQPRL
FT                   KGYALVNLRAGIDIVPGVTLFGELRNALDRRYATFGTFTDVGEVEMAQAPDASDPRAYG
FT                   PGAPRRWYAGVKARF"
FT   CDS_pept        complement(658034..659425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98932"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z774"
FT                   /protein_id="BAI98932.1"
FT                   /translation="MKRTLLLASAAMGLLCATATPAMAGTTADLLKRLHEKGILSDEEY
FT                   QELLKNESAEAAAAPAAPPVTPDASGGGRTVRMTDSGVGFEMGDITLKFSGSVNGFYVH
FT                   DDGEAPSATNSVVGGVATVGGNSSAIRNGLLPGFLKVEVMTNQGGWDVGAHFGMYPGIN
FT                   SVNYAAGGGANSPGNPRGLQTAGIDFRQTYLTFGRPGFGEVKIGRDIGLFASEQILNDI
FT                   TLLSSGTPAGNVAPSNTTLGRIGVGYIYTDFQPQITYTTPSFSGFTASIGIFEPLSSLT
FT                   GPAESNKEPGFQGKLVYDGKLGGVATRLWAAGIRQKHDVIAGPDYTGWGWDAGAKVTVG
FT                   PLTLVGTYYDASGLGTTALNLFDTDGLGNKRDSHGFYLQGLASFGKFSAGGSYGESNLD
FT                   YANAADALANPTLVDKNSSWVGQVRYGLTSWVTLLGEYVHTKSEAHNGNQASSDAIAAG
FT                   AILFF"
FT   CDS_pept        complement(659772..660743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05700"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98933"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="InterPro:IPR022456"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z775"
FT                   /protein_id="BAI98933.1"
FT                   /translation="MKRIFLAGLMLAPVIAQAASAQAETLYVSNERGNSVSVIDAASAK
FT                   VVATWAVGGRPRGITVSKDGKYIYLCASTDHAVQVIERATGKVVAELPSGEDPEQFFLS
FT                   RDGGTLFVANEDDAALTAIDLANRTVAFQVGVGGEPEGVAQSPDGRWVAVTSEEENVVN
FT                   WVDVAKREMVDATPVDLRPRHVEFTGDGAQLWVAAEVGGTVQIVDAASRKVVETLHFAI
FT                   PGVADHRILPCGIRFTPDGRTAVVALGRADHVALVDVASRKVRAYVPVGRRVWHVAVSG
FT                   DGARAYAANGLSDNVSVIDLAKGEVTGTIPVGAAPWGIVAVR"
FT   CDS_pept        660884..661309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05710"
FT                   /product="putative cytochrome c550"
FT                   /note="cytochrome c, mono- or diheme variant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98934"
FT                   /db_xref="GOA:D4Z776"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030991"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z776"
FT                   /protein_id="BAI98934.1"
FT                   /translation="MNLGRISLLGAMAILGATTATGLMAHGNVTPQAVDTSALPDIGEE
FT                   WLAKNPYSGNAKAIEIGQSAYGQNCARCHGLDAESGGIAPDLRYLEQGESGDQWFVERF
FT                   RHGSSHDGKVYMPPFGDVLGQKAGWAIRAWLETKFQG"
FT   CDS_pept        661314..662168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05720"
FT                   /product="ABC-type transport system periplasmic component"
FT                   /note="ABC-type amino acid transport/signal transduction
FT                   system, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98935"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z777"
FT                   /protein_id="BAI98935.1"
FT                   /translation="MIDRRSLLGGAGAALALGLLPGTTQAAPLGKVRELGVLRVVVYKD
FT                   NRPWSWEEGGKLAGLDVDLAGAIARKLGVRADVAQLVADESVDDDLRHGVWKGGLLGFA
FT                   PGDLMLHVPFDRTFAARNDQVAIVAPYYRESFRFAGMRNAIDLEAPPTGWRGHRLAAEL
FT                   DSIPDFYLIGSFGGILAKDVAHYPSGAEAVAAVAAGKADAVLASRAQIEEGLHRGGSLT
FT                   VRKGPLPAFTSPGWDIGMAVRENSRTLGDAVEEVVSAMAASGEMKALFATYGVEWTPAL
FT                   AAG"
FT   CDS_pept        662297..664039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05730"
FT                   /product="putative PQQ-linked alcohol dehydrogenase"
FT                   /note="pyrrolo-quinoline quinone (PQQ)-linked alcohol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98936"
FT                   /db_xref="GOA:D4Z778"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR034119"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z778"
FT                   /protein_id="BAI98936.1"
FT                   /translation="MKGRLTRALSGAAILGMAVAAAPLLAEGPTDADLMNDAATPGDVL
FT                   TYGMGPKAQRFSPLKAINASNVAKLVPAFSSSLGGEKQRGQEAQPIVYDGTIYVTGSYS
FT                   RLFAFDARTGEEKWQYDARLPEGIMPCCDVVNRGAAIHGDKIIFATLDAHMVALNRHTG
FT                   KVIWNKQIADYQAGYSATAAPMVVKGKVIYGNSGGEFGIVGAVEARDVNTGELVWRRPT
FT                   IEGHMGTLNGKDNGLTGKTNASWTGDLWKTGGGATWLGGTYDPETDLLFFGTGNPAPWN
FT                   SHLRKGDNLYTSSTLAIDPDTGVIKWHYQTTPHDGWDFDGVNEFIPFDATVNGKPMKLG
FT                   AKADRNGYFFVLDRTNGKFISASKFVMQTTWANGFDKNGRPNYNDANRPGAPGETAKGS
FT                   SVFASPSFLGGKNWMPMAYSQDTGLFYIPSNDWGMDIWNEPIAYKKGAAYLGAGFTIKP
FT                   IAEDHIGALRAMDPKTGKIVWEYKNKAPLWGGVLSTAGNLVFTGTPEGYLKAFDAKTGQ
FT                   ELWKFQTGSGVVGSPVTWEQDGEQYVAVMSGWGGAVPLWGGEVAKSFKDINQGGALWVF
FT                   KLPG"
FT   CDS_pept        664053..664829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05740"
FT                   /product="putative response regulator"
FT                   /note="two-component system, NarL family, nitrate/nitrite
FT                   response regulator NarL"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98937"
FT                   /db_xref="GOA:D4Z779"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z779"
FT                   /protein_id="BAI98937.1"
FT                   /translation="MIVMGRGNHMHSIPAIPPGAMRLATAHDLSDDPGRGVGRYMGGEA
FT                   IMERVLIVDDHPLVRDGLRSVIAISFDNIEIFEAATLDEAVSLLEKQDNFDLILLDLNI
FT                   PDVRRLDGLKLLRDRFPILPVVMVSGAFDRAIVQEALAAGAAGFIPKSLKRSAIVDALH
FT                   RVVSGEIYLPEAMGESVAPTAEEDEIARRIDSLTPQQKTVLAHLVRGRLNKQIAHDLGV
FT                   SMTTIKAHVSAILQKLGVLSRTQAVIKANQVHFRAD"
FT   CDS_pept        664949..665494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05750"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98938"
FT                   /db_xref="GOA:D4Z780"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z780"
FT                   /protein_id="BAI98938.1"
FT                   /translation="MSTSSSVTVRNATAGDAAAIAAIYAHHVLHGTASYEFVPPTVAET
FT                   VAKIGRVTGRGWPFLVACDGAEVVGYCYATQFRDRPAYAHACENSIYVAHDRRGGGIGR
FT                   ALLEALLDAAEAFGFRQMVAVIGGGEPASVALHAACGFRQAGRLTGMGWKAGRWLDTVY
FT                   MQIALGGGNATAPDAARP"
FT   CDS_pept        665670..666134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05760"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98939"
FT                   /db_xref="GOA:D4Z781"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z781"
FT                   /protein_id="BAI98939.1"
FT                   /translation="MAISQRLRGYMDRCGTRFDEWPHEHSSEMARAAQAAHVPGRQVAK
FT                   AVLVQAGDEYMLAVLPSSKHVSFNFLQQWLARDVSLAEEHTTAALFPDCELGAIPPVGA
FT                   AYGLKTIIDDDMLMDQDVWFEGGDHHTLVHMNAENWRRLQKGAGHFAFSI"
FT   CDS_pept        666332..668554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="SJA_C2-05770"
FT                   /product="catalase/peroxidase"
FT                   /EC_number="1.11.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98940"
FT                   /db_xref="GOA:D4Z782"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z782"
FT                   /protein_id="BAI98940.1"
FT                   /translation="MDAKTSNDPLSCPVKEPAALRSLLGRTNRDWWPNQLSLDILQQNG
FT                   LSGNPLGDDFDYAAAFKTLDYQAVKRDLTALMTDSQPWWPADYGHYGPFFIRMAWHSAG
FT                   TYRTGDGRGGASSGSQRFAPLNSWPDNANLDKARRLLWPIKQKYGQKLSWADLMILAGN
FT                   VAIESMGGPVFGFGGGRADVFEPEKDVYWGTEEFWVGQEGNETRIQPEKNMVLESPLAA
FT                   IQMGLIYVNPEGPGGNPDPLQSARDIRETFLRMGMNDEETVALTAGGHTFGKAHGAGDA
FT                   SKVGKEPEGADIAQQGLGWQSGYESGVGDHTITSGIEGAWTPTPRTWDHSFFHMLLDYE
FT                   YELVRSPAGAKQWQPVNQKPEDMAPGAHSPDRRVPTMMTTADMAFKMDPEYRKISERFR
FT                   NDPAAFEDAFARAWFKLCHRDMGPKARYLGPEVPAEDLIWQDPIPAVDHPLVDAADIAS
FT                   LKQKILASGLSVAELVTTAWASASTYRGSDHRGGANGGRIRLAPQKDWDVNQPEQLGRV
FT                   LSALEKIKAEFDSAGAKKISLADLIVLGGSAAIEKAAKDGGRNIEAPFTPGRADASQEQ
FT                   TDVQNFEVLEPKVDGFRNYLPVPFSVPVEELLIDRAQLLTLSAPEMTVLVGGLRVLGAN
FT                   HGGSSHGVFTDRPGTLSNDFFVNLLDMGTAWKEVEGQKDIFTGTCRRSNEQKWTGTRVD
FT                   LVFGSNAQLRALSEVYASADAGDKFVNDFVAAWTKVMNADRFDLAA"
FT   CDS_pept        668674..668844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98941"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z783"
FT                   /protein_id="BAI98941.1"
FT                   /translation="MRRLAVHDYLKDAADAAKLTDEQLLAILRRIGDPKHPTGFEQAVL
FT                   DEMERRHLRPS"
FT   CDS_pept        complement(668858..671065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05790"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98942"
FT                   /db_xref="GOA:D4Z784"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z784"
FT                   /protein_id="BAI98942.1"
FT                   /translation="MKDALPSSAEIEALREENRKLRKINAALIDRVERSSDMAGNAFSM
FT                   FETAISLEAMVRERTAQLEDALAKLAEANADLASAHGRADAARMRLRDAIDSINEGFVL
FT                   FDAEDRLVLYNEAYLGFWPEIADHIREGMSFDEIARLAAAHHRPVGQDRWVSDRLARHS
FT                   VAEGGHVQALSDGRWVQINELRTSEGGIVGIYTDITEAKAEDARDRARELAERNIVLQA
FT                   TLDNLSEGVCLFDAEGRLAAWNEALQRLLELPEDWAQEGGTHAALLDWCRGRLGMDDLG
FT                   CLDRGGARHRSELVHAGGRSFEIRSNAMERGGQVIGFTDVTDMLRAQAALRETAETLER
FT                   RVAERTSELEAEVAERREIEAQLMDAKTAAEKANLSKTSFLAAASHDLLQPLNAARLFV
FT                   AALGDRRLALPTRALVNQTSTALDSVEDLLEALLEISRLDAGAIQPEISDFRIDRLLDT
FT                   LRTEFAPMARSAGLALTVETAPVWVRSDIRLLRRILQNFLSNALRYTQRGSVRVACVAE
FT                   GEGIRLSVADSGPGIPPDKQQLIFEEFRRLDTRGGRGAGGKGLGLAIVRRASDMLRHEV
FT                   TLESAPGQGATFSIRVPRGEAVVEEGEGGSAPRSDRSMRGLKVLVVDNERAIQTGMSTL
FT                   LGGWGCTVATAAGFEEAVAAFAEGEAPDVILVDYHLDDGETGDAVIERLHGHFGRAVPS
FT                   VMISADRGEALKARMDGWGIALLGKPVKPAQLRALLRTMLK"
FT   CDS_pept        complement(671062..672198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05800"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98943"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z785"
FT                   /protein_id="BAI98943.1"
FT                   /translation="MLASQIAFASSHAGDPAKAMAEVAGQLGEEPLAGMLLFCSHRFDR
FT                   EALARAVNPRTEGVVAIGCTSSGELTENGYDEDSLSVVGFPASAFHMTSLCFDDIESFD
FT                   PAAARQAVRGLAARAERESRHLGDKVNHVALFLVDGLSHREELLTMTIQDGLGDIALIG
FT                   GSSGDGMAFRETAVFHGGRFHAHAAVVAILSTPRPLHVFKAQHYRPSEAKMVVTGAIPN
FT                   DRIVTEINAEPAAQEYLRLAGHAGEALGVAFYAAHPLMVRAGGDYHVRSIQSANPDGSL
FT                   TFYCAIDEGIVMTVGEPVDRIARMDALFADIAAEVGPVDRIIAFDCVLNRIDAEQRQIT
FT                   RAVSELYGRHRVIGFNTYGEQYHALHVNQTFSGLAIGR"
FT   CDS_pept        complement(672247..672636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05810"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98944"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z786"
FT                   /protein_id="BAI98944.1"
FT                   /translation="MDLPSRILATPEAEALIARLTMRHGPLMFHQSGGCCDGSAPMCFP
FT                   RGEFRVGGQDVLLGHIAGDVPVWIGAAQFDYWRHTQVTVDVVPGRGAGMSLESPEGMRF
FT                   IVRSRVFTDEENAALEAAGEPLRGA"
FT   CDS_pept        complement(672900..674405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05820"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="NAD-dependent aldehyde dehydrogenase /
FT                   chloroacetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98945"
FT                   /db_xref="GOA:D4Z787"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z787"
FT                   /protein_id="BAI98945.1"
FT                   /translation="MARFAGKTLIREKYENFIGGQWVAPVRGEYFDNLSPVTGQSVCKV
FT                   ARSTAEDIELALDAAHRAKEGWGRRSATERANILNRIAQRMEDNLDLLAMAETIDNGKP
FT                   IRETTAADIPLAIDHFRYFAACVRSQEGSIAEIDHDTVAYHFHEPLGVVGQIIPWNFPI
FT                   LMAAWKLAPALAAGNCVVLKPAEQTPMSIMVLMDLVGDLIPEGVLNVVNGFGVEAGKPL
FT                   ATNKRISKIAFTGETTTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDADDDYFDKC
FT                   LEGFAMFALNQGEVCTCPSRALVQESIYEKFIERAVARVQKIVQGSPLDPATMIGAQAS
FT                   NDQLEKILSYIDIGKGEGAKVLTGGTRAHLGGELEQGYYVTPTVLEGHNKMRIFQEEIF
FT                   GPVLSVTTFKDEAEALHIANDTLYGLGAGVWSRNGNTAYRMGRAIQAGRVWTNCYHAYP
FT                   AHAAFGGYKQSGIGRETHKMMLDHYQQTKNLLVSYSTKALGFF"
FT   CDS_pept        674625..675806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoB"
FT                   /locus_tag="SJA_C2-05830"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98946"
FT                   /db_xref="GOA:D4Z788"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z788"
FT                   /protein_id="BAI98946.1"
FT                   /translation="MTTEIILAHPVRTPIGSYNGALKDVPATELGAVAIRETVRRAGLP
FT                   AEVVGAVTMGNVIQAGNGMNPARQAAIHAGLPVSVPALTVNRVCGSGAQAIVSAAQEVQ
FT                   LGLHDVAVAGGMENMDRAPYLMTGGRWGYRMGDAAIIDSMLRDGLNDAFSGRHSGWHTE
FT                   DLVTRSQISRDAQDRWAERSQSRFAQAQAEGRFDAEIAPVTVQGRKGEISFARDEAPRA
FT                   DTTLEGLARLKPAFRPDGTITAGNAPGLNSGASAMLVASRAWAEANGVEPAARIVAHAV
FT                   AAMEPGLFGLAPIPAVVKAVERAGWTLPVVERFEINEAFAAVPLAIIQELGLPEDIVNV
FT                   EGGAIAHGHAIGATGAVLTTRLLHSMKRDGVRRGIVTLCIGGGQGIALALETL"
FT   CDS_pept        675806..676252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05840"
FT                   /product="phenylacetic acid degradation-related protein"
FT                   /note="uncharacterized protein, possibly involved in
FT                   aromatic compounds catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98947"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z789"
FT                   /protein_id="BAI98947.1"
FT                   /translation="MAARLQGRGMSGLDMISAVARGDLPYPPMAETIPFRLLPPEIGRI
FT                   ELMATPEERFLNPGGIVHGGWVMTVLDSAMGLAAVTMLEEGGFAPTHETSVKFLKPIHA
FT                   DIGPLRVIGTVISRGRSLIAMEGRIIGPGERIFAHGTSTCVVPR"
FT   CDS_pept        complement(676292..676960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05850"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98948"
FT                   /db_xref="GOA:D4Z790"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z790"
FT                   /protein_id="BAI98948.1"
FT                   /translation="MRYPSEHKARTRERILKEASRAIRCQGIDRVAVANVMSAAGLTVG
FT                   GFYAHFASKDDLVAHAVEHMFHERYEEFLGLLDVGDPRAAIAKFFDGYLSMAHRGHPET
FT                   GCPIPSLSSELGHLSEDGRGRLSRGMRGLVDGLTRLLERAGIGDPAEAANAAFSEALGA
FT                   LVMARMTTDPKAAEKILQKARKSVKERLGVADVDTRIPLRSRSASRAGAKPPERAEAAA
FT                   "
FT   CDS_pept        complement(676938..677303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98949"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z791"
FT                   /protein_id="BAI98949.1"
FT                   /translation="MLSGPVPPVLNLLPARRIAPAPLRVRKMVGAGSFATALNIMDFHG
FT                   HEKGGGMAAPADRVPPPPRGGIGAGSARPSGSKCLNLTGIILSWSQAAPRQCRAVPAAG
FT                   GCDPVSCGTMHEIPQRT"
FT   CDS_pept        677316..678896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05870"
FT                   /product="putative glycoside hydrolase"
FT                   /note="beta-glucanase / beta-glucan synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98950"
FT                   /db_xref="GOA:D4Z792"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z792"
FT                   /protein_id="BAI98950.1"
FT                   /translation="MRIFSFRPLAGALFACVLIFCMSEWGLSLTADTEKISAPAAEDRP
FT                   GIAPILARGFFGRTDGPSPRIDFSRPSPSPWTTALGSSNPAALFPAAPAAAPTGGPAWG
FT                   AAGKMATVSTMASLSATTLSAAGQATDFANFDFAGGTRYPELATASVGPAFYRPGSTVA
FT                   HVPISLDRPTPNTVIARVMTEDGPGLVRGVAGVNYQSIYKSVIFRPGDPLTKTVSVPIL
FT                   LGVPQADFIVRFVEAPWGGRMGTDRAFVQCDFQQEPTAEQVAGREPRIFQPTGALQWKM
FT                   SRETLKWSDAGHDKAWSTKLPNGRSQPGNQETGIYLDGWVYRDYGIEAPLRYTDEGLVM
FT                   HTQKLRQPIAWDGVPYDYGAVVLSGHNTRPVQIGYGQYEFTAKMPNRRGSWPAFWLIST
FT                   AGWPPEIDIYEGFGFESWWDFDRYTANTLHGGANITRTFQQGVFMNTDEIYGIGGFTTG
FT                   FHSFAVDIQPDYITWFIDGKETYQAVNPFAGFRWYPIMNVAVKTTGDYADGTGDMIVKD
FT                   VRIYSDGGQ"
FT   CDS_pept        679226..680422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SJA_C2-05880"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98951"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z793"
FT                   /protein_id="BAI98951.1"
FT                   /translation="MNAVVTQIGDLAEAGEKMVERLRRKAFLPDSRKELNIRFGIAEAA
FT                   QLLGCSTNRIRMAEEDGRLPPAPPTENGRRPGYKVEELLNMRQVLGASPERAPLDIPAI
FT                   IAVQNFKGGVGKSTVTTHLAHYFAVQGYRVLVVDCDSQATTTTLFGFNPHFNIQREETL
FT                   YPYLSIDPTQVDLLYAVKHTAWPNVDLIPSNLELFDVEYELAAAGSDGGSVLAARFRKL
FT                   KQGLMDLARHYDVVLLDPPPALGTISLAVMQAANALLVPLAATTPDFCSTVQFLSMMDQ
FT                   VIGQLQQAGIEVDYQFVRLLCSKFDSNDPSHSMVRAIMEQSFGPALLPIPILDSAEISH
FT                   AALRMMTVYELEKPIGTPRTHKRCRANLDEAMGQIEALVRQGWGRVAPAREEDIVNAA"
FT   CDS_pept        680485..681576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C2-05890"
FT                   /product="ParB-like protein"
FT                   /note="chromosome partitioning protein ParB / putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C2-05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98952"
FT                   /db_xref="GOA:D4Z794"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z794"
FT                   /protein_id="BAI98952.1"
FT                   /translation="MARKQSDYLAALLSDEPEAAARPAVEREEARAPAPSPSPAPAPPR
FT                   QDRARGTTLLGRESALARLASGEVRQVTQLLLDPARVRIWTGNARHYAHLNEENCRELI
FT                   DSIIAEGGQKVPAVVRRIEGDPDHDYEVIAGTRRHWSISWLRANSYSDMMFVAQVAQLD
FT                   DEAAFRLADLENRARKDVSDLERARNYADALKAHYGSHLTRMAERLKLSKGWLSKMIKV
FT                   AGIEDAVIDAFASPADVQLKPAYALAQSLDDPKGAPAIRAEANRLASEQRALRTAGAAP
FT                   IAAADVLKRLLDAPRAARSAPREEPFTWTTRYGRPALTVQSVNRQGITIRLHAGSGADM
FT                   ETLATALRDTLEHLERQGMGLQR"
FT   protein_bind    complement(681816..681823)
FT                   /bound_moiety="dnaA"
FT                   /note="dnaA_Box"
XX
SQ   Sequence 681892 BP; 116935 A; 227705 C; 221911 G; 115341 T; 0 other;
     atgacccgcg ccgcccggac gcagatcaac gaccagttcg aactcttcct cccctatatc        60
     gcggacatgc cgctgcgcga ccagcgcgag atgatggagc gccccttctt cagcctcgcc       120
     aagaccaagc gcgtcaagcc gatcgactac acctcccccg acggcaaggc ctgggtccat       180
     gtctcggcca atcccgatta tggcatggcc accatctggg acgccgacat cctcatctat       240
     tgcgcctcgg tcctggccga catggcccgc cgcggcctca acgacgtgcc gcgcaagttg       300
     cacctcatgc cctatgacct gctgcgcgcc atccaccgcc cgaccaccgg ccgcgcctat       360
     gaactgctcg gccagtcgct cgaccggctc gtctccacca cgatcaagac caatatccgc       420
     gccgaaaacc gccgcgaagc gaccttcagt tggctggacg gctggaccca gctggtcgac       480
     gaacgcaccg aacgctcccg cggcatgacc atcgaactca gcaactggtt ctatgaaggc       540
     gtgctgatgc agggcggcgt gctcagcatc gaccgcgctt atttcgacct caccggcggc       600
     cgcgaacgct ggctctacaa ggtggcgcgc aagcatgcgg gcggagcagg ggaggggggt       660
     ttcgccatct ccatgcccac cctgttcgaa aaatcagggg ccgagggcgc ctatcgccgc       720
     ttcaagttcg agatcgccag gatcgccgaa cgcgatccgc tgcccggcta tacggtcgag       780
     ctggaacagc ccgaaggcaa gcgcgaaccc tcgctccgca tgcgccgccg aacccaatcc       840
     gatccgcttc cccccacgac gacttcacgg cggacggccg cgaccccgca gtcggccgcc       900
     gccgctaccc acaacaacag cgcagtccgc caccctccgg ccgatgccga catgctggtc       960
     gacgcgggcg gcatgatccg cagaaccttg gccggcatgt ccgccaaagc cagcgccggc      1020
     gaaatcaccg acgcgaccat ggcgaccctg cgcgccgaat atcccggctg ggactatcag      1080
     acgctccatc aggaattccg cgactggctc gacgccgatc ccgcacgcac gccggtcaac      1140
     tatcaaaagg cgttcatcgg cttcgtccgc cgcttccatg agaagaaccg gcaccgtctc      1200
     taggctgtat cgacattcag ccctggcggc ctgcaaatgg tggttttccg tgcttccggt      1260
     gctcacctac tttgagtagg ctgcgcgccg ggtcacggta aaccaccatt ttcggctcgc      1320
     catcttctga atgtcgatac accctagagc gcggtccgct tagattgcga ttgcagcgga      1380
     tcgcactccg atttctcttg tctccatttt ccgatgccgg acggaaacat atctcatatc      1440
     cgccgctcga tgtcagaccc accgtccctc tgccttgccc catggctaga gcgttcccga      1500
     agtgtcgggt gacacggata tggcggaccc cgctgtcgcg cacgacagtt caatgcaccc      1560
     gacccgccgc cgaatttgaa cgtccttccc gacacccccg cccaatatga ttcaatccgc      1620
     caagcgccac ccaccgcaaa tggcgagcct cgacattccg ggaacggtct tcgcctcttc      1680
     aggaacgctt ccccgacatt tcgggaacgc cagcgtcgac attacaggaa cggacaatcg      1740
     accttatggg aacgcggcac aaaggccgac tcgtgcgatt ccggcgattc gggccgaaac      1800
     tctcagccgc taactcttta actttcctag aaaccttata acagcagcac gatattttct      1860
     ggaaaatgaa gcaggatgga cgaaggctcc atttcctaat gccctcccgt cagcctctcc      1920
     acctgcgcaa ccagcttcgt cgcgccctgg tgcgaaatgc ccagcaaacg ggcgaccgcc      1980
     atcttgccaa gcccgggata ggccagttca agccgcatga gcagcggggc cttgcttcgt      2040
     cgcgtcactc gcaattcctt cggcaaccgt gccagcttcg cctccagccg gtccagttcg      2100
     atcaatccct gcccggcctg ccgggcgatc atggccgcaa tcgctttcgc caatgaacca      2160
     gcatcgtccg gcaagaagcg cggcagtccc accagcgagg gcaagcggcg caggctgagg      2220
     cccgccgcca gcaacgcgcc tggaagatgg caggcgagca cccagcccat atcgaaccgc      2280
     cgcggatcga tgcgccattg ccgcccgtcc gccgtcgtca ccagatgacc ctcggtgaca      2340
     ggcgcgtcga gactccctct ggcatctatc agccgctgcg cgatccccag caaggtgccg      2400
     gcagggtagg gggcctccag cagcatctgg gccatccgcc atgacgggcc gaagcggacc      2460
     agatcctcgg gcgcccacag tccagcctcc ttcctgtcat cgagcagcgt gcgggagata      2520
     ttgagggtcg cccgcgcgat cggatcccga tcgtcgcttg ccgacagggc aaaatggaag      2580
     agggcggcaa cggagagcgg atcgttgaga ccctcgctat ggcgcggcgg cggcgtccgc      2640
     ccgcaaatcc agttctgaag ctccgtaacc gacaccggca ccccggcaaa gcctgacagc      2700
     atggaggcgc ccttcagcct ttccctggcc agccagatgt cggccgccgg gctgttgcag      2760
     agccgcccgt ccagccgccc caggacaagc agggcatgat ccggcgaagc tgaaaaatcg      2820
     tgcattcccc ggtcatagcg caagatggac tacaaccaaa taatatggtt ggttgtacat      2880
     gctgggatgg gggtggatag atggcgcctc ctgttttgag gcgacccttc aggccatagc      2940
     tatatgccat aacaaggcga tgcccgccag catcattcga catcctctcg cgcgatggga      3000
     tgaaagcgtt gcgcgacgac cgcgcttatt ttgcaggtgg cgttggcctg ccgaggcaag      3060
     agggagtcct tataccgtct gggaaaaggg aacagaacag gaaacgcgcc tatttcgccc      3120
     tcggaggctc gtcaggcgcc gcggaggggg ccagctaggt tggcccgtca gcagggcgaa      3180
     tttctttcct gtgagcttcc cagcctgcct aaattttggg caatggccgc tggcgtagct      3240
     ttgaacgccg gatcgagcgc cagggaagat gaagcctggc aatgggaaaa agcgccaagc      3300
     ggcggataac tgcgagacag gatggcattg gcctcaaggc tgggcatcac cgtcgaagat      3360
     cgggttgata tattgaagcc taggcagcgt ggacaaattc aagacttgcc ggactgagtg      3420
     atttgggtgg ggaggggcca ttccctattc gtcacctttc cccccctatt cgtcaccccg      3480
     gacttgatcc ggggtcccgc tgccttgggc tgggcgcggt gtagaggcaa aagcgggacc      3540
     ccggatcaag tccggggtga cggtgggggt aatgaccgct catggccatt tcacgacatt      3600
     ttcgaatttg tccaagctgc ctagtcatga agcggatcag attaaattct aaaagccgta      3660
     aatcttcatc cataaatggt cccgaagata ggctggcgag cagcgaaaaa tccgtcagag      3720
     acgtataaca aaacccgtca cccatcagca cgctgggacg atgtcctgaa tgagccattg      3780
     attttcaatt gacggtgaag ggttctcgta aaaaccgaaa catgccgctg caagttctcg      3840
     agaagccgat gggtcaatcc cgacaaagaa aatagattag ctgaacagtc cttttatcct      3900
     ccgggatttg ccttgctccc gccatcattt tttcggcaac cggattcttg tggcataatc      3960
     cgaacgatga acctgacccg attggcgggc catggccgaa tatctatcca attgacatca      4020
     aggaaaacgc ccgaccaaca tttgcgctgg ccggagcgtg atcctgatcg gcaaccggac      4080
     tgcccggccc ggaaatgcgg cgtcaaaagg tggacgtgct ttcatgatga atgaaagcac      4140
     gtccgccaat ctgacgatca ggccttttca gctgccgtcg ccttgctgga tttggcggca      4200
     ggctttttct tgggagcggg tttggcgggc gccttggcag ccggggcggg cttgttgcct      4260
     gccgccgcct tttcggcagg cttggcggca ggagcggcgt ctttcttcgg cgcgggtgca      4320
     gacggcgttg ctatggagag gcgcttgcgc gatgcggcag gctttgcggc cggcgccttt      4380
     gcggcgggcg ctttggcgac ggcgggcttg gcctccacgg gcttggctgc cggggccttg      4440
     gtggccgcag tcttgggagc gggcgtcttc gccgcggccg gcttggcagg cgccgccttt      4500
     gcgggcgctg ccttgggagc agcggcgggc ttcgcagccg ccggcgcggc gacagcggga      4560
     gcaggagccg cttcggccgg cttcttgacg ctcaccggct ttttgcccag gccgagcttc      4620
     gtggcgactg ctcgccgcgc ttccgaatag ttgggcgcga ccagcggata ggatttcggc      4680
     agcccatagc gttcgcgata ttcgttgggg gtcaggccat ggctggcaag gtggcgcttc      4740
     agcgtcttgt agggtcggcc gtcaatcatg ctgagaatat gctccggcga agacaggctt      4800
     ttgcgaaccg acaccgccgg cgtgtaagtc ggcgccgccg catcttcggg ctttgcggca      4860
     agatcatcag tcaaggccag gcgggtggtc cgaatgagat cggcaagacc ttcgctcgcg      4920
     acattattgt tggagacaaa ggcactcacc agctgaacag tgagcgtcgt gatgtcaggc      4980
     tggttgtttt cagacattgg ccccgcttcc catcttcgat taatagagag ggccttttga      5040
     gcggttttgc gtgaaatgta aatccgaaac aacttgacag cccggtcgca tgctgtcgaa      5100
     caggaacaaa caagcgcatt ttgtttcggg atggcacagc tttatcgtgc gcttccgtgc      5160
     catgtagcag accatcttcg tccatggtcc gtcagttaca ttgcgcaagc atcacgctcc      5220
     atacagcaaa gccggaatat cgatctatat tcgtgtcgcg cctaccagtg ttcggccagc      5280
     gcaaggcaat atttgtccgc cgcgaaacct gtttccggtg gaccaaaaaa aaggccggtc      5340
     tttcgaccgg cccaatgagt taggagagga tgcctgaaag gcactcgcca attggcgcgg      5400
     cgggcgtgca atggcaaatg cgaaacgcgg cgatgtgatt gcgtttcacg caatccatcc      5460
     gggcggtttc atcgggcagc acagcgggaa gagcggaaaa gggcttcccg acatcccggc      5520
     agaacactcc atgacgatcg gtctaaaccg cgcaaagatc gcggacctgc atcagatggg      5580
     gagggggagg gcaggcatcg atcctgccaa tatggcgcac cccgcccgtt cggctggggc      5640
     gcgccattcg atcaagggag gggtgccgtc ccgttcatcc gggccgatcc ttccgatcat      5700
     gtgtcggcgg agattgggac ggcggccagg tgcggccgcc ggggccattt tcagccgttc      5760
     aactggtcct tcacggcctt ggccggggtg aaggtcagct tcttcgaagc ggcgatctgg      5820
     atcacggcgc cggtcgaggg gttgcggcct tcgcgagcgg gctggtcctt gaccttgaac      5880
     ttgccaaatc cgttcagcga cacttcctcg cccttcgcgg cggcgccggc gatggcggaa      5940
     aagacgccgt cgacatattt gcgcgcatcg gccttggtca ggccatgatc ggcggccaat      6000
     gcttcggcga gttcagtatt gttcatggtg atctcccttt cgtggacgga tggtcttaac      6060
     ctgtctcttc gcgctcaacc agcccctttg cgaccggcga acagcgaaaa tcggcagcaa      6120
     aatcgcgtta ttggcgcttt gcgatgccga aatcatgccc gatcgggagc ctttgggggc      6180
     atttccgctc cgccgcgact ctgatctccc cggcgcgagg aggcgttcgg gccggggcaa      6240
     gggccgggcg ggcgtccgtt ccgccaaaat ggtcgcaatt gtcgagcgcc aggcgatgcc      6300
     ggcctgggcg gatcggccaa ggcggggctt cggcactgcg cggatatttt acaaaggctt      6360
     gcagatataa ccgatccggt cccggttgca gatgaaggcc gggtcgtttt cgcccatcct      6420
     tctgcgcagc ggcccattgg cggccgggat ggcgtggggg caggtggcgg cggatcatgg      6480
     cggggatggg gtggcgcagg ggcgcggcat gggcggttgc aacgggtctg gggctgatgc      6540
     tggcggtccc ggcggccgcg caggacgcag cgcccggcca gcagagcgcg gccccgatca      6600
     tcgatcgcga ccgtaccgac cggctcgagc cgcagatcgc gtcgccgccc gtcgccgcgc      6660
     cgcgccctgc gccgtcggtc caggtcgcgc ctgcggcctc ctccgcaggc cagaccctgc      6720
     tgacgcggct gcgctatagc ggaacgacgc tgcccacggg ccagcttgat gccgccgcct      6780
     cgccctatat cggacatccg ctaaccggcg agacgctcca ggccatcgcc aatgcgatca      6840
     gcgcgaccta tgcgcggagc gacatcgcct tctattccgt ctccatcccg ccccaggtgc      6900
     cgagcggtgg cgtgctgacc atccgtctgg tcgaggggcg ggtgacggat tatcgcctcg      6960
     cgggcatgtc gcccagcatg cctgccgggc tgatcgccgc gcatatgcgc cggctgatgc      7020
     gggacgcgcc gctgcgcaag agcagcctgg aacggacatt ggcgttgttg cgcgatattc      7080
     cgggacagac ggtcgatgcc cgcctgcggc agtcgggcgc gccgggcgac ctgctgatgg      7140
     acctcatcgt caagcgcaag caggtgcaga tcggcctgac gatcgacaat agcggggtca      7200
     gcaatgtcgt gcagggcgtg caggcgcaga tgtcggtcac ggtcaacggc ctcgtccgcg      7260
     aaggcgacag cacgcgcatt gccggctacc tgcccttcta tcccgaccgc tatcaatatt      7320
     attcgctcag ccacgccacc cccatcggca gcaacggctt gaccctggcc gcgcaggccg      7380
     cccatgtcga aacccgttcg cgcgacagca ggacgacggg tgaggcgaca ttggccggcc      7440
     tggcgctcag ctatcccgtg ctacggtcga caaagtccca actgtcggtc acggcgtccc      7500
     tcgacggcat cgacagcgac aattatttcc tcgacatccg tttcggggat tatcggtcgc      7560
     gggcgctgcg cctgggcgct tcctggtccc gcgccgacgc ccgggacggc tatgcgattt      7620
     ccacggtcgt cagccagggg atcgacgccc tgggcgccag gccctttgcc ggcttttccg      7680
     aaaccggctt caccaaggtc aatgtccagg ccgtcgcggt gaaggggatc agcggcaagc      7740
     tcagcctcag gacgtcgatc aagggccaat attcgaagga cgatcttccg gtgacggagc      7800
     gcttcccgct gggcggccgg ggcgtcggca tggccttccg caccggaacg ttgacggcgg      7860
     aacaggccgt tgccggcagc gcggaacttt cgtggtcgct tccggcccga tcgcccttgc      7920
     tgaaggcgag cgcgctgttc gttgcgcttg acggggcgct ggcgcatggc acggcgcggc      7980
     ccgcctaccg ccttgcggcg cgggactaca gccttgcatc ggccgggggc ggagtgcgac      8040
     tgggccttgg ccccaaatgg cgggtcagcg ctgaggtggc cgtgccggtc aagcggcccg      8100
     acccgggcca tagccgaaag gcgcgattct tcttcggggt agggcgggca ttttgatccg      8160
     tccttttgcg gatacgcaaa aacaaagaag cgggaagcaa gacaatgaac aatgtgtggg      8220
     aggtatggcc cgcggccctg accggggcgg aatgcgacgc catcgtcaag cgcgcggcgc      8280
     tttatcagcc ggaaagcgcg accgtcggct tcgcgcaggc ggtgcgcagc gatcatgcct      8340
     atcgatcgtc caccataagc tggctggatg tccatcgcga caaggacatt gtcgaccggc      8400
     tgatgcagtt cgtccattct tccaaccgca ccaatttcgg gatcgacatc gccggcccct      8460
     ttgagttgca atataccgaa tatcacggcc gcgcgcaggg caaatatgac tggcatcagg      8520
     atgtgtggct ggaatcctcc cgcccgttcg atcgcaagct gtcggtcgtg gtgcaactgt      8580
     ccgacccgga tgaatatgag ggcggcgcct tcgaattttt cggccttcag caaccgggcg      8640
     tgaatttcgc gtcgcggggc agcatgctga tcttcccctc cttcctccag catcgcgtac      8700
     tgccggtgac caagggcctc cgccgcagcc tggtgagctg gatcgaaggg cccagatggc      8760
     ggtgagccgc acctgacggc acgatcctcc atcctcaccc ttggcaaaga accgcgccga      8820
     tggggcgcgg gcaggatgga tgcgtgccga tcgcagcggc gaccgatgcc ttcggtcgcg      8880
     aaaatgagcc atatcggaag aaatcccgcc aagggcgact tgcgcggccc tggcccggct      8940
     ttgcggacaa gcaagtgtcg ggaagccagg taaaagccgg ttgttacggg gattgcctta      9000
     tctcttgcgc ggctttgcgc gggccgcgac atgcttttgc gtgtcgaatt gtgacgaaga      9060
     tgggtgaagt aaaccgttct gaccagactg gtttcttctt gacgcggcga taagcactgc      9120
     ccggcttaac gtgctcccgt tgcgatctgc tcgcaggaaa acagggagtc ttgcaatgcc      9180
     acttcatgga tcggtccggt cgggacggcg ctatctgctg tgcgccacgg cgatacctct      9240
     tcttttgctc agcgcctgcg ccgacggcgt gggtttcgac ataggggcag ggggcggcca      9300
     gtctccttcc ggtcccagcg gcccgacagg tccgacaagt cccactggcc cgaccagccc      9360
     gaccggaccg tccggcccca ctggcccaag cggccccacg ggtccgggtg gcccggccgg      9420
     tcccaccagc ccaactggcc cagcgggtcc gaccggcccc tccggtccta cgggtccagg      9480
     cggtccgacc ggcccaggcg gtcccaccgg acccgctggc ccgacaggcc ccggcggacc      9540
     caccggcccg ggcggtccga ctggtcccac cggcccgacc ggccccacca gcagcggatc      9600
     gatcatcggg gcgtccatcg gcaatcagcc gctggtcgga cccacggggc ccggatcgct      9660
     gatcggcgtc aacgtcctgc cgggcgacac tccggcgacc ggcagcgtgg ccaccgtcga      9720
     tctgctgacg ggcgacggca ccgtcgcgca ggtcgccctg ccgaccacgc cccagggcgt      9780
     gcagcagggg ctggcgccgg tgggcacgct cgccggcagc ctgctcggcg ccccggccgg      9840
     ggaggccgtg acccagctta ccgacggtct ctcccccgca gtggcggccg tcacctcgac      9900
     ggtgggccag ctcgccgcgc cgctgctgga cacggtcaac ggagcgctct cgcccgtcac      9960
     ggatccgctg gtgggcggca atggcgtcct cgcccccgtg acggggctgg tcgaaaatgc     10020
     ggtgggcggc ctgaccggcg ccttgggcgg catagggggc gatccttccg ccgctttggg     10080
     cgggccgctg atcggcgcga atgtcggcgg cgatgtcctg accggcgcct cgacttcggg     10140
     cacgctggtc ggggtcaatc tgctgccgtc ggatggcggc gcggttgccg gacagttggc     10200
     gacggtcgat gtcctgacgc agggcaatct ggtcgacgtc accgtgccga cgaccgccgc     10260
     cggggtggag gcgggattgc aaccggcagg caatctggcc ggcggcctgc tgggaccgca     10320
     ggccgaaacg accgtcaacc aggtcgtcag cgccgtcgcc cctgtggtgg cgaccgtcac     10380
     cagcacggtc gacagcgtgg ccgcgcccct gctcgacacc gtcaacagcc tcgccccgac     10440
     gctgcccgga ggagagagcg gttccccact cgcgcccgtg accggcctgg tcgacggctt     10500
     gctgggagga ggggaggggg ccaccggcaa tgtcctggcc cccgtcactg gcctgctgaa     10560
     cggcgcgctg gccccggcga ccggatcggg ttccgccacg gctcctgtga ctggcctgct     10620
     gggcgggctg ctgggcggcg gcaactgacg cggcgtggcg gtccgccatg gtcctcatgc     10680
     atgacgggcc gcctgccacg atgctctccc ccatatagcc cccgggggta gggcgggggc     10740
     gaggaggcag tgggcgcact gcctcctcaa accgatcccc aacgctggcc gctggccttt     10800
     gcgttcacgc aaaaatcttc ttcataaggg gaatatcacc ttgccgaacc gcctttttcc     10860
     gatccgccgc ctgattgagg gcgcagcggc cttgctgctc ctcaatgccc agcccgccat     10920
     ggccggtccc tacgcgccct atgccgtgac gccgggcgaa accgcggtgg gaacgatgct     10980
     ggacgcggcg gggggcgcgc ccggcggcga ccgcgcggcc atgctcgcgt cgatcgacgc     11040
     cctgccgacg gccgcggcgc gggccgatgc gctgggccag ctctcgccgc gcagctattc     11100
     cctgctgccc cgcctgtcga tccagtcgat ggacgccgcc gaccgggaga ttcgctcctg     11160
     gctggccgag cggcgcagca tcgccatcga tgccccggcc gatgttccgg ccagcggcga     11220
     ccgcaccatc accatgatgc tgagcggagg aataaagcag gcgagctata aggcccgcgt     11280
     cgaccgccct gaagcggagt ccgacagccg gtcgctgcgc ttcgccatgg atgtgaagcc     11340
     cgtgccaggc ctcatcgtcg gcgcgacgct gggcatcgac ggcatcgacg cccgactcga     11400
     cccggcgcgg cgcccccgca tcagccagtt caacagccag atcggctcct atgccagcta     11460
     tggcgacggc cgcttctatg tcgacgcgac ggcggcctat acgctctccg aatataagct     11520
     gcggcgccaa atcggctggg cgggcttcgc cgggcggatg gtggcgcccg tggacggcga     11580
     cggctgggcc gcatccggcg aggcgggcgc gatgctgcgc gcaggcccgg ttcggatgca     11640
     gcccttcgcc ggcctgcatt atcgctatgc cgacgtcagc ggcttcgtcg aaaatggcgg     11700
     acccgccgcg ctggaggtcg ccaccttccg caccaagtcg cttcgcggcg cattgggcgc     11760
     gcgcctctcc gccaatgtgg cgcaaggcgg ctggaccctt cgcccgtcgg tcgaggcgca     11820
     atggcagcgc gagttacgca gccgccccga cagccggatc gaagcgcgct tctccacccg     11880
     cgacttgccc atcttcacgc tgcgtcccac ccggctggcg cgtgacgcgg gcctggtgaa     11940
     tgccgggatc agcgcgacct ggaacaaccg caccacgttc cgcctgggct atgcgggcga     12000
     gttcagttcc gaccgccatg ttcatgcggc ggcgctgacg gtcggacggc gtttctaggc     12060
     aaaagggatt gctccgaaac gaaccggatt tcgcgccgca atcatacttg tcccgctatt     12120
     gcgtgggcct gctcacgcaa aggaagtgat ccatggcccg cttcatccgc gacatattgg     12180
     cgaccctttc ccatgaaccc gccgccggca aaggtccggt cgatcaggag gagctgagcc     12240
     gccttgacca gcggctcgcg cctttcacgg acaaggggcc gggatcgcgc ggcacgattt     12300
     cgatccagcc ggacgaatgt tcggtctggg acggcaatcc gcgcgaccag ccgggtttga     12360
     cggcggacgg ctgccggtcg ctgatcgatt ccatcgccag cgaaggcggg aaccgcatcc     12420
     ccgtcctcgt gcgcctcaat ccgccgggtt cggaccggcc ctaccagctt ctggtcggca     12480
     gccgccgccg tttcgcggtg gactggctca accataatgg gcggccggaa atgcggctgg     12540
     cggccctggt cgtcgacctg tcggacgagg aagccttccg cctggcggac atcgaaaatc     12600
     gcgagcgggc ggacatcagc gaactggacc gggcgcgcag ctatcagcat gcggtcgaac     12660
     gcttctacgg cggggtgcaa tcgcgcatgg ccgaggcgct taccctttcc aacagccagc     12720
     taagccgcct gctcgccctg gcgcaattgc ctgaggaggt ggtggacgcc tttgccacgc     12780
     gggacgagtt gcgcgtgcgc tattccgaaa tcctgacgcc gctgctgcgc cgtccggacc     12840
     agcgggcgcg catcattgcc gaggcgcgat ccatcgggga acagcaacaa gagctggcgc     12900
     gggagggcgg ccgcatgctt tcgcccgcga cggtgctggc ccggctgcgg gaggccgcca     12960
     tgccgcagcc tgttgaggaa gggcgcgaca tggcgatcat cgcgggcggg gcgcgcatcg     13020
     gccgcgccag gcccggccgg agcggcggcc tgaccatcga cctcaacata tcggaggatg     13080
     ccgatctgga cgaactgctg gcgcggctgc gcgaaaccat cgtcgcggcc cgggccgcgc     13140
     cggtcatgcc ataggaacgc gatcgcttcc ggagcctcaa caggcgactt tgcgtatacg     13200
     caaaaagccc gcgaccactg atgccagcgc ctctatgaag gcccggcggc ctccttccgc     13260
     ccataagtgg cggccagata ggcggcgatc cgttcggcat cggcaggctc gatcggcgcg     13320
     ccatagacct tgatcatctt gccgacgcta tccttccaga attgcgtccc cttgccgcgt     13380
     ggctgagtgg tgacatagtc cagcgaatgg caggcggagc agatcgccgt cgtcagttcc     13440
     gcgccatcgc cgggcggcag gacaatgggt cgttcgtcgg gcaggcgata gcccgcggca     13500
     gccgcgccgc tcgcggcgag aagggcgatg ggcagtagcg ctttcacagg gcgacgacct     13560
     ccacggcttc gacgacattg cgcatatagc cggcgggctg ccagagcgga tcgaacggct     13620
     ggacctctcc cgaccggccc gtcgcgcgga cgaggatgcg atggcggccg ggcgccaggc     13680
     tctgcgccga ccgccatgcc cggaagctgt agcggcccag attctcgccc agatcggcct     13740
     gccgccagct tgcgcccccg tcggtggaga tgtcgacccg cgcaatcccc gatccgccgt     13800
     cgaacgcgat gccggacagg actgtcagct tgcccgcggc cacctgcgcc ccggacatat     13860
     ggctggtgag gaaggaccgg atgttgagcc ggccgatggg ccgcgtcctg tccggcttgc     13920
     cgccgggcgc gacgcaggcg caatcattgt cgggaatgcg ataggcggtc ttcatccaat     13980
     agccgtcata ggccgcgtcg acgacgttga tctcatgcag atgcttgatc caataggtgc     14040
     cgtaatggcc cggcaagacc agacgcaacg gatagccgtt gagaaagggc aggtccgccc     14100
     cgttcatcgc ccaggcgacc atcacctcgc cgtcgcgggc atggtcgacg tccagcgcct     14160
     tgacgaagtc gggaatgccg tcggcctggg gattgtcgag tccgttgaac gtgacctgcc     14220
     gcgccccggc gcgcaccccc gtgcggtcca gcagcgcgcg aagcggaacg ccgcgccagc     14280
     gggcattgcc catcgcgccg ttgccgagtt gcccgccgcc tacacgcggt tcgaaaaagc     14340
     cgcgcccatt gccggaacat tggttgaccg cgacgatctc ctgcacggga aagtcgcgct     14400
     tcagttccgc gagcgaaagg gagagcggcc gctcgacatg accgcccagc gccagccgga     14460
     acctccgcgc atcgatgtcg agcggcagat ccgaaagatg atagcgcacg aagaaggcgt     14520
     cattgggcgt gatcggtccg tcgaacaggg ccagcggcgt ttcaagctgc ggcgggcgcg     14580
     tggtgagacc gatgagcgcc cgcttctgcg gatagcggac caggggccgc tcgccatttc     14640
     cgaagggcag ggcggcgtag ccgccacggg tccgcgccca gccggatacc ggcaacagcg     14700
     cccccgccat ggcggcgata aggccgcgcc gatccacccc attcatggtc cgtccgtccg     14760
     ccatggctgt cctgcctgca ccttcctgca ctctgatgat cggaatggat gcggccggtt     14820
     gtccggtgcg cagtctggct gccccggcca tcccggtggg aatgccgatc cgctgtgggt     14880
     aggacgtggc ggctggccag tcaatccggc aggtgcggcg ctgccccggc ggaaaccaaa     14940
     tcggcgatga ggagagccgg cctagctgaa aaaacgacct tgaatggatg ctttcccgcc     15000
     cttaatttgg cgcctggcgg tcaccgccgg aaggaagagg ggattggaag aaaggaggca     15060
     agcccatgtc cctctcccat tttcaaggcc ccttcgaagt ggcccatcat ccccagttgg     15120
     aacctgaggt gaagcgcgcc atccttgcat cctgggcttc ggacgccaat gccgtggagg     15180
     gcaatcccgc cgtcaggcgc ccgccccccc acaagcggcc gatccccatc gacgagatac     15240
     tggacgcgct gcgcaaagtg gatcggaacc ccggctaaat ttgacctgtt cctgcccgcg     15300
     caggaacagg ttgcgcttcg atgacgtccc gtcgcgggaa acactttgcc tcggcgcgag     15360
     gcagcatcgc ccctccgccc ggagaaaatc cgttcaggcg gtcatttcgt ccagccggtt     15420
     gatgagccgc aggaaggcca cttcgctttc gtcatgcggg gtgccgtccg catcgaaaat     15480
     atcgtggaac catttttcct tcagcccctc cagattgggg ttttcccatt tgtcccatgg     15540
     caggtgggtc tgcgtcttcc ccttcaccag gccccagcag aaggtgccga cctgctcctc     15600
     cttcgcgatg ggcaggatcg cctggaaggt gctgcccgcc gggcgcgcca tatattcggt     15660
     gcagagcagc ggacggccca tggtcttcag ccatttgacg cgctgggcga aatcctccgc     15720
     aatgccgtaa ttgtggaagg agatgacgtc ggaatgcgac gtctgcgcct gctggatcgg     15780
     actgagcagg tcgggcgccg accagtcgcc cagccagatg ccgctggtca gcggctgcat     15840
     cggctgcatg gcccgcgccc agccgaacgc ctcgaccagc agcggcacga ccagatcagc     15900
     cttcgccttg agcgccgccg ggtcgcacag cgcgacctcc ggcccattgt cgggctcgtt     15960
     ccagatgtcc caggccagca cgcgccggtc ctgtccgaag cggccgacca cgccccgcac     16020
     ataatcctcc agccgcgcat gctcgtccgg attccggagc acggcgacgc ctggagactg     16080
     gacccagccg ctattgtgaa ccccctcgcg cggctggggc tgtggcccca gcgccggttc     16140
     gggatgccag caggaatcga acagcaccag catggtgcgg atgccatgac ggtccgccac     16200
     cgcgaggaag gcgtcgatgc gcgccaggaa ggccgcggcg tcgtccagcc acagcaggtc     16260
     gtgcagatag accctgacgc tgttcatccc caccgaggcc gccagttcca gctcgcggtc     16320
     gatggtggca aggtcgaagc tgcccgcctg ccacatttcc agttgattga tggcgttgga     16380
     gggcgtgaaa ttgcacccga ccagccatgg ttgccgcgcg aaccagcgat gcgccgcttc     16440
     cggcgtccaa cgattgccca tatgcccgct caagacccgc ttctattgcc gccctgaagg     16500
     cggccattaa catcgctcag ctatagggca agaagattaa tatgatctga gtaagaggaa     16560
     atttcgatct tttgagaaga tattatagca cttcttcatt acacttacgt tatagtacgc     16620
     caatccgccc tttggttatg aagtcgaaat aaatgccacg gcgaaacgag cataatcgcc     16680
     aggccggaca tggtcttatg ccgcctgccg gatcatctcc cctggcagat gcgccgcgaa     16740
     atgatcgatg gccatggcaa gcgaatgcag cggcgccccc cggcggctgg ccagcgcggc     16800
     attggcgggc cgctccgccg tccagcccag cgtccggtgg ggaacgcccc ggatgcgcga     16860
     ggggtcgcag ccgcagctca tcgcgatccg gcgcgcgaaa tcggcccagg acagcgcctc     16920
     gccattggtc aggtgccatg gcccggcctc gccgtcgatc agcaggtcca gcgacgtcgc     16980
     gaccagatgc ggcacatagg tgggcgtcac gatcaggtcc tccgccgcca atatggtctc     17040
     cccgcgcctc agcgaccgca ccacggcgac cgcgaaatta tgatcgtcat ggggcgagaa     17100
     gaaggcggcg gtgcggatga tcaggtggcg accggacggg tgaggggcgc ccagcgcggc     17160
     gatcccttct tccatctccg ccttgctgag gccatagcag ttgcgcggcg cgaccggatc     17220
     gtcctcgaca tagggcgcgc ccttcttccc gtcgaagacg agatcgctgg agaaggaaag     17280
     cgacgcgacg ccgcgatccc cgcacgcctt cgccagcgcc acggctcccc gcgcattggc     17340
     gctcaggcag gcgtcccgcg ccgtttccgc ctcatccacc cggacccagc cggcggcgtt     17400
     gacgaccgcc cagggcgcga tgcggtcgag cgcggcggcg accgtctccg gcgccgtcag     17460
     gtccagttcc gcccgcgatg tcaggatgaa gggaatgttc cgcagcgcgc aggcccgcgc     17520
     catcgcccgg cccaacgttc ccgtcgcgcc gcatatcagc agcgggcgga ccgaagagag     17580
     atggtccgaa caaggacggg ccgcagagtt atgcgaacgc ccggccagat gcgccttcat     17640
     cgatgcgggg cgggcgaccc ccggatggac gatccgcacg gggcgctgcc accagcccgc     17700
     gccatccgcc agcatcgggc gctcaccccc gcgggccagc gcctgcgcca gcggcagcag     17760
     cgccgtggcg cgcggcgttc cgctgctgac gtcccacagc cccggctcat aatgacccgg     17820
     ctgcgtcagc aggctgttcc accccgaact gcccagcagc gaccagaggg tgacggcctc     17880
     gacctttatc ccctcggcgc acaatcggct cgcgacgtcc caggcctgcg cgatccagcg     17940
     caactgctcc tcccgcgtgc agccattatg gacctccgtg acggccagcg gccggccata     18000
     gcgggtccat gcctcgcgca gggcgccctc cagcccctgg ggcggcggct ccagcacgcg     18060
     gatggcctcc acatcggcat agagctgcgt gtcgctgccg ccatggctat gcgcgggata     18120
     gcggtggagc cggtggtcga ggaagcggtc gctcgtcaga taatggttga tgccgatgat     18180
     gtccggcgga cagggatcgt cggcgatggc gcgcagcctg tcctgaaagc cgaagcccga     18240
     aaggcgctcc cacagcggat gctcgcgcgt catcatgccg cagagcagat cccagctcgc     18300
     ccagcggcgc agattgtcga acccggcctg ttcgcgaagg gatgcggtgg cgtagctgcg     18360
     gcccagatcg tcggtctgga tcagccgcgc ggcgggattg acccgccgga tcgcctgcat     18420
     cgacaggcga acggcgtcga tctggttcag cagcgccagc cagaaggacg gttcggaccg     18480
     atgatgcgga taccaatggc cgtacagggc ggaaaagcgg gcggtggtca gcggctcgtt     18540
     gaccggcgtc cagtcggcga tccacggata gcgctccgcc gccgcccccg catgacgcgc     18600
     cagcccggct gcgaaaccct cttccagcag gccgctatag gccgggccgc tgccatgatg     18660
     gaccagcccg gcgatgacgc ggatgtcaag gtcgcgcagc cgccccagcc gttcgtcggt     18720
     ccattgccag tcgcgctcgt ccggatggcg cgggctgacc ctctcccaca ggacgggata     18780
     gcggatcgcc cggatgccca gcatcgccag ccggtccagg tcttccgccc ggtcctgatg     18840
     cccggtcgcc cggacctggt cctggtaacg gtcgtggacg cggttcacgg tgcattccag     18900
     accaccccat agctgcggct gcatggtcat tccggtcctc cgttgcaatg gcgggcgcga     18960
     tgatcggtcg attatttggc tcgttgaact tcgatcaagt gaaaagcgga gaattgcgac     19020
     gtcccagcaa cctggatcaa tagaggacaa ggaacggacc gttcgccgtc gtggtttgac     19080
     caatgttcac accgcagaaa ggttgcgtaa tatggtccag acccagtctt ccccttggca     19140
     tgaatctgga tcaattccgt cgaacggcgc gcataccatt ctctgcttca gtcatctgcg     19200
     gtggaaattc gtctttcagc gtcctcagca tctgatgagt cgcttcgccg cccaatcccg     19260
     cgtcctcttc tgggaagaac cctgccttgt cgaaggcctg ccggagccgg acctgcatat     19320
     cgacgtctgc gccaccagcg gcgtcatcgt catcacgccg caactgccgg ccgacggcgc     19380
     gcgggaagag gatggcgaga attcgaagcg cctgctcgac ctgttcctga cgggcgaatc     19440
     cggcccgttc gtgcgctggt actacacccc catgatgctg cccttttcgg aacatgtcat     19500
     ggctgactgc atcgtctacg actgcatgga cgagctggcc aatttcaagg gcgcgccgcc     19560
     cgaactgctg ccgctggaac agcgcctgct gtcccaggcc gacctggtgt tcaccggcgg     19620
     ctacagcctt tatgaggcga agaaggaccg gcatggccat gtctatccct ttccctccag     19680
     cgtcgatgcc gcgcatttcg cccaggcccg ctctgccccg atccggcgtc cggatgacgc     19740
     ccgcccgcgc ctgggctttt acggcgtcgt cgacgagagg atggatgtcg aactgctggc     19800
     ggcgctggcc gatgcgcgcc ccggctggga tctggagatc gtcggcccgg tcgtgaagat     19860
     cggcgaggcg gacctgccgc gccggcccaa tctccatttc ctgggcggcc gttcctatga     19920
     cgacctgccc ggctgcgtcg cggactggga tgtggcgctg atgccgttcg ccatcaacga     19980
     cgcgacgcgc ttcatcagcc cgacaaagac gcccgaatat ctggcggccg gaaagccggt     20040
     cgtgtcgacg cccatcgccg acgtcatccg ccattacgga cagatcgagg cggtgcggat     20100
     cgcggagcgc ggcgacgcct tcatccgcgc ctgcgatgcg gcgctggccc tttcccgctc     20160
     cggcggcgac tggctggcgg aggcggacaa ggtgctggcc ggcatgtcct gggacaagag     20220
     tttccagcag atgagccgcc tcatcaggga agcgatctcg cgcggcgccc atgcccatcc     20280
     catcgtgtcg cccaccagtt ggaaaagcgg cccgtcgcgg cattatgacg cgatggtcgt     20340
     cggggcgggc ttcgcgggcg ccgtcatggc cgaaaggctg gccgccgacg gcggcaggaa     20400
     ggtgctgctg gtcgaccgcc gcccgcatgt cggcggcaat gcctatgacg agctggacga     20460
     tgccggagtc ctcatccacc gctatggccc gcacatcttc cacaccaatt cgcaggagat     20520
     attcgactat ctctcccgct tcacccgatg gcggccctat gaacatcgcg tgctggcggc     20580
     ggtggacgac ctgctggtgc cgatgccgat caaccggacc acgctcaact tgctctatgg     20640
     cctggacctg gcgacggagg aggatgccgc cgccttcctc gctgcgcagg cggagccggt     20700
     gtcggtcgtc cgcacttcgg aagatgtggt gatctcggcc gtgggacggg aactctatga     20760
     aaagttcttc cagggctata cgcgcaagca atggggtctc gatccgtcgg aactggacaa     20820
     ggcggtgacc tcgcgcgtgc cgacgcgcac cagcaaagac gatcgctatt tcaccgacag     20880
     gttccaggca atgccgctcg aaggctatac gcgcatgttc gagcggatgc tggaccatcc     20940
     caatatcgac atattgctgg gggtcgacta ttgcgaggcg cgcgacgcct atccgcacga     21000
     tcatctggtg ttcaccggcc cgatcgacga atatttcggc tatcgctatg gcaagctgcc     21060
     ttaccgctcg cttaggttcc ggcatgtcag cctggatgtc gaccgatacc agccggtggc     21120
     ggtcgtgaac tatccgtccc ccgacgtgcc gcacacccgg atcaccgaat ataagcacct     21180
     gaccgggcag caggtgccgg ggaccagcat cacctatgaa ttcccggcgg cggagggcga     21240
     cccctattat ccgatccccc ggccggaaaa ccagcaactc ttcaaacgct atgaagcgct     21300
     ggcgatggcg cagaccgacg tcaccttcgt cgggcggctc gccacctacc gctattacaa     21360
     catggaccaa gtggtgggac aggcgctggc gacctatcgc cggatgacga agacccccgc     21420
     catccgcacc gtgcccgccc acctcgccgc cgccgcgcag ccccgccctt cggcggggtg     21480
     actcaccaag ctggaaagga tcgacattga agcggccgat ccgatgtagt cggatcggcc     21540
     gcttcaggcc tttgttttac cgccttttcc gagccagccg atgatcctat cggcttggaa     21600
     acctaaagcc cgctgtcgta acgcgccatc tcctcctgat agcgcgcggt catccgttcc     21660
     tgatccgccg gcgggatttc ctccttcagg tgaaggaagc ggtcattttc ctcttcatag     21720
     acatgatggg cgaccgcgcc cttgatatgc tccagctttt cgccccaatc gtcgctcagc     21780
     ggatcgagcg cttccagcag ggcgagctgg accttggcgg cctgctgctc ctcataggcc     21840
     atcgccatat gcgtcttatg gtcgtgcgaa agctgcgggt agatgaccgc ttcctccgcg     21900
     ctggaatggg ccgtcagcag cgcggcgagc tttcgctggg cgcgcgtgcg gctggacgcg     21960
     tccatcgccg cctccgcctc gctgaaggcc atttcgatct gctggtgatg ctggaggatc     22020
     tggtcgagcc agtctcccgc cccggccgcc gcccgcgcct tctctcttgc gcgggcgcgg     22080
     tcctcttccg attccggcgg cgtgacggct gcgacgaacc tgtcgatgac ggacatggga     22140
     ttctcctctg ctcatgggcg tgactcccat gcaagcgcgg caccgcgctt ccggttcctg     22200
     aacggcggac caaagcggaa ggccgctaac acaggtttag gggcgtcccc ttcaatagct     22260
     gccgttcgtg acgacgatgc tggcgctgac cgtgggggag ggcatgggga tgaaggtcgc     22320
     gtaacgcatc atcggactgc cgctcatgtc atagctgacc cgcacccgga acgtcccggt     22380
     cgcatcaggc cccgccgtga ccatcggccc gccgcccgcc gccagcaacg cgccatatcc     22440
     gtcgaccacc gcccgcgccc ggctttgcgc cagcgccgtg cgttccgtgg tggaaagccc     22500
     cgccacggcg gcgcgagcgc cctcgaccgc ggcatggcgc acgcccatca gcgcggcgaa     22560
     gtagaaggaa tagagcacga ccgcgaagac cagcatcagc agcgcaggcg ccagcagcgc     22620
     gaattccagc gccgccagcc cccgctcgca tgtccgcagc cgcagcgccg gcatcgcgat     22680
     cagcccggat tgacgctgtt gaacatcgtc gtgaaggcgg tgccgagctg cgtgcggaaa     22740
     ttggcgccga ccgcgacgat ggcggcgacc accaccgcgc ccagcacggc atattccaca     22800
     gccgtcaggc ctttttcatc ccgcgccagt ttcgcgatca gcgaacctaa aaacttgttc     22860
     atccttgtcc tccaatcccc tctgcaaaag accaacggcg cacgatgagg ggggaccgcg     22920
     cgccgccgtg aaaactcaca ccagcaccgg caccccgcag cgcgcgcctg tcgcccagag     22980
     cgtcgcatgg ccaagctgga cgcccagcgc ggcgagcagg tcggtgacca gcggatcgat     23040
     ggtggtgccg accagcccgg caatcggatt gaccaccgcg ctcgacaatt gcgaccgggc     23100
     gagcgccctg gtcgcgtcgc agacgatcgg caggcatgat cccagcaacg tcacctgcaa     23160
     cccgtcctgt ccgcccaggc tgcccaccag cgatgtcagc agcggcccga cctgcgcccc     23220
     attgccgatg ctggcgggcg tgccgggcga tccgggacgg cctatgctgc cctgcccgcc     23280
     ggggccgaag acgagggcgc cgctcgcgcc catgaccggc tgcgccaccg cgcggctgtc     23340
     caccgtgacg acgcccagca cattgacgat ccggaccgaa cgcacgtcgg cggcggacag     23400
     gggcggcatc ggccgcgtca tggcgccggc gggcaaggcg ccgatatagg cgttgacgag     23460
     accgctgccg gcctgcaccg tcacccgcgt gtcgcgcgcc tgttccgccg tgtcggggca     23520
     atcgatggcg ctgacctgcc cctgcgccgc cgcaatgtcg atcgtgaccg gcagtttgac     23580
     gacgatcagc ggaacgccca gcaggctgac gttcctgatc ccgacatcca gttgcagccg     23640
     caaggcggac gtggaaacgc tggtctcccc cgccggaccg aaggagaagc ggggccggtc     23700
     catcggcccg gtcgccatcg ccgccagcag gacgctgctg cccggcgcca cggcgccgat     23760
     cgcgtccgac aggtcgaccg cgccattgcc ggcctgcacg gcgtaggaaa agagctgata     23820
     ggcattgatc ccggcgcgca gggccggttt ctcgtccgcc ccgccgaccg gcatgttctt     23880
     ccacacgcca aggccgaaca ggccgttgag tggcaccgca tgaccattgc cgacctgccc     23940
     ggcgagcagg ctcagggtcg cggcggtcgc gctgtcgtcg gccgcgctgg cggcggcggc     24000
     gagcaagtcc cgaagcccca cggtgcgggc ggtgagcgca ccataggtgc cgctctcccc     24060
     gacccgctgc gccagcgcat cgaagaacag gccggcatcg acattgctcg ccatcagcgc     24120
     ctcgacatcg gcggcggaga ggcgcagctc gatgcccagc agtgcgccca gcaggtcgtt     24180
     gacgctgttc accagcgcat ttgtgacggt cagcacgccg gaactgatgc cgatccccgc     24240
     ctcgtcgatg cgggccgccg tggcgctggc cgacaggtcg ggcaggggat tggccggacc     24300
     cagcacgcgc atcaggaact ggcgcgccgg cttcccggtg cggatgcgca cggcattgac     24360
     ccgcccattg ccgggacaaa gcgccatgct ggcgtcgaag cgctgcgcgg cgcccaaccc     24420
     cgcatcggcg caatagcggc ccagttcgac cgatcggaga atagccggat catatccgtt     24480
     gcggctcagg ctgtcccgcg cccgcgcggc cgcctgagcc ggattctgcg cggcggccag     24540
     cgcggccgca tcggtcgccg cccgcagatt gcgctggccg acataataaa gcccgccatc     24600
     cagcgcgaat cccgccgcgc cgatcaacac cgcccccaat gccgcgaaca tcggcgcgac     24660
     tgcggcggat cggtcgccaa gcagcgggcg aagccaggcc cgacgaaaca cggggcgcct     24720
     cgatcggatc atcgcgcccc atccaccgcc cgctcgaccc gccggccgat ggactccaga     24780
     tagcgctgcc ggatgaccgc ggcctcctcc gccgacagtt cggcatcctc gcgcaccggg     24840
     gccttcaact gtgcctccac cacccgccgc gcttcgccca ccggcaccgg cgcgggcgca     24900
     gccgccatca gcaacagcac taccatctca gcctcccttg ccgatccgcg ccgcttccgc     24960
     cgccagcttc tgccgcagcg ccccgtctcc cgcccggcgc aacccggcct ccgcctcgtc     25020
     gcgccgcccg cccatgatca gcgccagcag caggttgttg cgcaccaccg ccagttgcgg     25080
     cgccagatcg ctagccccgc gcaacgcctc tatcgccgcg ccgatccgcc cggctcgcaa     25140
     cagcgcatag cccagcgcat tgcgcggcag cggatcggcc gggctcgccc ggctcgcccg     25200
     ctcgtaacag gcggccgcct cgtcccatcg cccccgcgcc gccagcagat gcccgcgcac     25260
     cgcgctgacc ccgccgctcg ccgtttcggg cggcagggcc accgcttccg ccgcgtcgat     25320
     ctgcttgagg tcgagcaggc tgttgacccg caacagccgc gcctcggcat cgccgggata     25380
     gcgccgttcg aaatcgtcga gataggccag cgccgcccgt ggccgcccat cggcccgcgc     25440
     ctggtggatg agttgcagat acagcccgcg cgtgtccggc gcttcctccg cttgccccgg     25500
     cgcggccgcg atcagcatcg ccgccagcat caaccgcctc attgcgacac cccccgcaaa     25560
     gtatcgaaga tcgccaccac cggcggcccg cccagcacca cgaacagggc gggcatgaag     25620
     aacaggatca tcagcacaac catgcgcacg gtgatgccgc ccatcgcctc ccgcgcattg     25680
     gcgacgcggc gctgggtgaa ctcccgcacg aattcgcgca gggcaggggc cagctcgacc     25740
     ccctggaaca gcgcctggcg gaacagcgcc gccagttcct tcgccccgtt caccgccacc     25800
     cgcgccgccc agcggtccag cgcctgctca tagcgcatgc cccggtcgag atcggcgacc     25860
     agcatcgcga tcagccgcgc atgatgcggc accgcaatgg cctcgtcccg cgcaatcgag     25920
     cggaagcact ggtcgagcga gatgccgctt tccagcatca tcagcatcag gtccagcagg     25980
     aagggaaatt ccgccatgat cgcccgcgcc cgccgcgccg cgagcagatg gatcgcctgc     26040
     ttcgccccga cataggtcag gcccgtgacg atgacgacca acaagggctg ggcaaggaat     26100
     ccgccccagc cgatccgcga aaccagcatc gccgccagcc ccgcgccgac ggtcgccgcc     26160
     atgcgcgccc agacgaacct gtccgccgcc cgcgcatcct ggaaccccgc cagcatcagc     26220
     ttgtcggcaa tttccgaccg atcccgcccc cgcgccccga aggctgcggg caggcggaag     26280
     cccggccggt cgcccgccat gcccagccgc gcctccagcc gccggtcggc cagcagcatc     26340
     cgcatgccca tcgcggcgca ggcgacgccc agcgccgcgc aaaggaggaa cagcgccccc     26400
     atcagaaggc cagcctcatc acccgccgca tcaccagcat gcccatgccc tgcaagacca     26460
     gcgcgaccac cgccagccga tgcccacgcg gatcgcgcag gaagaagtcg atataatcgg     26520
     ggttcatcgc caccagcacg gccatcgcca ccagcggcat gacgatcagc acccggccgc     26580
     tgatcttcgc ttcggaaatg gcggccttca gctcgcgctt gatgcggatg cgctcgcgca     26640
     ggatgttcgc caggttcagc agcaccgccg aaatcgaccc gccatagcgc atgttcgtgc     26700
     ggatcgcggc ggccagcatc gatatttcag gaacgcgcag ccgctccgcc agcacctgca     26760
     tcgcatcggc caccggcgcg cccagctcca gccgccttgc gaccggcgcg atatagctcc     26820
     gcaccacggc gggcgcgtcg gccagcgccc ggtccagcgc ctgcgccagc gaattgccga     26880
     ccgcctgcat ctgccgcacc gcgtcgatat aatagggcag cgcctcgatc agcgcttcca     26940
     cgcgccgctg cgcccgccgc cgcacccagc cgatcagcgc caccggcacg cccgccgcca     27000
     ccgccagcgc cgccaccggc cccgccgcca gcagggcgaa cagcgcgatc agcagcagcc     27060
     cgccgccgac catgcccagc ccccgcgccg tcacgtcgat ctgcgcctgc gccagcagcg     27120
     gcgccatcct gtccggcgcc gccagcaccg ccgggcgcgg catggccgcc gtcggggtca     27180
     gtcccagccg ccggtcgatc accgcccgct cccgcgcctg atcggccagc aactgccagc     27240
     cgattcccat caggatcatc agcgacagca tcatgaaggc cgccccgctc agcacggccg     27300
     attgccccga taatcgcgca gccgccccgc gaaaaagggc cgcggcgaca acgtctgaaa     27360
     ctcgccaagc cccgacagcg caggttgctc ctgaaaggcg aacagttcgt tcagcgaata     27420
     ggcctcgccc tccagccccg tcacctcgct gaccgacatc acccgccggc tgccgttgga     27480
     cagccgctgc aactgcacca ccacatgcac gctgttggcg atgaagcgcc ggatcgcccg     27540
     cacgtcgctc tgcaccccgg caaagcccag cagcatctcc agccgggcaa aggcgtccct     27600
     cggactattg ccgtgcagcg tcgccatcga cccgtcatgc ccggtcgaca tggcctgcaa     27660
     catctccacg gcctcgacgc cgcgcacctc gcccaaaatg atccggtccg gccgcatccg     27720
     cagcgcgttg cgcaccagtt cgcggctgct cacctcgcgg ctgccgtcca ccgtcggcgg     27780
     ccgcgtttcc agccgcacca catggctctg ccgcaactgc agttcggcgg cgtcctcgat     27840
     ggtgatcagc cgctcgcgat ccccgatgaa ggtcgacagc atgttgagca gggtcgtctt     27900
     gcccgcaccc gtcccgccgc agatcaggat gttcagccgc gaccgcaccg ccgcgctcag     27960
     ataagccgcc atgtccgcgc tcatcacctg gccggcgacg cagtcctcga tggtcatgct     28020
     ctgcaaccgg aatttgcgga tagagagcgt cggcccgtcc agagccaccg gcggaatgac     28080
     gatattcacc cgcgacccgt ccgccagccg cgcatcgaca taggggctgg cctcatccac     28140
     gcgccgtccg ataggcccca cgatccgctg gatgatgttc atgaggtgcg cgtcgtcgcg     28200
     aaagcgcgtc tccaccttct ccagcaatcc gccccgctcg gcatagacat gccccggccc     28260
     gttgacgatg atgtcgtcca ctcccggatc gcgcagcagc ggcgccagcg gccccatgcc     28320
     cgccacctca tcctcgacat cctcgatcag cagcagccgc tccgcgctgt tcagcgccat     28380
     ctgcccacgg cggctgcggc tggagatgac ctgctctatc tcctcgcgca gcgcccttgg     28440
     ccccagcgtc tccgccgtct cgccccgcgc ctccagctgc tcgatcaact gggcgcaggt     28500
     ctgcgccttg gcgagctgat agatgtcgct catccgttgc gcggcgggct gggcgacggg     28560
     cgtgatccgc acctcccgcg ccggaatgaa accctcttcc ccggtcagca ggctcatgac     28620
     gcacgctgga cgacgcgcag catcgccccc cgcagccggt cgatcccgcc aggcttcggc     28680
     gcgatcccgc aaagccgccg gatcgcggcc atataggccc cgccatccgc ctccatcgcc     28740
     atcggccgcc cggcgttcag cgcattgcgc atccgcgccc ggtcgatggg cagcgccagc     28800
     gccgcgccga cgcccagcgc atccgccatc cgccgcccat ccagcagcac gccgggcaga     28860
     tgatcccaca ccagcagccg catcgcctct atccgctcgc gctccgtccc gatcctgtcc     28920
     agcaagcggc ggcacgcctc gatctcgcga atggtctggc cgcagagcaa ttccacccga     28980
     tccgcctccg ccgccacctc gcgcagcagc ccgccatggc gcaggctgcc cgcattcagc     29040
     accacatgcc cgcaacagcc ccgcagcagc cggatcagcg cggccaggtc gactggcgtc     29100
     agtcccgccg gttcggcccc ggtcccgccg tcgaaggtca gcagcatcac accgctcggt     29160
     tcatgccgcg ccaccgtgct ggccagcagg ctggcgtcca gccggtccat gtcgccgata     29220
     gcggaggcca gcccataatc gacgaccagg tccagatagc tcgcggccgc gctcgtcggc     29280
     agggtgcagt cgatcagcaa cgtcgatccc cgcgccgtcg tggcgacggc catatcggtc     29340
     gccaccatcg cgcaggcatc gcggtccgcg cccagcagca gcgtcagccg tccccggccg     29400
     ccccggtccg cgaccgcctc gttcaacagc cgcgccaata tgggggcgat ctccccgcgc     29460
     tgcccgtcgc gcggaacgac gtcatgcacg ccggcgcgaa tggcgcgcag caacggctcg     29520
     gcctccatct cgtcggtcgc cagcaggacg ggccggccgc ccgcgtccgc caccacggcg     29580
     ccgatcgcga ccgacagggc gcgctcgggc ggaatggcgg cgcggtcgat gacgatcagc     29640
     gccagcccgt ccagcgcctc gcgctccacc gattgcgcca gttcgaccgt ggcgcggccg     29700
     cccgccgctt cctcgatgcg ctgcgccagc acccggtcga ccgacagcag aaggatcttc     29760
     gccatgctca ccgccgcacc acgccgaagg gcgcgctgga ctggtccagc ccgtccgtgc     29820
     ccaaaatcat gtcgcctatg ccggggtcga tccccgccgt cgccgcgccg ggcaagggcg     29880
     gcacctcctc cggcttcatc ggccccacca gccggggcgt cgcgacgatg atcagctcct     29940
     gcttctcctt ctggttctgc tgccgcttga agaaggcgcc cagcaccgga atatcgccga     30000
     aaaggggcgt cttctccttc gtcaccgtct ggctggaata gctaagcccc gcgatgacga     30060
     agctctgccc gctgcccagt tcgaccgtcg tctccgccga ccgccgccgc agccccggca     30120
     cgacatagcc ctgcaactgc acgccattat tataatcgag ttcgctgacc tccggcgcga     30180
     tcttcagcac gatatgatcc ttcgacaaca cgaagggcgt caccgataac cgcacgccga     30240
     attccttata ctggatggac agagtattgc ctgatcccga aacctgcggc accggcaccg     30300
     gaaactcgcc cccggccagg aaactcgcct gctcgccgga tcgcaccagc aaggtcggct     30360
     gcgccaatag ctgcgacagc ccgttggagg acagcgcgct caacaccgcg ccgatccccc     30420
     gattgggcgc ggaaaggaac aggttgaagg cgttttggat cggcgcgctc gcctccagcg     30480
     ccagcccatc gggattgaag gacgcgctcc ccaggctgct gggcgaaacg atggccccct     30540
     gaatatcgcc gctgagcttg gagaagttga agcccagcgc cttgagcgtc gtcgcggaga     30600
     ccgccgcgaa ctgcacgtcc accgccacca cctgctcgcc cgccctgacg atgggcgcgc     30660
     tcgccgccgc atcgggcgcg acgctgaccg gctcccgggc catcagtccg ccatcgccgc     30720
     catagacgct gacggtcgcc gcgccttcgc caatcgccgt cagccgcagc gaccgggcag     30780
     aaggcgcggc gatggacaac acgccctccc ggtccacctc gacccgcccg atggcgcggg     30840
     gataggaaag ggtgcgctgc tccttcacct gcaacgccgt ctgcgccacg gtggcaaggg     30900
     gcaggcccat cgcgatcagc cccaatccaa gacgcgcccg ctgccaacag cccgaaatcc     30960
     tcacttcgcg ccactccccg aatagatggt ttcgcgccgg ctccccacga ccagttcgat     31020
     ggcatggggc gcaggacgcg ccgtcgcgcg gggcgcggga gccgtcgcca ccggcatcgg     31080
     cgcgggcgcc gccaccggct cgacccccgc cgaagccgcc acggccaccg cgacctgcgc     31140
     gctgtccgcc ggattgcgca gcgacaaggt cagcgccccg atattcttcg ccagcgacag     31200
     gatcgacacc tgctccggcg tcaacgccag cgtcactgtc cgcgccggcg ggggagggga     31260
     ggagagcgcg ccttccacgc cgccattggc tcccgacgcc tgctgcgttc ccaccaccac     31320
     ctcgcccacg gccagcacct gcaccatctg gagcagggcc tgcgcccggc tgcgtcccga     31380
     tccgcgcgcc ccgctgatcg cgtcggcgcc gggatagacg acctgcacgt cgacccggtc     31440
     gcccggacgg atcaggccgg cgacggcgat ctccgccgtg gtgtcgatgc tgattgcgcg     31500
     catccccatc ggcacgcgga tggcaagctt gctctccatc cccaccgcat cgcgggcgat     31560
     caacgcatgc aggcctatgt cccgcgtcgc gaccttgccc accacctcgg cggatgtcgc     31620
     cgcataggga tagcgcgtcg gatcgcccgg cgcgttgcgg atcatggcgg ccgtgatcgt     31680
     ctcccccgtg cggatcgcgc gggccgcccg caccagcagg acaggcgcgg ccaccctgac     31740
     gggcgcggcc tggccctgca ccgtcgcggc ggaagcgttg cgcaattcgc ggacgcccag     31800
     cgccagaaaa gccgaagcgg aggtcagccc gacggcgatc gtcagcttgg ctttcgaacc     31860
     cagacgcatt gctttccccc aacggcgctt tgcgtgaacg caaaagcgct tcaaccgggg     31920
     gaattcataa ccctggcgct gttgtcaggg catgaaagaa gcaaccgtta cggtgcaaag     31980
     cgcttgcact ggcaaatggt ggctttgcgc aggaacgcca gatgttttca ccgatttcgc     32040
     tcacgcaaaa gccgctggaa gccacgatga ttgatccaaa tcggcgacaa ttaccgcggc     32100
     ctccctcccc acgctgcgcg caaggagggt ccagcgtcct ttcatgaccg ttccccgccg     32160
     ggccttgcca cctcaggcgt cgaccgaaat caccccgcgc ctgatctgat ccaactcgat     32220
     gctctcgaac aaggcctgga aatttccatt cccgaagccc tcattgccct tgcgctggat     32280
     gatctcgaag aagatcggtc caaacatgtt ctcggtgaag atttgcagca ggattccctc     32340
     gccattctcc accgatccgt cgatcaatat ccggttccgg cgcaatctct ccaaatcttc     32400
     tccatgccca ggcacccgct tgtcgaccag ttcataatag gtctcgatgg tgtcctgcaa     32460
     ccgtacgccc cgcgcccgca acttctccac cgtctcgtag atattgtcgg tggtcagcgc     32520
     cagatgctgg atgccctcgc catgatattg gcggatgaac tcctcgatct ggctcttgtc     32580
     gtcctggctt tcgttcaggg ggatgcggat cgccctgtcg ggcgcgatca tcgcctggct     32640
     gaacagcccg gtcgcctgcc ccttgatgtc gaaatatttt tgctcctcga atccgaacag     32700
     cgtccgatag aactggctcc acacccgcat ctgcccgcgt cggacattat gcgtcagatg     32760
     gtcgagcagg tccaagccga catcgttctc cgccgccgcc tgccgccagc cgggaaactc     32820
     cgcccaatcg gcataaaggt cttcgccgtc cttgatgaaa tagagatagg aaccgccgat     32880
     cccctggatg acggtatcgt cctcgtccgt cggcctggcg ccgtgctcca gcgcccattg     32940
     catcgccgcc tccggatcgg ccacgcgaaa ggccatggcg ctcgccgacg ggccatgctc     33000
     gccccggaag gccgccaccc gcccggcatc gtcgcggttc agcatcaggt tgatgcgccc     33060
     ctgcttgtag cgggtgatgt tcttggtcgg atgccggtgg ctggccacga agcccagttg     33120
     ttcgaactgc cgccccatgg cttcgggatc cggcgatgtg aattcgacga attcgaaacc     33180
     gtttaggccc agcggattga tgatgtcggc catgaagcca atcctctcga ttatggttgg     33240
     ggttaccgcg tcagcatggc attttggcgc gggcgtgatc ctggctgccg cgatgataga     33300
     cgcgatcctg cgccagcacc gcatcgggcg ccacgtcgct ctccgtctcc aattcgcgat     33360
     agatcggccc gaagtccaca tcggacgtct tgcgcagaag atcctcgaaa ctgtcgatga     33420
     cgaaatagct ctgctgataa tcgtcgatgc gatattgggt ccgcatcaac cgcttcagat     33480
     cgaaaccgat ccgattgggc gaagcatcct ccagcgcgaa caccgactcg ccgaaggacg     33540
     aaacgatccc cgccccgtaa agccgcaagt cgttgccatg ccgcatcagc ccgaattcca     33600
     ccgtatacca gtaaagccgc gccagatgat cgatcgaccc cagcccgtcg gcgcgcagcc     33660
     cgccctcgcc ataggcctgc atataatcgg caaaggccgg atgggtcagc aaaggcacat     33720
     gcccgaacac gtcgtgaaac acgtccggct cctgcagata gtcgatctgt tcgggcctgc     33780
     ggatgaaccg ccccgccaca aaccgccgat tggcgagatg ttcgaagaaa acccggtccg     33840
     gcaccagtcc cggcaccgcc accacctgcc agcccgtgcg cttcatcaac cgttcggaca     33900
     attcggcgaa gtcgggaatc cccggccgcg tcatccgcaa tatgtccagc ccctccagga     33960
     attccggcac cacccgcccc ggcagcatcg cggcctgccg ttcgaacagc cggtcccaca     34020
     tggcatgctc gccgggcgta taggcagacc agtcctgcgg aaccgtccag tccgcagccg     34080
     cgccctcggg aggtgtcatg tccgcctgtg ccatgttcag ccttatccca tgttccgacg     34140
     gaaaaagggt ttcattctga cgcccttcat ggcccccaat gaaatggggt ggtcacatat     34200
     cggcggatta tgaaatctca tttctgcgcc ttgaacgccc agcgcatcgt ccccgccagc     34260
     gcgaaagccg ccgcccggac cagcggccgc gccacgacgg gcatggaaaa gccatgcatc     34320
     cgccgcgccc atccgggcag cagcgccacc gccgcctgca tcgtcatcgc ttgcgcgggc     34380
     atcagcccca gcgagggcgc aggctgccgc agcacgatcc gcgccacctc ccgcgtccgc     34440
     tccgtcacgg ccagctcgcc gcgaaagcgc gccatcagcg ccatcgcctc ggcccggctc     34500
     tccggcaccg gatcagcccc caaagcccgc gccaccagcg ccgcctcggc aaaatagcgg     34560
     tcctgctccg ccaccggcat gaacggctcg ccataggcca tccacgcgtc gagaaagctc     34620
     accgcctcgc agacatgcac ccaggcgagc agccagggat cgcccgccgc ataggccgtc     34680
     ccgtccgcca gcgtcccgcg cacatggtca tgcacctgcc gcacccgcgc gatcgccgcc     34740
     tccgcctcgg cccgttcggc ataggtggtg acggcgatga accgcgccgt ccgccgcagc     34800
     cgccccagca tatcgtcccg aaaccggctg tggtcccaga ttcccgccaa ggccgccgga     34860
     tgcagcatct ggagcagcaa tgcgccgacc ccgccgatca tcatgctggt gacgtcgcca     34920
     tgcacgcgcc ggatcaccga ccccggcgga tagagcgccc ggtccgaagc gacgaccggc     34980
     gcttctcctc gggcgctgtc atgaaacacg ccccgcacct ggcgcaccag caaccgccgc     35040
     accagatgcg aaggccgttc caccgacaca aatccttccc aagccttcgg cgcaggaagg     35100
     atctgtccta cccggccgcc atctgcgtca tggacgcata atccgtcttc ccggttccca     35160
     gcagcggcag agcatccagc acccggattt ccctgggcaa ggccagttcc gccacgccat     35220
     tggccttgcc ccaggcctgc aacgccgccg ccttcgcatc ccgcgcggtc gtgaacagca     35280
     ccagttgctc ccccttgcgc gcgtcgggcc gcgtcaccac ggcatggtcc gcatccggcc     35340
     agaccgcgga ggcatagccc tccaccgccg gcagggagat catctcgccc ccgatcttcg     35400
     caaagcgctt cgcccgcccc cggatcgtca cgaagccctg atcgtcgatg gtcacgatgt     35460
     cgccggtatc gtgccagccc ccttccggcg gttgcagcac gcccggcgca tcggccttca     35520
     tatagccggc catgatgttc ggcccccgga tcgaaagccg cccgccttcc tcgatccccg     35580
     gcacatcgtc cagccgcgcc tcgatccccg gcagcagccg tccgaccgat ccggcgcgga     35640
     aatgcatcgg ggtgttgacc gcgatcaccg gccccgcctc cgtcgcgcca tagccctcca     35700
     ggatgcgcag cccgaatttc tcggcataga tcttccgggt ctcgtcccgc acccgctccg     35760
     cgcccgcgaa gatgtagcgc agcgagtaga agtcatagcc atgcgccatc cgcgcatagc     35820
     ccgacaggaa ggtgtcggtc ccgaacagga tcgtcgcatt ggcgtcatag gcgagcgccg     35880
     gcacgatccg gtaatgcagc gggctgggat agagcagcgt cttcaccccg tggaagatcg     35940
     gcagcaaagt gcccccggtc aggccgaagc tatggaacac cggcagggcg ttcagcacca     36000
     cgtcggccga attgaagtcg atgcgcgccg ccaattgccg gcagttggac agaaggttgc     36060
     gatgcgtcag caccacgccc ttgggcagcc cctccgaccc gctggtgaac aggatcaccg     36120
     ccgcatcgtc cggcgaaacc ttgagccgcc ggtgcgcgcg cccggcaaag cggctggcga     36180
     tcagcccgcg cagcttcgcg ccggggccga tacccgccgc cacatcctcc agccagagga     36240
     aggcgatccc ctccgcctcc agccccgcga cgacatcgcc gagcttgccc tgctcgacaa     36300
     aggcccgcgc cgtcaccacc gtccggattt cggccgccat gcaggccgcc ttcaggttcg     36360
     ccaggcccgc cgtgaagttc aacatcgccg gcacccgccc gcctgcctgg agcgcgaaga     36420
     aggccaccgc caccccggcg acattgggca gcagcacgcc gaccgcctcc ccctgccggg     36480
     tcgaacgcgc cagcacgcgt cccagcacca gcgatcccgt caccagccgc ccataggtca     36540
     gcggttcgcg cttcacatcc tcgacgacgg ccgatccgcg cccatggaca tggctcgcct     36600
     ccagcagcgc ttcgaacaat gtcctgtccg tgtcggaggt cgcgaacatc atctggctca     36660
     tctcgtcata gagccgccgc ccggcgatag cgcgccgcgc ccgcgccgtc atctcgccct     36720
     ctatggcgaa gcggcggggc ggcagcacgg tgagcgtgat tcggggaaag cgccgcagcc     36780
     ggaccttgcc cctgaggcgg gaaaagggcg tgaactgcgc gccgtcgatc cgcacgggaa     36840
     tgatcggcgc gtcggccttg tccgcgacca tgccggggcc gtcaaacacc ttcatcaagg     36900
     cgccggtgac ggtgatccgg ccttcgggaa agatcaccag cgtccgccct tcgcgcaccg     36960
     ccttcaccat cgccttggcg gacagcggat tggtcgggtc gaccggaaag gcgtcgaaca     37020
     gcggcaggaa gggcttgacc caccaggccc tggcaatgcg cgtatgcacc gcgaaggtgg     37080
     gcttgcccgg caggaaggcc gccagcagca ggccatccag gaacgacaca tggttgacca     37140
     cgacgaccgc cggttcgccc gcgccgggca tattttcagc gccgatgacc tccacccggt     37200
     agcagagccg cagcatcccg cgcacgatgg ccttgatcac cgtctccggc agcagccagc     37260
     aactgatcag cgccaccgcc agcgtcgcaa agcccatcgc cccgatcacg ccgggcacgc     37320
     tctcgccgcg cgccagcatc gccgtcacca ccgcgacgac cgccaccgtg accgccgcat     37380
     tgacgatgtt gttggccgca atggtgcgcg accgctcctg ccgcgggctg tgcgtctgga     37440
     ggatcgcata gagcggcacg atgaacatgc cgcctgaaaa ggcgatgccg aacaggtcga     37500
     ccatgatccg ccagctcccc ggcgacccga cgaattccgc tatgcccgcg cccgaatgca     37560
     tgggcgcata ggagccggtc gacagccaca ggtcgatcat gaacccggcc agcgccagcg     37620
     cggataccgg cacgaagcgg gcggacacct gcccgcccag cagccggttg accagcatcg     37680
     accccagcgc cacgctgacc gagaagatca gcaggaagaa ggtcgcgacc tcctgcttcg     37740
     ccttcagcac cccgctcacc agcggcgcga actccgccag caataccgcg cccacggcga     37800
     agaaccagct tatccccagg atcgacagcc acacgccgcg cccatgccgc gccgccttca     37860
     atatatgcca ggtgctcctg aagatgttgg gttcgatgcg cagccccggc accaccgtcg     37920
     gcgcggacgg caccgccagg ctggccagga agcccaggat cgccaggccc accgccacca     37980
     gcccggcttc ccatggcggg atcaccccgg ccagcaactg accgctcaat atggcgagga     38040
     aggtgcctgc ctcgatcagg ccggtgccgc ccatgatctc gtcggtgcgc agatgctgcg     38100
     gcaggatgga aaatttgacc ggcccgaaga tggtcgaatg cagccccatc aggaacaggc     38160
     aggacagcag cagcggcacc gattccagcc agaatccggt gacggccagg gtcatgatga     38220
     cgatttccgc cgccttcacc gcccgcacca gcttcgcctt gtcccaggcg tcggccagtt     38280
     gcccggccag cgcggaaaac aggaaatagg gcaggatgaa caggcccgtg gcgacggtcg     38340
     ccagcatctc cgccttgtcg ggctcggccc gatagaggcc gaaattggcg aggaacagca     38400
     gcgcgaactt caacagattg tcgttgaacg cgcccaggaa ctgcaccacg aacaagggcg     38460
     cgaaacggcg tttacccagc aaagacagat caggtgcgga cattttctta cccccgtcct     38520
     tcacgcatta tgcagcaata gtcgcggagt tgttaatcgg ctcccgcaac aggcgattat     38580
     agagccatcc gatgccgatc aggctgaagc ccagggccag gaaggatgcg atccgcagca     38640
     gcccggtcag ccccgacgca tccaacagga acaccttggc cacggcgagc agcatcagca     38700
     gcagcgaagc gatgcgccag tctctggcgt tttcggcctg cgcctgcctg cggatgcccc     38760
     agagcaggaa gccgatggcg agcgccaatg cgagcacgga acggagaata tcctccacct     38820
     ggcccactcc gcgcacggtc agcagcgatc cgacgaaaag ctgccgcagc atcgccacgc     38880
     cgaacagcgc gatcaacgcc atgcgcaccc catcggcgat gcgccgcgac cagccgtccg     38940
     ccaccttcag cgcaacaaag gcaagggcca gcaccaccgg cagcagattg acgaagggcc     39000
     aacgccccac cgcctgcggg aaccagagcg gattgtgcag caccaccgaa taaaccagca     39060
     aatgccccaa tcctgccgcg acgaggcatg tcccgaccac gcgcgcccaa ttctccccgg     39120
     ctttccgcga cgggtggaaa tgggccggcg cgatccgggc ccccaacgca acgaaaccca     39180
     ggcctatcag cacagcttcc caaagcgtgc gctccgccag agcaaggcgc gtcacctccg     39240
     ccaggctgcc caaagcgaaa agctgcttga atgcgacatg cgccgccacc ccgccaagca     39300
     ccgccgcgac acagccgccg atccgtcgcc cgaccgcatc cacggcggaa ccgccccgcc     39360
     acaaggcaag gcccagggcc atcgccggca aggcgatccg ccgcgccacc tcgcttgttc     39420
     cgggcaagtc ccgcaccaac acgggttcac ccaccagcga cagcaacacc cggcccagcc     39480
     agatccccag gggccaggcc gcccaaagca ccaccagcgc caaggccacg cccagggcag     39540
     gcgccattcg cccgcccgcc agccgccgcg ctccttccgc cagcaccgcc agccccagcg     39600
     cggcgcccac cggcacccag ggcgttggca ccgcctgcgc cacggcccca taggcgagca     39660
     gcaccgccac gccctgcgcg accatccgtc cctccgcgaa gcgcgcccgc caggcgaaca     39720
     gcgccgccat tgccgcgccc gccgtccagc gcatcacgcc ctgccagccc ggcccatccg     39780
     cagcctctcc ccacagccgg acgacatcgt ccgatccggc cagaaccacc agcgcgccga     39840
     aggcgaagcc ccagccgctc cattcaaccc gccggtcctc cgccagcgcc gccagcttca     39900
     gcagcccggc cgcaaccgcg gcaatcacca tggccagagt ccattccggc agccccagcc     39960
     cgccggccac caccagcagc agcgccgcgg cgctcgccag cgtcacgaag cgcgcatcct     40020
     cccgccgcgt gccgcatcgc cagcccatcg ccatggccgc gccgggcaat ccggcggcag     40080
     ccagcgccag cagggcgaat tccccgtcca gcccgacccg ccagcactgc cccagcgcca     40140
     cggcaaagcc gcccagcgcc agccccgcga tctgccccgc ctcgaccaat ccgcctcgcc     40200
     agacccgcag cagggccgcg ccgccataaa tcgccgccat gcccagcatc accagggcga     40260
     agcgacccat ttccggctgc ggccacaccg ccgccagcag cagcgcgaca ccggcgccga     40320
     tcgccgccag cggccgcaag gccgcctccc gccccagcca caccagcata agcgacagca     40380
     gcccgaacaa tccccattgc agcaggccga agccgccggt cgccaccagc gccgccatct     40440
     ggcccgccgc caccacggcc gcgcccatgc gcagcagcgc ggcccgcatt ccggaaaagg     40500
     ccaggaccgg caacgccatc cccagcatca gcaccagcaa cccgaccgac agcgacgacg     40560
     cccaatccag cgcgcccatg gccagcatga cgacgcccca gccggccccg ccggccagcg     40620
     cgctcacccc cagccacatc cagcgctggg tgcgcgacag cacgcaaagc ccaccgaccg     40680
     ccagggcgag ataacagctc agcaggggca cattgggctg ccccgcctcg accagggcgg     40740
     gcgccgccag gccgccgacc agccccagca gcgcactcgg cgcgccaaag cgcagcgaca     40800
     gcgccatggc cagcccggtc acgcccgcaa gccccgcaaa ggcgatgccc ggcccgacca     40860
     gcccgtagag catgtgcgcc gccaggactg cggcatagag cgtcgccagc cccgcgcccg     40920
     ccagcgcctg ccgcacccgc gcatcgcgga cccgatcctc cagccgcaac gccgcctccg     40980
     ccccgccgat cagcgccccg ccgaacagca gccccagaac cacccgcacc agcggcgaga     41040
     gcagccccgc atcgatcgaa tatttgacca gcagcacgcc cgcgaccgcc agcgtcacgc     41100
     cgcccgccca gatcggcagg cgtcggccga acagttcctc gaagctgaag gaggggcgtg     41160
     cagggcgcgc gacttcgatg gcgatgcctt tcgcctcttc cccgcccgtc ccgccttcgc     41220
     tggattgacg gtcaacgatg accgcgctcg cggggggcgg agccgcggcg tccatgacga     41280
     cccgccgctc cacgacgctt gcgggcgccg ccggcctcgc ccgcgcatcg tcatccccgt     41340
     cttctgggac ggggcggtcg ggaagggagg gcgcatttcc aacaccccct tccagcagcg     41400
     ccaacctttg ctcggccgcc ttcaaccgcc cgcgcatgtc gaacagcatc accccaaaaa     41460
     ccagcagaac cagcgtcaca agcatgattc gaacccctgc acccagcaat gcccatcggc     41520
     taccgcaaaa ttgcacactg ttcaataaaa taattagaca gcgttcaatt gatcttctat     41580
     tcgcctctcc atgggcagac gatccgacca tagccgcgag gagctggagg cgctcatcct     41640
     ggaggagggc caccgccaca tggccgagtc cggtttcgcc aaattctcct cgcgagaggt     41700
     ggccaagcgc atcggctatt cggtgggcac gctctataat gtcttcggca gctacgaccg     41760
     gctggtcgcc gccatcaaca cgcgcacctt caacctgtgg gccgcctttc tggaacggcg     41820
     cctcgccagc cggccgcggg acaggatcgc cgcgctggtg gagggctatt tccgcttcgc     41880
     ttcggaaaac acgaacatct ggatggcgat ctacgaccat cgcctgccgt ccggcgtgcc     41940
     cttgccggag gaatatgccc ggcagcgcgc cggtctcacc gatgtcgtcg tgcgcgaagt     42000
     cgccgccgtg ctgccgccgg aatcccagga tgtcgctccg cgcctcgccc gctcgctggt     42060
     ggcgacggtc catggccatt gcaccttcgc gctcaacggc agcttcgccc ttttgggcga     42120
     gacggacccc ctcgaaatgg ccacggcgcg ggtcaaggaa agcttgaggg cggcaggggc     42180
     ggagctttaa cataggcggc aggcacggcg ggcggcaagc tggagacaaa agggggacat     42240
     atcatggcaa actggttcga cagcctggaa cgcgacctgc aatcgccgct tgccgtgcgg     42300
     cgcctgggca gcggctggtt ctcgggcttc ttcgcgctgc tgctcagcac caccgggctt     42360
     tgtctggtga tggcgctgcg ctggcccgac tggttcgcga cgcccgaact ggccgcgctg     42420
     cacgcctggg gcgggctgcg tcctctggtc catgcgctgc tgatcggcgg ctatgccctg     42480
     gcgttgctca gcctgctttt gcgcacacgc aaagccatcg gcgccaccgc gctcatcgtc     42540
     gcgctgctcg ccaccctgtt gggcggagcg gaagtccaac cgcgtgagac ccatgactgg     42600
     ggcgtgttct tcggcgtcga tttcttcgcc gtcaacatgg tcgccaccgg cctgatgttc     42660
     gcgccgatcg agcgcctgtt cccccacagg gcgcagcaac ggctgttccg acaggaatgg     42720
     cgggaagacc tgttctatta tctgatcagt tcgatgatgg tgcagctcat caccttcctc     42780
     gcgctggcgc cgtccagctt catcaacgcc aacaccgccg gcctggcggg cgtccgcgcc     42840
     atgatcgccg gccagccctg gccgctccag ttcctggaag tggtgctgct gaccgacttc     42900
     gtccaatatt ggttccaccg cgccttccac cgcgtcccct tcctctgggg cttccatgcc     42960
     gtgcaccatt cggcccggtc gatggactgg ctcgcgggcg cgcgcatgca tttcttcgag     43020
     atcatcgccc tgcgcggcgt gacgtccctg ccgctgctca ccttcggctt ctcgccatcg     43080
     gtgatgcagg cctatatcgg cttcgtctat atctactcct cgctgctcca cgccaatctg     43140
     cgcggcgatt tcaaccgcct cggccgcatt gtcgcgacgc cgcgcttcca ccactggcat     43200
     catgcgatag aggaggtcgc ggtcgacaag aatttcgcga tccacttccc ttttctcgac     43260
     cgcctgttcg gcacacatca tctgcccgac ggcgcatggc cgaccggcta tggcgtgccc     43320
     gaacaggtgc cccagggcta tcgcgcgcaa tttctctacc ccttccgccg aaagcgcgac     43380
     gcagccttgt gaatctgcta tggtcttccg gctgtcaggg gagtcggacc atggtctact     43440
     ggatgctcaa gggccgcgaa ttcgccaatt gcaactgcga atatggctgc aactgccagt     43500
     tcggcggcct gcccgacaag gggcattgcc aggccgcctt cggcttcgcc atcgatgagg     43560
     ggcgtcacgg cgacaccgac ctgtcgggcc tcaacatcgc agccgtcttc cgctggcccg     43620
     gcccgatcca cgaagggcag ggggaatgcg ccgccttcgt cgacgaacgg gcgacggaag     43680
     cgcagcgcaa cgccctgctg acgatcatga ccggcggcga caccgccccg atggcgacgg     43740
     tcttcgccgt cttcgcctcc accatcacca ccatgcacga acccagtttc gtccccgtcg     43800
     acttcgaggt cgacgtggaa ggacgcaagg gccgcctgcg catagcgggg catctggaaa     43860
     tggacggcga acccatccgc agcccggtgg acggatcgga aatccgcgcc cggatcgacc     43920
     tgcccgacgg cttcgaatat gaagtggcgg agatcggctc cggcaccagc cgctcgatcg     43980
     cgccgatgcg gctcgaccat gcggcgagct atggccagtt cgcctatctc cacctcgaca     44040
     gccacggcgt cgtcaggggc tgacgatgcc gatatggagc gtggtgcttg cccggcaccg     44100
     cttgatttcg cttgtcgcgc tcgcggtgct gatcctgctg gcctggggct ggctgctttc     44160
     aggcgcgggc atggggatgg ccctcaccgc ctccttgttt ccggccggcc tggcggaaga     44220
     cccgatggcg gcgatgatga tgcccggcga catgccatgg gcgatggcgc ggttcgtcat     44280
     gaccttcgcc atgtggtggg tgatgatggt cgcgatgatg cttccctccg cggcgccgat     44340
     ggtcctgctc tacgcccgcg ccgcgcccgc ctccacgcgc ccggcgacgg agagcttcac     44400
     cctgggctat ctgctggtct ggggtttctt ttcgctcatc gccaccctgg cgcaatggcg     44460
     cctggccgca atggcgatgc tgtcccccat ggcgatggcg acgtccagcc gcccgctggc     44520
     cgccgccctg ctgatcgcgg cggggaccta tcagatcagc ccgtggaagg atgcctgcct     44580
     gcgccaatgc cgcaatcccg cgcagttcct cagccgccat tatcggccgg gctggaccgg     44640
     cgcgctgcgc atgggcgcgc tccatggcgc ctggtgcgtc ggctgttgct ggatgctgat     44700
     ggcgctgctg ttcgtgggcg ggatcatgaa cctcgcctgg atcgcgttgc tgacgctgct     44760
     ggtgggtctg gaaaaactgc tgccatgggg ccgcgtcgtc tccgtggcga cgggtatagg     44820
     ctgcatcctg tcggcgtggg cgatattgat ggggtgacgg tttttggccg ccaggggtag     44880
     ttccgcgcct tccgctctca ttgaagcgca gcgtgcgcct catggccagg tctggccacg     44940
     ccatccgcca gcccctaggc cttgtccttc tccacgcccg cgtggaaggc gatcctgagc     45000
     gcttcggcca ggcttttcac ctccagcttc tgcatcaggt tggcgcggtg gatttcgacc     45060
     gtgcgcgggc tgatcgccag gtcgtaggcg atggtcttgt tcggcaaccc ttcgaccagc     45120
     ccgtccagca cctcgcgctc ccgctcggtc aggatgttga gccgcgcccg cgcatcctcc     45180
     gcccgcgcat tcgcgccgcg gtccgccacc gccatccgcc gcgccgcctc gacgcagccc     45240
     agcagcgccg ccttttcgaa cggcttttcg atgaagtcgc tggcccccgc cttcatcgcc     45300
     gtcaccgcca tgtcgatgtc gccatggccg gtcatgatca ccaccggcag catgatgcct     45360
     cgatcccgca gctcccgctg caccgccagc ccgtccatgt cgggcatccg cacgtccagc     45420
     agcacgcagc ccggctccag accggcggcc tctttcaaaa agggcaaacc gccctcaaac     45480
     agcttcaccg cgaaaccgct ggtcttcagc atgaaggaca gcgaccgccg gatcgcctcg     45540
     tcatcgtcca cgacatagat gggaaatggc tcgctcatcg ggctttcatc ctaatccacc     45600
     gcgtccaaag tgaagtgaaa ggccgtgccg ccccattgcg acggtccggc ccagatgcgc     45660
     ccgccatgcc cctccacgat ggtctggctg atcgacaggc cgacgcccat gccggacgcc     45720
     ttggtggtgg tgaagggggt gaagagcgtg cgcgacatat ccggcgccag ccccggcccg     45780
     ctgtccgcga cgatcacctc cacccggcca ttttcccccg gaacggcaga caggcgcagg     45840
     atgcgcgccg ggctgtccgc catcgcctcc acggcgttcc tggtcaggtt gatgatgacc     45900
     tgctgcaact gcacccggtt gaccagcacc ttgtcgacgc gggggtcgac gctgatgtcc     45960
     atgtccaacc cccggctgtc cacgccgatg aaggccagcg ccgccccctc cgccagcaat     46020
     ccgcgcagcg gttcgggctg gcgcatcgtc tcgccgcgct tgatgaactc gcgcagcgac     46080
     cggatgatct cgcctgcgcg caaggcctgg ttcgcgcttt ccgccatcgc ctcgcgcagc     46140
     agttcgcggt ccaccggctc cccggcgtcc agcatgtcgc gtcccgcctc cagatagttg     46200
     gcgatggcgg tcagcggctg gttcagttca tgcgccagcg ccgacgccag cgtccccatc     46260
     gccgtcaccc gcgacgcatg ggccagttcg gcctgaaggt cggccacccg ccgctcggcc     46320
     tgctggcttt cggtgaggtc acggatgaag ccggtgaaca gccgccgccc ttcatcctgc     46380
     acctccccca ccgacagttc gatggggaat gtcgacccgt cccgccgccg cgcgctggtc     46440
     aggcggccga tgccgatgat ccgcttttcc ccggtcgtca gataatggtg gatatagccg     46500
     tcatgcttct cccgatcagg agacggcatc agcatggaga tattctcgcc cagcacgtcg     46560
     ctttcggcat attggaacat gcgctgcgcg gccgcgctga acgacacgat cgtgccgcgc     46620
     atgtcgatga cgatcagcgc gtccgggacg gtcgccagga tggagccgag caacgcctgt     46680
     tccaggctgt gctcgcgctg cgtcaggcca tcggtttcat cgtccgctac cgccatgccg     46740
     acaccatgcc gtggcttcaa tgcgccagca agagcggaac atgcgcctcg cgcagcatgg     46800
     cgcgggtgac gccgccgaat atcatttcgc gcaaccggct atggccaaag gcgcccatcg     46860
     ccatccagtc cggcttcagc acgccgatgg cggccttcag cgacgcatcg atggtgcgcc     46920
     cgtcctgcgg ccatgtgtgc aactggcact tgatgccatg gcgggccaga tattccggcg     46980
     cgtcggtggc ggggaaggga tatttgcccg cttcctcgac cgtcacgaca tgcacctcct     47040
     ccgccagctt cagcagcggc acggacaggc gcagcgcggc ggatgcttcc tgcgaaccct     47100
     cccaggccac cagcgcgcgg cccgtgaccg gaaaggactt cgcttcctgc ggcacggcga     47160
     tcaccggaac ccgcccggcc agcgccaggt cggcggccag gtgcagcgga tctgcgaatt     47220
     cccggcgcgg cccggacggc agggtgacga tcatgccgtc ggtcagcgcc gccgcggaca     47280
     gcaggccatg gacgacatcg ccttccacat ggcgccagtc ccagctcaca tcctcgcggc     47340
     gcagccgatc ctccacgcgc atccgggcct tttcatcgat gtcgtaaagt tccgccatca     47400
     tcgccggggc catggacgcg cccccgtaca tgtcggccgc cacgaaatcc ggcatggccg     47460
     tcacctgcac gcaatggatg tgcgcgcccg atgcgcgggc aagatcgcag gcggcctgca     47520
     agcggctttc cgcgccacga tcttcatgaa tgtgcaacag gaccgatttc atcgtctgtc     47580
     tcccggcaag cgtctctttc ccttttggct aggactcccc cggcgcggtc gccatcagga     47640
     ataatcctta tatccctttt cggcgcggaa tccgattgca tggaatatga gttggacgac     47700
     catacgcctc gaacttgccc ggacgcccgc ctttcccaac ggatcggcgg cgcgaagcta     47760
     tgtgctgcgc ctgccgctgg gcagcggcgg cctgatcgac gaaagggaat atcgcatcca     47820
     tcccgaactg gcgacggcgc gccgtttctg gccgaacgag ccggaccggc acggcacgtt     47880
     gctgcacacc gggaatggtt gggccttgtc ctatgagcag ggcgaggcgg atgacgagaa     47940
     gatctaccgg ctggacgccc acgccatcca gcccggcgcc tatctgacgc tgaccgaccc     48000
     ggacggggaa tgcctgccct tcgtggtgaa ggggatgagt ccggcctgat cgcggcggcc     48060
     gcacttcgcc ccgcagtcgc tgccgcgagc ctggccggga gtcgatcttc gggaacaagc     48120
     gggttcggcc cggtcccagg gcgttgatgg cgctgaatcg agtcggcaga gccacccgcg     48180
     aaatgcaaat ctatactgct aatgacttgc aacatcctcc tcatttggct agcgggagtg     48240
     cagcctcatg ggggaatgaa tgcacatccg accgtctttc ctgctcgtca ccaccatgct     48300
     cgcgctgtcg agccggcctg ccctggccca gtccgaaccc gcgacccagt ccgaacccgc     48360
     gacccagtcc gaacccgcgg ccgaggccga gggcgcaggc ccgatcgtcg tgacggcggc     48420
     gcgcacgatc ctgcccgcca acgccctgcc gatgaccatc gacgtaatcg atcgggaaac     48480
     gctcaaccaa caggtcgcga tcggcggctc catcgtcgat gcggtgtcgg cgctgacccc     48540
     gtccttctcg cccacgcgcc agaagctgtc cggcgcggga gagacgctgc gcggccgttc     48600
     gcccctctat gcgatcaacg gcatcccgca aaccgcgccg ctgcgcgacg gatcgcggga     48660
     cggcttcacc atcgacccct tcttcatcga ccgggtcgaa ctgatctacg gttccaacgc     48720
     gctgcagggg atcggcggtg ccggcggcat cgtcaaccag gtgacggtgg cgccgcccca     48780
     gagcgacggc ctgtcgggcc ggatgctggt gcagggcaat gccgacaccg gctttcacgg     48840
     cgacggcgtc ggcggcaaga tcgcggggct gctcgcctgg cgcgccgggc gctgggacgc     48900
     gacggtgggc gcggcctatg agaagcgcgg cgcattctac gacggccacg gcaatcgcgt     48960
     cggcaccgac ctgacccagg gcgagacgca ggacagccga agctggtcgc tgttcggccg     49020
     cttcggctat gcgctcagcg acagcgcccg gctggacctg accatgagcc gcttccattt     49080
     gaagggggag ggcgactacg tcacgctgga cggcaatccc gccatcgacc tcccgacgac     49140
     ctccgtgcgc ggcaccccgc cgggcgtccc cgccaccaac cgcaccgaaa gcgcggcgct     49200
     gacgctcacc gacggcgacc tgtggggcgg caacttcatc gcccagcttt tcttcaaccg     49260
     ctcgcgggac acctatggcg gggaggttgc gcccatcgcc accttccagg atgcggccat     49320
     cgcgccggtc aacacgctgt tcgaccagtc gcagaaccgc agccgcaaat atggcggcaa     49380
     gatcagctat gaacgcgccg tgccgggttt cgaggcgctg accgccgttc tgggtttcga     49440
     tgcgctttac gatctgaccg aacagcgcct gatcgccacc ggccggacct gggtgccgcc     49500
     gaccgactat cgcagcctgg cgcccttcgc ccagctcaac ctggcgctgt tcgacaagaa     49560
     gctgcgcctg gcgggcggta tccgatatga ggatgtgcgc atccatatcg acgactatca     49620
     cacgctggcc tcctatcgcg gcggcttcga cgtggcgggc gggacgccga cctttcacga     49680
     caccttgttc aacggcggcg ccatattgga gccgtgggag ggcatccgcg cctatgccag     49740
     ctatgccgag ggctacaccg tccccgacgt cggacgcatc gcgcgcgccg tcgaccgggc     49800
     cggggtcgat atcgacaatt atgtgaacat cagccctatc gtgtcgaaca atcgcgagat     49860
     cggcgttgaa gtgaagcgcg gccccgtgga tgccagcgcg gcctatttct ggtcgaccag     49920
     caagaacggg tcgctgctgg tgcagcagtc ggtcggcgcg ccgttcgagg tgcaacgcca     49980
     gcgggtggag atacagggcc tggaactgaa cctgtcagtc aggacgccgc tgccggggct     50040
     gaccctgtcc accggctacg cccatctgat cggacgcacc gacggatcgg acaatggcat     50100
     cgacaaggtg gatcgcgacc tggacggcgc gaacatttcg cctgaccgcc tgaatgtcgc     50160
     cgccagctat gtgcatgggc cgctgtcggc gcgcatccag acgcaattct tcctttcgcg     50220
     ccagttcgaa cgcgaaccgg gcaaatatcc cgtgttatac aggttcgacg gctatgaggt     50280
     gaccgatgtg tcgctccgct atcagacgcg gttcggggcg ttgacgctgg cggcgcaaaa     50340
     tatcttcgac agattcacca tcgattatta cacgcaaacc gtccggccca ccgacaaggc     50400
     ccattatttc gcggggcgcg ggcgcaattt caccctgtcc tgggattatc ggttctagtg     50460
     aagctgatcg acgcccttca ccgctggacc ggcggactga tcgggctgct gctcgccctt     50520
     ctgggcctca gcggcgcgct gctggttcac aagaatgcct ggacgctggc gccccatgcc     50580
     ggcgacccgc gggtggagga tgtgcgccaa ctggcgcagg tgacgcagcg catcatggtc     50640
     gatccggcgg cgcggcccca atcgatcacc tatgcgtccg acgatttcgg gctgctgaaa     50700
     ctgctgttcg acaatggcgg cggcgcctat gccgatcagc gcggcggcgt ggtgatgcgg     50760
     tggagcagcc agtgggagcg gcctgaactc tggctgttcg acttccacca tcacctcttc     50820
     tccggcgaga cgggtgattg ggttatcggc atcgccgcgc tttgcgggct gttcttcgtg     50880
     ttcaccggcc tcatcctctg gtggcgcacg cggcggacct tcgaatggcg gctatggccg     50940
     gcgcggatga gccgcccggc gatcgtgcgg catcatcgcg acctgggcgt cgtcgtcgcg     51000
     ccgctgttgc tgctgtcgct ggcgacgggg gccgtgctgg tgttccggcc gatggcggcg     51060
     ctgctgttcg ggccgggcgc gcccgcgcag atcgacaagg ccttggccgc tccgccgccc     51120
     cgcgacgcca gacttgccga ccgactggac tgggcgggca tgatcgtgac ggccaaggcc     51180
     cgctttcccg acgcggaact gcgcagcctc agcctgccgc gcaagaatag cggcctgatc     51240
     accctccgca tgcgccggcc gcaggaatgg ctgcccaatg gtcgcaccac cctctggttc     51300
     gcggccgaca gcggcgcgct ggtcgcggcg cgcgacgccg ccacgctgcc gacggtggtg     51360
     aaggggtata atctgctcta tcccctccat gcggcgaagg tcgggggcct ggcgttcagg     51420
     ctggtcatga ccctggcggg gctggcgatg acgctgctcg gcacgctcgc ggtctggacc     51480
     ttctggttca ggcgtccggc aagggcggcg cgcccgcgtc agatcgcgat cagggcatag     51540
     ggccggtcga accgttccga cagcacgaac tgggcgcaat tatagaccgg aacgccgccg     51600
     ggcgtttttc cttcgaacgc gccgcgatgg gcgtggccgt gcacggcgaa gcggacattg     51660
     tcgaacctgt cgatggcttc ggccaaccgg gaggaaccca ggaatgggaa gatctccggc     51720
     ggctctccct gaacggtatc gaccaccggg gcatagtgga gcacggccac ggtccgctcc     51780
     gtccgcagcg aacgcagcgc gttttccagc ttgcgcgcct cgttgatcga ttcctcgacg     51840
     aagcccttga tcgcgctttc cccgaaggcg cccagttccc cccggccgaa tccgccgaca     51900
     aagcccttca ccccggcgaa gcccacgccc cttatctcca ccgcctgatc gtccagcacg     51960
     gtgacgccgg cgccgtgcag gatctgcgcc acgacttcgg gctggccgca ttcatggtcg     52020
     tgattgccca gcaccgcgac ggtcgggatg gtgcagcttc gcaggtcttc ggccaggact     52080
     tcggcctccc gcgtcttgcc gaaattggtg aggtcgccgc acagggccaa tatgtccgcc     52140
     cgggcggaaa tctcctcgaa catggcgcgg tagcgatgct cggacgaatc cgtgacgtgc     52200
     aggtcgccga cggcggccag gaccaggctg tccctcggcc gcgcctcact ggttgcggtc     52260
     atggctctcc tccagcccct tgcccaccac gtcggcaaag ccccagtcgg tgatgtcgac     52320
     cagatagtcg cgcggcgaaa gcagccgtcc ccggcacacg cgcagattgg gaacgggcag     52380
     ttcggcgcgg gtctgcaacc ggcccagcaa ttcctcgaac agccagagcg gaatgcaatg     52440
     ccgctcggtc ggatagatga aacggaaatt cagcaggtgg atgagcagca cttcccaatg     52500
     cagttccatc gcgtccagca gccgttgcca gtcgatgcgc tcatgctgcc gcaggatgat     52560
     gtgcgcgacg tccgcgccgt catagcggta tcgatcctgg atgaagacct tggacaggat     52620
     gaattcggtc ggcggggtga tccgcaccgt cgtgccatag acttccgcat gggatatgtc     52680
     gcggaaccat tcctcggtca cgggcaggct ggccgaggag atgttgtata tgacgtcgaa     52740
     gaaattgccg tcgcgccaga ccttgccgat ccagcgttcg tcctcgaatt cgacccgatg     52800
     tcccagcgcc ttgaaatagg ccaggatgcg gggcgcgtcg cccggcttgc agaagacgtc     52860
     cagatccttg gtcggccgcg ttatgccggt atggcatccc agcgcatagg tgcccgacag     52920
     catgaagggg atgccggact ggaccagatg cgcaaggctt tcggcataga attccgccgc     52980
     gtccggtgga ggatcgaagg tggcgggttc gcggttcatc cccaggggaa cggacaagcg     53040
     ggcgcttccg ttcccccttc cgtttccgcg ggcttatttc atcgtcggga tgacgaagct     53100
     ctggtcgatc accgcgccgc cgtcgggcca gcgctgcgtg atcttcttgg tgcgggtgta     53160
     gaagcgcacg ccgtccatgc cgtactggtc gagatcgccg aagcccgacc gcttccagcc     53220
     gccgaagctg tgataggcga ccggaaccgg gatcggcaca ttgacgccca ccatgccgac     53280
     ctcgacatcg gcggcgaact tgcgggcata atcgccgttg cgagtgaaga tggcgacgcc     53340
     gttgccatat tgatgcttcg agggatagct cagcgcctcc tcgaagctct gggcgcgcag     53400
     gatttgaagc accgggccga aaatctcgtc ctgatagctt ttcatgtccg gcgtcacccg     53460
     gtcgatcagc gtcggggcga ggtagaaacc ctcctcatag ccctggagcg agaagccgcg     53520
     cccgtcgacc acgatttccg cgccttcgtc ggcggccatc tggatatagc tttccacccg     53580
     cgccttgtgg acgccggtga ccagcgggcc atattgcgcg tcgggatcgg tggggatgcc     53640
     ggggcgcagc gtttcgatgg cgtccagcag cttggcgcgg aaggcgtcgg cggtcgcttc     53700
     gcccaccggc acgacgaccg gcagcgccat gcagcgctcg cccgccgagc cataggccgc     53760
     gccgacgatg tcggccaccg cctggtccat gtcggcgtcg ggcaagatga tgccgtgatt     53820
     cttcgcgccg cccatcgcct ggacgcgctt gccgttctgg gcgccgcggg catagacata     53880
     gttcgcgatg tcggacgatc cgacgaagct gaccgccttg atcgccgggt ggtcgaggat     53940
     ggcgtcgacc atttccttgt cgccatggac gacgttcagg atgcccgccg gaatgcccgc     54000
     ctcgatggcg agttcagcga ggcgtaccgg gacggagggg tcgcgttccg agggtttcag     54060
     gatgaaggcg ttgccgcagg cgatggccat ggcgctcatc cagaggggga tcatcgcggg     54120
     gaagttgaag ggagtgatgc ccgccgcgat gcccagcggc tggcgcatcg aatagacgtc     54180
     gatgccgggg cctgcaccct gggtatattc gcccttcagc agatggggga tgccgcaggc     54240
     gaattcgacg acttccaggc cgcgctggat gtcgcccttc gcgtcggcga gcaccttgcc     54300
     atgttcggag gagagcagca gggccagttc gtccatattc tgttcgatca gttccttgaa     54360
     gcggaacatg acgcgggcgc ggcgctgggg gttggtggcg gcccattcgg gctgggcgga     54420
     aagggcggaa tcgaccgcct tctggagatg ggcggcggtg gcgagttcca cctgggcctg     54480
     gaccgcgccg gtggcggggt tgaggatgtc ggacaggcgg gcgccgggtt ggggggcgga     54540
     ttgtccatga atgaaatggt gaactgaacg catttttccg gttcctctcc tgccggtggg     54600
     atgggatgga tatagacggg ccggctttgc agatatacat gtatgtcgac acattgattg     54660
     tgcggatttg cctatgctga actcggacga actgcggctg ttcctggcgg tgatgcggga     54720
     gggcaatatg ctggccgcgg cccggcggat cggggtggat catagcacgg tcgcccgccg     54780
     cctgaccaat atggaggcga cgttgggcgc gcgcctgttc gaccgcagcc cgcgcggggt     54840
     gacgccgacg cctgccgcct tcgctctggt gtcccatgcc gagcggatcg agagcgagtt     54900
     gctggccgcg atgagcagcg tcgccgggcg cgaccgggag gtggagggga cggtgcggct     54960
     cgccacgccg gaggccttcg ccagccatct gatcgcgccc cgcgtggcgg cgttgcggga     55020
     gcggcatccg cgcctgacgc tggaactggc gtcggagagc aaggcggcca gcctgtcgcg     55080
     gcgggaggcg gagatcgccg tgatgctgaa gccgccgccc aaggggcggt tcgtgacccg     55140
     caagctggcc gattatcgcc tgggcctcta tgcgtcgaag gcctatctgg agcgggaggg     55200
     gcggccctcc ctgcgcgccg acctcagccg tcatgtcttc gtttcctata tcgaggaact     55260
     ggccgggttc gcggagatga tcgcgctgga ccagttgctg cccggcgcgg ccatcgtctt     55320
     tcgcgccagt tccagcgcgg cgcagcatgc ggcggtggcg gctgggatgg ggctgggcgt     55380
     gctgcatgtc ttcgcggcgg cggaggatga gcggctggtg cagatcttcc cggagtcgat     55440
     ggaggtgtgg cgcagctatt ggctggtcat gcatgcggat ttgcagagat tgccgcgtgt     55500
     gcgggcggcg gcggattttc tggacgaggt gatgcggggg gttcgggagc ggttgtagga     55560
     gagggaggct ggcggaggag agggcttagc gccctttggg cgctcccctc caccattcgc     55620
     tttgcgaatg gtccccctcc ccatctttga tggggaggat taggggtgca ggaaccgggc     55680
     tttggttctg tgggtttgcc ttgcaggaca atggtggaga gggaagcaat cgtggcgaca     55740
     ttggtcgaag acaggacggc gctcgccttt cgggagtttt tcaggaatcc gctggcggtc     55800
     gggtcggcct ttccggcgtc gcatttcctg gtcgacgcca tgctcgggcc ggtggactgg     55860
     agccggatgg agcgggtgat cgaatatggg ccgggcaccg gcatcttcac ccgcgccctg     55920
     ctggaccggc tgccggggca tgcgcggttg ctggccatcg acaccagccc ggccttcatc     55980
     ggccatctgc gcggggagat gcgggaccgg cggctggtcg cggtgacggg gtcggccgac     56040
     ggcgtgctgg agatcatggc ggcgcagggg tgggacaggg cggattgcat cctgtccgga     56100
     ctgccctttt cgacgctggc gccggagcgg gcggagcggc tgatggaggc gagcgcctgc     56160
     gcgttgcggc cggaggggaa gttcctggcc tatcagatgc gcagggcggt gaagccgttg     56220
     ctggagcggc gcttcgagga ggtcagggtg gggttcgagt ggcggaactt gccgccttgt     56280
     catctttatt gggcttcggg gcctgggtga ttgggggtga ggactggagg aagcgtgggg     56340
     aagggggcgt gacctgcgta tttcccctcc accactcgct ttgcgagcgg tccccctccc     56400
     catctgcgat ggggaggaat ttcagggtag gtccgctatc aggtgcagca ctttgtcggc     56460
     gtggtctttg cggcagatga gcaggtcggg gaggtagacg tcgcgctggt tgtagatgag     56520
     gggggagccg tcgatgcggg agcagtggag gccgtgggcc tgggcgacgg cgacaggggc     56580
     caggctgtcc cattcatatt ggccgccgct gtgcaggtag atgtcggcct ggcccaatat     56640
     caccgccatc gccttggccc ccgcagaacc catcggcacc agttcggcgt cgaggcgttc     56700
     ggccaccgcg accgcctcct tggcggggcg ggtgcgggat atgaccatgc gcagcttttc     56760
     cggcgcgggc gggatgggga ccggctggtc cgagcgcagc aaggtgcccc cgttcaggcc     56820
     gggcagcgcg accgcgcccg ccgccgggcg gccgtccatg gcgaggccga catgcacggc     56880
     ccagtcggcc cgcgcctcgc catattcgcg ggtgccgtcg accgggtcga cgatccagac     56940
     ccggcttttg gtcaggcgcg cctcatcgtc cttctcctcc tccgacagca ggccgtcttc     57000
     gggccgcgtc tcccgcaggg cgcggcagag gaactggttg gcggtctggt cgcccgcctt     57060
     gcccagcgcg gcgggaccga acaggccgct ttcccgcaca ttgaccaata tgcgtccggc     57120
     cacctcagcc agatgcgcgg ccagttcggc gtcggtcatg gtgctggctg gtccgctcat     57180
     ggaatgatcc gggcgacgat ggcctctgcc gcctgttcgg cggtcatggc ggtggtgtcg     57240
     atgcggattt ccgggtcttc gggcgcttca taggggctgt cgatgccggt gaaattcttg     57300
     agttcgcccg aacgcgcctt cttgtagagg cccttgacgt cgcgggcctc cgcatcggcg     57360
     aggggggtgt cgatatgcac ttcgatgaat tcgccgggct gcatcatctg gcgcaccatc     57420
     tcccgctcgg cgcggaaggg ggagatgaag gcggtgatga cgatcaggcc cgcgtcggtc     57480
     atcagcttcg ccacctcgcc cacgcggcgg atattttcca cccggtcggc gtcggtgaag     57540
     cccagatcct tgttgaggcc gtggcgcaca ttgtcgccgt ccagcaggaa agtgtggcgg     57600
     ttcatccgcg ccagcttctt ttccaccaga ttggcgatgg tcgacttgcc cgcgcccgac     57660
     agcccggtga accacagcac ggcgggcttc tggttcttga gattggcgtg gaagtcgcgg     57720
     ctgacgtcgg tcgcctgcca atggacattc tgcgcccggc gcaggctgaa atgcagcatg     57780
     cccgccgcca ccgtggcgtt gctgatcttg tcgatcagga tgaagccgcc cagcgcgcgg     57840
     ttctgcgcat agggttcgaa cacgatctgg cggtcggtcg acaggttggc gacgccgatg     57900
     gcgttcagtt ccagcgtctt cgccgccaga tgctccatcg tgttgacgtt gacctgatat     57960
     ttgggctgct gcaccgtggc ggtgacggtc tgcgtgccga tcttcagcca ataggggcgg     58020
     ccgggcagca tgtcctcatc cgccatccag acgatggtcg cctcgaactg gtcggcggac     58080
     tggggcgggt tgtcggacgc ggcgatcacg tcgccgcgcg agcagtcgac ctcgtccgcg     58140
     aagcagaggg tgatcgactg gcctgcgacg gcggagtcaa gatcgccctc gagcgtgact     58200
     atgcggctga ccgtgctggt cttgcccgac ggcaggacgc ggatcgggtc gccgacgcgg     58260
     accgtgccgg tcgcgatctg gccggaaaag ccgcgaaagt cgagattggg gcggttgacc     58320
     cattgcaccg ccatgcggaa gggcttttcc cggtcggaga cctgatcgac ctccaccgtc     58380
     tccagatgct ccatcagcgc cggccccttg taccaggggg tgttggcgct gaggccggtg     58440
     atattgtcgc ccctgaaccc cgaaatcggg atcggggtga aggcctttat gccgatgccg     58500
     ttggcgaatt cggcataatc cttgacgatg ccgtcataga ccgcctggtc atagtcgacc     58560
     aggtccatct tgttcaccgc cagcacgatg ttgcggatgc cgatcaggtg ggcgagatag     58620
     ctgtggcggc gggtctgggt cagcacgccc ttgcgcgcgt cgatcaggat gacggcaagg     58680
     tcggcggtcg acgcgcccgt caccatgttg cgcgtatatt gttcgtggcc gggcgtgtcg     58740
     gcgacgatga acttgcgctt ttccgtcgcg aagaagcgat aggcgacgtc gatggtgatg     58800
     ccctgttcgc gttccgcggc gaggccgtcg accagcaggg caaagtcgat ttcctgaccc     58860
     tgggtgccga cgcgcctgct gtcggcttcg agggcggcaa gctgatcctc gaagatcatc     58920
     ttgctgtcgt agagcaggcg gccgatcagc gtcgacttgc cgtcgtccac cgacccgcag     58980
     gtgatgaagc gcagcatcgt cttgtgctgg tgcacctcca gatagcggtc gatgtcctcc     59040
     gcgatcaggg cgtcggtctt gtagatgggg tcgtcgagcg tgtcggtcat ctcgttccag     59100
     tcccgttcgc cctgagcttg tcgaagggct tttcttcttg aagataaaag tggagggctt     59160
     cgacaggctc agcccgaacg gaggagaggt gggctagaag taaccttcct gcttcttctt     59220
     ctccattccc gcgccgcctg cgtccttgtc gatggcgcgg ccctggcgtt cggaggtggt     59280
     ggtgagcagg gtttcctgaa tgacctccgg cagggtcttg gccgtgcttt ccaccgcgcc     59340
     ggtcagcggg tagcagccca aggtgcggaa gcggatggag cgcatcaccg gctcctcgcc     59400
     cggtttcagc gggaagcgtt cgtcgtcgac catcagcagc atgccgtcgc gctccaccgt     59460
     cgggcgttcc tccgcgaaat agagggggac gatggggacg tcgttcaggt ggatatattg     59520
     ccagatgtcc agttcggtcc agttgctgat cgggaagacg cggatgctct cccccttgtt     59580
     cttgcgggca ttgtagaggt tccacagttc cgggcgctgg ttcttgggat cccagccgtg     59640
     gctggcggtg cggaaggaga agatgcgctc cttcgcccgg ctcttttcct cgtcgcggcg     59700
     ggcgccgccg aaggccgcgt cgaagccgta gaggttgagc gcctgcttca gcccctccgt     59760
     cttccacatg tcggtgtgca gcgggccgtg gtcgaacggg ttgatgccgc gttcctgcgc     59820
     ttcgggattc cggtagacca gcagttccat gcccgattcc cgcgccatcc ggtcgcgcag     59880
     gtcgtacatc gcccggaatt tccaggtggt gtcgacatgc agcagcggga agggcggcgg     59940
     cgaggggtag aaggccttgc gcgccagatg cagcatcacc gccgaatcct tgccgacgct     60000
     gtagagcatc acgggctttt cggcctccgc caccacttca cgcaggatat ggatgctctc     60060
     cgcctccaga cgttccagat gggtcagcct tttcgaatcg atcatgttca ccgccttgtt     60120
     tcgtgacggc ctgatggcag aagcggggag ggactggacc tcccatatgg gaggatatac     60180
     atattagtca tgcgactgga cgacggcgga ttattggcgg ctctccatga gggtatgttc     60240
     gagcaacccc tttggcacgg gttcctggaa aagctgcggg cgcggaccgg ggcggcctat     60300
     gccgggctgg cgttccggcc catcgatgag gaaaggatcg tggaactgca tgccgggccg     60360
     gcggggccgc tgcatccgga ccggctgttc aacgagaagc aggggcgcga tccgttgccc     60420
     taccggcgga tgcgggaggc gcgggtctat acgctggacg aactgatcga gccgaaggat     60480
     gcggcgctgc aatcctatcg ccgggaatgg ctggacccgt tgcgcatcac cgccttccgg     60540
     tcggtgcgcg tcgcggaggc gagcggcatg gacgcctggc tgagttgcgc gggcgggcgg     60600
     gaggtgggac cggcggtcgg cgcgctgctg accgcgctgg tgccgcatct gcgcatcgcg     60660
     ctgcgcagct tcgtcgcgtt cgagcgggag aaattccggt cgtcggtgac ttcggaggcg     60720
     ttcgggcggc tcaattcggg ctggctgacg ctggatgcgc ggtgccgcat cgtcgacatg     60780
     acggcgcatc tggagccgct cttccagcgg tcgagcgtgt tgcggcgggg gcggtatgac     60840
     cggctgatgc cctcttcccc ggcggtggac cgggaactga ccgctctggt caagcgcttc     60900
     gccgaggatg cggaggcgcg gcccaaggcg atcaacctca gccgcgatcc gatgatcgac     60960
     atgctggtgc ggccgatcca ggaccggtcc ccctcggtcc agtcgccgcc cgtcgccatc     61020
     gcctatatca gcggcgaccg atggtcgcag gcggacaggt gcggccagtt ggtcgacctg     61080
     ttcggcctgc tgcccagcga ggcgcggctg gcctgggcca ttgcgcaggg catgtcgatc     61140
     ggggaggcgg cggacgatct ggggctgacg gtggagacgg cgcggaatta ttcgaagaag     61200
     atctacgcca agaccggagc gcgggggcag gcggaactgg tgcggaatat tctgacgagc     61260
     gtgctggctt tggcttgatg aggtttggct atggccatgg aacgatatgt gctcctgcga     61320
     aggcaggagc ccagttcaga cggtccgatc atccactaag ggcgggactg ggctcctgcc     61380
     ttcgcaggag cacgtaggtt ctttaccggc aggtttcgct gcggatcttc ttccggtcgc     61440
     aggggatgaa atggcagggg gcgttcttgt cgtccggggt ggcgggcttg cgttgccagg     61500
     ggggcgtcca gccgggaggg gcggaaccgc aataccaggg gctttgggcg gcggctgccg     61560
     gtggctggac ggcggtcagc gggatgatgg cgagcaatgc cagcgcgcta gaccgcatgg     61620
     ctgaagcgcc tttccgccgg ttccatatag gcgtcgaagc aggcggcgat gctgcgggca     61680
     tagggcaggg cgtcccgcgt cagggcgacg cggccttcgc tcaggcggac gaggcccagt     61740
     cgttcgaagc ggctgaggtc gggcaggggg tgcgccgtgc cgacatgcgc ctctccctgg     61800
     cagagcaggg cttcgatgat gcggccgcgg cggcggtcct ccggcgtgcg gagcgtgccg     61860
     cgggcggcgg tcaattgccc ggcgtcggcc agggcgcgcc aggggcctgc ctgtttctca     61920
     ttctggacga tgaggtcggg gaactggctg atcgcgctgg cgcccaggcc cagcaatatg     61980
     tccgccggat cgtcggtgaa gccctgaaaa ttgcggcgca ggcggccttc gcgggcggcg     62040
     cgggccatgg cgtcttcggg cagggcgaaa tggtcgaagc cgatggcttc atagcccgcg     62100
     ccggtcagcg tctcatgacc ccgcgccgcc atggcgaagc gggtggcgag atcgggcaaa     62160
     tcgcccgcgt cgatgcggcg ctggcgtggc agcaggcgcg gcatatgggc atagccgaac     62220
     agggcgatgc gggcggggcg catggcgatg gcggcctcca gcgtggcggc gaggtcgtcc     62280
     tgcgtctggc cgggcaggcc gtacatcagg tcgaagccgg tcgcgatccc ggcggcgcgc     62340
     aactggccga cggcgcgttc caccatgtcg agcggctgga tgcggccgat ccgcgcctgg     62400
     acatgggggg tgaaggtctg gacgcccagg ttcacgcggt cgacgcccat cgcggccatg     62460
     gtcgaaatcc attggccgtc gaggcggcgg ggatcgagtt cgaccgacaa ttcggcatga     62520
     tgcgcctcga agcagagcag caattgctgg agcaggcgga cgaaatcgac cagcggcagg     62580
     ctgttgggac tgccgccgcc gaaggcgatg cgccgcaccc ggccgcgtcc gttcagccgg     62640
     gcggcgaggg tcgcgatttc ccgctccagc gattcgacat aggcggcgag acgctggacc     62700
     cggttcgccg cgccggtgtt gcagccgcaa taccagcata tgtcgtggca ataggggatg     62760
     tggacgtaga gggagagggc gtcgtccctt ttcaccccgg ccaccgcatc cagccgggcg     62820
     gccagttccg ccgcgccgac atcgccgccg aactgcgcgg cggtgggata gctggtgtag     62880
     cgcgggacgg gccggtcgag caggtcggga tgataggtcc acatgatcct ggactcaggc     62940
     cggtcttgcc ggttcggaag aaatcgcgac ggacatgctg gcttgctccg gcctaaatct     63000
     gactatgctg gagccgtcgc cggccctcat cgccgagcct gtgtaggaca gcgagcgcgc     63060
     acgcatcttg atttatctca atcgggttcg aatttcgtcg accccgctgg gcgtgagttc     63120
     taacggaagg gggcgggcgg ccggaagatc gttcggaccg gacagtccct cccatccctt     63180
     cggcaggaca acgaccttct tccccgcatt ccgtccaagc atggcttgcc gcgatgtgga     63240
     ttcgcgtcat ccgcatgggg aatttccgtt ttcattggcg gatttgcggt gaatgaccgc     63300
     aattcatata tcgaatgtca tagtattttt ccggaagatg gcaggagaag gcgggttttt     63360
     ggccggcgcg cccctgattt ggatcagttc gaccggttcc aatccactat ccgaatgacc     63420
     gccattcagc caaagacctc gaatcgccgg gccgacgtga tacggaattt gaatgaaggt     63480
     cattcggcgg aacaataagt tgatgaacat gcgggttttt cgacccgatg acggcgggaa     63540
     accgctgaac ggggtggctc tccctggagg tcgtcccatc ccttgctgcg cctgatccgg     63600
     aagaaccccg gcctcgcgtc tagaggccgg gcacgtttta atgttggaga gagtcaagag     63660
     tgatgaacaa gttaaatatc ttcagtgccg gaatttgcct catcggcctg gggatcgcat     63720
     ttcccgccta cgccacggac ggatattatc tcaccggcgc caatgcgcgg gccacgggca     63780
     tgggcggcgt cggcatcgct ctgccccagg gaccggaagc ggcgacgatc aacccggccg     63840
     gcgcgacctt cgtcgacaat ggtttcgaga tcggcgccca gcttttcatc ctgaacaccc     63900
     gcactacgga cctgttcttc cccggcaatg acgtgaaagg ccatcaatat cagccgattc     63960
     ccgacttcgg cgtcaactat cacctgaacg acaaggtgac gatcgccgtc acttctttcg     64020
     gcggaggatt gggccagagc tacaacaagc ccttcgtgcc gggcatgggc ttttcgaagg     64080
     aacgcgccaa tttcatccag gcgggcatcg cgccgaccat cgcgtttaaa ctgcgcgaca     64140
     atctttccat cggcgtgggc ctaggcgtgg tcaacgagtt cttccgggcc aggggcgtca     64200
     tcgtgccgac gccccaggga ccggcgcaat tgccgaacca tgggtggagc catgccttcg     64260
     gcgtcggcgg caggttcggc atcctgtgga agccggttcc cgccgtgggc ctgggcgcga     64320
     cctatttcac caaggtgcac atgtccaacc tcaagggata tgaggacgac ctgctcgccg     64380
     gcctgggcgg gagcatagac acgcccgagc agttcggcgc cggcgtctcg gtcaagccga     64440
     acgatcgcct gacgctgggc ttcgacgtga tccggaccaa ctggagcggc gtcaaggcct     64500
     tcagcgagca ggcgggcttc ggctggcgcg atcacaccac cttcaagctc ggcgtggcct     64560
     atggcctgat gccggggctg acggttcgcg caggcaccag ccttgccaag cggcatttcg     64620
     gcagcgaatt cgtcctggcg aacgtcaata ctccgggcac gtcgtccaaa tcgctgacct     64680
     tcggcttcac caagcggctg ggcgagaagg atgagcttac gttcagcgcg gactatgaat     64740
     tgaacggcaa ggtggtcggg acgggccaca gcgcggggac ggtgatccgt tcgcgctatg     64800
     ggttcaccgg cctcagcttc tcccaccgtt tctgacgtcc tgatcggacc atgcgcgccg     64860
     gcggcgggac catatcccgc cgccggcgct gccggtcctg caacatgacg gcaacggtca     64920
     tgtcgcccgc ttgcgggacg gggcgggatg gcgggcgccc tgctgtttcg aatcgctttt     64980
     catatcggaa gcgaaagtag cgggttggcg gcccgccaca ttgagccagg tcaaattgcc     65040
     ggttgcgcgg gatcaatgcc gggtgcgtcg cggcccggca caaggggctc catcgacaac     65100
     agggatggag tttcaaagac atgagcgtca agacgatcct gctgggcgcg gccgccggtt     65160
     gcgctgttct ggccgggcct gctgaggcgg cgcagggcga cgtgctggtg cggctgcgcg     65220
     gcatcatggt cgcgcccaac gagaagagcg gcagcgtgct gcccgccttt ccgggcgaga     65280
     aggtgaaggt cgacgacagc gtgatgccgg aagtggacgt cacctatatg gcgaccgacc     65340
     atatcggctt cgaactgatc gccgcgacca ccaagcatag cgcgagcggg cggagcggca     65400
     cgaccggcgg catcggcaag ctggcctcca cctgggtgct gccgccgacg ctgacggcgc     65460
     aatatcattt cctgcccgaa gggaagatca ggccctatgt cggggcgggg gtgaattaca     65520
     cgctcttcta tagcgagaag gcttcgggcg cgctggaggg cgcggtgggc gcgaccaaag     65580
     tgcatatgtc cgacagcttc ggctgggcgg ggcaggtggg ggtcgacatc gacctcaacg     65640
     agcggatgtt cctgaatttc gacgtcaaat atatcgacat cgacaccacg gcgcggctgt     65700
     cgaccgccgg tgcgggcgtg cagagggtga agctggagct tgatcccttc gtcttcggcg     65760
     tgggcgtggg aatgaagttt tgatgggagg gtggcggctt ttggccaata gctgatatca     65820
     gtttccgtca ccccggactt gatccggggt cccgctgcct tgggctgggc gcggactcag     65880
     aaagaaagcg ggaccccggg tcaagcccgg ggtgacgaaa tcgggaacgt cggctttcca     65940
     cccacttccg cctcataggg acaattacgg ataggtcgcg gtgtgccggg gcggcatgga     66000
     tcggcgcatg gatatgcgat ttgatctggc gcaaaaggcg caggaggatg cggccttcgc     66060
     catggcggca acgccatcgg ccaagggctg cggcgggcaa tattgcgacc gttgcgaggt     66120
     gcgcgatcag gcgatctgcg ccgatcttga cgaaaagcag cgcggggcgc tgaaccggat     66180
     cgggcggcgg gtgtcgttgc aggccgggca gaccgtgatg tgggaaggcg acagttcgac     66240
     gctggtcgcc aatgtgatcg aggggacgct gaagctgtcc acctccaccg gcgacgggcg     66300
     cgagcagatc gtcggcgtcg tctatgcttc ggatttcatc ggccgcccct tcggcgcgcg     66360
     cacgccgcac agcgtcacgg cgctgaccga tgcgcggctg tgcctttatc cgcgcggggc     66420
     gttcgacggc tttgcgcggg agcatccggc gctggagcat cggctgttgc ggcggacgct     66480
     ggacgatctg gaccggacgc gggcgtggat gctgctgctg gggcggaaga atgcgcggga     66540
     gaaggtcgcg acgttgctgc tggacatgcg gcggcggctg cgggcggacc gggccggggt     66600
     gatcgaattg cccctgtcgc ggcagcagat cgcggacgtg ctggggctga ccatagagac     66660
     ggtgtcgcgg cagatcggcg agttgaagcg gatgggcgtg atcgcgctgg ccgggcggcg     66720
     cggggtgcgc gtcgtggatg ccgagcggct ggaggggatg gccgaggggg aatagcactt     66780
     cccctcccct tcaggggagg ggaccgaggg gtggggcgtg ccccacgcga aagcttgggg     66840
     ataacggcac gcccccaccc caacccctcc cctgaagggg aggggcttac cagggccgcc     66900
     ccatacggac attcccctac atacctgcgc cgccggcttt gacagaggtc aatgcatggg     66960
     tgcggctccc ggaggaagga cgccgcatag cctttgacgg ggaaatccga tggagcaact     67020
     ggtgtggaag acgggcggct ggttcgcgct cgcgacgctg gcctttctgg cggcgctggc     67080
     ggcggcggac ttcggctttg ccgtgcatat ggggatcgcc tgcgcggccg cgctggccgt     67140
     ggcggtgctg acgatgcggc acgccgatta tgaggcgatc acccgcgggc tgctgaagat     67200
     gcctgcgtcg caaggcagat atgacgacga tccgatccgc tggggcgtga tcgcgacggt     67260
     cttctggggc ttggcgggct ttctggccgg gctttatatc gcgcttcaac tggcctttcc     67320
     ggcgctcaac ctggggatcg aatatacgag tttcgggcgg ctgcggccgc tgcacacctc     67380
     cgccgtcatc ttcgccttcg ggggcaatgc gctgatcgcc accagcttct acgtggtgca     67440
     gcggacatgc cgggcgcggc tggcctttcc ggctttggcg cggttcgtct tctggggcta     67500
     tcagcttttc atcgtgctgg cggcgaccgg ctatctgctg ggcattaccg agggcaaaga     67560
     atatgccgag ccggaatggt atgtcgacct gtggctgacc atcgtctggg tcgcctatct     67620
     ggtcgtgttc ggcgggacga tcctgcgccg cagcgagccg catatctatg tcgcgaactg     67680
     gttttacctg agtttcatcc tgacgattgc gatgctgcat atcgtcaaca atctttccat     67740
     gccggtcagc ctgctcggtt ccaagagcta cagcgctttc gcgggcgtgc aggatgcgct     67800
     gacccaatgg tggtacgggc ataatgcggt cggtttcttc ctgaccgccg gtttcctggc     67860
     catgatgtat tatttcgtgc ccaagcaggc ggagcggccg gtctatagtt acaggctttc     67920
     catcatccat ttctggtcgc tgatcttcct ctatatatgg gcagggccgc accatcttca     67980
     ttataccgcg ctgcccgact gggcgcagac cttgggcatg gtcttttcgg tcatgctgtg     68040
     gatgcctagc tggggcggga tgatcaacgg gctgatgacg ctgaacggcg cgtgggaccg     68100
     catccgcacc gatccgatca tccgcatgat ggtgatggcg ctggcattct acggcatgtc     68160
     gaccttcgaa ggaccgatga tgtcggtgaa ggcggtcaac agtctttccc actataccga     68220
     ctggaccatc ggccatgtcc atagcggggc gctgggctgg aacgggctga ttactttcgc     68280
     ctgtctttat tatctgacgc cacgactgtg gaagcgggag cggctgtaca gtcttcggct     68340
     ggtgaactgt cacttctggc tggcgacggt gggcatcgtt ctctacgccg cgtcgatgtg     68400
     ggtcgcgggc atcatgcagg ggttgatgtg gcgcgaatat ggcagcgacg gctatctggt     68460
     ctacgccttc tccgaagtgg tgagcgccat gttccccatg tatctgatcc gggcggcggg     68520
     ggggctgctg tacctcagcg gtgcgctcgt catggcctgg aatatcggca ggaccatcgc     68580
     gggcagcccg ctgcgcgtgg agaagccgat gaacgatgcg gcctatgatg ccgcggccga     68640
     ccggccgatc gtcgcgcagc ccgcctgaag gagtatccgg acatggaaac caagaccaag     68700
     ggcaagttct tcgaccatgg caggctggag cggaatgttt cgctgctggg catcgcagcc     68760
     ctgattacag tcgccatcgg cggcatcgtg gagatcgcgc cgctcttctg gatcgacaac     68820
     actatcgaga aggtggaggg cgtgcgtccc tatacgccgc tggagctggc ggggcggaat     68880
     atctacatcc gcgagggttg ctataattgt catagccaga tgatccggcc cttccgggac     68940
     gagacggaac gctatggcca ttacagcctg gcggcggaga gcatgtacga ccaccccttc     69000
     caatggggat cgaagcggac cgggccggat ctggctcgcg tgggcggccg ctattcggac     69060
     gaatggcatg tccagcatct gaaagacccg cgcgcggtgg tgccggaatc gatcatgccc     69120
     ggctatgcct tcctggcgga gcgggaattg aaggcgggcg acatgagccg ggatctgacc     69180
     gcgctcaacg atgtcggcgt gccttatacg aaggacgata tcgacagggc caatgacgac     69240
     ctgaaggcgc aagccgatcc cgatgcggac agcagcgacc tgctgaaacg ctatcccaag     69300
     gcgcaggcgc gcgatttcga cggcgatccg ggcaagctga cggagatgga tgcgctggtc     69360
     gcctatctcc agatgctggg cacgctggtc gatgtggaca gcgccaagcc gcaggaggtt     69420
     gggcgatgag ctacgacgcc ttgcggcatt tcgccgatag ctgggggctg gtcttcatgg     69480
     gattgctcta tgcgatcctg atcggctggc atttcctgcc ccatgggcgg cagcgcagcg     69540
     ccgacgccgc gctcgccatt ttcgagcaag aggaagccga ccatggctga cgagaagcgc     69600
     atcgatcccg ccaccgggac ggagatcaag catcatgaat gggacggcat ccaggaactg     69660
     gacacgccgc tgccgcgctg gtggttgtgg accttctacg cgacgatcct gttcgctgtc     69720
     gggtacatga tcgcctatcc ggccatcccg atgatcgacc gggcgaccgg cggcatgctc     69780
     ggctggtcga gccggggggc gctggacagg gaactggcgg cgcgggaaag gcagatcgcg     69840
     ccgatccgga aagcgattgc ggagacgccg gtcacggcgc tgccggggcg gcccgaactg     69900
     atgcagcagg cggtcgaggg cgggcgcgcc gcgttccggg tgcattgcgt ccagtgccat     69960
     gggtcggggg ccgcggggtc gaagggctat cccaacctca atgacgacga ctggctgtgg     70020
     ggcggcgatc tggcggccat cgagaagacg atcaccgacg gcgtccgcaa tcccggtcat     70080
     gacgccacgc gccagtcgct gatgcccgcc ttcggcaagg atcagttgtt gacggcggcg     70140
     caggtcgatg acgtggtggc gcatgtccgg gcgatcagcg ggcaggaccg gccaggcgcg     70200
     gcttcgcggc ggggggacag ggtcttcgcc gacaattgcg cggtttgcca tgggcctgcg     70260
     ggcaagggga accgggcgtt gggcgcgccc gatctgaccg atgcgatctg gctctatggc     70320
     ggcgatgccg ggaccatccg cgagaccgtg tggaacagcc gccatggcgt gatgccgcgc     70380
     tgggacgaca agctggacaa ggcgaccatc cgcatgctgg cggcctatgt gcatagcctt     70440
     ggcgggggcg agggtgatgc ggggcggtga ggcttttctg ttcctcccca tgcttgcatg     70500
     gggaggggga ccgccgccga aggcggtggt ggaggggaaa tgggctgagg ttgcgcattt     70560
     cccctccacc agccttcggc tggtccccct ccccacgcct tcggcgcagg gaggaacagg     70620
     ggggtgctga tgtctgggtc cgcctcgctc tatgagaagc gcaagggggt ttatcccaag     70680
     gccgtcgacg gcttctaccg tcgcctgaaa tgggcgatca tggcggtgac gctggccatc     70740
     tactggggca cgccctggct gcgctgggac cgggggcctt atgcgccgga tcaggcggtg     70800
     ctggtcgatc tcgcccatcg gcgcttctac atgttcgcca tcgagatctg gccgcaggaa     70860
     ttctattatg tcgcgggcct gctgatcatg gcggggatcg ggctgttcct cgttacctcg     70920
     gcggtggggc gggcctggtg cggctatgcc tgtccgcaga cggtgtggac cgatctttat     70980
     cagcatgtgg agcgtttcgt ggacggcgac cgcaatgcgc agttgcggct ggccaaggcg     71040
     ccgtggagcg cggccaagat tgcccggcgg atcgtcaaat ggtcggtctg gctggggatc     71100
     gccttcgtca ccgggggcgc gtggatattc tatttcgcgg acgccccgac cctgcaacgg     71160
     gaattctgga gcgggaccgc cgcgtggcaa gcctatgcga cgactttcgt gctgaccgcg     71220
     accaccttcg tgctgggcgg gttcatgcgg gagcaggtgt gcatctatat gtgtccctgg     71280
     ccgcgcatcc agacggcgat gctggacgag aagtcgctgg tcgtcaccta caagcattgg     71340
     cgcggggaga agcgcgggag cctgaagaag gccgaagcgc gtccgggcgc gttcggcgac     71400
     tgcatcgact gcaaccagtg cgtcgcggtc tgcccgaccg gcatcgacat tcgcgaaggg     71460
     ccgcagatcg gctgcatcac ctgcgcgctg tgcatcgacg cctgcgacaa ggtgatggcg     71520
     caggtcgggc ggccgcgcgg gctgatcgac tattgcacgc aggatgacgc cgaagcggag     71580
     cagaaggggt cggaaccgcg cccggtgctg aagacgctgc tgcggccgcg caccatcgcc     71640
     tatttcgcga tctgggccgg gatcggcgcg gccatgctgt tcgcgctggg ggcgcgggag     71700
     cggctggaga tcagcgcgca gcaggaccgc aacccaatct tcgtgcgcct gtccgacggc     71760
     gcgatccgca acgcctatac ggtcaagctg cgcaatatgc aggcgcggcc ccggccgatg     71820
     gaggtgggcc tcaccggcct gcccggaggc cggatatgga cagatgcggg gtcgcgggag     71880
     aatgccgccg cgacggtgcg gacgaccgtg cccgccgaca gcgtggcgaa gctgcgcatc     71940
     ttcctgacgc tgccttccgg cggcccggcg cggcaggatt tccgcttcac cgtgcgcgcc     72000
     atcgatcgcg aaggcggcag cgccagcgaa cccgcccgat ttgaaaggcc ctgaagcatg     72060
     acccctgctc catcccccct ccgccgcttc accggctggc acatgacggc gatattggtg     72120
     gcgttctttg ccgtggtgat cgcggtcaac atgctgatgg cgaccgtcgc ggtgcgatcc     72180
     ttcggcggca cggtggtcga gaacagctat gtcgccagcc agaagttcaa cggctggctg     72240
     gcgcaggcgc gggcgcagaa gcggctggga tggcgggacg cggtgacgct ggatgcggcg     72300
     cggcatgtcg gcttggtcct taccgacgcc aagggcgcgc cagtggcggg cggccaggtg     72360
     acggcggtgg cgcagcatcc gctggggcgg acgccggacc tgtcgctggt ctttcgcgag     72420
     accgcgccgg gcgtctatgc cagcgaccgg gccttgccgg aggggcggtg gcagatccgt     72480
     ttcgacctgc gcctgaccgg gcgcgaggag catctgttga gggaggtcga ctgatggcca     72540
     cgaaagcgct gatctccgat cctgtggcgg aaggggcggc cgaaagcctg ttcgccgttc     72600
     ccggcatcca ttgcgtcggc tgcatcgcca agatcgagga ggggctgccc cgccagcccg     72660
     gcattatgtc ggcgcgggtc aatatggggg cgaagcgggt cgccatccgg cacgatccgg     72720
     cgctgacccc gcccgacctg cgcgccgcca tcgccgcttt ggggttcgag gcggagccgc     72780
     tggctgatgc gggactggac gtggcggcgg cggaaagtcg tcgtttgacc cgggcgctgg     72840
     tggtggcggg cttcgcggcg atgaacatca tgctgctgtc ggtgtcggtc tggtccgggg     72900
     cggcgggcgc gacgcgggga atgttccact ggctctccgc gctgatcgct ttgccgacgg     72960
     tggcctatgc gggccagccc ttcttccgtt cggcctgggc ggcggtgcgg caggggcgga     73020
     cgaacatgga cgtgccgatc agcatcggcg tgctgctgac caccggaatg agcctgtatg     73080
     agaccgtcac cggcggggcg catgcctggt tcgacggggc ggtgatgctg ctgttcttcc     73140
     tgctggcggg gcgctcgctc gacagcatga tgcgcggccg ggcgcgggcg ggggtggcgg     73200
     cgctgctgaa gcagaccgcg ccgggcgcgc tggtgctgga ggcggacggg agcagccggt     73260
     ggatgcgggc ggacgcgctg cgccccggca tgacgatatt ggtggcggcg ggcgaaaggc     73320
     tggccgccga cgggcgtgtg acggaggggg aaagcgggct cgacatcgcc tttctgaccg     73380
     gcgaaagcgc cccggtgcgg gtgcatcccg gcgacgatgt gcaggcgggt gcgctcaata     73440
     tcgacgggcc gatccgggtg gaggtgacgg cggcgggggc cgacaccgtc attgccgaca     73500
     tcgcccggct gatggaggag gcggggcagg gcaagtcgcg ctatgtgcgg ctggccgacc     73560
     gggcggcgcg gctctatgcg ccctgcgtcc atctgctggc ggcgctgtcc ttcgcggggt     73620
     ggatgatcgc cggggcgggg gtgcatcagg cgttgctgat cgcggtggcg gtgttgctga     73680
     tcacctgtcc ttgcgccttg gggctggcgg tgcccgcggc gcagatcgtt gcctgcggcg     73740
     cgctgatgcg gcggggcgtg ctggtcaagg acgggtcggc gctggaacgg ctggcggagg     73800
     tcagcgaggc ggtgttcgac aagactggca cgctgacgct gggccgtccg gtgccgcagg     73860
     ggttgcgccg tctgtggcgg gacgaccggt cgatcctgct gtccctgtcg cgggcgtccc     73920
     gccatccgct gagcgtcgcc ttgaggcaag cattggaggc gcggggggtg acgcccgccg     73980
     cgctcgacaa tgtccgcgaa gtcgccggag agggcgtgtt cggggactat gaaggcgtgg     74040
     ccgtgtcgct ggcgcgtccg cgcagcctga tcaacctgtt cgggctggcg gcggaatatc     74100
     ggcgcgggga tcaggccttg ctgctgggct tcaccgacgc gctgcggccc gatgcggcgg     74160
     aaacgctgga cgtgctgcgc ggcatgggga tgaagatatt gatcgccagc ggcgaccggc     74220
     ccgaagcgct ggaggagatt gcccgcgaaa cccgcactac cgccatcggc catctgcgcc     74280
     ccgccgacaa gctggcgctg atcgaccggt tgaaggccag gggcgagaag gtgctgatga     74340
     tcggggacgg gctgaacgac ggtccggcgc tggcggcggg tcatgccagc atggcgcccg     74400
     cctccgccag cgatgcgagc cagcttaccg ccgacgccgt gttcctgggc gacaggctgg     74460
     cgccagtggc gctgaccgtg catgcggcgc ggcggacggt tgcggtggtg aagcagaatt     74520
     tcgcgctggc gatcggctat aatgtgctgg cggtgccgct ggccatagcg gggaaggtga     74580
     cgccgctggt cgcggcggtg gccatgtcga catcctcgct gatcgtgatc gccaatgccc     74640
     tgcgcctgaa aggagccgtg aaatgacggg tctcagcctg ttgattccga ttgcgcttgg     74700
     gctggggctg ctggggctgg cggccttttt ctgggcgttg ggcaatggcc agttcgagga     74760
     tacggacggg gcggcggtgc gcatcctgat tgacgaggat tgacggcagg cggattttcg     74820
     tccgttgaag ctcgtcagga tagtcgattt ggctgaaaat tccgctgcaa taaggcttat     74880
     ctccttggca tcggctgttc ataagtcgga ttgcatgcca tgatttccct atcatggcgc     74940
     gcatgacgaa cccgcccacc ttcaccgatt tcgcccctgt catccggccg cagtcgccgc     75000
     tccgccaggc gatcaccgcc gcctatcgcc gcgacgaagc ggagtgcatg gcgcccctgc     75060
     tggaagccgc cgcgctgccc gacgccatgc ggcggggagt gcgggacatg gcgcgcaggc     75120
     tggtgacgac gctgcgcgcc aatggcaagg gcagcggggt cgaggcgctg gtgcaggaat     75180
     attcgctctc cagccaggag ggcgtggcgc tgatgtgcct ggccgaagcg ctgctgcgca     75240
     ttcccgacga tgcgacccgc gacgcgctga tccgcgacaa gatcgccgac ggcgactggg     75300
     gcgggcatct gggcggcggc aggtcgctgt tcgtcaatgc ggcgacctgg gggctggtgg     75360
     tgacgggcaa gctggtcggc agcgtcgatg accggggcct cggcgcggcg ctgacgcggc     75420
     tggtggcgcg gctgggcgag ccggtgatcc ggcgcggcgt cgacctcgcc atgcggatga     75480
     tgggcgagca gttcgtgacc ggcgagacca tcggggaagc gctgaagcgg gcgcgggcgc     75540
     aggaggccaa gggcttccag tacagctatg acatgctggg cgaagcggcg gcgacggcgg     75600
     cggacgcggc gcgctacctg gaggattacc ggcaggcgat ccacgccatc ggccgggcgt     75660
     cggacgggcg cggcgtctat gccgggccgg gcatttcgat caagctgtcg gcgctgcacc     75720
     cgcgttacag ccgtgcccag gcggatcgcg tcatggggga attgctgccc cgggtgaagg     75780
     agctggcgtt gctcgccaag ggccatgaca tcggcctcaa tatcgacgcg gaggaggcgg     75840
     atcggctcga attgtcgctc gacctgctgg agagtctggc gctggacccc gagcttgcgg     75900
     ggtggaacgg gctgggcttc gtggtgcagg cctatggcaa gcgctgcccc ttcgtcatcg     75960
     actggatcgt cgatctggcc gggcgggccg ggcggcggat catggtgcgg ctggtcaagg     76020
     gcgcctattg ggacgcggag gtcaagcggg cgcaggtcga cgggctggcc gatttcccgg     76080
     tctacacgcg caaagtccat accgacgtcg cctatatcgc ctgcgcgagg aagctgctgg     76140
     cggcgcggga ccgggtgttt ccgcaattcg cgacgcataa tgcgcagacg ctggcgacgg     76200
     tccatcatct ggcggggccg ggtttcacgc tgggcgacta tgagtttcag tgcctgcacg     76260
     gcatgggcga gccgctgtac gagcaggtgg tggggaaggg cgatctcgac cggccctgcc     76320
     gcatctatgc gccggtcggc acgcatgaga cgctgctggc ctatctggtg cggcggctgc     76380
     tggaaaatgg cgcgaacagc tccttcgtgc accgcattgc cgatccggcc gtgccggtgg     76440
     aggagatgat cgccgacccg gtcgagcagg tgcgggcgat gccgcatccg ggggcgcggc     76500
     atgcggacat cgccctgccg tccgggcttt atcccgaccg gcgcaattcc gacgggatcg     76560
     acctcagcga tgaaaatgcg ctggccatgc tgacgcgggc gctggcggaa agcgcgcaga     76620
     tcggctggac ggcccggccg gagggcgggg agggcgcggc gcggcccgtg ctcaaccccg     76680
     ccgaccggcg cgatgtcgtg gggacggtgt tcgaggcgtc gacggatttt gcgcgggcgg     76740
     cggtcgcgcg ggcggacgga agcggctggg cgcgggcgcc cgtgacggaa cgcgccgcga     76800
     tattggagcg ggcggccgac gcgatgcagg cgcgcatgcc gatcctgctg ggcctgatcg     76860
     tgcgggaggc gggcaagtcg ctgcccaacg ccatagccga ggtgcgggag gcgatcgatt     76920
     tcctgcgcta ttatgcggag caggcgcggt cgaccttcgg cccggcgcag gagcctttgg     76980
     ggccggtggt gtgcatttcg ccctggaatt tcccgctggc gatcttcacc ggccaggtgg     77040
     cggcggcgct ggtcgcgggc aatgcggtgc tggccaagcc cgccgaggaa accccgctga     77100
     tcgcggcgga ggcggtgcgc ctgctgcacg aggcgggagc gccgggggac gctctgcaac     77160
     tgatccccgg cggcggcgag atcggcgcgg cgctggtggc ggcgccgcaa accgcaggag     77220
     tgctgttcac cggatcgacc gaggtggcgc ggctgatcca gcggcaactg gcctcgcgcc     77280
     tctccgcttc gggcaggccc attccgctgg tcgcggagac gggcgggcag aatgcgatga     77340
     tcgtcgacag ttccgcgctg gcggaacagg tggtggcgga tgtcatcgcc tccgccttcg     77400
     acagcgcggg gcagcgctgt tcggcgctgc gcatcctctg cctgcaggag gatgtggcgg     77460
     accggacgct ggcgatgctg aagggcgcgc tcagggaatt gcgcatcggg cggaccgacc     77520
     ggctggcggt cgacatcggg ccggtcatca ccgacgaggc gaaggaagga atcgggcggc     77580
     acatagaggc gatgcgcgcc ctgggctgcg cggtggagca gcagccattg ccggaggaaa     77640
     gcgcgcatgg cagcttcgtg ccgccgacga tcatcgagat cgacgacatc gcgcagttgc     77700
     ggcgggaggt gttcgggccg gtgctgcacg tcatccgctt cccccgcgca gggctggacg     77760
     cgctggtgga tgcgatcaac gcgaccggct atggcctgac cttcggcctg catacgcggc     77820
     tggacgatac cgtcgcccag gtgacggggc gggtgaaggc gggcaacctc tatgtgaacc     77880
     gcaatgtgat cggcgctatc gtgggggtgc agccctttgg cgggcgcggg ctgtcgggca     77940
     ccggacccaa ggcgggcggg ccgctctatc tggggcggct tgtgcgcgtg ccgccggcct     78000
     ttgccgggcg ggccgattcg ttcccgtcgg cgctcgccga tttcgccgac tggctggcgg     78060
     cggagggcga ggcggaggct tcggccatgg cgcggcgctg cggcgatgcc tcggcgctgg     78120
     gggtggagat ggcgctgccg gggccggtgg gggagcgcaa cctctatgca ttgcatccgc     78180
     gcggatggat cgggatgcgg cccgcgacgc ggcagggcct gttgcggcag atggcggcgg     78240
     tgctggcgac gggcaatcgc ggggtgctgc aggacatggc gctgccgcgg ggattgcccc     78300
     cgcatatcgc cgcgcatttc gcgtctcggc cggaagggcc gctgggggcg gtgctggtag     78360
     agggcgatgc cgggcggatc ggcgcggcgg ttcgggacgt ggccggcctg ccggggccgg     78420
     tcgtcagcgt ccatgcggcg ggggcggatg ggatgtatcc gctccactgg ctgctggagg     78480
     aggtgtcgac ctccatcaac acgacggccg ccggcgggaa tgcgagcctg atgatgatcg     78540
     gatgagggct ggttaaaggg caaggtgctc ctgcgcagga acacggtgcg ttaatcgaac     78600
     gcaggcgggc ccgcggcgcg tttatgcgtc cttgagcaag cccgcgacga ccggcgcgat     78660
     cctgccgacg acgatgttca caccggcggg attggggtgg atggaatcgg cctgcatcag     78720
     cttgggatcg ccgatcacgc cgtccaggaa gaaggggtag agcggcaggc cgtaatcctt     78780
     cgccagccgg ggatagatgg cgtcgaactt cgcgccataa tccttgccca tattgggcgc     78840
     ggccagcatg ccggtgagca gcacggggat ctgccgccgt ttcagttcgt ccaatatggc     78900
     gcgcagattc ttctcgctgt cctccggcgg caggccgcgc agcatgtcgt tgccgcccag     78960
     gtcgagcagc agcaggtcgg gcttgcgcgg caggccgtcc agcgtgaagg ccaggcgctg     79020
     catgccgccc aaggaggttt cgccggagac cccggcattg cggacctgaa ccgccagccc     79080
     ctgcgccttc agcgcctgtt ccaggcggaa ggggaagctt tcattctggg ccacgccata     79140
     gcccgcataa aggctgtcgc cgaaggccag caccagcttg ccgtccgcga ccggggcggc     79200
     cgcgttaccg gcctgaacgg acggcgcggc atgattgtcg gcggcgggtt cgcccgaaca     79260
     ggcggtgagc aattgcacaa tcgccgccgc gcccacatat attgaccgtc ttcccgcctt     79320
     catggggttc ctttcgccga tgcacggttc gtcctccctt gcccatattg cgattgaagc     79380
     gcgcaatgtc accctttcgc tcggcacccg cgaagcgccg acgcagatat tgaggggcgt     79440
     cgacctttcc atacccaagg gcgagagcct ggcgatcctg ggtccgtcgg ggtcgggcaa     79500
     atcgtcgctg atggcgatat tgtcggggct ggagcgcgcc agcggcggcg acgtgcgggt     79560
     cgccgggatc gattatgggc cgctggacga ggatgcgctg gcgcgggcgc ggcgcgggcg     79620
     cgtgggcatc atattgcaga gcttccacct gttgccgacc atgacggcgg tggagaatgt     79680
     cgccgtgccg ctggaactgg cgggctttgc cgacgccttc gcccgcgccg cggacgaact     79740
     ggcggcggtc gggctggggc accggctgca ccattatccg gcgcagcttt cggggggcga     79800
     gcagcagcgc gtggccatcg cccgcgccgt cgcgccgggg ccggacatca tcttcgccga     79860
     cgagccgacc ggcaatctgg acggggcgac cagcgggtcc atcgtcgaac tgctgttcgc     79920
     ccggcgggcc gcgaacggcg cgacattggt gatcatcacc catgatcccg gcctcgcggc     79980
     gcggtgcgac cgcatcgtgg agatgcgcga cgggtcgatc gtcgcggacc gcaggccgtg     80040
     aaggcgctgg gttggcgcgg ctgctggcgg atcgcccggc gcgacctgca tcgcggtttc     80100
     cgggggctgc ggctgctgtt catctgcctg ttcctgggcg tggcgacgct ggcgaccatc     80160
     ggcggcctga ccgccgcgat caccggagag attgccagca agggacaggt gctgctgggc     80220
     ggcgatgtcg aggtggcgat gtcgcagcgc gaggcggggg ctgcggagaa ggccgccttc     80280
     cggcgcgagg gcgcgctgag cgagacgatc cgattgcggg cgatggccca gcgagtgggg     80340
     cagggcgctg gcaatggccc gtccgccgtg ctgaccgaac tcaagggcgt ggacggggcc     80400
     tatccgctct atggcgcgct gaccctgaaa ggcgggcgcg ccgggccgat gcgcgccgac     80460
     gaactggtca tcgggcaggc cttggcggac cggctggacg tgaagccggg cgatggcctg     80520
     cgctacggcg ctgcggcctt ccgcatccgg ggcatcatcg ccgacgagcc ggaccgggtg     80580
     ggggagggct tcactttggg gccggtggcg ctcacgtcga tggagggcat ccggcgcacg     80640
     gggctgatcc agccgggcag cctttatgaa agcaaatatc gcatccgcct gagcgcgggc     80700
     ggggatgccg gggcggcggc ggagcggctg aaacgcgcct ttccctccgc cgggttcgag     80760
     atcaaggatc gcgacggcgc ggcgccggga accagccgtt tcctggagcg gatggggcag     80820
     ttcctgtcgc tgatcggcct cgccgcactc gccatagcgg ggatcggcgt cagcaacggg     80880
     gtcgcctcct atctggcgat caagcgcaac ggcatcgcga cgttgaagat attgggcgcg     80940
     tcctccgccg acatcgcccg catctacctg atgcagatcg gcgcggtcgc gctgctggcc     81000
     atcggttgcg ggctggcggc gggggtcgtg ctgccgctgg ggctggtgac ggcgatgcgg     81060
     gacatattgc cggtgcagcc gggcttcgcc gtcgcgatct ggccgctggt cacgagcgcg     81120
     ctctacggcc tgctgatcgc cttcatcttc acggtgccgc cattggcgcg ggcgcggacc     81180
     ctgcccgccg ccgccctgtt ccgcgagacg gtggaccggc ggcgcggcgt cgaccgggcg     81240
     agcatgatcg ccgtgggcgc ggcgggggcg gctgcgctgg cgctggcatt gggcacggcg     81300
     cgggagccgt ggttcgcggc ggcgatgctg ggcgcggtcg cggggatgct ggcgctgctg     81360
     accgggatcg ggctgctcgt ccggcatggg gcgcggcggg cgcccgcgcc gcgtcgtccc     81420
     ttggcacggc tggcggtggc caatctccac cggcccggcg cgcagacgtc ggcgctggtg     81480
     gtggcgctgg ggctggggct gaccctgttc gtgacgctgg cggcgatcca gtcgagcctg     81540
     agcgccgaaa tccgcaacac cgtgccccgg accgcgccgg accagttcgt gctggacatt     81600
     cccatcgccg ccaaggatcg cttccttgcc ctcgtcggac aagaggcgcc gggggcgaag     81660
     gtcaatatgg tgccgaccct gcgcggcacc atcgtcgcct atggcgggca gcgggtggcg     81720
     gacctgaagc aattgcccga aggggcgtgg ttcctgcgcg gcgagcgcgg cgtcacctat     81780
     agcgatgcgc tgcccgaagg atcggaactg gtgaaggggc ggtggtggcc ccgcgactat     81840
     gccgggccgc cgctggtctc gctcgaccgg gaggcggcgg aggtgatggg cgtcggcgtc     81900
     ggcgacatgc tgaccgtgtc ggtgctgggg cgggagatgg aggcgcgcat cgcatcgctg     81960
     cggcaggtga attgggagac gatggggttc aactacatca tggtcttttc ccccaacgcg     82020
     ctgcgcggcg cgccgcacag cctgtccgcg acgatcacga tgaagggcgc gtcggaaggg     82080
     gtgatggcgc ggacgctgct ggcggccttc ccctccatat cgatcatagc ggtgggggat     82140
     gtggtggcgc aggtcacggt gctgctgggg cagatgtcga ccgccatcgt gctggcgggg     82200
     tcggtcgcga tcctggcggg gatcgccgtg ctgatcggcg ccatcgcggc gtcgcggcag     82260
     gcgcgggcct atgacagcgt gatattgaag acgctgggcg cgacccgctg gcagatattg     82320
     ggggcgcagg ggatcgaata tgcgctgctg gccggggtgc tggcgctggt ggcgttgggg     82380
     ctggggctgg cggcggggtg gttcgtgatc gtgcggatat tcgaattcca ttgggcgccg     82440
     gactggctgc tggtgctgtt gacgctgggc gcgggggcgg tgctgacgct ggggatcggg     82500
     ttgctggggt cgatcccgct gatgtcggtg cggccggcgc gggcgctgcg ggcgctctga     82560
     gccttggctt gggtcgtgtt cctgcctgcg caggaacaag gttcaaatga cgacaagctc     82620
     tatgccctgt gcccgccggc gcggtccagc gccgccatca ggtggacgga cagatcctgt     82680
     atcgtgaagg gcttggccag cagcggcacg ccctccttcg cggcggaggc cgccgccgcg     82740
     ctgtagcccg tcatcagcat cgtgcccaga tgcggccagt gcgtccggac ccggagcgcc     82800
     agttccatgc cgccgacctc gcccggcatg atcatgtcgg acaggatcag ggaaaaatcg     82860
     tccgcccgct ccagccggcg cagcgcagcg tcgccattgt cgacccgctc catctcatag     82920
     cccagcgtcg tcagcatgcc gcccaccgtg tcggccaccg tgtcgtcatc ctcgaccagc     82980
     aggatgcgct gcttgccgga ggcgccgacc ggctcgaccg gcccgtcgcc cggccggggg     83040
     gcgagcaggg atcgcggcag cagcagggtg atggtcgtcc cccggtcgac gatgctgtcg     83100
     accagcacct ccccgccgga agcgcgcgcg aagccgtaga cctggctgag gccaaggccc     83160
     gtgccctgtc ccaccgcctt ggtcgtgtag aagggttcga atatcttgtt gagcagttca     83220
     ggcgcgatgc cctctccgtt gtccgtcacc gcgatctgca cccggtcggg caggccgcca     83280
     tggcccggac ggttcgcgcc ctctatgacg atggcgccgc tcttgcgcat ggcgtcgcgg     83340
     gcgttgaggg cgatgttgag gatcgccacc tccagttccg acgcgtcgac ctccaccggc     83400
     cagaggtcgg cgggaagatg catggccacc tctatgcttt cgcccagcga tcgttcgagc     83460
     agcgcgtcca tgcccctgat ccgctcccgc aggtcgacga cttcgggatt gagcggggtg     83520
     cggcgggaaa aggcgagcag ttgccgcgtc agcttcgcgc cccggtccag cgcctggcgt     83580
     attccggcgc gcagcttctc cagcctggcg gcgtcctggg tgcgttccat gaggtcgagg     83640
     ccacccgaag cgaccatcag cagattgttg aagtcatgcg cgacgccgcc ggtcaactgg     83700
     cccatcgcct ccatcttctg cgactggcgc agcgcctctt cggcctgctg gcggctggcg     83760
     atctccgcct gcaaggcctg atgcgcgcgg cgcagcgacg aataggaggc ggcgagcatc     83820
     acgatcagca ccgccgccgc gatgacgatg accgcgatgc ccagatagcg ggtcaggcgg     83880
     cgcgacaggc tgtccatggt cgattgcaga tagacggagc caagctgcgt gccgccctgc     83940
     ttcaccggga ccgtgacggc aaggcccgac ggcggcgaat cccggcccgc ctccgccgcc     84000
     agcctgggca gccgggcggg agggcgcgcg aagccggcga cgaaggcgcc cttgccgtca     84060
     taggcggcga ccgcgacgat ctgcggatcg gccttcagcg cgttcagata ttcctggagc     84120
     gcgacatcgt cctcgaacgc cagcggcgcg gcgatcccgt tggccagcac ctgcgcctgg     84180
     accgtcgtct gccgcagctt ttcgacccgg ccgagctgtt cgagctggat ggcggcggcc     84240
     agccccgcgg cgagcagcag gaaggcgatc aggaccgcgg acaggggcgt cgccatctgc     84300
     ccgacgacct tgcccaggct gagcctgcct tgggtcgccg gcttcatttc cggtccaccg     84360
     cgatggcaag gcccagcaat ttggaactga tcttgaggcc gttggcgcgg gccgccttgt     84420
     cgtcgatctg gaaccgcacc cgcccgttcc gccgcacgaa ttcgatcatc gcgccgctgg     84480
     gaccggcgcc cttgtccgcg accgtcagca ccggctggcc gcccgtggtc gcgaagggcg     84540
     catagccggg gtcggccgag cggccggcga acaggatgtg gcaggccgga cccgcctcgc     84600
     cgccggtccg ccgcaccacc accgggcggc cgaccatctt ctgcccgcgc accacatcgt     84660
     tgagcatggc gccgaacgga tcctccccaa ccacgcagat cacgaaattc ctttccgtcc     84720
     ctgaaaatgc cgccgggggc cattccacga agggcgcgaa cttgaacagg aaattcgcct     84780
     ggatcgcgcg ttccagcgcg gcgggcgaat tggccggcac cggcgccgga acgaggagcg     84840
     cgaccgccgc gagacaggac agcgcggcac ggcgtcgtcg ttgcccgcgc ctgccgcgcc     84900
     aggggctcag atcgtccatt tgagcgccac gaacacgctg cggcgaagcg gcgtcgcctg     84960
     cgaggcggga agctcccggt ggcggcggtg cagcaggttg aagcccgaca ccgacaattc     85020
     ggcgcgctcg tcgaactgcc agcccagcct tgcgcccagt tccacatagc ccggcacatg     85080
     cgggtcgggc agggcggaca cgtagcgcag gtcgaaatcg acattcacct ccggcccgat     85140
     gtccatggag gagcgcagcg tggcgcggtg cctgggatcg ttgccgacct gcgacacgcc     85200
     gatcaggggc accgaatccg gcttgaagcg gaacttctgg atcagcaggc tgtagccggg     85260
     cttgagccgc caccagcttg ccagccggat gtcggcccag gcgtcgaagc catagctgtc     85320
     gccctttatc ccattgcccc agcgcagcgg caggaacccg cccggcgccg gctccaccgt     85380
     ccgcaggtcg tcatagacat tgtagaaggc ggataccgaa agcgacgcgc ggggcgagag     85440
     catcagccgc gtgcccagtt cgaaggcggt cagcttttcg gagcggaagc cgggaagggc     85500
     ggtcaggaaa acggtgcccc cgatggattc gaccacatcc tcgtcaaagg gggtgggcga     85560
     acggacggcg cgggaaaccg cgccccacag cagggtttcg gcgtcgggct tccaggacag     85620
     gcgaacgctg ggcaggaagg tgaggtccat atagctgcgc cgctccagct tggccccgac     85680
     cgtggccgtg acggacggcg tcagggcgat gctgtcctgc gcgaacagat tgccgacgaa     85740
     aaggtttcgc cggtcgggca cgaagtccag gccgggaatg ttgcggatca catagcggct     85800
     gaggcgcgcg ccgccgcccc agacgatgtt gtggccggag cctagcgcga agctgtgctg     85860
     cccctccacg tcgaaggtgt cgagcgcgaa gcggccgccg tcattctcga tcttgcgggc     85920
     gctgtggtcg taataggcct ggagctggag cgtggccccg gacgccgcgc catggcgcca     85980
     gcgggcaagc aggtcgtagc cgtgcaggct ctcgtccggc gcggccccct gcgagcggga     86040
     accgtaatag ccgtccccct gcaccatcag cgcgtcgtcg ggcgtcgcgt tccagtcgaa     86100
     gcggaagccg gcctgggtcc ggcgattgcc gtcgtccgcg tcgttcgcgc tctcgaaatt     86160
     ctcgtgccgc ttcacgaaca ggcggtagct ggcgttgccg ccggcatggc cgccatagcg     86220
     cagccccagg tcataggtgc tgttgccgac cacgcccgtg ccgtacaggc cctgggaggc     86280
     ccccgcgtcg cgggtgatga tgttgatcac gccgttgacc gcgttggacc cccacagcgt     86340
     ggcgccgggg ccggaaatca cctctatgcg gtcgacatcc tccggcaaaa cgtcctgcat     86400
     gtcccaatag acgccggaat agagcggcga atagatgctg cggccgtcga tcagcaccag     86460
     cagcttgttg gagaaactct gcgcggcgtc attgccgccc atcccccggg cggcaatgac     86520
     cgtattgttg gggccgccgc gcatgacctg cagattgggc gcaagccgga gaatgcccgg     86580
     cagcgtcagc gtgcccgaac ggacgatgtc gtcatgggtg atgacgtaga tcgacgccgg     86640
     ggaatcggcc agcgacgccg tcgaccgggt gacggaggtg acgtccagct tcgacagggc     86700
     ggcgatcggc atgtcgcgca attcttccag gctctgcgcc tgggcggcgg tgcagcatag     86760
     ggatagaagg cccacggcca ttccgccgaa cgccgcgccg ccaaaagccc atgccattcc     86820
     cattatcccc ccgcgctgcc cattgcgctt gcccccgacg cgaggcccga tgcgatgatc     86880
     ccccgcgcgc cgcggagtcg ttacgcggcc gcgccggaaa agttccacgc caactcccgc     86940
     aattccttgc gcaatccgcc ttgaacgcgc cgccggagcc atcccgccgt cacagcgcgg     87000
     caaggctctt ggccaaatcg atctgcttga aaggcttggt cagtcgcggc agttccgccg     87060
     aaatcccggc attttcggca tagcccgaaa tcagcagcgc ccggatcgcc ggcttgagca     87120
     cccgtgcctg ctcgatcagg tcggtgccgg tcgtgcccgg catcagatga tcggtgacca     87180
     gcacgtcgat gtccggctcg gccttcatga tcgccagcgc atgttcggcg gaactggcct     87240
     ccagcacgtc atatcccagt tcgcgcagca tatgcacggt gctggcgcgc accagttcct     87300
     catcgtccac caccagcgcc atgccatggt ccagcttcac gggcgcagtg tccggcccgg     87360
     ccgcgtccct tccggcctcg atctcgctgg tcggcagcca gaggctgatc gtcgtgccct     87420
     ggcccacggc gctttcgatg gtgaggcccc cgcccagttg cgcggccagg ccgtgcacca     87480
     tcgacaggcc aaggccggtc ccctggccca cgcccttggt cgtgaagaag ggttctatcg     87540
     ccttttcggc ggtctgctgg tccatgccga tgccggtgtc ggccaccgac aggcggacat     87600
     agcgtccctc ccgcaggcgc agccggttgt cggccgccat gctgtcgcat gtcacgccga     87660
     tgcgaagctg tccgccatcc ggcatggcgt cgcgcgcatt caccgccagg ttcagcaacg     87720
     ccatttcgat ctggttggcg tcggcatggg cggccggcag gccttccgcc accgccagtt     87780
     cgacctgcac ccgcgggccg gacgtgctga cgatcaggtc gcgcatgtcc cgcaccagcc     87840
     cgcctatgtc gatggcggtg ggttgcagcg gttgccgccg cgcgaaggcg agcagccttt     87900
     gcaccagcat cttcgcccgg tcggcggatt gcagcgcgcc ctcaatcagc cgccgctccc     87960
     ggtccgtgcc caggccgcgg cggtggagca ggtcgaggct gccgacgatc ggcgtcagca     88020
     ggttgttgaa atcatgggcg acgccgccgg tcaactggcc catggactcc agcttctgcg     88080
     actggcgcag cgcctcctgc gccagttcca gttcatgcga ccgctgctgc acgcgttcct     88140
     ccagcgtctc gttgagcgcg cgcagccgct cctcgctccg gcgcagcgcc gcctccatgc     88200
     ggcggcgttc ggtgatgtcg ttgaacagca cggcgacctg gggcgctttg ggatcgccca     88260
     cgcgaaaggc gtagacatcg taccaatagc cgcccagcgc ctctgccgcg tcctcgaagc     88320
     ggacggcctc gccggtgcgg gccacctggc cgtaaatgtc gaaccaatgc tgttcatgcc     88380
     ccggcaccag cgatcgcatg ctctttccca ccgcgtcgct gaggccggta tggcgcgcga     88440
     aggcgggatt ggtttcgatg aagcgatagt cgaccggctt ccccgcatcg tcgaagatca     88500
     tctctatgat gcagaagccc gcctcgatcg aatcgaacag ggatcgatat ttctccgcgc     88560
     cgcgatgcag ttcctccagc cttgcgcggg cgtcatattg ccggcggcgg ccgcgcagcg     88620
     ccgaccgggc gaggctgatc agcgtggtgg ggtggaaggg ccgctccagg aaattgacgt     88680
     tgcccagcat ctccagatag cgggacgccg acgggttgcg ctccagcccg ccgccgcgcc     88740
     gggtcagcag aatgaagggg aagtccgacc attccggctg gttctgcaac cagccgacca     88800
     ggggatgcag gtcgcgattg tgcagcgcct cctccgtcac cagcgcgaag ccggcgccat     88860
     ggtcgatgcc gcccagcagg tcgggaagat cccggcagac atgcgagcgc aatcccgcct     88920
     ccgccagcat cgacgccgcg atctccgcat cgcgcccgac cggagcgaga atgagcgccc     88980
     gttcggacag gtgcgggatc acgcctcctc gtcttccagc agcgcgggcg cgccgccgac     89040
     gaaatgcggc acgccgcgca gcacgccctg gaagccgatc agcggttcgc ccaggcggat     89100
     gccgtaggaa ccgatgcgga actcccggat cgtgtcctca tgcgatccgg tgcgcttctt     89160
     gatgatcgac atggcgcggc gcacccggcc cagcgcctcg aaatagcgca gcaggatgac     89220
     cgtgtcggcc agataggtga cgtcgaccgg cgtcttcatg tcgcccacca gtccatgctg     89280
     cgcgacggtg aggaaggtgg tggccccctg ccggttcaga tattgcagca gttcatgcat     89340
     gtgcaggacc agcgcattct cctccggcat ggcggactga tagccgttca ggctgtcgat     89400
     gacgacggtt ctcacgccat gccgttccac gcagttgcgc acccgctggg aaaattcgcc     89460
     gggggacagt tcggccgcgt ccacctgctc gacgatcagg tcgccgctgt cggccatcgc     89520
     ccgcatgtcg atgcccagcc ccagggcgcg gttgaaaagc aggcccatct cctcgtcgaa     89580
     gacgaagatc gccgcctttt ccccgcgcgc gaccgccgcc gtgacgaagg tgagggcgag     89640
     cagcgacttg cccgtgcccg ccgggcccag gacgagcacg ctcgaaccgc gctctatccc     89700
     cccgcccagc agggcgtcga gttcggtgga ctcgcttttc agcacgtcgc gctggaaatc     89760
     ggtcttgtgt tcggccgaca ccagccgggg gaagacgcgg acgccgcccc tttcgatgac     89820
     gaaatcgtgg aagccgccgc gaaaatgccg gccgcgatat ttgatgacgc gcatccggcg     89880
     gcgctccggg ccgtagtcga gcgacagctc ctccagccgg atgacgccat gggcgacgct     89940
     gtgcaccgtt ttgtccgcga cctcggccgt caggtcgtcc agcatcagca cggtcgcatt     90000
     ctgtttcgag aagaaatgtt tgagcgccag gatctggcgg cggtagcgca gcgagctttg     90060
     cgccagcagg cggatttccg acaggctgtc cagcaccacc cggtccggcc ggacccgttc     90120
     gaacgcgtcg aagatgcggc gtgtggtctc gcccagttcc aggtcggacg aatagagcag     90180
     gctttgctgc tgctgctcgt ccagcaggct ttcgggaggg accagttcga acaggtccac     90240
     cccctccagc gtccaaccgt gcgacgcggc gctttcgcgc atctcttcct cggtttcgga     90300
     cagggtgatg tagaggcagc gttcgccgcg ccgcgcgccc tcgatcagga actgcgtcgc     90360
     tatggtggtc ttgcccgtgc ccggactgcc ttccagcagg aacacgcggc cgcgggtcag     90420
     cccgccggaa agaatgtcgt ccaggccatc cacgcccgcc agggcctgtt tggtcgaata     90480
     ggtctccacg tcacctccct ttcagagcag gagcatcggc gattaccacg agaagcggcg     90540
     gccctgaatg cgtcgcagat tgatttcgat caagtcccgc cggtccgatg cggctcatgg     90600
     gccgtgcgcg ccgcgcgcgc tatcgtcgat ctgttgccgc gcctccgccg cggcgcggat     90660
     cagttcgttc cccgtctctt ccgccgcatc gggcgtcatg ctgatggcga cgccgtcggg     90720
     accgtccagc atcacctgtc cttcctcggc ataggccttg ccagattcat cgaaaacgcc     90780
     gtctcggggc atggattctc ctcttccgtt cgggtgcaaa ggacgctttg cgggcggatg     90840
     cggttccctc agccgccgat gaacagatag gacgggtcgt aatcgcacag ccgccgcagg     90900
     gcggcgaggt cgaagatggt gacccgcccg cgctggacct ggagcagttc ccgttcgcgg     90960
     agttcccgca gcatgcggtt gatgtgcacc gacgtcatgc cgcaggcctc ccccaggtcc     91020
     gcctgggtca gcggcagcgc gaaccggctg ccgtcgctca gccccacggc gcgcagcttc     91080
     gcctcgatct cgcagaagaa atgcgcgatc cgcgccatgg cgtccaatcg gccaaggcgg     91140
     aatatccatt cccggtgcat ggccgcgtcc agcagcgtgc tgaaccacag cagcttcgtc     91200
     agattgggcc gctgcgccag caggccgtcc agcgcctcat gcgggaccat ggcgatccgg     91260
     gatgcgcata gggtcgcgac atcatggtcc agccgcccca gcggatagcc gtgcaggtcg     91320
     acgaaatcgc cggggacatg gacggcgacg agctggcgca ggccgttgcg gtcgtccatg     91380
     tagcggcaga tgaacccttc catcagatag gtgctgtacg cgatcggctc gcccgcctgg     91440
     gcgataagct ggcgcgcatg ggtcttgcgc acctggctga cgctggcctc cagcgccgcg     91500
     agatcgcgct ccgacagctg ctcgcggcga cggttgcgga ggaaatcggc gaagatcatg     91560
     ggtggacaac gcctggacgg ccgatcggct tcatcccgtc gggaatggcg gacccttcgc     91620
     gcctgccgtt cgtatagccg gttccataaa tcaggagacg atcatgaccg atgcgcgaaa     91680
     gctgaaggaa catctgtggg atcggatggc cgacagcccc ttcatgatgc tgggcctgac     91740
     gggcagcgga cagcatagcg agccgctcac cgtccagttg gacgaggacc aggtggacag     91800
     gctgtggttc ttcatcggca aggacaaccg cctggccggc ggcggcgcgg cgatggggca     91860
     gttcgtttcc aaggggcacg acttcttcgc ctgcttcgcg ggccaagcgc gcatcgacaa     91920
     tgatcccgcg atgatcgaca agctgtggtc gaccacggtc gaagcctggt tccccggcgg     91980
     caagtcggac cccaatctgg ccctgttgcg cttcgtcatc gacgaggcgg aattgtggga     92040
     ggcggacgtg tccctgaccg gcaagctgaa gatgctgttc ggcggcaaga tccgtccggg     92100
     cgaggaaggc agtcacgcca gggtcgagac gacggcgaag tgacccgtcg gtccggcggc     92160
     gcgccggcgg atcgaaacgg acgtgcgttt cgatccgccc ctgtgtagga ggcatggtgc     92220
     ggcccccgac ccgcccctga aggccttttc acaggaatga cgacgctgat ggaacacagg     92280
     tccgtggatg cggtgctgct ggacatggac ggcacgatcc tgaattccat caaggcggcg     92340
     gaacgcgtct ggggcgaatg ggcgctgcgc catgggctgg atgtcgacgc cttcctgccg     92400
     accgtccatg gcgttcagtc ggtggagacg atcaggcggc tgggcctgcc cggcgtcgat     92460
     ccggtggcgg aggcggcgct cgtcacccag gcggagatcg acgcggtcga ggggatagag     92520
     gccattgagg gcgcggcggc gttcctggcc gcgctggccg attgccgctg ggccgtcgtc     92580
     acctccgccc cgcgccggct tgcccggcgc cgcatccggg cggcgggcct gcccgcaccg     92640
     ccgctgctga tcgcggcgga ggacgtggaa cgcggcaagc ccgcgccgga ctgcttccat     92700
     ctggcggccg agcggctggg gacgagggcg gaccgttgcc tggtgatcga ggattcggtt     92760
     gccggcatca tggcggcgga acgcgccggc gcgagcatcc tggtcgtcgc cgcgacccac     92820
     caccggccga tggagacgcg ccatcccgtc atcatcgact atcgcggcct gggcgcggtg     92880
     ccggattccg gcggggccgt gcgcatcggg ccgatgggct gagaccgtga cgatttccct     92940
     cgcgccgccc tgcctatgca agaacgccat cgccattgcg acgaaaatat cctatatgtt     93000
     ccgtatccga ccctataagc ggcgatcatg tccgacctgc acaatatgtc acagcctgcc     93060
     agcgccatcg gtcccgcagc gcgcgccgct tccggaccga cgctggtgga gcgcgcctat     93120
     gagcatcttc tctccatgct gatgacggtg aagatcgcgc cgggcgaacg catccccatc     93180
     gataccgtgg cgcggcagct cggcatttcg cagaccccga ttcgcgaggc gctgagccag     93240
     ttggaggcgg agaagctggt ctacaagacc accaatgtcg gctaccgcgc cagcccgcag     93300
     atgacgccgg aggaggtgca tgacctctac acgctgcgcc tgctgatcga accctatgcc     93360
     gccgcccgcg ccgccgagca gatggacgac gagacgctct ccatcctcca gtcgatccag     93420
     gcggacatgg acgcggtcgt cgagcgggac gagcaggcct atgcccgctt cgcggaggcg     93480
     gacgcgctgc tccaccggct gatcgccaag ggcagcggca accgcctgat cgaggagacg     93540
     atcgagcggc tgcacgcgca tctccagatc ttccgatcgc tctaccagaa cagcgcccag     93600
     cccaatgcgc ccgaagtggc ggcgcgggag catcaggcga tcatcgccgc cctgctggcg     93660
     cacgatcccg tcgcggcgga gcagtcggtg cgcgaccatc tgacctgttc tcagcagcgg     93720
     atggaccggg cgaacggcac gtcgccccgc tgacggccat ggccgcctga agcgcgaacc     93780
     cgccggccgg ggacgggcgg cccatggcgg tcgcgtcctt ggcaccggct ttcggaatga     93840
     tgcgcggcgc gggccgcccg accgttcgac aaggtgggaa aggcccttga cgcgcctgcg     93900
     gcaaccactt accacgggct taccagatca tataggatat gaaataggtc tggagaggat     93960
     ggatatgcgg tcagccatga aagccggttt ttcacttgtc agcctgacgg tcgcgatgct     94020
     cgccggactt ccggcgacgg cgatggccga aaccacggtg ctgcgcgact tcacgctgat     94080
     cgacggcacc ggaaaggcgc ccgcggcgaa ccaggcgctg gtcatgacgg acgggcggat     94140
     caaatgggtc gggccggtcg cgaagctcaa ggcgccggcg ggcgcgaagg tcgaaaggct     94200
     gaagggcaaa tatctgatgc ccggcctgat cgacagccat gtccatctgg ggctggtcga     94260
     cggcatcacc cagaacctgc aatatcagac gccggaaaat atcgagaagc agctccgcac     94320
     ctacgccgcc tacggcgtca ccaccgtcca gacgctgggg acggaaaagg acatgatctt     94380
     cccgatccag cagcggcgca agggccgcgc ggcgatgtcg cgggtctata ccgtggggca     94440
     gggcgtggtc ttcaagggca gctatggcgg cgtcgccggc ctcgaccagt cggtcgccac     94500
     gcccgaagag gcgcgggcga tggtggacag ggaggcggcc aagggcgccg acctcatcaa     94560
     gctgtgggtc gacgacgaat tcggcatgct ggaggaacgc atgccgcccc cgatcagcag     94620
     cgccgtgatc gaccaggcgc acaaggacgg gaagaaggcc gtcgcgcata tcttctatta     94680
     ttccaacgcc gccgaactga cgcgggaagg cgtggacgcc ttcgcccatt ccgtgcgcga     94740
     ccgcgccgtt gacgacgcgc tgctgggcca gatgaaggcc aggggcgtgt ggcagatggc     94800
     cgcgacgctg agccgcgagg cgtccttcac ctacaagacg ctgcccttcc tggacgatcc     94860
     cttcttcgcg cggggggtga cgcccgccgt gctgaaggaa ctggccagtc cggagcgggc     94920
     ggcgaagctg ggcgcggcgc ccaacttccc caaatatgcg cccaccctgc aatatgcgat     94980
     ggacaatttc gcggcggagg cgaaggcggg catccgatat ggcatgggca cggacagcgg     95040
     cccgacggcg cgcttccccg gctatttcgc gcattgggaa ctggaactga tggtgaaggc     95100
     cggggtgacg ccgatgcagg cgatcacggc cgcgaccagc gccaatgcgg aattcatggg     95160
     ggccagggac atcggcgcgg tcgcgccggg caaatgggcc gacctgctgg tgctggaccg     95220
     cgatcccacg gcggacatcc gcaacacccg cgccatcgac gccgtctata tcgccggcaa     95280
     caaggtgccg accatctggc agacctgcac cggccgcgcc gccgatgcct gcggaccccg     95340
     cccgtgaccg gcgaggcaag cgtcgcggaa ccgcgcggcg ccgccgccgg agccggcgcg     95400
     gcgcgcccga cgcgggcgcg ccatgtcgtc ctgtggctga cggtgctggc ctatctcatc     95460
     acctatatgg accgcgtcgt gatcgccacg gcggccccgg tgatcgagaa ggaatatggc     95520
     ttctcgcccg tgacgatggg ctggatcttc gcgtccttct ccatcgccta tgcgctgttc     95580
     cagatacccg gcggctggct gggcgacagg ttcgggccgc gccgggcgct gacgggcgtg     95640
     gtgctctggt ggtcgacctt caccgccgcc acggcgctga cctggtcggc cgggtcgatg     95700
     atggtgtgcc gcttcctctt cggcatgggg gaggcggggg catttcccat cgccacccgg     95760
     tccttgtcgc gctggatgct gccgtcggaa cgcggctggg cgcagggcgt cacccatgcg     95820
     ggggcgcggc tgggcggggc ggtgacgccg gtgttcgtcg cgctgctgat cgtccagttc     95880
     ggctggcgca tgcccttcat ggccttcgcg ctgatcggca tcggctgggc ggccctgtgg     95940
     ttttggtact atcgcgacac gccgcgcgag catccggcgg tcaacggcgc cgaactggcg     96000
     atgatcgagg gcgcgctggg cgcgggccgg gcgcgggtga gcgtgccgtg gcggcacctg     96060
     ctggccaatt cgcagctctg ggtgctgtcg gccatgtatt tctgctacgc ctattgcatc     96120
     aacatcttcc tgacctggtt ccccaaatat ctgcacgatg cgcgggggtt cgacatcgcg     96180
     ttgatgggcc tgttcgccag cctgcctctg atggcggggg tggtgggcga cctgatgggc     96240
     ggatgggcgt cggacctgct ggtgaagcgc ggcgcggggc tgaagatggc gcgccgatcg     96300
     gtcgccgtgg tcggcttcct gacggcggcc gcgatgatac cgctggccgc cgccatggac     96360
     gggcatgtgg ccagcatcct gtgcttctgc atcgcgctgt tcgggctgga gctgacggtc     96420
     ggcgtgtcct gggctgtgac gctcgacatc ggcggcgaat atgcggggtc ggtgtcggcg     96480
     gtcatgaaca cgctgggcaa cagcggcgcg gcggtcgcgg cggcggtcac cggctatatc     96540
     gtcagcatga gcggctggtt cgccgccttt gcggttcttt ccgtcctctg cctgatcgcg     96600
     gcggcgctgt tcctgcgcat cgacgcctcg cgcaggctgg aagacgggca gggggcgcgg     96660
     gccccggaag aaatctgaac atcgcgcgca tggcgcgcac gacaggaggt tgcttaggtg     96720
     aagacttgga tattcgctgc gggcatcggc gcggtgatcg ccggcgcggc ggtcgccgcc     96780
     cccgcgccga agggaaatgc cgcgcatggg cagcagcttt tcgcgcgctg cgccgcctgc     96840
     cacaaggtcg ggccgaaccc ggcgcgcgcc atggggccgt cgctgaacgg cgtggtcggc     96900
     cgggcggcgg gcagccaagg cggctatggc tattcgcccg cgatgaaggc gtcgggcatc     96960
     aaatgggacg agaccagcat cgacaagctg ctgcaaggcc cgtcgaagct ggtccccggc     97020
     acgaagatga tcttccccgg catggccgcc gcgcaggatc gcgccgacat catcgcctat     97080
     ctgaaacaat ttggcgcgga tggtaggaag aagtgagcga cgtccatacc gccttcggcg     97140
     cgctgcgcct gccccgttcc gtcctgttcg ggcgcgggca gcgccacgcg ctcggctccg     97200
     ccgccggcaa gctgggcagc cgcgccctgc tctgcaccga tgagcggcag gccgcccagc     97260
     ccgaattcca cgccatggtc gcggacctga aagcccatgg gctggaggtc cgggtcttcg     97320
     accggacgat ccccgacctg ccgatcggat cgatcaatgc ctgcgtcgac gaagtgcgcg     97380
     gcttcgtccc cgatctggtc gtcggcatcg gcggcggcag ttcgatggac atggccaagg     97440
     tcgtcgccgt gctgctgacc catggcggcg acatccggtc ctattatggc gaattcgccg     97500
     tgcccggccc ggtcatgccg ctgatcgcca tgccgacgac ggcgggcacc ggatcggaag     97560
     tgacgccggt cgccgtggtg tccgacgacg agcgcggggt gaaggtcggc atcgccagcc     97620
     cgcatctgat cccgctggtc gcgatctgcg atccggaact gaccgccacc tgcccgcccg     97680
     ccctgaccgc ctgttccggc gccgacgcgc tgacccatgc ggtggaggcc tatacgacgc     97740
     tggcgcgccc ggccgacccg atgctgacgc aggatcatgt gttcgtgggc aagaacctgt     97800
     tgtcggacca tttcgcccgg ctggcggtcg acaacatctt ccgcttcctg gagcgggcct     97860
     atcgcgacgg cggcgacatg gaggcgcgcg aggggctgat gctggcggcg cttgcggcgg     97920
     gctgcgcctt cggcacggcg ggcacggcgg cggcgcatgc gctgcaatat ccggtcggca     97980
     acctgacgca caccgcgcat ggcgacgggg tggcgacgct gctgccctat gtcatgcagt     98040
     tcaaccgtcc cttctgcgcc ccggccttcg ccgaactggc gcggacggtg ggactgcccg     98100
     acgcggcgga ggaggacatg tctcaggcgt tcatcgatgc ggtcgccgac ctgctgggca     98160
     gcgtcgacat cccccgctcc ctggcggcgc tggggctgaa ggcggagcag caggacttcg     98220
     tggcggaaaa cgccctgaac gccgccaggc tggtcaagaa caatccccgt cccctcgatc     98280
     tcccggcgat gcagagcatc acccgcgccg cctttgccgg cgagcgggcg gcgctcaagt     98340
     cagcctgact tctcgaacaa ggtttcccat gacgacgcaa agctatagct gcacgacgac     98400
     cgatggccat gccggcccct tcgccattcc gaccgacctg ctgatcgggg aggcgtgggt     98460
     gcccgccgcc agcggcaggc gcatcgacat cctcaacccc gcgacggaga cggtgctgac     98520
     ttccgtcgcc gacgccagcc cggccgaggg catcgccgcc gtggacgccg ccgccgcggc     98580
     cgccgcggac tgggccgcga ccccgccgcg caggcgcgcc gacatattgc tcgcctgctt     98640
     ccatgcgatg atggcggagc aggaatggct ggcgcagctc atatcgctgg aaaatggcaa     98700
     ggcgctgccc gacgcgcggg gggaggtggc ctatgccgcc gaattcttcc gctggtatgc     98760
     ggaggaggcg gtgcgcatca acggggaact ggccgtctcg ccgtccggcg ccaaccgcat     98820
     catggtgcaa tatcagccca tcggcatcgc cctgctgatc acgccctgga acttcccggc     98880
     ggcgatggcg acgcgcaaga tcgccccggc gctggcggcg ggctgcacct gcatcctgaa     98940
     accggccgag gaaacgccgc tgacggcgct cgccgtggcg gagatcatgc gccgggcggg     99000
     cgtgccggcg ggcgtggtca atgtcgtcaa cagcagcgat ccggggccgc tgtgcagcgg     99060
     catcctgcac gacccgcgcg tgcgcaagct gtccttcacc ggatcgaccg aggtcggccg     99120
     catcctgttg cgccaggcgg cggaccaggt catcagttcg tccatggaac tgggcggcaa     99180
     cgcgccgttc ctggtgctgg acgatgccga catcgacgag gcgatcgagg gcgcgatggt     99240
     cgccaagatg cgcaatgcgg gggaggcgtg cacggcggcc aaccgcttct acgtccagcg     99300
     cggcatccat gacgccttcg tcgcgaagct ggcggagcgc atgggcgcga tgaagatggg     99360
     ccccggcacg gaaagcgcga cccagtgcgg cgcgatgatc aaccggcagg cgatcgacaa     99420
     gatcgagcat ctggtggcgg atgcggtcgg ccgcggcgcg gaggtcaggc tgggcggcag     99480
     gacgccggag ggcgcgggct tcttctaccc gccctcggtg atcgcgaacg tccagccggg     99540
     gtcggagata ttgacgacgg aagtgttcgg cccggtcgcg gcggtgatcc cgttcgacga     99600
     tccggcggag gcggtggcgc tggccaatgc gaccgaatat ggcctggccg cctatgtcta     99660
     taccgccgac ctcaagcgcg ggctgcaact ggcggagcgg atcgaggcgg gcatggtggc     99720
     ggtcaatcgc ggcctggtgt cggacgccgc cgcgcccttc ggcggcgtca agcagagcgg     99780
     cctggggcgc gagggcgggc atcacggcct gctggaatat tgcgaagcca aatatatcgc     99840
     ggtgagctgg taagccgcag ccgggaaaga gagagggaag gggcctaaag cgcgatgttg     99900
     aagatgaccc gacgcaggct gttgggcggg acggtcgccg tcgccgcgac catcggcacg     99960
     gccccggtgc ggcgcgccat ggcgcaggaa ctgcccggcg ggccggacac cgaatggcgc    100020
     cattatgcgg ccgaccaggc caatacgcgc tactcgccgc tcgaccagat caacgccgac    100080
     aatttcagcg accttcaggt cgcgtggagt ttcaagaccg acatattggg ggcgcgcaag    100140
     gaatatcagt tcgaaccgac gccgttgctg gtcaaggggc ggctgttcct gaccgccggg    100200
     tcgcggcgcg actgcgtggc cgtcgacgcg gcgaccggcg aactgctctg gatgttccgc    100260
     aaggatgagg ggcagcgcgc gctcaattcg ccgcgccagc tttcgggcca tggctgttcc    100320
     tactggaccg acggcaagca ggaacgcatc ctgttcgtga ccatcggcta tcagcttgtg    100380
     tcgctggacg cggcgaccgg cattcccgat ccggccttcg gcgtgaacgg cgtggtcgac    100440
     ctgaaaaagg atttcgacca ggaactggac ccggaaaccg ccgatgtcgg gctgcacgcg    100500
     acgccgctcg tcgcccgcga cacggtggtg gtgggcgcgg cgcatacggc gggcgacgtg    100560
     ccggcggtgc gcaagaatgt gaagggctat gtgcgcggct tcgacgtgcg caccggcaag    100620
     cgcaagtgga tattccacac catcccgaaa aagggcgaat atggctatga cagctggctg    100680
     aacggcgacg ccgacgaagc gggcaatggc ggcgtctggg cggaaatgtc cgccgacgag    100740
     gaactggggc tggtctatgt gccggtggaa ctgcccaccg gcgacgagat gggcatgttc    100800
     cgccgcggca atgcgctgtt cggggaatcg ctggtcgcgc tggacctgga gacgggcgtg    100860
     cggcgctggc attaccagct tgtccatcat ggcctgtggg accgcgatat tccctgcgcg    100920
     ccgatcctgt gcgacattcc ggtgaacggc aggacggtga aggcgctggc gcagccgacc    100980
     aagcaatgct tcctctatgt gctggaccgc accaacggcc agccgatctg gcccattgtc    101040
     gagcggccgg tggaggcggg cgacgtgccg ggcgaatggt atgccaagac ccagcccttt    101100
     ccgaccaagc cgcccgccta tgacgtgcag ggcatcggca tggacgacct catcgacttc    101160
     acgccggaac tgcgcaagca ggcggtggag ctggtgaagc agtacaagat cgggccgctc    101220
     tacacgccgc ccgtggtcag caagcccggc cgctggggca ccatctccgt tccgggcatc    101280
     cagggcggca ccaactggcc gggcggctgc tacgacccgg aaagccatac cgtcttcgtc    101340
     tattcgaaga cccagccgtc ggtgatcggc atcatcccga acgacgaccc cagcgtctcc    101400
     gaatttccgc atgtgcatgg cattgccggg tccgaagtgc ggccgcaggt ggcgatgggc    101460
     gcggcggcgc cgacgccctt catgcggccc ccggcggcga agcccggctc cggcccgccg    101520
     cccggcttcc tgaccgtgca gggcctgccg ctgctcaagc ccccctatgg ccgcatcacc    101580
     gccatcgacc tcagcaaggg cgacctcaaa tggcaggtcg cccatggcga gacgccggac    101640
     aatgtccgca accatccggc gctcaaggga ctgaagattc cccgcaccgg ccgggcgggc    101700
     aatctggggc cgctctgcac caagagcctg gtgatctgcg gcgaggcggg cttctacacc    101760
     aatgaatatg gcatcagggg cgcgatgctg cgcgcctatg acaaggccac gggcgaggag    101820
     aagggcgcgg tctacatgcc cgcgccgcag agcggatcgc ccatgaccta tatgctgaac    101880
     aaccgccaat atatcgtcgt cgccatcggc ggcggcaatt acagcgccga actggtggcg    101940
     ttccgacttc ccggagtggc ttaatggcag gagtggcttg atgggcaagg tgacgcgggg    102000
     atattggctg gcgggcgcgc tgctgctggc gggcggggcg gtcgtgacgc gcgcgcaggc    102060
     gccggaacgc cacgtctgga ccggggtcta caccaaggat caggcggagc ggggcaaggc    102120
     cgcctatgcg gaaaattgcg ccgcctgcca tggcgaaacg ctcgccggaa tcgacgtcgc    102180
     gcccgcgctg gtcgggccga cattcctcaa caactggaac aacacctcgg cgggcgacct    102240
     gttcgcgcgc atccagacga ccatgccgct caacgcgccg ggcagcctgg gcgggcggaa    102300
     ggtcgcggac atcgaagcct atatgttcga agccaacggc tttcccgccg gcgacctggc    102360
     gctgccgccc aatgcggcgc tgatgcccaa tgtcaggatc gtggcgcaaa ggcccgaacc    102420
     ggccaaggcg gggccggaat gcaaatgcgg taaataaggg gcggggcggc ggaaccgccg    102480
     ccccgttccg cctcaggcgc cggtccagtc cggcagcttc ttcgtgcgcg ccaggaaatc    102540
     ggccacgccc cgccggaaat cggcgctgcc atagacctgc gcaatcagat cctcgacatc    102600
     gggcaaggcg cc