(data stored in ACNUC7421 zone)

EMBL: AP010805

ID   AP010805; SV 1; circular; genomic DNA; STD; PRO; 190974 BP.
XX
AC   AP010805;
XX
PR   Project:PRJDA19949;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Sphingobium japonicum UT26S plasmid pCHQ1 DNA, complete genome.
XX
KW   .
XX
OS   Sphingobium japonicum UT26S
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Sphingobium.
OG   Plasmid pCHQ1
XX
RN   [1]
RP   1-190974
RA   Nagata Y., Ohtsubo Y., Oguchi A., Ankai A., Yashiro I., Fukui S.,
RA   Kamata S., Takahashi M., Ichikawa N., Tanikawa S., Tsuda M., Fujita N.;
RT   ;
RL   Submitted (04-JUL-2008) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institure of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RX   DOI; 10.1128/JB.00961-10.
RX   PUBMED; 20817768.
RA   Nagata Y., Ohtsubo Y., Endo R., Ichikawa N., Ankai A., Oguchi A., Fukui S.,
RA   Fujita N., Tsuda M.;
RT   "Complete Genome Sequence of the Representative
RT   gamma-Hexachlorocyclohexane-Degrading Bacterium Sphingobium japonicum
RT   UT26";
RL   J. Bacteriol. 192(21):5852-5853(2010).
XX
DR   MD5; 7246b14ae09c414ef0e1d745162afc8d.
DR   BioSample; SAMD00060927.
DR   StrainInfo; 715801; 0.
XX
CC   "Nagata, Y., Ohtsubo, Y. and Tsuda, M. are at Department of
CC   Environmental Life Sciences Graduate School of Life Science,
CC   Tohoku University. The other authors are at NITE Genome Analysis
CC   Center (NGAC).
CC   Please visit our web site. URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE. The database
CC   contains genome sequence data, physical maps and the genomic and
CC   proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for the
CC   sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..190974
FT                   /organism="Sphingobium japonicum UT26S"
FT                   /plasmid="pCHQ1"
FT                   /strain="UT26S"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 101211"
FT                   /db_xref="taxon:452662"
FT                   /culture_collection="NBRC:101211"
FT   CDS_pept        1..1164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SJA_P1-00010"
FT                   /product="replication initiator RepA"
FT                   /note="protein involved in initiation of plasmid
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98953"
FT                   /db_xref="GOA:D4Z8M1"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M1"
FT                   /protein_id="BAI98953.1"
FT                   /translation="MDDEQALDHAVTPSPTGDDASPGRAMRVAAALQAKGGDEFAKPGS
FT                   IVEVKFVKGQSLSLTASRLLALMILTAGGDAWEDRPHKMRKADIRRGHKGNERISDMLE
FT                   ELHRTLFAVDDKSWRGKKATLRFSLISSSREEAEDEEGADAGWIEWEFTPEARKLIQES
FT                   ETYAVLNRQAVLGFRSTYALKLYEIGALRLHRRQSLWKGDMTALRALLGIAPDVYKDFA
FT                   QLRRKVLEKAKAEIDQLAHFRVEWREIRQGRTVTEIEFRFEPKDAPAQIATVDEIGRHS
FT                   AGRKARREDEVETVAVEAVTQAAVAALVSKDKAGAGEVTFPNGTIRFGSDTLAAIGRSA
FT                   GGGWDIDLIADAYRAQMGERLAKLKGAKLIASWTGFCESFLARRGRP"
FT   CDS_pept        1360..2562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SJA_P1-00020"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98954"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M2"
FT                   /protein_id="BAI98954.1"
FT                   /translation="MAASLDIEGTQDLLSVSTLAQRTSSVLERLRDSARSARADERREP
FT                   TFPIGKAAELVGRTAAAIREAEKDGRLPPPPRTENNRRVGYTLAQLNDMRGLFGTRPWR
FT                   AATDPCCVIAVQNFKGGVGKSTLSVHLAQYLAIKGYRVALIDCDSQASATTLFGYVPDL
FT                   DLTEEDTLYPFLRHDDMESLDYALRKTHFDGLELVPANLRLFQSEYEIAARMARGQGNL
FT                   IDRMAQGIASIADRFDVVVLDPPPALGAISLSVLRAANALVVPVPPTVMDFSSTAAFLA
FT                   MLDETIETLADRGLAPSLQFLRFVASKVDENKSMQKELLNLMRTLFGHAIVRTPLKDSA
FT                   EIDNATARLMTVYELDGPVTSSTVRNRCLAYLDGVNSEIEVDIRSMWPSHLTRLRKEGL
FT                   A"
FT   CDS_pept        2607..3623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="SJA_P1-00030"
FT                   /product="chromosome partitioning protein ParB"
FT                   /note="ParB-like partition protein / putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98955"
FT                   /db_xref="GOA:D4Z8M3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="InterPro:IPR040873"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M3"
FT                   /protein_id="BAI98955.1"
FT                   /translation="MMSKKNANFAADLVAGIDPGAQAPAARRPGIGASVLAGRESRLAE
FT                   LATGSVVSRTHELVDPARCRMWAGHNREYALLNEERCADLIESIKAQGKQEMPAIVRRV
FT                   KDDPAFDFEVICGARRHWTISWLRAHNYPDFRFLVDIRSLTDEEAFRLADLENRARDDL
FT                   TDLERARDYLRALDAYYEGRQKVMAERINVTESWLSRYLDLARLPAELMAAFALPQDLR
FT                   IKHVTAIKPLLKPEDRRQRVFAEAGRLAQVQSDRAAPMPVPDIIRALALAADPPKRSGS
FT                   PKKSGKPETIVSEGGKPLLKVEAVDRKGLKLTLLPHAGGTRAEAEAALKALLDQHWS"
FT   CDS_pept        3688..4038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98956"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M4"
FT                   /protein_id="BAI98956.1"
FT                   /translation="MTAAFQDDIRENEIISPRRLAERLRFSMAHLARVARLDPKAMTLY
FT                   PSAPTVQIKLEEIARVITRAAELAGEEGKAVIWFKHQPISGVGKTAAELVANGDIDIVM
FT                   EDLDRMAAGVYS"
FT   CDS_pept        complement(4083..4766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98957"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M5"
FT                   /protein_id="BAI98957.1"
FT                   /translation="MDAIATTQVRWQPCYRIVASRFPPISLFEDVADPADLEAVYAIEA
FT                   MTNDRLRDEVGDLALVPPEDRVSGPGTSAIMAAFTHLNPDGSRFCDGSFGLFYAASTIE
FT                   TAVAETRHHRTRFMAYTHEPAQELDMRVYAVDLDAMLHDIRGLRDERPALYAPDSYAAG
FT                   QALGRHLREQGSDGIVYQSVRDADGECAAVFRPRLLANSRQERHLCYVWDGRAIVTVYE
FT                   KKTFA"
FT   CDS_pept        complement(4766..5164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98958"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M6"
FT                   /protein_id="BAI98958.1"
FT                   /translation="MATTAHSGVPAKAPSRKDLSGPALRTFFRIADAWDLKEAEQMKLL
FT                   GLDSRSTFQTWKRGAVAAIPKDALERISYVMGIYKGLKMLLPRTANEWVRKPNEAPLFA
FT                   GRPAIERMASGNVADLYVVRQYIDAQRG"
FT   CDS_pept        complement(5261..6427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98959"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8M7"
FT                   /protein_id="BAI98959.1"
FT                   /translation="MERFHPLAADSDAPPEELALAQGECALALGRLDGLLAGLAEDEKA
FT                   LFCVGLLREVLLSALAQAGFADAEHRFNAWFAGLDRGPQETPLTACSAYAVVRALMGEL
FT                   SHHPWEPLADAAQTIALAARFGADRPMQAEDALAEEAIGRALTLVKQAGADDETPLPFA
FT                   GLARLHALLRADPLFAPLERTVHIRSLGNRAVAIEQAAPRTPLWAVEASLGRLLTACGA
FT                   WQLALPCPGAVTAETLQPQLWPGERAIVSARTLHASATRLAELVAKARRRTALMREQLG
FT                   HLRSSARAPQVWILLAGFAPLGLDQITWAFGISRRGTYAIGDALVAARMARRETVKGKA
FT                   LLVVEEPGRDGQPASLDQATALPHAALAEFDAAMGEIDRLLAGSSGHP"
FT   repeat_region   6664..11279
FT                   /note="transposon Tn3 family"
FT   repeat_region   6664..6709
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(6722..9679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="SJA_P1-00080"
FT                   /product="Tn3-family transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98960"
FT                   /db_xref="GOA:D4Z8I8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8I8"
FT                   /protein_id="BAI98960.1"
FT                   /translation="MARRRLVSAEIWAGHYGAPLDEREIARHYTLTGDDLEIVGRRRGD
FT                   ATRLGYAMLLLYMRWPGRALEAGEVPPAPVLAYVAQQLGVAPEAFADYAHRDQTRREHL
FT                   VEIRRSHGFRIFDRKAFHEVVAFSIPIAQTIVHPGQMAGVIVDELRRRQILLPSSSVLE
FT                   AVLRRARQQAEQLTYEVLTNGLRPDTLQGLDDLLARRTGQAATWLSWLRNAPQSPAARN
FT                   ILRLIERLTHIRALDLDRARADMIPALTFDRLADEGSRITPQHLGELNALRRHATLAAQ
FT                   GIRLEESLTDATLTMFDKLLGSMSRRAENRTRDKALKTVRELQGHLRTLTGSCRILIEA
FT                   RTNGVDSLAQIEALDWQRFAVAVARAEVLGRPETVDRTAELIERHRTVKLFAGAFLNTF
FT                   EFRGAGAVQGLLSALTIIAELYRTGKRRLPDRVPLRFVPSAWRPFVLRDGIVDRAAYEL
FT                   CALSQLRERLRAGDIWVSGSRQFRDFDSYLIPPATFDALREKGPLPLAIETDFDRHIEE
FT                   RRARLDTAIEQVTVLARQGELPQVRLDESGLIISPLKAATPPATEIARRAAYDRLPRVK
FT                   ITDLLLEVDAWTGFSECFIHRRSGREADDRNALLTVILADGINLGLTRMAETCRGASLR
FT                   QLAHLHDWHISEAAYGEALGRLIDAHRAMPLAALWGDGTTSSSDGQQFHAGGRGAAIGD
FT                   INARSGNEPGVAFYTHVSDRYDPFATRVIAATAGEAPYVLDGLLYQQTGLTIEEHYTDT
FT                   GGASDHVFGLMPFFGYRFAPRLRDIKQRRLHLLPGQEAGPLLAGMTAEPIALGHVAAHW
FT                   DELLRFATSIRTGTATASAMLRRLSAYPRQNGLALAMRELGRLERSIFMLDWLRDIDLR
FT                   RRTQAGLNKGEARNALARALFFNQLGELRDRRFENQTYRASGLNLLVAAIILWNTRYLE
FT                   VALADIGTPDEIARHVAPLGWEHISLTGDYSWNVEDRPDPDVLRPLRAISSLLAA"
FT   CDS_pept        9762..10370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpR"
FT                   /locus_tag="SJA_P1-00090"
FT                   /product="resolvase"
FT                   /note="invertase/recombinase like protein / site-specific
FT                   recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98961"
FT                   /db_xref="GOA:D4YYA0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA0"
FT                   /protein_id="BAI98961.1"
FT                   /translation="MAIRTRSQNDGKTDTIGQHVALIGYARVSTADQKLALQLDALSAA
FT                   GCDRIFDDYASGAKADRPGLAEALTYLRTGDTLVVWKLDRLGRSMSHLIEKVGELAARG
FT                   VGFRSLTEQIDTTTSGGMLVFNIFGSLAQFERDLIRERTHAGLRAARERGSQGGRRPVV
FT                   TPDKLRKARAHIAAGLTVREAAARLKIGKTALYKALESA"
FT   CDS_pept        10367..11155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00100"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98962"
FT                   /db_xref="GOA:D4YYA1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYA1"
FT                   /protein_id="BAI98962.1"
FT                   /translation="MKPLPIQNSWVLVTGASTGLGRASALRLAASYQAKPLIVGRRLDN
FT                   LRELQSEIGERFNVPCEIIVADQREIEGREKIAAKVIELKVNAAFLAAGLTSAGPFDAS
FT                   RADAYAEVIGTNVAGFTDLLARLIAIFRQQPFESSIIAVSSLAGETSVPFQAVYGASKA
FT                   YVSTLMRALSIELAGTGVSVGSFAPGGIDTDMAALSDLKWGKLGLMNVDRCATLAVDAL
FT                   VHRRSFAIPGMGNRLTYLASRALPRSLVSRLAALPYRRPQ"
FT   repeat_region   11234..11279
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(11833..12165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98963"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N1"
FT                   /protein_id="BAI98963.1"
FT                   /translation="MKKKDADTVRFQLDPGNLPPLTEAQKAELDALQAMPDSGIDYSDA
FT                   PTLTEDFWKTAERGRFYKPIKQQVTARLDADVLAWLKSQGKGYQARMNAILRREMLAAA
FT                   KERRHA"
FT   CDS_pept        complement(12146..12445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00120"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98964"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N2"
FT                   /protein_id="BAI98964.1"
FT                   /translation="MRFSWHPAKAESNLRKHGISFETAASAFADPFALSVHDRIEGGEQ
FT                   RWQTLGLVEGHLLLLVAHTVAEDDDDGEYVEIIHIISARKADRKERRRYEEERR"
FT   mobile_element  12567..13446
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   12567..12583
FT                   /rpt_type=INVERTED
FT   CDS_pept        12598..13392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P1-00130"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98965"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI98965.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   repeat_region   13430..13446
FT                   /rpt_type=INVERTED
FT   CDS_pept        13718..14860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="SJA_P1-00140"
FT                   /product="Tn3-family transposase"
FT                   /note="remnant"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98966"
FT                   /db_xref="GOA:D4Z8N4"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N4"
FT                   /protein_id="BAI98966.1"
FT                   /translation="MLADATNLGHKRMAEACDLVTQRQLSWLASWHLREETYGRALARL
FT                   VNAQHTAPLAALFGSGTSSSSDGQNFLLDRRAQATGAVNPHKGAEPAVSFYSHVSDRYA
FT                   PFHSTVISASASEAAQVLDGLLHHGADLHIEEHHVDGGGVSDHVFALCHLLGFRFAPRI
FT                   PNIAARRLHLFNGIEPGPDIAPLVAGRIDEALIAAHWDDVLRLGTSIRTGVVSASIMLE
FT                   RLGSYPRANGLALALREIGRVERTLFTLDWIEQPEQRRRATRELNKGEAENALKRAIFF
FT                   HRIGRIRDHALQAQTHRASALNLVAGAIVLWNTTYLQAARMHLASLGRSVPPDLLQHLS
FT                   PLGWQHINLTGDYLWTDPDAPSSALRPLRQMHAVEGPAKP"
FT   CDS_pept        complement(14879..15133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98967"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N5"
FT                   /protein_id="BAI98967.1"
FT                   /translation="MVDSSNIYREQQKAVALEFMEKALAILVEVDDSAADCYLQQSIDT
FT                   CMASPRMTFPEDEFWDCVDELPHLTDRVLFLHRQNGVGT"
FT   CDS_pept        15292..15546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98968"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N6"
FT                   /protein_id="BAI98968.1"
FT                   /translation="MLVFRRWLVLAGHRRKWTAAQIGGRGPRRASSIKLRPCIPGVDTF
FT                   VAQGARLSRPDRGRLNRHSELAICTYAHNFRLRAMYICA"
FT   CDS_pept        15555..15929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00170"
FT                   /product="hypothetical protein"
FT                   /note="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98969"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N7"
FT                   /protein_id="BAI98969.1"
FT                   /translation="MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTK
FT                   PLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVYVLHAFQKKSKQGKATPQADMDLIR
FT                   TRLKSAEEHHRQHQTPRGTA"
FT   CDS_pept        15926..16252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00180"
FT                   /product="Xre-family transcriptional regulator"
FT                   /note="uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98970"
FT                   /db_xref="GOA:D4Z8N8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N8"
FT                   /protein_id="BAI98970.1"
FT                   /translation="MSAQDEIIEEGSGNVFADLGFADPDTHLLKAQLVTRVAEAMQERK
FT                   LTQIAAAKVTGSTQPELSRILRGQFRSVSVERLLAMLTRLGCKVDIVVRPQGRTTESAV
FT                   IHFA"
FT   CDS_pept        16252..16494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98971"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8N9"
FT                   /protein_id="BAI98971.1"
FT                   /translation="MCDDFAQARLDMFEAGLFGQGPAFWRWIETDAAQPYLAAFAADRR
FT                   PPEPGEPFAIDLAADDLLAPDRLAQLALQIEADHA"
FT   CDS_pept        16487..16786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98972"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P0"
FT                   /protein_id="BAI98972.1"
FT                   /translation="MLDPNPSVADLDALLDRHRNDDAAMEKIVRGYLRCAIYSYQKHCV
FT                   WRALRHIGKDDWSFKEEDVAALRAEGAKSISDFRDWLIEELAGMGISAHTGLPN"
FT   CDS_pept        complement(16807..17919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbN"
FT                   /locus_tag="SJA_P1-00210"
FT                   /product="muramidase TrbN"
FT                   /note="soluble lytic murein transglycosylase or related
FT                   regulatory protein (some contain LysM/invasin domains)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98973"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P1"
FT                   /protein_id="BAI98973.1"
FT                   /translation="MAADLPPVVIEERVQCSIAAALRYNIPANVMLAVAEQENGRPGAR
FT                   VQNTNNTADLGSMQLNSSYIQSLARYGIRPEYVLAAGCYPYNLAAWRIRNHIRDDKGDL
FT                   WTRVANYHSRTPVHNARYRALIMAKGARWEAWLSSRYNTYSVNGIPVSGGAPAARSASI
FT                   PLTITAADATGGGQLAAQPAIVQPQGSADASAGYVASILAAAFNARITDTWRALEANYG
FT                   AANSFHKYGQAVDFVPRAGLHTITREQIRAVMAQHGIRVAELLGPGDRGHADHWHLAFY
FT                   TGDQTRPLDRAQIVVARAERGVGGLTSAAVQPMASYEAAPAPQARVMAARPNAAPISVA
FT                   VNFRRDMLHPSPTDPTADPRFIPRTITASN"
FT   CDS_pept        complement(17922..19100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="SJA_P1-00220"
FT                   /product="conjugal transfer protein TrbL"
FT                   /note="mating pair formation / type IV secretory pathway,
FT                   TrbL component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98974"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P2"
FT                   /protein_id="BAI98974.1"
FT                   /translation="MQQSRQHFLKVAIADRIATIPAHRPQDHITLEMAPLEIRHRSVRP
FT                   ISAKHAQASRFLQQSPATGEGSSLQDLGTMLVFAVVLLALVNKVPAMVGGVISGGSIHA
FT                   AGGIGAFGAGAALGAAGMAAGAAATGGAMIAAGAMNAAGGASAIKAAFAAAGGSGGEGG
FT                   QTGMGGGQPLSSAGDMPGGGDNGGGGGGGGGGTPLSVAMGGDGGSPPANDNSGLQGGSE
FT                   AASAGGGTAASAAAGSEAADREDGNGGGAAGGSPAGEGEASSASSQGEGAPESGDTGGT
FT                   QRTGLSRAAKTASILGGAAAGMAVGALKERVGNTVGGRLAANIRASAASASSGSETLAP
FT                   ATGAGSPASSSDSSPPPTAQFAGDTISAARDAGDMETPEDEVAAFVQRRGDS"
FT   misc_feature    19087
FT                   /note="may be target duplication site"
FT   mobile_element  19088..19967
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   19088..19104
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(19142..19936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P1-00230"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98975"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI98975.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   CDS_pept        19935..20990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00240"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98976"
FT                   /db_xref="GOA:D4Z8P4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P4"
FT                   /protein_id="BAI98976.1"
FT                   /translation="MLKLHDFCNRARYSIGVGVTGFELDFWGRVRNLSDAARSQYLATV
FT                   QAERAFRLALIRDVASTYFASREADERIALAEATVRSRQEGLRIAERRLEAGVTSALDF
FT                   RQAESLLTQAETELASLRLAEAQSENFLAVLLGGPVPVGLTVPLTLADQKNGTVIAAGL
FT                   PSELMVTRPDILAAEEKLRAARANIGAARAAFFPSISLTGSIGFASTDLGNLIGNEGLS
FT                   WSFGPSISLPIFDWGARKGNLSVAEAREDIAIAEYERTIQGAFREVADALAGRRWLAEQ
FT                   VAAQVRATAAQRAIADLARTRYREGVANYLEVLDAERNLFIAEQTLIQLRRAELDALVS
FT                   LYVALGGGQQG"
FT   repeat_region   19951..19967
FT                   /rpt_type=INVERTED
FT   misc_feature    19968
FT                   /note="may be target duplication site"
FT   CDS_pept        21113..21508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98977"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P5"
FT                   /protein_id="BAI98977.1"
FT                   /translation="MIAMPETASTPPQRRPVIRAVSFDEADAAIGRLLRIALPPTRAAE
FT                   TGASAKVADFLLAWWNGDECGHFPILHLCNVDAVIAEDMLTVMTYLAQESTTYADAWGY
FT                   RDAMHDLWVRYRGDPRRERLNASEDPP"
FT   misc_feature    21480..21587
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        21523..21918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98978"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P6"
FT                   /protein_id="BAI98978.1"
FT                   /translation="MIENDDEAFADNYAERDQAKALREQARAGGLRFEAYLPGDMADWL
FT                   LAQVERGHFVDPSEAVFAIVQNFIEMEPHRDLRDELLRRILDESVARGLEDVKAGRVRP
FT                   ADEVFDELRRELAKPRPEPARWQKIAR"
FT   CDS_pept        21915..22877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00270"
FT                   /product="invertase/recombinase like protein"
FT                   /note="site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98979"
FT                   /db_xref="GOA:D4Z8P7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P7"
FT                   /protein_id="BAI98979.1"
FT                   /translation="MNQLAPLPSPALVLPALIAAADERARLRFLEFFAVTIRNPHTRRA
FT                   YARAAGDFLAWCEARGVASLAGVQPLHVAAWVEALGRELAAPSVKQQLAGVRHLFDWLV
FT                   TGHIVPVNPAGSVRGPAHSQRRGKTPVLAPDEARRLLDSIDVITHAGLRDRALIGLMVY
FT                   SFARIGAALAMRVEDVFMQNRRLWVRLHEKGGKRHEMPCHHNLEDYLSAYIDGCELRED
FT                   RKGPLFRTIARGTKRLSETPLPQANAFAMVRRRAGAAEIGTAIGNHSFRATGITTYLKN
FT                   GGTLETAATMANHSSTRTTQLYDRRPDDVTLDEVERVLI"
FT   CDS_pept        complement(22874..23494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00280"
FT                   /product="putative phosphoglycerate mutase"
FT                   /note="fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98980"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P8"
FT                   /protein_id="BAI98980.1"
FT                   /translation="MRAIFIRHGESTGNAGVPCHDLAAIELTERGHEQARQVAASWTQA
FT                   PALIVTSPYTRTRQTAAPTIARFPGVPVEVWPIEEFTYLQPARCNGTRSAERMPHLERY
FT                   WSAADPDYCDGEGAESFRALLGRCEAALARLAAMPPASLVYVFGHGQFIQAARTIVADA
FT                   DLDERAKMRAFWRKGEPPAISNAQRLGFHWDGDRWACAPAIAA"
FT   CDS_pept        complement(23504..23785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relE"
FT                   /gene_synonym="stbE"
FT                   /locus_tag="SJA_P1-00290"
FT                   /product="RelE/StbE-family addiction module toxin"
FT                   /note="plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98981"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8P9"
FT                   /protein_id="BAI98981.1"
FT                   /translation="MRTIDRSTRFKRDYKRESKGRHRATLDADLLPVLAALATDTPLDP
FT                   KYRDHDLSGDWAGYRDCHVKPDLVLIYAKPDDETLRLARLGSHSEVFG"
FT   CDS_pept        complement(23772..24038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relB"
FT                   /locus_tag="SJA_P1-00300"
FT                   /product="RelB antitoxin"
FT                   /note="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98982"
FT                   /db_xref="GOA:D4Z8Q0"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q0"
FT                   /protein_id="BAI98982.1"
FT                   /translation="MAVSDTYVRARIDNTTKERATAALGAMGLSISDAIRLLMLRIADE
FT                   RRLPFEVKVPNAATREAMAELAAGKGTKFASVDALMADLHADD"
FT   CDS_pept        24089..24454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98983"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q1"
FT                   /protein_id="BAI98983.1"
FT                   /translation="MAMGAVIMRLPLARHRGSSRSRSPSPQAVLAQGDDPHGGSEIAAR
FT                   ISRSSAGVRRRRSCLKGERRSRPPLPRNGNQRDRGSLASLPAPRTTPADSRCPPLSPAF
FT                   LGVRVPADGMAIAGQAI"
FT   CDS_pept        24469..25110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98984"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q2"
FT                   /protein_id="BAI98984.1"
FT                   /translation="MTHEIRESWLNAVAQGMAPLFEALDAPLPDRVRVAIGFTSRGAKG
FT                   KAIGECWDNRLSADGHFEIFIRPDLAHAPDAMPAQIAAILAHELVHAAVGIPAGHGKAF
FT                   KRVALGLGLVGPMRATTPGEAFLAAVASILDVAGPLPHARLDTDGESTAPKKQKTRMLK
FT                   CECATCGYTARTARKWLEQAGAPLCPIEDHGQMQHKPLDDDSEEEGGEDG"
FT   misc_feature    24777..24784
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        25186..25839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00330"
FT                   /product="ParA-like protein"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98985"
FT                   /db_xref="GOA:D4Z8Q3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q3"
FT                   /protein_id="BAI98985.1"
FT                   /translation="MPTIAIISQKGGAGKTTLALHLAAAAEDSGHTALVIDLDPQATAS
FT                   QWAAWRQDVPPVVIDSAPPRLAAKIEQATAQGAEFIVIDTPPHADSAASAAVEAADLVL
FT                   IPCRPSAFDLAAIKTTASLVKMRGKPAFVIFTAGSPTAPRMYEEATQLVQDYGLDACPH
FT                   RVADRAAFRHAAAEGKTAMEIEPDGKAADEVRQLYKWTCEHVNMQASTKRRASA"
FT   CDS_pept        25836..26150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98986"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q4"
FT                   /protein_id="BAI98986.1"
FT                   /translation="MSRKGSLLALRDRDPAPTPASAEPEGRAAVPIAGSTGVGTGSSSS
FT                   SSPVAPSRQGKKAMTGYFSPEMSFAMHMTARKHGMSLQDAMAEAFNDWLRKMGESPVGK
FT                   "
FT   CDS_pept        26169..26696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00350"
FT                   /product="putative acetyltransferase"
FT                   /note="GCN5-related N-acetyltransferase / histone
FT                   acetyltransferase HPA2 or related acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98987"
FT                   /db_xref="GOA:D4Z8Q5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q5"
FT                   /protein_id="BAI98987.1"
FT                   /translation="MAVNATTLSYCRHDFRRSNHAMVVIRHAIFPRDTASVLGIWREFI
FT                   ANSPVNLDYQNNDAEFANLPGKYAAPKGCVLLADREGEIEGCVAMRQVTHEICEMKRLY
FT                   VRPQAQGRHLGRALAERLIEEARTVGYSEMRLDVQAKFVPARKLYETLGFVAAEPISFN
FT                   PVPGASFLGLHL"
FT   CDS_pept        complement(26786..27436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SJA_P1-00360"
FT                   /product="plasmid replication initiator protein RepA"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98988"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q6"
FT                   /protein_id="BAI98988.1"
FT                   /translation="MQQSLQTGGVEETRIFGLIEEARITRKTFDGRMLDLEITLSDWVY
FT                   RSVISKNVLTLHRDYFRLRKPFERRMYELARKHCGVKDEWKIGLELLQKKCGSNSPLRV
FT                   FRALVKKVCEHDADHGHFPDYAVTMDDDVILFRNRSGLKSKPDPLANAGDDAPYIDPET
FT                   MHDAKTAAPGYDVYALYDEWVSWWHDMGKPELKSPRAAFLGFCKKRHERKPLR"
FT   mobile_element  27424..28303
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   27424..27440
FT                   /rpt_type=INVERTED
FT   CDS_pept        27455..28249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P1-00370"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98989"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI98989.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   CDS_pept        complement(28221..28586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00380"
FT                   /product="putative transposase"
FT                   /note="remnant"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98990"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q8"
FT                   /protein_id="BAI98990.1"
FT                   /translation="MTRILARIDRWIVDVDIDPCPPLGWRFWTLPGFPTDPVEPHPYGG
FT                   TRCLALALIDWDDSAQWLCAMERDESFRLFATHDLFPCAAQHGVEAFASGLCCKDWRQS
FT                   EVGCRSAPIRRLLRNGG"
FT   repeat_region   28287..28303
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(28583..29704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98991"
FT                   /db_xref="GOA:D4Z8Q9"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Q9"
FT                   /protein_id="BAI98991.1"
FT                   /translation="MTPALAANIALPPVAIDATIERAIRDRAWFVFSLSGGKDSGATAA
FT                   TVSALLDSIGHPRSRRLAIHADLGRAEWRTTPSTVEAVSRHLGLPLIVVRRRAGDMVDR
FT                   WEQRFRDGCRRYADLLTYNLIGPWSSSALRFCSSELKANVIGPELARRLRGETVVQVIG
FT                   IRRDESSARQLTPVSKLDIRFAPSGNAAGTRMMLWHPLIDWTAQDVFAAHEQYHVPLHE
FT                   AYARGSTRLSCAFCVLASLPDLTIAANVQDNLSLYHHLVGLEAHSTFSFQPARWLADVA
FT                   PDHLPETLKRDIDQARCDAGRRRSLEASLPKGLRFVKGWPPRLPTWDEAVRIAEVRAEL
FT                   LYRHALQHRYPTATMIRDRFAALIEERDLKRAA"
FT   CDS_pept        complement(29701..30153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98992"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R0"
FT                   /protein_id="BAI98992.1"
FT                   /translation="MTTLDLAERIIADFACAESRLRLIKPVPHHEWLVPPGELYWFAGD
FT                   VPTSVAHGASIFLRRTPADPLLEDQIHIEVRLFWDEPWRMDKPATHRAILWCERGPRFF
FT                   GRSTSLIGSGASFFYACCIEHLCEDVIEAIGTALYVWNRLREGTRS"
FT   CDS_pept        complement(30150..30614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98993"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R1"
FT                   /protein_id="BAI98993.1"
FT                   /translation="MQILAARKRIAGTLPLAEYRILIPFDAITPTRSALISMRSNYGVE
FT                   GGPYARLPEVIAPLDWLRMEPGLAKYDAGRDIDRIAKQIEAVLLHAIFPEMTANPVPPI
FT                   YRSPREITTTVIRAHINDISDGYRFLHRKGVTPSGDAPFGLQLLPQSRAA"
FT   CDS_pept        complement(30626..31273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98994"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R2"
FT                   /protein_id="BAI98994.1"
FT                   /translation="MSYDVAFRHRQALDPAALITTTGALHALCAAITDCRNAGKDIETD
FT                   PAVLLLARHLGSVATDGKPAASDLRRACITEIGEIERNPLLLLLARRFVSYDEAAKRCY
FT                   HAEGRRVLKRLADALRLERGEYDIHSCVGGPAVAGEISLHSSNLYVMIGIDWPDERRHV
FT                   LFRRVSSRQDYTGGPNHWASIKEVLSPDIFVERLTRELQLTPPAAAPARLFA"
FT   CDS_pept        complement(31431..31919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98995"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R3"
FT                   /protein_id="BAI98995.1"
FT                   /translation="MDARHIETRLDRFAKEGGIVPLRPFYIWGEFRIEWNGESLYSDEA
FT                   HEYCETCADALLAKLLPLLPEDQREDHRVSATELHHEDTSKNCMICGALLDYALNECGV
FT                   ASELDHYRAYPPAGKLHPGDAFHIARMLEAAPANRAVLRLGKAAIQHLPQHDGALATA"
FT   CDS_pept        32034..32228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98996"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R4"
FT                   /protein_id="BAI98996.1"
FT                   /translation="MMRELDEEERQVLRDLDAGVSTADLIAMVRDLAEILRGRGHVVQA
FT                   SVAEIAADRLNLLSTGVRA"
FT   CDS_pept        complement(32259..32957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98997"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R5"
FT                   /protein_id="BAI98997.1"
FT                   /translation="MSTTSPRDLARLLTRACAAIQFLPGHDPARMALIQDLTEASQNLG
FT                   ALGDRWPIEIHVGTIEHSEGVNGYVGASRSELMEKIGEFCREWWDQINDNRDPATLGDE
FT                   EVASVYSEKHPEDHVHTDRVQLEAAWPSASGFPIETGQYCVLGIGHLSMPTADVLDQWC
FT                   SEKSDDRPLPLAETPYGWFIPTREVDEATRADIPADLLAVMQFGRERGFEHVLIDRDAG
FT                   TTDDLPLFTW"
FT   CDS_pept        complement(33057..33254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98998"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R6"
FT                   /protein_id="BAI98998.1"
FT                   /translation="MNRCRKHIPELEDIPLNFNRVFCRNCGRKGLLSNGRSRTGKRRIV
FT                   WLTTQPPDARDGPGTERPAP"
FT   CDS_pept        complement(33260..34126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI98999"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R7"
FT                   /protein_id="BAI98999.1"
FT                   /translation="MRIQHSTSIDHLIHAAAETVANEYLSISTATEHEFRNERERTRYA
FT                   ALVRAWGLFAHGDRFLACLAEPAVDAQAIPAERPVRPVCSHCGSDSLVRDASARWDADA
FT                   QDWAISGVYDCTFCDECSAESDDLCKWVPLPPADPTPLEPCLSARVRILERPRVGGDRF
FT                   RNREGVIVKAHFAGFYVKLDRTSREKTDKTELVETGFLEVLALPRPIAIEDGFQAFETR
FT                   REELRRHRKPSRADNPLEFDRLAQHLRQSRINCGADHARCVAQGFASDFGWDADELLHA
FT                   AGLSAEG"
FT   CDS_pept        complement(34266..34796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99000"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R8"
FT                   /protein_id="BAI99000.1"
FT                   /translation="MAIHDLIEAYIATPAAEAEQKILRAAQLLGPGCLMPISPVDSPIS
FT                   RSARPCINDAVNLVLLAWSLCPLDDDAQHLFHDLGMAALARLATALGFASGACSNLWQY
FT                   GEASTSGDLYMFAGEFVFSLTLDQVMIGEELAITRSGDGSGSTFIAASICELLRPDILA
FT                   ARVRSELHYTTPY"
FT   CDS_pept        complement(34907..35455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99001"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8R9"
FT                   /protein_id="BAI99001.1"
FT                   /translation="MSPQPTIFLGGSRSITRLHPAIIDRMSRIVAGGYRILIGDADGID
FT                   SALQRFLAETGYRDVTIFCSGERPRNYHGPWTIHRIHAPFCAHGYEFHAVKDRAMSDAA
FT                   DLGFMIWDGASPGSALNALRLTGQGKPVFIFDSPAGTTIRLETVCDWTTYIGRHPARIR
FT                   ASLRTRATPAEWAMIHADF"
FT   CDS_pept        complement(35481..35981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99002"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S0"
FT                   /protein_id="BAI99002.1"
FT                   /translation="MNIELRKLKLNRQLSEETNCYSAEIWIDGVRAFLAGNHGHGGADH
FT                   YRQVGTLSEQEVDAWLKANRPKILIADVELDHSLEIEVSDLIAEHQQVAALRRKARTHL
FT                   LTIEDGQIFSRPLKGRDPDAFAVHLRRTKPDLVVIQEQGDDGFKRAARLLIGAARVKEG
FT                   RGR"
FT   CDS_pept        complement(36038..36739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99003"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S1"
FT                   /protein_id="BAI99003.1"
FT                   /translation="MTQAAPANPSPRLYSQTEHDDRGNFHYQGDLYREREPLPSICKRI
FT                   ERHLPQIFGDAQFSVRRQSSTGSRTIIAELLDAAEDLQDRAARDAFTARVRDQIERFSF
FT                   TRSNFYQDYISCAFSTDVRIGPAYWAALAARRGNANPVASLIPLTAFKRQLKPGDQLKL
FT                   VSASAGHPALGATRTVQAVRSGDLIFEGKIYLSFPRASCFACDGKRVRFAIGSEYEPDR
FT                   HLVYEWLQIGL"
FT   CDS_pept        complement(36762..37001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99004"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S2"
FT                   /protein_id="BAI99004.1"
FT                   /translation="MSVPFKNEAGDHLRRLEHLAIARHLSTGVPHCIVQRSPAASPVIL
FT                   PEADVIAGGPMLIDSILWSTDTAETDGFDPALLA"
FT   CDS_pept        complement(37003..37464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99005"
FT                   /db_xref="InterPro:IPR017042"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S3"
FT                   /protein_id="BAI99005.1"
FT                   /translation="MTKTAQSIYDEAVLGATICYSDGTPRPPDRFKRKLRAWEARNGRG
FT                   RLTRRSPGSRGSRPYPATFTLHEGNYGSEGVIILSVNRIFSVADERAFEIVDVPSPGAA
FT                   LVLHRWSDEPELLHVAADRAAAESWRDRHGYPNAYIEIVGEAESVTKVA"
FT   CDS_pept        complement(38027..40429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00540"
FT                   /product="putative DNA methylase"
FT                   /note="C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99006"
FT                   /db_xref="GOA:D4Z8S4"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S4"
FT                   /protein_id="BAI99006.1"
FT                   /translation="MLHAAPSTRVIRHAHVFCGLGAGARGFNMAKARVGNVVARFLCTG
FT                   GIDVDAGAIRNFERLTGTPGTVMDLFSREQYRAFHGHEPPPGWREATPADVWRALVGAD
FT                   GIRPDVIFLSAPCKGFSGLLSSKQALTERYQALNALTLRGVWLICEAFKDGPIPIILFE
FT                   NVPRIQTRGRALLDHISAILRAYRYNIAETVHDCGELGGLAQSRKRFLLIARQREIIPN
FT                   FIYEPEKKRLRGVGEVIGKLPLPGDPVAGAMHRIPMLQWKTWLRLALVPAGRDWRALNE
FT                   LAVVDGVLRDYGIVPDRPLRENALGVMDWADTAGVVIGNQRSPLHGRHSVADPRPHSAD
FT                   WNSDVLGVRTWSDASGTVPGRSGPTNGAHSVADPRYAARDRASTLGVRAWTETAGTVQG
FT                   ESYPTNGSFSVADPRPAYGISTHRHVLGVNPWTRASYTIIGSAKPSSGSFAVADPRIAG
FT                   HPKSVQMGVRPWTKPAGVVTGSMVAGGGPNSVADPRISASPRFNNIYRVVAFNAATPSV
FT                   ADPRMETRDYKTTKYKITPWSGQTRTVIGASTTGDGAYAVADPRTGYGPNSHRNKMRVV
FT                   SAEAPAPTVTGSDRVGSGALSVADPRPLGLNSPGRDGYATQGHYGVVGWGDRSYAVPAY
FT                   AKYDRGHWSVADPRHEEGNPSCDDGPSPSLPAPDDRLVARIIALDGTWHRPFTTLDLAA
FT                   LQSIVDPEAIFYQDRDGVWHARMPFDLESESDSEKREWIGNAVPSESAAEIGSVIGEAI
FT                   LLAEMGETFTLSEKTIWVSPVRVALAVDSWQAATDLDGMGDIMRLVQ"
FT   CDS_pept        40391..40570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99007"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S5"
FT                   /protein_id="BAI99007.1"
FT                   /translation="MTDHARRGRCMEHWGTFRAGGRFDPLPPLPSWPARWPEGSWRHDA
FT                   RPAGASRIFGMQLC"
FT   CDS_pept        complement(40593..40826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S6"
FT                   /protein_id="BAI99008.1"
FT                   /translation="MRIDYSIQGSFSVPEGSAFLPGSANLVRLPGGQVISVHPVIEMAS
FT                   DANADDHRNLNYEEARALDVILEDYERSSVPW"
FT   CDS_pept        complement(40897..41925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99009"
FT                   /db_xref="GOA:D4Z8S7"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S7"
FT                   /protein_id="BAI99009.1"
FT                   /translation="MPIEIVVGLPHLSEGPILQRARAMGVPALISANCLSRWKRRDGWR
FT                   EWAGWRLGTLANAAGLRSLDLDCGGFSAMVRYNGIPWSVDEYMALAASYPFRRFASLDY
FT                   CCEEAVARDREEVLDRISRTIRANRDCRMRAADLGILDRLMPVIQGRLPTDYERCVDAL
FT                   WQSMKPGTIIGIGSVCRRQIFGPEGLIAVFEHLDRILPKGVFCHGFGVKGDCLPYLKGL
FT                   EHRVIAVDSQAYGTLARVDANQRGVAKTDRLVADHMERWTARQLQRRSEPARPRQGELG
FT                   LGAPEPRPADRWQRAIAQAYQEIRAKIEMGDLDHNEITAGWIQEWAADIYTAEEGDDAQ
FT                   NP"
FT   CDS_pept        complement(41942..42772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99010"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S8"
FT                   /protein_id="BAI99010.1"
FT                   /translation="MQLQVQPAADLRALLDRNPVIGEPRRGPRRFWTTREEKLLGEHYP
FT                   AGGVEACLLHLPGRTATAIYNHAATLGLQAPSTQKHDFRRQRWTSSDHIDAVIRRAYQR
FT                   TPAKGDIDALAVAVGRPRWWVTKRASKLGLVTPRFKEPAWTDAERDVVHDNFHRSAKTI
FT                   QRMLKRLGFVRTETAITVMGKRMGATREDPHHVTAHGLATLMGVDAKTVSGWIARGLLK
FT                   ARRRGTERTAAQGGDQHWIHLRDVRGFIIDNAAVVDIRKVDKFWFIDLLAHSHN"
FT   CDS_pept        complement(42924..43154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99011"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8S9"
FT                   /protein_id="BAI99011.1"
FT                   /translation="MSKSANNDTRLTPWALRRAQIIERARELAKSGAYRSWETVALHLI
FT                   ADGYEDARDILDDPVLREELDSYCGRESDRA"
FT   CDS_pept        complement(43322..43831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00600"
FT                   /product="putative acetyltransferase"
FT                   /note="GCN5-related N-acetyltransferase / histone
FT                   acetyltransferase HPA2 or related acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99012"
FT                   /db_xref="GOA:D4Z8T0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T0"
FT                   /protein_id="BAI99012.1"
FT                   /translation="MSDRFAIEPLVKSHRRSDFTCGNERIDRYFRETVTQDVRRNYAKC
FT                   FVARAVDTSKVAGFYTLSSSNVPLTEVPEALAARLPRYPTVPAVMIGWLGRHIDYRGLG
FT                   LGEALLFDAIETVATAPIGAHAIFADAIDEQAAIFYTAYGFTPLTKRPLTLYLPIATAL
FT                   PLLSEH"
FT   CDS_pept        complement(43828..44118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00610"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99013"
FT                   /db_xref="GOA:D4Z8T1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T1"
FT                   /protein_id="BAI99013.1"
FT                   /translation="MPRQNAETETARLEARIPVQVYDQMQRAARLRGMTLTGYLLATAG
FT                   EDARRAVEDADILRLAREDQIRFAQALIDPPTPNDRLKRAASRHRELIEPQ"
FT   CDS_pept        complement(44328..44711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00620"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99014"
FT                   /db_xref="GOA:D4Z8T2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T2"
FT                   /protein_id="BAI99014.1"
FT                   /translation="MIAIDTSALMAIVLDEPQATACIAVLEAEDEILISAGTVAEALIV
FT                   SERRNVGEEVGTLIDGLGFDIVDVTPAAARRVALAYARWGKGIHPASLNFGDCFAYEVA
FT                   KEHACPLLFVGDDFAKTDIGRAT"
FT   CDS_pept        complement(44708..44965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00630"
FT                   /product="putative antitoxin"
FT                   /note="antitoxin of toxin-antitoxin stability system /
FT                   prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99015"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T3"
FT                   /protein_id="BAI99015.1"
FT                   /translation="MQVSVSDAKGQLTELVRRAEAGDEVILTRHGHAAVRLVPIKRAPD
FT                   GKKRRQLLEAARRAGATKAVAGPDAAHSQDFLYGDDGLPA"
FT   CDS_pept        complement(45204..45731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00640"
FT                   /product="putative acetyltransferase"
FT                   /note="GCN5-related N-acetyltransferase / histone
FT                   acetyltransferase HPA2 or related acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99016"
FT                   /db_xref="GOA:D4Z8T4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T4"
FT                   /protein_id="BAI99016.1"
FT                   /translation="MTLPSWYEEAISKAHDRVSFDCGDDDLNIFLQRYARQSHELGGAK
FT                   TFLAIDDADSKTVLGFYSIAPGSMDYADTPELVRRGLARHEVPGFRLARLATDIRVQGK
FT                   GLGGQLLGAIARRCIRVAAEVGGVMLIVDAKNERAAAWYASYGAVPLHDKPLTLILPFA
FT                   TLERELRAASQF"
FT   CDS_pept        complement(45728..46006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00650"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99017"
FT                   /db_xref="GOA:D4Z8T5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T5"
FT                   /protein_id="BAI99017.1"
FT                   /translation="MPRAVVEDNRRMSLRIRPEQKALLARAAALKHTDLTTFVTRSALR
FT                   EAESVIEEAERTKLSERDSLLVLDLLENPPPANAKLRAAIAAMPKQA"
FT   CDS_pept        complement(46426..46737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99018"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T6"
FT                   /protein_id="BAI99018.1"
FT                   /translation="MTTATIHGSHGSLTVHVATGHIVERKLEGDEYADIPFFDPTPIAR
FT                   WRGDLDILAAGYWTTRGDYAEPLTIRLTQWRGGTIFDDWVPLRLLPAPRQHDPTSEIA"
FT   CDS_pept        complement(46752..47513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99019"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T7"
FT                   /protein_id="BAI99019.1"
FT                   /translation="MSRPHILSIGSAPAEEACAQLGVTRNYDRAAFLEACCYRAAIIAT
FT                   HGRPPDGVSLRPARCAHDFGSYVEIQAHYDPADPTACTYAEQIENGLARWLDAGFLAPV
FT                   RYRDDSQIEEYIYQDHFEAARRVMLTLERQRIDGFGTAAEAAAIAHLRAEYPRQSEEAD
FT                   QLLRQIATERQIRSPSARQVGLYASYRLTFFPALFNEARGHGYPEGDAIDVTAYELRTG
FT                   RHRYIQCDIVTVTTIDEALSLCWEHMARYVI"
FT   CDS_pept        complement(47637..48620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_P1-00680"
FT                   /product="antirestriction protein ArdC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99020"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T8"
FT                   /protein_id="BAI99020.1"
FT                   /translation="MPRRFAPRSDAPSPAQTITDAIIARLETGTKPWVKPWTGSAPQRP
FT                   LRVCGTPYRGANIFWLWLVADLMGYRSPTWMTYRQSAALGGQVRKGEKATIAIFYKSYA
FT                   KSVADPITGEEDRQTRRVLRSYPVFNCDQIDDLPDRYYAQPELAVARNEPDPARVADLM
FT                   AFFDAIPAEVRHGGDRAYFHIQEDYVQLPPVESFADFHCYSAIRCHELAHWSGAESRLD
FT                   RKFGHRFGDEDYAVEELCAELTSAILGSELNLPVMLLDNHASYIQSWIDVLRADSKALL
FT                   TVASKAEEAASYLLGLAGRHDDPAGDIVGDEADNDDDVPAEMSKAA"
FT   CDS_pept        complement(48695..52963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00690"
FT                   /product="putative methylase/helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99021"
FT                   /db_xref="GOA:D4Z8T9"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8T9"
FT                   /protein_id="BAI99021.1"
FT                   /translation="MASIAPDLFTHVALSNDRTPHLLAIAHSLVPDLLRGTTIDRKTLA
FT                   DRATAHFGSTDATGRWAMRDAYDALEAAQVLSVRNPKGWLNQAGDADILARLHDRMLGL
FT                   STQSYRSEGQIELQQFSTPLTLAFVAARAAHILPSDLVLEPSAGTGMLAAWLPRDIPVH
FT                   LNEIDPQRAALLEGVLGQIVTRYDAEYIDDLLSPVVRPSVILINPPYSRSTTRGDDPHA
FT                   GARHLRSALLRLAPGGRCVAIMPAWFSPHSSGRDGYAVVEKLLPPRLDLLVGKAFVKHG
FT                   TSIDTRILVFDKIADVQTQRVACDGLADALAHVTKCDRLVGEPTAASIMRKPAPLLRRP
FT                   AAGSLLGKLSAPRTLAPKAVAATDNAPRPLDYAVREHPLPAEEPVGVYVPYRVARIDIE
FT                   GARLHPTPLVESAAMASILPPTPTYRPMLPSSAIRALSDAQLETVIHAGQAFERMLPGR
FT                   FKANEAGTLLVEQDDGAEYRQGFFLGDGTGAGKGRQVAAIMLDQWSQGRRKAVWVSRSS
FT                   ALIEDARRDHCALGGLPLDIQPLDAFAPGTSITMDTGILFVTYATLRSQRHDQQSRLQQ
FT                   ILAWLGSDHDGVIVFDEAHAMANAAGTETKFGTQKGSEQGLAGVRLQNLLPKARILYVS
FT                   ATGATDIANLCYASRLGLWGPGTAFGSRDVFMSQMTEGGVAALELVARDLKALGLYTAR
FT                   ALSFAGVEYDMLVHQLSADQIAVYDAYADAWAVIHAGLEAVLEATGIVDRMGGRTLNAH
FT                   AKGSALSRFESQKQRFFASTLLAMKLPTVIQEIEKEIDAGHSAVVQLVTTSEALLNRRL
FT                   ADLSPEERAELDIQLSPTQTMIDYLMNAFPTRQMQVFTDENGNPYSEPMTDEDGNPVHS
FT                   KEAIDRRDALIEQLCVLPEIGSALDEIIAHFGTAQVAEVTGRSKRLVRDRDGRQRLETR
FT                   SARSNLGETAAFTDGSKRILVFSDAGGTGRSYHADRDSRSAGYRRIHFLLEPGWRAAEA
FT                   IQGLGRSNRTNQASAPVFRPCTTNCRGERRFISTIARRLDSLGAITRGQRQTGGQNMFD
FT                   PADNLESEYALEALRQWYQMLHAGKLQSVSLGDFCRMTALKLVDKDSGELVENLPPIQR
FT                   WLNRLLALRISVQDAIFTEYLALIEARVEAAREAGTLDVGVETIMTERLVELDSTVLRT
FT                   DPHSGAETRLVHLELHRRRHALSYAALMRDWSDVPDALPVRNSRSGRIALRVPTWPDMD
FT                   DDGKFRTAWRLQRPTGSERIGGAEFAKSHWEFCDSETFETLWHEEVAEAQSKIDVETIH
FT                   LATGLLLPIWHKLPDRSMEVWRIADKAGNGLLGRIVAAADVARMADQLGIEIAVTLSVQ
FT                   EILAAARRPDGIVIPALGKARLIRSRVNGQQRYELKEFDAARLPLYKSRGAFTEVVQYR
FT                   TRLFIPVDQADEVIARLIAD"
FT   CDS_pept        complement(53182..55212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00700"
FT                   /product="ParB-like protein"
FT                   /note="ParB-like partition protein / putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99022"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U0"
FT                   /protein_id="BAI99022.1"
FT                   /translation="MTEILYIPASKLSVSPLNVRKSQDPVADAQLRADIIARGVLQNLI
FT                   GVPKARRKGHYEITAGGRRLTQAQAAIAAGELPADYVIPVKPMADVGDAQEASLAENFQ
FT                   RLKMSPTDECIAFLHATQRDGQTPAEVARRFGLTERFVLGRMRLAKLADVVFDALRDGK
FT                   ISLDIAMAYATTSDTARQQAVYEQLSRGGYGINAYTVRRMVQEGGCRGTDPRARLVGRE
FT                   VYEAAGGRIDADLYDDAGGETWLDTELLDRLVTEKLACFASDTRDAMGLAEVRVVGDSA
FT                   DIWSEARALQTIKLDSPALDDEAQARVAVIEQEIEELQTTAGEGGLSDEQQARYDGLGV
FT                   ERERLLAPMPTISDEQKSSAIGFVYLSRDGSLQLHQDFYGKLVEAPAPGAPAQDAVADE
FT                   RSPSSEGLAGVAEEPKAKGLSKRLTDELAHQKTELVALHVASDPHFALMLGTFVMVDKV
FT                   VCRYADQDGSLLPSTLACRTPESALSDFKSGTQAAERWTELESTLDRSWAELVTPIERF
FT                   EAFRALDDDMRAAWFGWAVARTLIPTAYGETGDIFISHVGEQLEIDVAAWWRPTALNYF
FT                   DRAPKHVTLDAIDRVGGPELRHRYALAKKGDLATTAEKLFRGDSLIEADAKERALAWVP
FT                   TEMSFSARLDASNPAVEVAHLGDEASDTGAMHNPDTFADAA"
FT   CDS_pept        complement(55345..56244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virE"
FT                   /locus_tag="SJA_P1-00710"
FT                   /product="virulence-associated protein E"
FT                   /note="putative primase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99023"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U1"
FT                   /protein_id="BAI99023.1"
FT                   /translation="MTATIELETAGRRIVEALKGHWRKSSGMCRCPAHADRDPSLSVRV
FT                   GRTSLLFTCFAGCDRVDILRAIRNARILDTDYVPTVEASGADDYAPDSSALWRRQRAQE
FT                   IWDRARPLAGTPAQHYLQERGLPGYNSELRYLARTPIGTDRGLGYRPALIAAIRDTRSL
FT                   VAIQRNFLDITIPAKALDLENPKMALGAPDAGAVRLMPAQDILGIAEGIETSWSASLLH
FT                   EIPVWAALGSERFGQIAIPDHVTRLILLPDPGKAGRRAEALALEAHARPGRTIETIWPP
FT                   RGWGDWNDVWLRRLKQGF"
FT   CDS_pept        complement(56585..56740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99024"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U2"
FT                   /protein_id="BAI99024.1"
FT                   /translation="MRRVRGLKPIRGPVFEQVNFLPCYQTDVKAPAKAMALVASFRTQD
FT                   VDLIAM"
FT   CDS_pept        56758..57642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00730"
FT                   /product="MucR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99025"
FT                   /db_xref="GOA:D4Z8U3"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U3"
FT                   /protein_id="BAI99025.1"
FT                   /translation="MSEAEKPDLTSLTVQLLSAYVSNNTVESSELAGLIQSTRAALSED
FT                   KAPDAPAAPEFVPATTARKSLASRDHIISMIDGKPYKTLKRHLATNGLTPSEYRERYGL
FT                   PRDYPMVAPGYSEQRREVAQRLGLGRKPAVAKQDEENKIVDAAPAASAEARALDNAAAP
FT                   VAAPVPSEAPAKPARTPRKAAKAPATKARSVKTAAAAEPEVAPQEAPATDDVAVSEAAP
FT                   VVSEAPAKPARKPRKSASAVAKEASVAEKPANGDAAKPTRGRRSKGNEVTSVVEAKAPR
FT                   RRKAPAQPAVEAG"
FT   CDS_pept        57828..58124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99026"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U4"
FT                   /protein_id="BAI99026.1"
FT                   /translation="MDLLTQAIREQLCIRATYNRGLVRMAPHILYTRHDALFVDAVVTE
FT                   RNGAAPAEAKLGSFRLTGLSGVAMTMEPFRRFVSFDPTDERYVGRTIATVEQD"
FT   CDS_pept        complement(58215..58511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99027"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U5"
FT                   /protein_id="BAI99027.1"
FT                   /translation="MPIFNKDIVEDRRVNYDTERLDELVLALLWLNLDTTGTAWKGFDW
FT                   SAMERLHDRNLITDPVRKSKSVLLTHEGLAEGERLFRELFTRSPSRAADDALE"
FT   CDS_pept        complement(58561..59127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99028"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U6"
FT                   /protein_id="BAI99028.1"
FT                   /translation="MSLTIDLCQNLRCVKPDKHLSQLAPRGSEALVAAADIAGQGRAAI
FT                   LVDTTVYIHDAAGTLPAAAVSLVDRGLLFHCAICIGELTTGVANADPSSAGWKELRDHY
FT                   AGLIVSIQPTRLLTPDPEVWSEAGLIAGTLARTQTYQRHQRKEALNDALIFLTAAKAGL
FT                   PVLTANRDEFDLIQQLAPHGRFIYF"
FT   CDS_pept        complement(59111..59449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99029"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U7"
FT                   /protein_id="BAI99029.1"
FT                   /translation="MVTCTASSKGGKRPGKAGAAGRARSATPKRITVASVVMEEARRTG
FT                   LLDGDSTEHVSFRAPKALIDAAKHESGATKPTELGLLALAMLAQPDPAASYMQRTRGKL
FT                   GADHELDY"
FT   CDS_pept        59665..59859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99030"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U8"
FT                   /protein_id="BAI99030.1"
FT                   /translation="MIGDDGWPFTKIRKPEPVPQRPRADKWRAVVPGLSPPKTEKNFLR
FT                   NGCSGVESILMTVSGFVST"
FT   CDS_pept        59920..60171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99031"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8U9"
FT                   /protein_id="BAI99031.1"
FT                   /translation="MPHLAWSRARHRMQADDPMVAEAIRLMEKALNLFDNAGIGTAAFA
FT                   CHLSMAIDCAQAAFDADGVSMLRQFGDNEALPEGGSLH"
FT   CDS_pept        complement(60191..60640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00800"
FT                   /product="ECF-type sigma factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99032"
FT                   /db_xref="GOA:D4Z8V0"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V0"
FT                   /protein_id="BAI99032.1"
FT                   /translation="MSWLTLARLIRAIAHRLRRSAQNSPSRQSLGSGRRSGPPVIAFAR
FT                   AHCSERRDIEIDALETEFHVRASGIAIRAWLIVGRDDMPADLLSTAMRAAQKLDMLPPP
FT                   ARQIFYLTASYGLTVAEVARLLGMSRRKTRRYLLQAIACLDSRSL"
FT   CDS_pept        60903..61529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="SJA_P1-00810"
FT                   /product="conjugation factor synthetase TraI"
FT                   /note="N-acyl-L-homoserine lactone synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99033"
FT                   /db_xref="GOA:D4Z8V1"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V1"
FT                   /protein_id="BAI99033.1"
FT                   /translation="MIQIFQGSLALGTNALFDAMHRDRKRIFVDLLKWDVPVVEGRYEV
FT                   DQFDDERAVYLVAPDSDGGHRGSIRLLASDGPHILGSVFPWLCEDDVPRSRHVFEISRG
FT                   CLSPRLRAAERLQVRNALTTAAVEYALLHDIESFTCIADSGWLSQILSLGWDCWPLGLP
FT                   VKIGRVLTGALKIDIGSDTLRKLREAGTYAPAQLIFAVQAEGVAA"
FT   CDS_pept        61526..62437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00820"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /note="protein involved in biosynthesis of mitomycin
FT                   antibiotics/polyketide fumonisin"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99034"
FT                   /db_xref="GOA:D4Z8V2"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V2"
FT                   /protein_id="BAI99034.1"
FT                   /translation="MKIMSFAAARPRYDGHTDIVTRLFSQGYCVVEDAVGQGDLAALRR
FT                   DLEPLFEQTQRSVGPFYGDATKRFHGLLRRSRHMETFVLQHDILRAVETVLGNHCDSIQ
FT                   LNLTQAIEILPGGEMQPPHRDQDMWPLRTPGVEYLVNVMWPFTPYSADNGATVIWPGSH
FT                   RRQDEIVIDESEAIPIEMAPGSALLFLGSTLHAGGANRTRAPRRGMIVSYSLGWLKPYE
FT                   LPWLAYPPEVVSALPRELAELAGYRAHRPNLGTHEGRCPSYLLSGERADLGAIDALLPE
FT                   QEELIALYRTGALAPSNSHAAP"
FT   CDS_pept        62508..62921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00830"
FT                   /product="MarR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99035"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V3"
FT                   /protein_id="BAI99035.1"
FT                   /translation="MEACRLLIAERKQIGTHLGFDLCPVPAWDMLLDLYIAFHEGRETH
FT                   ISSLCLAANIPLSTAHRKVGEMVQEGILQRGFAGGRVTVDLTGKYVEKLDRLFDDLIAA
FT                   VFADGMYFPNLPCQTLGGKSSLGNQDVAQGAGK"
FT   CDS_pept        63111..63386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00840"
FT                   /product="histone-like DNA-binding protein"
FT                   /note="HNS-type DNA binding protein / bacterial nucleoid
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99036"
FT                   /db_xref="GOA:D4Z8V4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V4"
FT                   /protein_id="BAI99036.1"
FT                   /translation="MNNSDLAEAVAGAHGLSKADAKKVVDTVFSTIGEAAAKGDEISLN
FT                   GFGKFKVKASSERQGRNPATGETITIKASKKLGFTPAKVIKDKLNG"
FT   CDS_pept        complement(63629..63820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99037"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V5"
FT                   /protein_id="BAI99037.1"
FT                   /translation="MLRSIGRMDFAVAPGRSDGAKNGGDSNSRDPSWAPRGRTLASPPY
FT                   GTAAEQEEILRIRNDDFH"
FT   CDS_pept        64247..65035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00860"
FT                   /product="putative oxidoreductase"
FT                   /note="NADPH:quinone reductase or related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99038"
FT                   /db_xref="GOA:D4Z8V6"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V6"
FT                   /protein_id="BAI99038.1"
FT                   /translation="MHPASRSATGSSPASRRTRSAHLPTMRSSRKPLLAKMPASLDFET
FT                   AAGVPLAGLTALQALRDELHLKPGSSVFIPGGAGGVGTFAIQIAKWLGAEVTTTASRRG
FT                   RALVERLGADVVIDYTTQDFADQVRDMDGAFDLLGGDTLHKIFGVVKSGGKIVSIAGLP
FT                   EPETARKDLGRGIGLAALFWFASYRSRAEARRHGVAYRYLFMHPSGAELAELGQLIEDE
FT                   RLEPVIDRVFPFADIAEAFTYLEAGRAKGKVVVRMDDDAG"
FT   CDS_pept        complement(65032..65457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00870"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99039"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V7"
FT                   /protein_id="BAI99039.1"
FT                   /translation="MTPTTGRWSVSSKCSDPPMRRRLPRYGATPSGRTGSGSSSCSLRV
FT                   CRSQKVRFYGIRSVDEARTYLDHPVLGTRYRDCVTALQDLPISDPVAVFGAIDAMKLRS
FT                   SLTLFEAVQPSALLASALDRWFGGERDAETLQLLGAD"
FT   CDS_pept        65581..65850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00880"
FT                   /product="prevent-host-death protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99040"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V8"
FT                   /protein_id="BAI99040.1"
FT                   /translation="MRAETYGAADFKTKCLAILDRLASRDVDQVTITKRGRAVAVLTAP
FT                   PSTADAVGTLHGFMRGSVSVPRGIDLLAPSLDETLTAEDGKLHG"
FT   CDS_pept        65847..66302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00890"
FT                   /product="putative toxin"
FT                   /note="toxin of toxin-antitoxin (TA) system"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99041"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8V9"
FT                   /protein_id="BAI99041.1"
FT                   /translation="MTNGQKPTTAPRAVLLDTCAVIWLANGDSIAPAALEAITHAALAD
FT                   GVFVSPASAWEVGLLSRVRGDKSPSVAFLPDPQSWFASFMAGPAIREAPLLPEIAIASS
FT                   LLPEPLHGDPADRFIIATARHHRVPVITRDGKIIEYASAGHVSVIEC"
FT   CDS_pept        66755..67507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00900"
FT                   /product="ECF-type sigma factor"
FT                   /note="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99042"
FT                   /db_xref="GOA:D4Z8W0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W0"
FT                   /protein_id="BAI99042.1"
FT                   /translation="MACAHVQPATVKAHALCALPGFFHIRLWPSPRVDIGRDANGPEHG
FT                   TNIGESRLHSAASGVCVMPPRLNGHAQPNGIVAEKSDGGPEPAGFPEFYRDEVPALVRF
FT                   FRRRLRSSDEAEDLAHEALARFLRASPVTQILMPQAYLKRIAGNLLRDRAESASTRLAD
FT                   LSVPLDESMEPPTPYDQHRELVGREELEHFNVVLQQLKPRTLEIFLMSRVDGYTYKEVA
FT                   KKLGMTLFGVKWHMLRAIEHIDRHRRDR"
FT   CDS_pept        67504..68499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00910"
FT                   /product="FecR-like transmembrane sensor"
FT                   /note="Fe2+-dicitrate sensor, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99043"
FT                   /db_xref="GOA:D4Z8W1"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W1"
FT                   /protein_id="BAI99043.1"
FT                   /translation="MSGGRYFSRARRIDRQAHKWVMRMLDDPQRHAAKLQRWMAISPDH
FT                   QAAYKRVVTEVGYASDAATLMPSLRASTESSRSTWQRPTYFAAATAIAGGLLLAVGWHF
FT                   YSSSTAVLPSPLEQVQTVAIADGEKEIRLADGSTVLMHGATTLSIRYGSTERAVHLLSG
FT                   RARFDVKHDRARPFVVYAKGGSVTAVGTVFEVSVERDVQVRLLEGRVRVAMPPKVHEAK
FT                   GREVLLAPGEKAAFSPAPEPAQQPSISERQPPQRSLNTFDDVPVSVIVAEVNKRSSTKI
FT                   ELVDETAGRERIFADLNLDDADAVARRIARGLGLTIDRSTPGVIRLSKGH"
FT   CDS_pept        68575..71145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00920"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99044"
FT                   /db_xref="GOA:D4Z8W2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W2"
FT                   /protein_id="BAI99044.1"
FT                   /translation="MRYYRSFVLCGAAALALTISNASCAQEPGERDYNVAAQDLKYALR
FT                   DMARQSGLELVAQSAALADKKAPALRGHYSAVEALNFLLAGTGLTAEISEGTIFIRGRS
FT                   EPPVAAAVAEGGSSDIVVTGSRIRGAAPASPVIALSQTQIRLQGQNNLGEAIRSLPQNF
FT                   SGGQNPSVGVGNFGATTTNFNGTSSLNLRGLGPDASLTLLNGHRLAYDGAIQSVDISAI
FT                   PLGAVDRIEIVADGASALYGSDAVGGVANILIKRDYDGLEASFRFGAATDGGNVQQQYT
FT                   LVGGRKWSSGGFIAAYSYEHDTPILARQRSYASGLFGQEDLLRYQSVHNALFSGHQDIV
FT                   EGVELGLDAIYSHRATGGNLPYTTTNDVFFSGQIDRTKAESFSIAPSIKAELGGDWRVS
FT                   LTGTYGKDSTRAHSDYYSAGDVVFVYAGCNCNELKSVELNGEGALFELPGGTARLAIGG
FT                   GYRWIGYKVTVGGVFNYTASRDSYFAYGEVNLPFVSQHQGIPFVNSLTLTAALRYENYP
FT                   GMDKVVTPKVGLIYAPTEDLTIKGSWGKSFKAPTLVQENFPQFAYVYPASAIGAVGVPS
FT                   AATVLYLEGGSKTLKPERANTWSGTVVLHPRALAGLNLEVSYFDIRYRDRVIQPIASLG
FT                   GILSNPIYQGLITYSPSLQLIDSAIGRAATGLSNPFNVAYDPNDIIALIDNRNVNVAAQ
FT                   KLHGIDLLASYRSDLGDGRSLTFSANGSYLKSSQQLSSAQPSAPLAGTIFNPPHYRGRA
FT                   GVVWDDPSLVLASYLSYIGGVTDNRSTSTRHVGSMTTLDLTAVVHLNRATGIFGGIDLT
FT                   LSVLNVLNDKPSVIRTGVDYETPYDSTNYSSVGRFVSLTITKRL"
FT   CDS_pept        71145..73388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00930"
FT                   /product="putative peptidase"
FT                   /note="dipeptidyl aminopeptidase / acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99045"
FT                   /db_xref="GOA:D4Z8W3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W3"
FT                   /protein_id="BAI99045.1"
FT                   /translation="MRILAWTTGALILLLSCPALASAEYAAQASPDCADIISATGHSRA
FT                   SRLQPEDMIRLRDIGPPDGSAAAAGLISASPDGRHLAFQIRRADPAANGYCLAMVVMEA
FT                   RPGAVPRIVDQGGVLIRYQYDDLWGLAGWPTGWPVEIVPRWSADGQWIAFLKKQGARVQ
FT                   VWRARVDGSSSQAVTRSPDDVVGFAWTGDGGIIFSTRPEYGRRLAAIESEGLSGFLFDD
FT                   RFWPLARSRPMVRAGSSLVAFHVNVESQELRSATPEEARTVGAVQEEERVERPLLSVVR
FT                   EGRRAWVTKREPQRYVSPTSLSVTLPDGTTATCTSTACDHIVDLWWSAGSAGVLFLART
FT                   GWGSSDLSLFAWDPSVGSPRRILATADLLVGCQPTGRHFFCLREGSTTPRHLVDIDLVT
FT                   GTSRTLFEPNPEIASLRLGQVQRLQWRNNRGQECFGDLVLPPTHKPGEKHPLIVVQYQS
FT                   RGFLRGGTGDEYPIFLFASHGYAVLSLQRPPERGGLGDAKDQISFERSNIAKWADRESV
FT                   LSAVLEGVRLAESMGVIDEDRIGLTGLSDGVSTVMHALIETHIFKAVSISQCCDDPKIQ
FT                   TNYVGSQFSDFLHQVGYPSLDEGRLDFWQPHSLALNAARVSAAILIQVSEDEYRSALES
FT                   FAALRHSGRPVEMYVFPDEHHIKWQPAHRMAVYERNLAWFDFWLRSIEDTSVERASEIA
FT                   RWKAMRDSSASAPARQVATWPTPRRRPGQEGGYSPCRSSGRIEQVGPGRCRHR"
FT   CDS_pept        complement(73267..75012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00940"
FT                   /product="putative asparagine synthase"
FT                   /note="glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99046"
FT                   /db_xref="GOA:D4Z8W4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W4"
FT                   /protein_id="BAI99046.1"
FT                   /translation="MALRYVIVVGSAAARARIRPQDDPEFALRELFEAPQFSIYAADGT
FT                   SAVTNKRWSSAVIGHLFWTVQPQRVVELDGALAERVQKSSGHEFVERHWGSYVAVFGGN
FT                   GADEVHILRDPLETAPCYYFRCDELWLVASDIATARQFTEPPASIDWSAITQQLLRPDL
FT                   RTATTCISGVTELPGGHRLTLRQDGSKLEELWSPAKFARPRDNVIGKQEAIERVRRVTL
FT                   NSVHAWASCYRNILIQISGGLDSSILAAALRGNRAQLSALTIATTQPEGDERDHASLVA
FT                   DHLGFPLQDAFFDPRRVDITVCDGAHLPRPCARSHVQETDRLTLLAAKAVGAEVVFNGN
FT                   AGDAVFCFLQSASPVADRLLADGIGGALQTSVDVSHITGVGIWSVLHRGISRAASWRRP
FT                   YRWRMDTRYLHADVIAAGPDASAHPWLDSDATLLPGKLGQLAGLAQSHYHREGFASGGP
FT                   IFMVSPLLSQPLVELCLAVPSWMWCAGGVNRALARAAFERDLPRQIIQRRSKGSPDSLL
FT                   LAILELNRPALIKWLCDGLLASRNIIDVDSVRAQLARSGPTTGTDYIRLLDLADVEAWA
FT                   RSQPA"
FT   CDS_pept        complement(75012..75665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99047"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W5"
FT                   /protein_id="BAI99047.1"
FT                   /translation="MALALRDQLSFCIIEQHVLFLDVANDRYFGVRESTSSALLCMMAG
FT                   KEIDRVAPGLRALLDQGYLVEKDCHTRLSPSVHPIARIDCAVIERIPTAADIARAVVAL
FT                   GHSALLLKYRRLHLILESIRRRKSGLGPRRRPARSLAIAGALKTLGSVFGQHERCLLYS
FT                   LALAKLLLSSGTSPTLIFGVKLAPFAAHCWVQDGDCVLNDDLDHTRLFTPILSI"
FT   CDS_pept        complement(75728..75868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99048"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W6"
FT                   /protein_id="BAI99048.1"
FT                   /translation="MDRHDNSEVDEIIDLGTASAVTQGMGSGSTDQNGQPKNLIGGISD
FT                   D"
FT   CDS_pept        complement(76044..76661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00970"
FT                   /product="GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99049"
FT                   /db_xref="GOA:D4Z8W7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W7"
FT                   /protein_id="BAI99049.1"
FT                   /translation="MSPEPVAAERTYRLLRERIIIGAIKPGWPLNLQRLAEEFNVSVSP
FT                   LRDAMHRLVGERIIEALPVGGFQLPIPSKESLHDLYSWHDKLIRQAVTRRLTAEERGIL
FT                   PALSPDLDPEILARAVTTLFAVLGGASGNAEHIEAIANASARLFRVRLAEIDLIKGVLS
FT                   ELESLVTVSATGDAVSIRHAVWGYHRRRLRRSAKLVAEMMAR"
FT   CDS_pept        complement(76671..77087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00980"
FT                   /product="Xre-family transcriptional regulator"
FT                   /note="HTH motif"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99050"
FT                   /db_xref="GOA:D4Z8W8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W8"
FT                   /protein_id="BAI99050.1"
FT                   /translation="MPLRSTTQVTEPERLGQIKLLSGKIIEERRKHVRMTQSQLAAKVG
FT                   IGVRWLREIESGNPKSTIENHFRCAFALGMAASHLIFPLIFMENDMKFPLQLFLDDPDG
FT                   VEKRCIQCIGDYYMESIARQFRPNAEPGDPLTAA"
FT   CDS_pept        complement(77248..77670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99051"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8W9"
FT                   /protein_id="BAI99051.1"
FT                   /translation="MAQSRTYKLRLSKEGIDLFLQCHCRLAHLLQNFIPYGVTLMVAVA
FT                   ILEGQDACDVVAELEEQRLHHCIGDNIRFVGSSTALIDATKRVSDKLLNRHECPSAPQM
FT                   GHLYIIALLSLASAEDRQLVEAFERVAPPRRRSRQG"
FT   CDS_pept        78012..78287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99052"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X0"
FT                   /protein_id="BAI99052.1"
FT                   /translation="MYKHSSRLVALLCAVASGSIAEARGTRLVLPTPAIESRAEIRATE
FT                   GGFAIYTLPLSLDIHPSPVAVSVGSSVRIDKAILVQPKLPARNAVQ"
FT   CDS_pept        78284..79072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01010"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99053"
FT                   /db_xref="GOA:D4Z8X1"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X1"
FT                   /protein_id="BAI99053.1"
FT                   /translation="MTGAKRGLLAASAALAFVGLIAGPASAQSQSAADKDLAKAAAEAE
FT                   QQLHQTFTNLKFDDFGPAPVKGPIYQAIAGGKIIYYAPQSEHILLAAIYDKNGVNVTAL
FT                   AQDASTRRKLGVVDPAKALVIGPAGAPTVIEFTDPDCPYCRALEKFWAVKEAEGKPVRR
FT                   LVYFVSGIHPEAAAKAEHILCSPDKAAEFKAIYAGAAPKELHKCLPGRSKVEADAEIVR
FT                   QVGISGTPTLIVDGRVISGFQQGELEEFLSKPKQEGKAPQ"
FT   CDS_pept        79267..79581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99054"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X2"
FT                   /protein_id="BAI99054.1"
FT                   /translation="MIRKIGKHAVSFANVGVPLVLFAAMSGGAHAFTAPATGDLGYDIY
FT                   DIVVNKGVKGPLGFVGGVAAFLFGVSRLFSNVMVGIPTIVAAVCLIKSDTILQTFGMVI
FT                   "
FT   CDS_pept        79698..79964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99055"
FT                   /db_xref="GOA:D4Z8X3"
FT                   /db_xref="InterPro:IPR009838"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X3"
FT                   /protein_id="BAI99055.1"
FT                   /translation="MDERLPQYLHRPVQILWFGSDEFILVMSTIFVAVIVGGVIGWTLI
FT                   GALLLFIPWKRTKPRGFIPHLAWRWGLLRFRHYPGPTQTRFFE"
FT   CDS_pept        79973..80608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01040"
FT                   /product="putative sex pilus assembly and synthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99056"
FT                   /db_xref="GOA:D4Z8X4"
FT                   /db_xref="InterPro:IPR007973"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X4"
FT                   /protein_id="BAI99056.1"
FT                   /translation="MPFLKSWAKSQADPLLGKPASWGIHRYLQGSSNLFEENRLLKFAI
FT                   VGLFGVAAVLGALIYTSNQNQRTVVVPFGAGGDLYVTGNTPSPGYLRMMTRNIVSMAGT
FT                   YSAYSADRQFQELLAIAHPSAYNGLRDSLSGILDELADNPTLSIATYIRPDQPVLTTNT
FT                   DILVPVEKVRVIGGVIRKFRGNLRIGYALENGRFWLTSLHEENFDADR"
FT   CDS_pept        80595..81383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01050"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99057"
FT                   /db_xref="InterPro:IPR010563"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X5"
FT                   /protein_id="BAI99057.1"
FT                   /translation="MPIADRSGVARPYAQAAALIAFAAVIAGQAQAQSITALPDQTSSI
FT                   RLSNRDINHVVCEGGEIEDVKFSAEKAIAVERAGSDAWIKFLVKEVETEGVPTRTYATA
FT                   ASEFFISCNGAVYPLYAEPSDIPAQTVILTPGAAQRARTNADLLGPLVEEERAVSITLA
FT                   LLQDRVPASFSEVAPIARDFALPSLPAASLHERRRISIDGAGLSASEYLVSVSAAQRID
FT                   ERAFLVSNLGANIFAITLDRTDLRAGDTARLIVVRRGAVQ"
FT   CDS_pept        81380..82708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traB"
FT                   /locus_tag="SJA_P1-01060"
FT                   /product="conjugal transfer protein TraB"
FT                   /note="TraB pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99058"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X6"
FT                   /protein_id="BAI99058.1"
FT                   /translation="MSGEREEIAPEDGAPIEHSPYQQRLAEQASLDLDVPPPGSSWDAV
FT                   RARWDGLSSRQKLRAKQLGVAAAIGVLGYGLYSASSSDTPAATAPAASKLDMGAGLRGD
FT                   SLEVKLRGDLKKVLDGQNLLGDRITAIEEGKTPIGPHAAPGSDADGGPLPPALPGSPPD
FT                   LPAPPSPSEIGSADGSLPAPPVPPSAPPAPPAPPVEKVVGAIGQATTPVVPKDAAGGSA
FT                   DSKKKNRTIYLPPGFMKARLLTGIDALASRDATSNPEPIIARVQAPAVLPNDVKANLSG
FT                   CFVIGNATGSLAKERVEIQLVSLSCVDFDEHSVVDQPVKGFFVDADGKKGLSGKVVTRA
FT                   GAALARTFIAGTISGIAQTVENTFGDTSTSALGTVRTLDAGDAAKSGIAGGLSKSSDKL
FT                   TDFYLDLARQAGPIVEVGAAKDVVVVIQEGVTLEIKPTAGSKF"
FT   CDS_pept        82708..83343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01070"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99059"
FT                   /db_xref="InterPro:IPR014118"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X7"
FT                   /protein_id="BAI99059.1"
FT                   /translation="MRVQSVICQPTFPNGRLALLPALALLSSCATVGSLMSPYSEKFSC
FT                   KNSDHGQCIHPEKAYEDAVAGRASRSDPTVTADRKLLKSGAADGAVPSAPVGGRTARQQ
FT                   APAPGAFAGYRDSVYRELQGLIDDPVTPMLKSPRTVRTLILPYADRQRPDRLYMPRYVY
FT                   SILEAPSWVVGDYLVNPVSPAAQAPVLGQVRDKPSDDGAPASSPEPRP"
FT   CDS_pept        83340..85859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /gene_synonym="virB4"
FT                   /locus_tag="SJA_P1-01080"
FT                   /product="type IV secretory pathway VirB4 component"
FT                   /note="sex pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99060"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X8"
FT                   /protein_id="BAI99060.1"
FT                   /translation="MRAPGTRHGGGLTFTRLRQSVARDRFSDFLPLVAWDEREEAFLCI
FT                   DDGFGYAWELVPSAYMFAHVHQALLGLLNVHFDPGTVLQIHSFADPLIDAALDGFLDLK
FT                   TRADPLIQASARRTADYLGMGRHGLRALHGIPLRDFRTILSVKTRRPMASDMKRQIEEQ
FT                   LDKLGITRLAPEETVSFYRRIFNGVYTGAPGVFTSEANAQGSAPPIRKQIIDAGPDLLF
FT                   DGPEVFLGNQVARCLTPKSPARRISAERANRLTGGMRGSAEDSDQIGGPFLYTLNVLFD
FT                   HSAFEIHKRAQVLSAQKAAGSFAVEVGKQIEEIGWVLDEAGNSKFVRVIPTVWVFGRDS
FT                   AHAREMAARAKRLWESEPLPFMMQEESYLNPILLPLSLPFGLYPDNRTMRMLERDFRMP
FT                   VKAAVLMSPIQTDFRGGGRPALLYTGRKGQLITLDLFDPRINNYNFIVSAESGAGKSFL
FT                   LNNLCQQYYAQGALIRIIDIGGSYRKLCTLCSGRYIDIGEEQLVLNPFDMGFALDGEDK
FT                   QSAISMAVAIVAEMANAATRKGVSTSEWNLLKSAVQWTIDEGHAEEGIDAVRAWLGAYP
FT                   EFAASDLDRVDHLVPVARELAFNLRDFASEGAYGHFFNGPSTFDITSDEFVVLELERLK
FT                   AMPDLFNVIVMVVVNAVTQELYLSARDRPRFVLCDEAAQFMTKTEGQDLSRLAEAFGQG
FT                   YRRARKYQGSFGIVLQSMNDLLLFGGTGQVILENAATRFLLQGSTYDKAVENKILDYSG
FT                   FVLELLKSVRNSKPHYSEVFIDSPLGLGIARLVVDPFSYWINTSAPQEVAAFEAKLRAG
FT                   KSPLEAVCELAGVDATEILGPRAEAAE"
FT   CDS_pept        85865..86191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99061"
FT                   /db_xref="GOA:D4Z8X9"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8X9"
FT                   /protein_id="BAI99061.1"
FT                   /translation="MLKRKPNLDQFAFDLSKDAALERMIEARVAIRCENDAIRWRFRLI
FT                   LIETCMIASLVLVAGLALKQPTALVIRGSLIVGAGCFASGVMLIGLSGLTGHLLSIYRR
FT                   WRQR"
FT   CDS_pept        86188..86430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99062"
FT                   /db_xref="GOA:D4Z8Y0"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y0"
FT                   /protein_id="BAI99062.1"
FT                   /translation="MRGILSGSPAPSAIRLLVGSHLLLLIQAGLVLNSRQPLDRMLAAL
FT                   VLMLAIVGLAALIAAIIGEPREQHCDPRRRYRHVR"
FT   CDS_pept        86420..87079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traW"
FT                   /locus_tag="SJA_P1-01110"
FT                   /product="plasmid transfer protein TraW"
FT                   /note="sex pilus assembly and synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99063"
FT                   /db_xref="GOA:D4Z8Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y1"
FT                   /protein_id="BAI99063.1"
FT                   /translation="MSADPPILSARIAWFQAGTVAILLIASIFVAGAAHGETSTIGRTW
FT                   PIAEPDALAEIEAKAATLPMDFGAKFGPRSRWSAMKSASLAPATAARVRTLVPFYTLDM
FT                   DVTLPDGRVLYPKGFTFNPLTYVSLPQRLVIVHARELGWALKTAAPTDWILLAAGGGTS
FT                   ADPIALGEKVGRPLFILEERVKDRLGLTVAPVIVRQVGQKLELTEVRLAQTGSAAR"
FT   CDS_pept        87076..88089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traU"
FT                   /locus_tag="SJA_P1-01120"
FT                   /product="conjugal DNA transfer protein TraU"
FT                   /note="sex pilus assembly and synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99064"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y2"
FT                   /protein_id="BAI99064.1"
FT                   /translation="MTRLKRLFCAGAAAILTALLPSALAQASSCPAGAVFNPITKVRWT
FT                   CIFPITIGGVRIGTFDKLSKELDAQSSSKPLCACRKGATFWFGVKVSFWSPNRMIDVVT
FT                   EPGCMMALGADLMPTHGKLQGSQSSISDGTNTRKMFAQMHYYISPVWAMLDMFTDLPCL
FT                   EDNGFDVALITEVLPTWQSGTLGAIIQPEGILFGNPAAGLACMADSAAAAAGKVIDPLF
FT                   WCMGSWGATYPIAGDIHFDDSVEAWAGLAARGTFMMGRLGAATISSADGCSFKAAPIWT
FT                   KSRYKYQLMEPVKGGSCVNVGRPGALWSSMKHAPGKDNAQFMVFEKVICCAGISTP"
FT   CDS_pept        88188..88430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99065"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y3"
FT                   /protein_id="BAI99065.1"
FT                   /translation="MSSSPLDAVPPPVSAVDPLPPRQGHAPLARVAAAAALTTLDGQAV
FT                   FRIIGSEDSRLPLGEIFRLRRGTRAHRLFFLEART"
FT   CDS_pept        88427..90349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01140"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99066"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y4"
FT                   /protein_id="BAI99066.1"
FT                   /translation="MKRVSLIALLCACVCHSAQAQTLEDRARSAAAAAQAKTGSSDALQ
FT                   QNYVTPGMSGQPITTVDNSKSFTPTINCQKTASLLEVLIQPSSTGDIGTVRISQDTDFD
FT                   GSFDKSSTLPVPVSGICANGIVSCQPGTWNQCHSFKWDVDGAKALKLTEVAMPELAGCY
FT                   CVNNSCGTNLVFGNLAEVLKDLGGGMVGALTTVDPRIGVAQAQVNGPVIDYVGAQATAC
FT                   AADPTIGQTAYRANPAAIQGDAGSIAAGNSIFQALKGSPAGIGKAEQLRSCTIEREVTL
FT                   TSATFDDIVSVSGALLGVSSCGTDCRRYRIGGTGNCSAAPPIFSARFDIHKPGRVVSAR
FT                   IVGMAAEDWVQGRVDGAIVGYAGKRPWLTEALPSGDCAVDGTWGNGVVIDLLDKFKAGG
FT                   AVVAARVRGGKDERWGYVDVEVKVDTSCSTSERLVDLCAGYAADSACRLDDEDVDGVET
FT                   FRNGVGTGLKPLPQTRLFGTDSCTVQLTRDFFKRSRSYKCVLDTGSMPEPDLSRGAYII
FT                   DHSTETLLADQMKKPDGSVTQTSSPFSLPDRGSVPACEAICKTRAPKMNTAAAPAGVVA
FT                   TQQNNPIGWDTFYHVCEVANVCPTGPGEEVVSACGCLDDFPEAVVMMQSVRLAGADMTC
FT                   TSAVP"
FT   CDS_pept        90346..91443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traN"
FT                   /locus_tag="SJA_P1-01150"
FT                   /product="mating pair stabilization protein TraN"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99067"
FT                   /db_xref="InterPro:IPR014121"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y5"
FT                   /protein_id="BAI99067.1"
FT                   /translation="MKRPSLLRGALLGVSLAFAGGITGPVHAQQLCAVDLNGNGDAADP
FT                   GETASCLGTASGGWQCPIQQVACTVAAPGVYACPLGDQYACEAPASGGAPTCSPNACID
FT                   GGANPIEDEPVVDDPGVPADGEIDADGNCTANIEIFSGRAVRCRPPGLKTTFSNCCKDK
FT                   GKIVKDGMGSSISSIGTKIAIAKGVFTGMKAAYTAFKAGATASQAATSGANAIIAGIDP
FT                   TSIAISLAVNFMIEVLLQGCDQQDMETGMLRGSGMCHEVGSYCSSKILGICVQKAKGHC
FT                   CFNTKLGRIIQEQGRPQLKSFNGIGWGTPKNPMCRGFTPEEFQALDFSKMDLSEYYSEI
FT                   QARTAGEIQVDMKDKIDAYMQTVGH"
FT   CDS_pept        91499..92299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99068"
FT                   /db_xref="InterPro:IPR019106"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y6"
FT                   /protein_id="BAI99068.1"
FT                   /translation="MVQAQTQPDGAKAQIEQQGDAAVDRLKGAIARQKPHDASRTPTTP
FT                   SEATPETRRRAFEAMRRRAPAPAMDARARSALEAGRADVAREREAMAKRLGQALGLEAP
FT                   DTTALAKTIAPPAKAGWVPVLFVSSSIPVSTLRTYVGQLEKARGVIAFRGMPGGLNKVA
FT                   PMAKLSAEILRIDPGCEGPACAMRDIQLIVDPIIFRQHGITRVPALAMIPGDPTQPYCE
FT                   REDNSPRSSHIVQGDAALPGLLEEYGRLGGREEVRDAQARLESR"
FT   CDS_pept        92271..92867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01170"
FT                   /product="type IV secretory pathway protease TraF-like
FT                   protein"
FT                   /note="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99069"
FT                   /db_xref="GOA:D4Z8Y7"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y7"
FT                   /protein_id="BAI99069.1"
FT                   /translation="MLRLAWNLGKRAWPEVKLLPLRAAVALGASGLGQPLRPEQLFKAY
FT                   CIVLPIGLLTWWAIPQVTWVMSPSIDAWAVRADPGPIHRGDLVSFMLSHPLAGPKPVAV
FT                   TKYALCMPGDRLDMIEKPSMVHGQWDGWYYCNDKLLGVSKPIGRNGQHLEHFRPTQRLI
FT                   PAGFIFVGSRHPSGFDSRYYGPISIGRLTRMERVL"
FT   CDS_pept        92864..93763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01180"
FT                   /product="thioredoxin-related protein"
FT                   /note="glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99070"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039555"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y8"
FT                   /protein_id="BAI99070.1"
FT                   /translation="MKGSAIVLAAALGLAPLSASAQAQSDPAREGYWWYAPKPEPAEPK
FT                   PAEEDALVKPAIPPMAELATWTPPKIRKLIEQQRDYAATVLTVDAVADFWRLQDFARRK
FT                   ARAFAGVTQLAMLQHPELNSKSANPMVGDARDQLLAYKDDTRRQYLRAHAGEFALVMFS
FT                   RTTCGYCRVQWPIVQRFQDEMGWQVTLMDIDRRPELGARFGVEVTPTTMIIRRNSQQRM
FT                   IIASGVEAYPNLAQMAYQAVRLLTGDIRPEQFMTGAGEEGGFFDALGLGPVSASDPRAA
FT                   EEMVGGNLISSPPDQKPR"
FT   CDS_pept        complement(93802..94200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01190"
FT                   /product="PilT-like protein"
FT                   /note="twitching motility protein PilT / putative
FT                   nucleic-acid-binding protein, contains PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99071"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Y9"
FT                   /protein_id="BAI99071.1"
FT                   /translation="MKITADTNLLVRAIVLDDVRQTEAAEHELDKAALVALTLPALCEF
FT                   GWVLSSNYRLAPADIATSIRKLLEASNVAADHIAINAGLQMLDAGGDFADGVIAAAGKS
FT                   LGAEAFVSFDKKAVRLLRANGEAARPPK"
FT   CDS_pept        complement(94197..94445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01200"
FT                   /product="putative transcriptional regulator AbrB"
FT                   /note="regulator of stationary / sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99072"
FT                   /db_xref="GOA:D4Z8Z0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z0"
FT                   /protein_id="BAI99072.1"
FT                   /translation="MNAYTLTSKGQITLRKEFMQHLGVHPGERINIDKLPDGSIKITAT
FT                   KATGKISDAFRLFKHDGPTISIEDMNETIEKGWAGKL"
FT   CDS_pept        94668..95267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99073"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z1"
FT                   /protein_id="BAI99073.1"
FT                   /translation="MRTPLRFLLGIPGIVIGGLTVDPAGAQQVSQDASRRAAIHPVADP
FT                   AAMQAWLSRVPLTRDFPPDFSATLKGDAPAFVVEMTTSPQCAPCADLWAKLQILRRQYG
FT                   VNVAVLSREEAIVRSGRLGLPWVGHPVAWVRATNDPNRVIPIAIGTDHSVNLARNIYLA
FT                   FKMMTGVRPDVGVRAMAKFTGIVGIAASPPPYSKGN"
FT   CDS_pept        95362..96741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traH"
FT                   /locus_tag="SJA_P1-01220"
FT                   /product="sex pilus assembly protein TraH"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99074"
FT                   /db_xref="InterPro:IPR010927"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z2"
FT                   /protein_id="BAI99074.1"
FT                   /translation="MVAACGTTVPAHAQSWAESWFDNVTYTSPGSFEDQTRGYLTAGGM
FT                   SGRVDVHNDYLMSLSLPKVKAGCGGIDMFLGGMSFLDPDYLVQKLESILQAAPAVAFQY
FT                   LLETLDEKMGNIISKMEAATNFLNSIQVNDCRLANRMVQIAKGDDNMSGIIEEMTGYRS
FT                   VKQGFAKSYQQSREKIQANNNNPTEDLKDALENCPAEVTDIFRTGSLLSHAASRVGAAD
FT                   WAEVMRARVGDVYMRWDPNDKVPLFSAIPACPRQDTESPDDFLSGRVQRRVLNIPATGA
FT                   DCSNDGGKGALELARTRMDSIATKIRTRAALTAEERQFVANVSTLPVYRMLEWGVRQGV
FT                   AGSVIGDTDELVALTLAYQMLNDLTRSIDFALSNAERGTTAAGAADAANTSICQTRILT
FT                   KGIEQLRDLREEVLRQRAQMRQSYLAALGAANLSANYAGLMRQRDRDARDAAGAAAARE
FT                   Q"
FT   CDS_pept        96746..100474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="SJA_P1-01230"
FT                   /product="DNA transfer and F pilus assembly protein TraG"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99075"
FT                   /db_xref="GOA:D4Z8Z3"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z3"
FT                   /protein_id="BAI99075.1"
FT                   /translation="MIRRLIRVALALAMVGAATPAFAIDASFYTYDGFAETVDAFRLVA
FT                   MIFADPRYETLVIVIATVGISLGALLASVRGQGMGLVAFGFQMLIGIGLFVGMIATTGT
FT                   VHVYDKVRNAYQPVGDVPNLLVLVAGTTNLIERALVETIDDNTLDPNIKIEFGAGGHTF
FT                   DLFFNAVSPRGPITDTFLDATIKDYVRQCYPVARVSAAYGVDDDRLFRTATDLPAAFAA
FT                   MAGPATFSTVYTAADKGGTTVSCDEAWQHISTALSDPALFDDYSRQVCTRTGFDVTQPD
FT                   QLNRCRSQLGEMGDMMMGTPLSLQAFMTNILLGNSVGDVLFEDSPASAARVMANRAVIS
FT                   NGLATMSVANEWMPTIRAVVFGIMLFMIPIALLFILTPINLRVASFALGLFVFVALWGV
FT                   IDAGIYQLTLGRAMDALAEMRSNAVATNAWLLAPSAAQKALAIFGSFRTAAAGLAGAFV
FT                   FTVFRFSGNVFTSFTSGSLGVHGQASAAAAPLATGEGYASALEAQASATGTMARRNASS
FT                   NFGDFGERSTFGANRSFGAAGGLLSERASGVPGVPAFGMGGIDAARELGGLTPALVNGD
FT                   LSNPAVQRAVRANATTAAIHQFAEKDALRSLGNRYFGEGQAGERAFASFAQNMVQWRAF
FT                   GDQRAYDMMLQGATRHFSRNGYGADDAQLKAASVISEASADPTFAKLIANTFDQEAMLQ
FT                   NDLTSAQVQVGAMEGRRDYAGDRVAQVERGNVATEQAHRTGSNEGQRNAAAMLGLSVDE
FT                   TSRRISFINALSGEARSSAISQLSRATGRNEAQVMHALESYNAAVHVGTADGATAEAAR
FT                   EGTSVYGRTREAAGYDFAERAGKLDAQREVGHDGTRNAARIGEQRRQSENFGFAEGAEA
FT                   AGVSTREAARLDSFIQTLSRTAGNQVDMAEGGSAGVADRARNERLTRIVDNERLTRAQG
FT                   LLRSHGIDLTKRQIAMDQNGDFSLNLTPETAAQMWRAGLINQDQLGAVANGGSARFSFA
FT                   HNDLLISSSTGFQRSARSDTSTRFEAGKQAGPDTIEHFLGSGTEGQAAMANWLKGGFEM
FT                   DRSGNWRLKPQVADTLERDVTAIMVQTGWQRSLSRGASHQVTNGDAESIGISGGVGGRG
FT                   SQTAKGKAGQASGNEGGSTASINLQTSDLGVGSTDARSSIDIVNHDVRNAIANAERAAS
FT                   RSRTPEAAFSSELGRAILGADGLRNRYLDQADAGRGPWDATAPFTSIEQSQILRSGRFT
FT                   GDRTNGLEDGDPEFKRR"
FT   CDS_pept        complement(100471..100938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99076"
FT                   /db_xref="GOA:D4Z8Z4"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z4"
FT                   /protein_id="BAI99076.1"
FT                   /translation="MDPQGATPKTSDCPTEAQPKAPRLSQWLWRPWYAKLWWKTAAIFW
FT                   VAFILEEAFVPRSLSHALFDQYEGWILGALLLFHPFLIVPVLAFGWLWALSNQPRGEGE
FT                   GWIAGAYDCSTGFGFLGRNMDPTNPADPRFVGLPCNPASEAWRNQHVRGHS"
FT   CDS_pept        101219..101524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99077"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z5"
FT                   /protein_id="BAI99077.1"
FT                   /translation="MLPQRRYRSVIVAVGSNDSTRELRVRLPDLRARLGGARVTWIYPY
FT                   GRSVAWEIYAVARLNGDRAFGFWNVGSSDKVHPADYRAVIKMLGRPKYISWEFGRR"
FT   CDS_pept        101527..102138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01260"
FT                   /product="MobA-related protein"
FT                   /note="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A / uncharacterized MobA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99078"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z6"
FT                   /protein_id="BAI99078.1"
FT                   /translation="MHCTKSIEQQEGSVAEASTAAILLAAGQSVRFGKEHKIATAVRGK
FT                   ALGHYAAKRLAAIPFAARFVVTSNSTLQWPHFQALINNRPEDGIARSIALGIAAAHKRG
FT                   VEAALIALADMPFVPIVHFQRLLAQYKGTGTLVASGVDGSRMPPALFGAEWFEMLQQLN
FT                   GDQGARSLISRATLVVARPEDLVDIDSPADLERSMKHFDW"
FT   CDS_pept        complement(102180..102389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99079"
FT                   /db_xref="GOA:D4Z8Z7"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z7"
FT                   /protein_id="BAI99079.1"
FT                   /translation="MTNNIGYAVAVGIVNGLLQLFHYQAGAPEGNATWAVIGLGLVLPA
FT                   FLFIAAAMNFVAVLLLPLGGMTRA"
FT   CDS_pept        complement(102413..102685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99080"
FT                   /db_xref="GOA:D4Z8Z8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z8"
FT                   /protein_id="BAI99080.1"
FT                   /translation="MLCFMLGMVLGIPVLIRLSQLRGTRFGVACAMLGAALSSLAFTAI
FT                   PSGGATTAMIAYSLVGLFTGAISSSSTPPWSPSRAWTVLRVDATR"
FT   CDS_pept        102729..103079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01290"
FT                   /product="GST-like protein"
FT                   /note="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99081"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z8Z9"
FT                   /protein_id="BAI99081.1"
FT                   /translation="MKKARGRVSVKHPKYLGAFLSTRFAAFSCRRGSGLRFTPNLQSHR
FT                   SAVRVCGALGSRLAVGNGPCLTGDRFVEADLCLFPTLYSDDPVYYLRKKLNCADVLDYT
FT                   TKNNEFAPVARR"
FT   CDS_pept        complement(103133..103531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01300"
FT                   /product="HPP-family protein"
FT                   /note="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99082"
FT                   /db_xref="GOA:D4Z900"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z900"
FT                   /protein_id="BAI99082.1"
FT                   /translation="MGQMVVDTSILLTSLISSAVVIITAPASKASYPARVLTSHLVAAL
FT                   TGLVLRSFLPISPWSVAAAVGFALLIVLVADRLHPPAIANAGIMFSANGSTLELIGLVA
FT                   VTASILTGAAFLSRHCLLRVPTGKEPLS"
FT   CDS_pept        complement(103686..105029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01310"
FT                   /product="putative glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="NADPH-dependent / pyruvate/2-oxoglutarate
FT                   dehydrogenase complex, dihydrolipoamide dehydrogenase (E3)
FT                   component, or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99083"
FT                   /db_xref="GOA:D4Z901"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z901"
FT                   /protein_id="BAI99083.1"
FT                   /translation="MPQFDYDLFVIGAGSGGIRAARVAAAAGARVAVAEVSRVGGTCVI
FT                   RGCVPKKMFVYGAQFAKDGRYRERLGWAGTEGTFDWQVLRDNVSAEVSRLEGLYRQTLF
FT                   THNINLFRGGARIVGPNAVDVAGSHLTAEKILIASGAKPTIPDVHGVEHGITSNEIFEL
FT                   ESLPRSIVIIGGGYIAIEFAGILNSLGSEVTLLNRTHTILRSYDAELTAKLVDIYRARG
FT                   IKLLFSTSLVGAERDVNGRIAMELSNGDHLVADALMFAVGRSPNITALGLDEVGVATGP
FT                   NDGVTVDAENRTSVASIFAVGDVTDRIQLTPVAIREGHALADRFFNNRPADIDYTAVPS
FT                   AVFSDPPLASVGLSEAAAKAAGIEVDIFSSDFRPMKHALQGSCERAFYKMIVDRASGAV
FT                   IGLHLLGPEAPEILQIAAVAMRAGATKQHFDDTMALHPTMAEELVLLR"
FT   CDS_pept        complement(105130..105966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01320"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99084"
FT                   /db_xref="GOA:D4Z902"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z902"
FT                   /protein_id="BAI99084.1"
FT                   /translation="MIEQVSTTNSHGGVQSVYKHASTSTGTEMTFSVFVPVHAPGSSLP
FT                   VVWYLSGLTCTHANVTEKGEYRRACADLGLIFVAPDTSPRGEDVADDPTGAYDFGLGAG
FT                   FYVDATQAPFAQHYKMWTYVTEELPCLIGANFPADLDRQSILGHSMGGHGALTIALSFP
FT                   SRFKAVSAFAPIVAPSQVPWGQKALGGYLGADQAAWRRHDSVALIEDGARVPALLVDQG
FT                   EADSFLEKQLRPELLQGACERAGIELELRLRAGYDHSYYFISTFMEDHLNWHASRL"
FT   CDS_pept        complement(106000..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01330"
FT                   /product="glyoxalase-family protein"
FT                   /note="lactoylglutathione lyase or related lyase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99085"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z903"
FT                   /protein_id="BAI99085.1"
FT                   /translation="MAVISGDGVFSHACLGASDLAQSTAFYDAALRPLGVANLGPFGDN
FT                   IVLYGKDKPALLILTPGNGEAPSSNGVTVGFAASSQADVDAFHKAGLAAGGVDEGAPGP
FT                   RGHLPNAYAAYLRDPAGNKVCAYTFV"
FT   CDS_pept        106357..106584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z904"
FT                   /protein_id="BAI99086.1"
FT                   /translation="MRKYTITGNNCHNNSPLLEIIEFFFESLSETACTTCANAFAKPQF
FT                   VPGVGADREPLQNMLWLATFPAPLHLPARR"
FT   CDS_pept        complement(106644..107753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01350"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="Zn-dependent alcohol dehydrogenase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99087"
FT                   /db_xref="GOA:D4Z905"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z905"
FT                   /protein_id="BAI99087.1"
FT                   /translation="MKSRAAVAFEPKKPLEIVEVDVEGPKAGEVLLEIMATGICHTDAY
FT                   TLDGYDSEGIFPSILGHEGAGIVREVGAGVTSLKPGDHAIPLYTPECRQCKSCLSGKTN
FT                   LCTAIRATQGRGLMPDGTSRFSYKGESIFHYMGCSTFSNFTVLPEIAVAKIREDAPFQT
FT                   SCYVGCGVTTGVGAVVNTAKVVPGDNVIIFGLGGIGLNVLQGAKMAGANMIIGVDINPD
FT                   REEWGRKFGMTHFVNPKEIADDIVAHLVALTDGGADYTFDCTGNTTVMRQALEACHRGW
FT                   GTSIIIGVAEAGKEISTRPFQLVTGRNWRGTAFGGAKGRTDVPKIVDWYMNGRIQIDPM
FT                   ITHVLSLEEINKGFDLMHAGESIRSVVVF"
FT   CDS_pept        107851..108729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01360"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99088"
FT                   /db_xref="GOA:D4Z906"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z906"
FT                   /protein_id="BAI99088.1"
FT                   /translation="MTSEWDGIEEFLAVYDRGRFAPAAKSLRKSPSHVSRAISRLEARL
FT                   GERLFQRNTRIVTPTEFAHAFADRCRHMVEDRIEAFALSDGQGPPRGALNVTCSIAFGE
FT                   RVIAPLIRHFVKQYPQVIATLDLNNRVVDLVSENYDVAIRTGHLSDSRLIGRRIGSRKL
FT                   YLCATPDYLEKHGVPSDINDLKYHACIQGTADVWHFIVDDKLVDFRPKGPLRVNSGTAV
FT                   ADAALASFGICQLPDFYVEPYINSGSLVSLLETSSVPEEPIWVVYAHRQHLRLSTRLFI
FT                   EMLQGGVARNP"
FT   CDS_pept        complement(108786..109706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01370"
FT                   /product="AraC-family transcriptional regulator"
FT                   /note="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99089"
FT                   /db_xref="GOA:D4Z907"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z907"
FT                   /protein_id="BAI99089.1"
FT                   /translation="MLAPPPAPLSPFTLCETHGIFELPGCRVRRSSAELEWSSLFLSEQ
FT                   DEAPFSAEVNATNDHLIVMHLSDPARVQLEADNMTACAVIPRRSLFVWPAGHGFQISVD
FT                   APVETLHLYVRRSLVEEVGLAMGYDGIDLVLEPRLGVYDELLEQLALEARRLASRKDRA
FT                   SHVYVDWLACAIAARLIESNMLIREEDPQDQRGLAPNKLKCVTQFIDENLAGEIAIPRL
FT                   SNVAGLSPSHFLRLFKVATGQTPHQFIVRRRVEKAQHLLRGTSQPIAQIAFACGFSHQQ
FT                   HFSNVFTKFNGMTPANFRRATERRN"
FT   CDS_pept        complement(109868..110833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanB"
FT                   /locus_tag="SJA_P1-01380"
FT                   /product="vanillate monooxygenase oxidoreductase subunit"
FT                   /EC_number="1.14.13.82"
FT                   /note="vanillate O-demethylase oxidoreductase subunit /
FT                   flavodoxin reductase (ferredoxin-NADPH reductase) family 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99090"
FT                   /db_xref="GOA:D4Z908"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z908"
FT                   /protein_id="BAI99090.1"
FT                   /translation="MDQTLLEVRVTKKTLEADDIASFELKNCDGSSLPHFSAGSHVDVN
FT                   MANGLVRQYSLCNVPGETDRYLIAVLRDPNTRGGSAFMHDRVQQGDTLTISQPRNLFAL
FT                   ARDARRSILFAGGIGVTPILAMAERLAQIDAPFELHYCGRSRSRTAFLDRISSSHFSKQ
FT                   AHFHFDDGPEEQRLDVNAILASPSADTHLYACGPSGFLDFVLGAASQLGWSGSCVHREY
FT                   FAAAATTSAEDQSFEVELASSGQTFHIPPDKTVLEILAANGIDIPVSCEQGICGTCVTR
FT                   VLRGEPDHRDLFMTDQEHAANDQFTPCCSRARSLRLVLDL"
FT   CDS_pept        complement(110947..111987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linD"
FT                   /locus_tag="SJA_P1-01390"
FT                   /product="2,5-dichlorohydroquinone reductive dechlorinase
FT                   LinD"
FT                   /EC_number="2.5.1.-"
FT                   /note="glutathione S-transferase /
FT                   gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99091"
FT                   /db_xref="GOA:D4Z909"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4Z909"
FT                   /protein_id="BAI99091.1"
FT                   /translation="MSADTETLARKVREEVIKPEQSTLISPDRQSPSLLRREATVEPRF
FT                   ELFHFVFSVCSQKVRGTLMEKGVTFGSNELTILPPQNENYCPQYVRLRLRSEAAAKHRP
FT                   VSSFTGQSSVDSEGFDPLVVPTLVDHETGRILADSKAICLYLCDALSGGTDLLPADIRE
FT                   AVLKQVQLADTTPHVALLYGADPDGDRRPESMQAVMPGIHAHKIDAVRRNIPLADGDPL
FT                   LLEAYQHKIVKEEAAASFVINEPQMRTAISKAEQLVTDLDRDLGASTGPWLFGDRFTLA
FT                   DLFWAVSLYRFLWLGYSGFWKDGAGKPRVEAYANRLFARPSVKDAIIQWPGHPPSENVI
FT                   HLLSNA"
FT   CDS_pept        complement(112047..112679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01400"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99092"
FT                   /db_xref="GOA:D4Z910"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z910"
FT                   /protein_id="BAI99092.1"
FT                   /translation="MLFSVITTISPEKLAERTAAIPAHRAYLASHTASILAVGTTFAEG
FT                   GDLVGSTYLVDVDDWNAARAFIAEDPMTVSGARQSIDILEWRMGGFDRRYPWQGANVER
FT                   QDAAHQSLNKEGVSAAPQPSLRTRHLRVLLLITTLAPLVALVNILLGDTIAHLPVLLRS
FT                   FLVVGLVVPAATYVALPLLTGLARCVGQERRESSPAIRPPAEHTHST"
FT   CDS_pept        complement(112687..113403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01410"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99093"
FT                   /db_xref="GOA:D4Z911"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z911"
FT                   /protein_id="BAI99093.1"
FT                   /translation="MTFSPEGPYGTIVTGPPVEQANAAIILLHGRGQRAQAMLELARQL
FT                   DLPSVAWLALQAPAGAWYSPKYDGFDPDGDRSVADACTALAEISSRLEAAWVALDRQGI
FT                   VGFSQGACLASHFMWCGAAKMGFLGSLTGSLPGFELPTAPVEPRFTGLKAIFTGGLNDD
FT                   WVKAEHVRETAERFRLSGADVGEYIQPIKDHGIGADEIALLRDTLIARFELNPPVPTRG
FT                   PRHQPLVPQSTPSLTD"
FT   CDS_pept        complement(113400..114209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01420"
FT                   /product="putative alpha/beta hydrolase"
FT                   /note="alpha/beta hydrolase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99094"
FT                   /db_xref="GOA:D4Z912"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z912"
FT                   /protein_id="BAI99094.1"
FT                   /translation="MKRMWRHRAVNSRNGARIGVHTTGLPSGEPILLLSSLLADWRSWN
FT                   DVAGRLPSGVYAITMDLRGHGTSSPSAGDYSLAELAADVLNVMDNLAFARVHLVGTSVG
FT                   SMVAQYLGATAGHRLISLTLVAAGSLVPEPAWPIWDKRVAAVRSGGLITQVPIVYPAWF
FT                   SGAVDQGLLDLAESMILATTVAGFTGAVAAIKGHDARSLLPQVETPTLVIAGANDAAVP
FT                   PEAVRATAALIPGAAFEVVTGAAHQVAMQHPVAFADRLCRHIAGAPR"
FT   CDS_pept        complement(114235..115200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linE"
FT                   /locus_tag="SJA_P1-01430"
FT                   /product="chlorohydroquinone/hydroquinone 1,2-dioxygenase
FT                   LinE"
FT                   /note="hydroquinone meta-cleavage dioxygenase /
FT                   gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99095"
FT                   /db_xref="GOA:Q9WXE6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WXE6"
FT                   /protein_id="BAI99095.1"
FT                   /translation="MMQLPERVEGLHHITVATGSAQGDVDLLVKTLGQRLVKKTMFYDG
FT                   ARPVYHLYFGNELGEPGTLYTTFPVRQAGYTGKRGAGQISAVSYNAPVGTLSWWQEHLI
FT                   KRAVTVSEVRERFGQKYLSFEHPDCGVGFEIIEQDTDGQFEPWDSPYVPKEVALRGFHS
FT                   WTATLNRNEEMDSFMRNAWNLKPQGRDGNYQRYAFGNGGAAKVLDVYIDEDERPGTWAL
FT                   GEGQVHHAAFEVADLDVQAALKFDVEGLGYTDFSDRKHRGYFESIYVRTPGGVLFEASV
FT                   TLGFTHDESPEKLGSEVKVAPQLEGVKDELLRTMNDPIVI"
FT   CDS_pept        115332..116243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linR"
FT                   /locus_tag="SJA_P1-01440"
FT                   /product="LysR-family transcriptional regulator LinR"
FT                   /note="LysR-type transcriptional regulator for linD and
FT                   linE operon / gamma-hexachlorocyclohexane degradation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99096"
FT                   /db_xref="GOA:Q9ZN79"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZN79"
FT                   /protein_id="BAI99096.1"
FT                   /translation="MNIDDLDFRHLVLLDALLKRHSVSAAARELDLPQPTASHGLARLR
FT                   KALGDPLLVRARDGMEPTPRAEAIAGVVQQLLELRRDLAEGGQTFSPDRLKREFIIAGS
FT                   DIAHLVVLTALHSAARFEAPHTSYRALTLSGDEMVSALETGHVDIAVGAYPSLVAGIKT
FT                   QRLYQEEYLCFGKEGHPFIKSGETDDFMAADHIVVSTKGMAHAHRAVERALLDKIHPDR
FT                   IRIVASSFLVALAACFESDLILTAPARVIGRLAEVYGLRAVRPPILMEAFEVRQYWHAR
FT                   NQDDPPHRWLRQLLHKVLSARM"
FT   CDS_pept        complement(116338..118893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01450"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor protein, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99097"
FT                   /db_xref="GOA:D4Z915"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z915"
FT                   /protein_id="BAI99097.1"
FT                   /translation="MKNRIKIGLMLGTAGALGWTPAYAQAPAEAQIAPALPQAVAPAQA
FT                   ESTDPASNVGIGDIVVTAQRRAENVQQVPIAVAAFSGAALQEKGVDNVSQLANLTPGVQ
FT                   LSSTSQIFSSPSMLSGFIRGIGQDDFALNFDPGVGTYVDGVYLARTAGSNVDLLDVERI
FT                   EILKGPQGTLFGRNTIGGAISVVTRKPTDDFSVMGQVSGGRFNRIDVGGVINIPIVEGK
FT                   LKSSIAFSSKNRNAWQKRIPFPGAAGFASDPSEAFQQIDYTSRTAAGGISEQGVRGKLL
FT                   WNATNAIDVTLEGDYLNSETSASPSTLLGTRSTVLSPAGTPVDADGNGVPDSTLADLYN
FT                   TCISLPESVLGAIGLGGACGPRAGGLPAIAGANADADPTNSRLPIDNRFVTGSLNRGYG
FT                   TGINFTNTRNFGFTGTVDIDLGGPALKSITAYRNLDTRFGQDLDNSPVVGFEGSFRVKQ
FT                   HQFSEELQLSGKAFNDKLDYLVGAYYFSEGGRESEDVAFPGGLLQIVGNYRFNTKSYAL
FT                   FTHLNYRVNDLIGITLGGRYTKEDKTLVGSQRDLNMLLTKLGTPAFLFPDPTDLSQFYP
FT                   TGEQKLSFSNVSPRVGIELHPTERIMLYGSFSKGFKSGGWTTRVAAPVPPDPTKPADKQ
FT                   APSFNPEKADTFEIGFKSQLFDRMLQVNAAAFYTDYKGIQIQIQRGIGASFENAGNARI
FT                   KGFEVETIFAPSRVFRVSASAGYIDAYYRRINDPSGTITLASRLPRVPKWTATLSPEFN
FT                   VFLANEGRVTLRADYSYKSTMAADAENTPELFSGNVSLVNASLTYSAPGDDWSLAIGGN
FT                   NVFNKRYIANGVNQLNGAGLLSAVPNRPSEYYATLRFKF"
FT   CDS_pept        complement(119085..120014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="SJA_P1-01460"
FT                   /product="vanillate O-demethylase oxygenase subunit VanA"
FT                   /EC_number="1.14.13.82"
FT                   /note="phenylpropionate dioxygenase or related
FT                   ring-hydroxylating dioxygenase, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99098"
FT                   /db_xref="GOA:D4Z916"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z916"
FT                   /protein_id="BAI99098.1"
FT                   /translation="MLRDMCPHRFAPLSKGKIISDQLQCPYHGLRFNSNGQCVFNPHGD
FT                   GVVPKAAVTRTYPVLEKFGLVWVWMGQKAADPAKLPNFDFMDDTRWTYVKGHIHGSGYY
FT                   ELFTDNILDLGHAAFLHTGLSAPAFTIGKRHVFQDGDTVWSNVSHPNDFISDIMNNMFN
FT                   SHGKRFDAWTDVQWTAPGSMSLLSYYAEPGTPKEDGHMHTSIHVMTPESPDTTHYFWAF
FT                   GRDIHPDNEEFSAKLRAGIEYAFEEEDKPMIALQQAQVGDRDIMSMRPVLLAGDAGAVR
FT                   ARRMLRKLIAQEQSNGEEASDQKQSVDA"
FT   CDS_pept        120043..120447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99099"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z917"
FT                   /protein_id="BAI99099.1"
FT                   /translation="MTSGSSITLRPNGWSPISSLHATAYQVFHAYTLSGASSIVDPSSC
FT                   NNLPVARALSSEPSRIAGPFYRISARHLFSVIGHITASAFERLRISALLVQILALFPRA
FT                   DMGQIVEPTGTYRSYSSSEVCIAEPGMTFG"
FT   CDS_pept        complement(120511..120723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01480"
FT                   /product="putative acetyl-CoA acetyltransferase"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99100"
FT                   /db_xref="GOA:D4Z918"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z918"
FT                   /protein_id="BAI99100.1"
FT                   /translation="MDAIDLIELDEAFAPQVLAVVKAWGRSADNSWHERLNVNGSGISF
FT                   GHPIGVSGARIRGTLAHELRQRDLR"
FT   CDS_pept        complement(120791..121153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01490"
FT                   /product="putative mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99101"
FT                   /db_xref="GOA:D4Z919"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z919"
FT                   /protein_id="BAI99101.1"
FT                   /translation="MYKINLGEAFGRFSDHWSPKIAGELNDSFVKLAKFSGQFHWHHHE
FT                   HEDELFLVVSGRLPMGLRTGDIDLDAGEFIIVPKGIEHRPEALTDECSVILLEPKSALN
FT                   TGNVTNERTVRDLERL"
FT   CDS_pept        121447..122307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01500"
FT                   /product="putative DNA-binding protein"
FT                   /note="transcriptional regulator, Fis family /
FT                   site-specific recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99102"
FT                   /db_xref="GOA:D4Z920"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z920"
FT                   /protein_id="BAI99102.1"
FT                   /translation="MSLQAAEDIELERQQLHEQWKLRLERAGYETALVRRRYEAVDPDN
FT                   RLVARTLERDWECALSAEQALRDEQQRALAEEPEHLTDADREAIRQLAQNIPALWSAAS
FT                   TTPRDRQTIARMLLERVEVLVLGETEHAELTCHWSGGVVTKHAFIRPVRRFEQLEHFDK
FT                   LLARITQLRTHGATAQSIADILNTEGWAPPKKDSFNAPMIHRLLQRCGLGTTRPIWSGN
FT                   VPRQHDGEVTLQEYADRVGAHRQTVYGWLRRGQIKGRLVKVGSQRIWLVNADDTSTGIC
FT                   TGESS"
FT   CDS_pept        122321..122479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01510"
FT                   /product="putative transposase"
FT                   /note="remnant"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99103"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z921"
FT                   /protein_id="BAI99103.1"
FT                   /translation="MLFAHLKRILKLDRLRLRGPNGARDEFLLAATAKNLRKMAKLLPM
FT                   PVPAVAA"
FT   CDS_pept        122659..123564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01520"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99104"
FT                   /db_xref="GOA:D4Z922"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z922"
FT                   /protein_id="BAI99104.1"
FT                   /translation="MLIRHLAYFVTLAKERHFARAADACHITQPTLSAAIRKLEEDLGV
FT                   PLVARGHRFTGLTPEGEKLLAWSRQILTDYQSLINDLAGARTGLVGELRFGVIPAAMPA
FT                   VSFITARFCDANPGATVSIRSLTSRAIAEGLDAFELDGGLTYLENEPIENVRRVSLYRE
FT                   RYKLAVPANHKYARRKAVSWLEAAGEQLCLLSPDMQNRRIIDRLTSRIGLTVHPAIVSN
FT                   SFLGVCAHVRQGGWASIVPHSFFHVLGQQPDIVAIDIVDPVHSEAIGLVISDREPRSPM
FT                   AAALLAAAIDAGIEESFSSL"
FT   mobile_element  123683..124562
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   123683..123699
FT                   /rpt_type=INVERTED
FT   CDS_pept        123714..124508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P1-01530"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99105"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI99105.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   CDS_pept        complement(124527..124973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01540"
FT                   /product="hypothetical protein"
FT                   /note="outer membrane autotransporter barrel / large
FT                   exoprotein involved in heme utilization or adhesion"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99106"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z924"
FT                   /protein_id="BAI99106.1"
FT                   /translation="MLLLSASIPAAALLANAGGALAAPATVNVPSGAGTGAAVNADIAT
FT                   AITTPANPDLTVTIANGADISGANIGYDFVAGGFAAGEGDGAVIVNNDGNVTGLSFGGV
FT                   GAASASNSFTATNNGEVAGSISASNFGGAVSVTGSVAKIGGSQR"
FT   repeat_region   124546..124562
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(125026..125196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99107"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z925"
FT                   /protein_id="BAI99107.1"
FT                   /translation="MRCKKDLRGLLSVNRCLRMLRTFAQRQVFGGVPNSIDARPIASVQ
FT                   RCCSSFTTQST"
FT   CDS_pept        125316..125747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99108"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z926"
FT                   /protein_id="BAI99108.1"
FT                   /translation="MRRKRIMMQVRREGARINRPPSNVALKKCGRKHMSFVDEWDQDRA
FT                   RNLVGCLVKETGFSASQIARRSGLAPSTLTRIYPNPTVGYSLSDRSVAKLKATFPDAFS
FT                   TCETGALRLPSPVSEITANRPLTKSAVADSVRQWDCLAG"
FT   repeat_region   125679..125682
FT                   /rpt_type=FLANKING
FT   repeat_region   125684..127140
FT                   /note="insertion sequence:ISSj02"
FT   repeat_region   125684..125703
FT                   /rpt_type=INVERTED
FT   CDS_pept        125753..127117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01570"
FT                   /product="putative transposase"
FT                   /note="IS5 family transposase / transposase or inactivated
FT                   derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99109"
FT                   /db_xref="GOA:D4YYL9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYL9"
FT                   /protein_id="BAI99109.1"
FT                   /translation="MAMGRDSEVQSDLIVTWAEIPRSPGHVFYDKLQKLLAEAGFDGFV
FT                   EKTCKPYYAPRMGAPSLPPGRYFRMLLIGYFEGIDSERGIVWRCSDSLSLREFLRLSSR
FT                   DKVPDHSWLSKTRSRLPHEVHDQIFGWVLALVAGHDLVKGERIGVDGSTMEANAALRTI
FT                   VRRDNGETYREMLVRMAQESGIDTPTIDDLVRLDRKRKGKKLSNADWASKTDPDAKVAR
FT                   MKNGSTRLAYKPEHAVDLDTGVIVAAPIHPADKGDTTTLDATLETAARNLADIGLAPTS
FT                   GDPCDLVTDKGYHSRELLKGLDGDIWKTRIAEPAPPNGYLRWHGDEAAQKAVYANRSRL
FT                   KSAVGRKAMRKRGEMVERSFAHVLDRGGMRRAWLRGRENVHKRYLIHVAGFNLGILMRA
FT                   LFGCGTPRGARGASKAFLFVVQTDVALVIALVAEFDGERAMLLIVFTPEGADRPG"
FT   repeat_region   127121..127140
FT                   /rpt_type=INVERTED
FT   repeat_region   127140..127143
FT                   /rpt_type=FLANKING
FT   CDS_pept        complement(127152..127796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01580"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99110"
FT                   /db_xref="GOA:D4Z928"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z928"
FT                   /protein_id="BAI99110.1"
FT                   /translation="MTMASQQSSDKRTHILNVAGRLFLENGFAGTSMGDIAKAGAGSKG
FT                   TLYTYFDSKEQMFDEFMHSEIEARANLVFELPEHTENPAAALRELGVRYLKLTTHPTVS
FT                   AILRLVIAEASRFPKIGKLFYDGGPKAAHDKLTAFLHRCVEQGHFAIPDVSLAASQFVR
FT                   LCQADIWLEFLLCVREAPDSGEINYLVDSAVEAFAAAYGRRSGASAPQSHQ"
FT   CDS_pept        128049..128687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01590"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99111"
FT                   /db_xref="GOA:D4Z929"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z929"
FT                   /protein_id="BAI99111.1"
FT                   /translation="MPKRGLTPSCGDRVLDAAIDQFGRHGICGASTRAIAAAAGTAMSS
FT                   ITYHYGGKEGIYLAAAYHIAERCERVLAPTLERASLDGELDGEAAIEKIDELVVDLLHL
FT                   MLDDQSAPWARFILREQLEPTDAFDILYSAVLERVGDRLIDVMAQLGRGLWSSTEIRLK
FT                   AFTILSQVRMFRTAPEMLQRMTGLDPTKSENADAIEQFVRRICRATLLA"
FT   CDS_pept        complement(128858..129913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01600"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99112"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z930"
FT                   /protein_id="BAI99112.1"
FT                   /translation="MIPSDETAQVRAARFRRRDHPTLHQKAVPGVPRDLANSIDENGSL
FT                   VTVPPVDWIVCFVPGLQSQWWHRFVLSKHKHVYAMRPTSTGSWLLVEPWWTRMMVTILP
FT                   PADAVKFLRWGGTGDILRVREAVPGHASQLRGWSNCAVLTAFVLGRRSWTWTPHGLFRR
FT                   LLRETSTRRENVEDLLVEQFTRVISQHSADALAVSADQLSLPLEELLTIIGRNLLEAMM
FT                   TPSLIEVCYTAILEAERYPAATRVYAEHGPKRAIAVVSRILDRAVCDGHIDLVDCEAGA
FT                   RRFLAMLRGDVHLQAVLQIGRIPTPAELDLRARTTVKRFVRGARDDRATSRDTDGRERG
FT                   AMSCRSEQDRA"
FT   CDS_pept        complement(129910..130545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01610"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99113"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z931"
FT                   /protein_id="BAI99113.1"
FT                   /translation="MNGERTEDSPGGSGQQDDMLHTLSAKLDDSSETLNGIDPVLKRGG
FT                   YSKQEILSAFGSIDDLLVTIAERKAALLSDPLVNCGQIIDVEFARRVLTNFGILAWKEY
FT                   STSIIALVRLMVAEGAHSPDLRKRVYEAGPSSVAFELCQFFAKAHRAGVLNVPQAGLAA
FT                   EQLLGMLREPLYEALVLNPAAASACDGSGAVAASVDLILDGCKRRRAP"
FT   CDS_pept        complement(131101..131754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01620"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99114"
FT                   /db_xref="GOA:D4Z932"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z932"
FT                   /protein_id="BAI99114.1"
FT                   /translation="MVADSRAKRPSQDSRRTAILEAAAQVFFEQGYAATSIDAIIERIG
FT                   GSKRNIYNEFGNKEGLFTALVSESADTALSALSVGGFEGRSLNEVLLEFGRRLLEIYMS
FT                   PGLIGVYRSIMPEALRFPELAKDFFDKGPGRASDRLAEVLAEARDRGEIDLDDCHAAAD
FT                   HFVGMFRDNLHLRVVLGLRPPPSPAEAEAAVTSAVGIFLHGIYGIDRAGRPKGR"
FT   CDS_pept        131843..133264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01630"
FT                   /product="RND-family efflux transporter"
FT                   /note="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99115"
FT                   /db_xref="GOA:D4Z933"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z933"
FT                   /protein_id="BAI99115.1"
FT                   /translation="MRRIAILVLVGGLGGCATVPDLGPRPDPAQPGAFAATRSLAGTSQ
FT                   AWPQDDWWRTFGDTQLDTLVGEALQGSPTVAQAAARIRIAVSQADLARAALLPSVGATA
FT                   TARDSRLTQSIGLPTDGDWHWLLAGLVNMSWELDLWGKNSSALRAAVSARTAAEADEAA
FT                   ARLALASAVSTAYVDFAQLLVRRDVAADAVRIRRETRDLVVRRFDAGLEPRTSVEQAEG
FT                   GVDAAEAQLAAINEAIGLGRNALAALVGAGPDRGLAIEPPSLTTRRPDALPANIPIELV
FT                   GRNPEVVSARWRVEAAAERIGVARAGFYPNVNISGLIGLASFGLDNLFRSESVIGSVGP
FT                   AISLPIFDGGRLSARYRGARGEYDTAVATYNETLLQALHHAADAATSLRALRERVDRTN
FT                   ASVARQEAAYRLAKMRYEGGLSDYQRVLISEDALLSAREQAAALRLRGFILDIALAKAL
FT                   GGGFRAAVPARDTNS"
FT   CDS_pept        133278..134429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01640"
FT                   /product="HlyD-family secretion protein"
FT                   /note="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99116"
FT                   /db_xref="GOA:D4Z934"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z934"
FT                   /protein_id="BAI99116.1"
FT                   /translation="MTDVTLDQDHNTPENPPSPKSQKRKRLFLFFGGGLVLIALSWWIW
FT                   ATFIAGDTESTENAYTNVEVAQVTPLVGGPVKRVLVVNTQAVRAGDVLAELDDTDLRLA
FT                   VAQAEAALGRARRQVRQVQETDANLAGQVAVRAADEATARADLVRAQADLDKAQLDERR
FT                   RRRLAGPGAISQQELSDAQTAVRVAQAAVEQARARIAAAEAARNAASGARRANQVLFED
FT                   TTVETNPEVLAATARLDQARVDLSRAVIRAPVDGVVDQRHVAVGQRVQPGVPIMVVVPV
FT                   QNMYVDANFKEGQLSQVRPGLPVTLTSDLYGSDVVYHGRVEGFAGGSGSAFAAIPAQNA
FT                   TGNWIKVVQRLPVRIRLDPRELQEHPLRVGLSMHATIDLSGAH"
FT   CDS_pept        134431..135966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01650"
FT                   /product="putative multidrug resistance protein"
FT                   /note="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99117"
FT                   /db_xref="GOA:D4Z935"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z935"
FT                   /protein_id="BAI99117.1"
FT                   /translation="MSAKGGEHEGSGYPPLTGAKLVMAAAALSFGNFMVVLDTTIANVA
FT                   MPTISGDLGVSTTEGTWIITAYAVAEAITVPITGWLSRRFGEVRLFTACVVAFVICSIL
FT                   CGLSGSLGFLVLFRILQGFAGGPIIPLSSTLLISIFPKDKANIALAIWGMTTVVAPIFG
FT                   PILGGYISDNYHWGWIFYINIFFGIAVGSVAWWLMHNRETAITRSRIDIVGLLLLVVFV
FT                   SAFQTMIDKGRELDWFSSSFIVWMAIVAGIALGALILWELTDDDPVIDLSVFRNRTWLV
FT                   STLSLGLMFGLFFGNIVLTPLWLQQMMGYTATWAGFATAPMGILAVLTAPIVGRLMSKI
FT                   DPRLIVTYGMVVLAISFFMRAHLNAQADFMSVAIPMFVLGAGVPACLVTLTSLGVSELP
FT                   PEKIANGSGLQNFIRIMAMAVGASLTSTYWENATKGNRAELVAIIDPSTAPAALPGLQS
FT                   GSGLAAFSRMVDMQAVMLATNDFYAMATILILVFAAVVWLAKRPKGPLKQVSH"
FT   CDS_pept        136056..136730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01660"
FT                   /product="TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99118"
FT                   /db_xref="GOA:D4Z936"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z936"
FT                   /protein_id="BAI99118.1"
FT                   /translation="MVRQGSSPRSGRVNRRHDKRGERRSAIVAIAQQAFSEQGFGGTSM
FT                   SAIAARMGGSKATLWAYFPSKKDLFAAALTAWIEESTPVRRPDWSGDPRSVLICYCAEF
FT                   MRAMLSPTAATLFRLMAAEGRRFPELGREFYKCVPRRQHSVLAGLLEDEIRAGRLRASD
FT                   SLRAAEQLHSLCICGLVMRHMCSWQPGASEVEIEREVVDAVDLFLNGYGVRPKRGDPQK
FT                   DH"
FT   CDS_pept        136796..137725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01670"
FT                   /product="LysR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99119"
FT                   /db_xref="GOA:D4Z937"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z937"
FT                   /protein_id="BAI99119.1"
FT                   /translation="MPDLSLDLRNLRYAIAAAQHRSFRRAAAALNISQSTLTRRVQLLE
FT                   HRIGFRIFDRSPSGVQLTNAGQLFLEEASTGMHQLGQAILLAASVHKGERGELQVGVVV
FT                   PLAAGRLHLALKEFHRRYPRIRVCLHEGSSEQDLARVMTGELDISFLAGTPKTSGQDVQ
FT                   LLWTESIYVALPSSHRLAKREELHWRDIRDEVFVVTQRGAGPEIRNYLVRKLSMPGFSP
FT                   KIDVHDVSRQSLLSVVAMGYGITLTSGSIVDGMAEGVAFRPIGGDPEQLRYSAVWSPSN
FT                   SNPALGCMLRLIRDVAAGRRGLNGAVRA"
FT   CDS_pept        complement(137722..137973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01680"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99120"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z938"
FT                   /protein_id="BAI99120.1"
FT                   /translation="MAKLKLGAITEDKPVKVSLELPGALFRDLQEYSEILAQQEGVPAT
FT                   EPSRLIVAMVQRFIQTDRGFARARKNKMRNPLEADRER"
FT   CDS_pept        complement(137976..139202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /gene_synonym="virB10"
FT                   /locus_tag="SJA_P1-01690"
FT                   /product="conjugal transfer protein TrbI"
FT                   /note="type IV secretory pathway, VirB10 component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99121"
FT                   /db_xref="GOA:D4Z939"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z939"
FT                   /protein_id="BAI99121.1"
FT                   /translation="MSDTDPRSEESPEEEARPLTGEPPSPAAMRLRAEPPRVTRLSRKV
FT                   LAGLALVASVGIGGALVYALQTRDGSRPNEELYSTENRPTADGISGLPRDYSGVPQLGP
FT                   PLPGDLGRPMLGAQNRGQPVPAPGVAAPNPGPNPAEQRRLQELEAARTARLFASTETRS
FT                   AGPVAAPAAPDAVSPPPTLTNLGLAPPPATPTAQDRQNAFLNAAADRRTVAPDRVVAPA
FT                   SPYVLQAGAVISAALLTGIRSDLPGQITAQVTENIYDSPTGRVLLVPQGTRVVGQYDNN
FT                   VQFGQSRVLLVWNRLIFPNGRSIVLERQPGADSEGFAGLQDGVDYHWFELAKAAGLSTL
FT                   LSIGSELAIDDDDRLLRAIRNGGQDTFNQAGQEIVRRQLNIAPTLTIRPGFPVRVIVTR
FT                   DLVLEPYGG"
FT   CDS_pept        complement(139199..140248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /gene_synonym="virB9"
FT                   /locus_tag="SJA_P1-01700"
FT                   /product="conjugal transfer protein TrbG"
FT                   /note="type IV secretory pathway, VirB9 component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99122"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z940"
FT                   /protein_id="BAI99122.1"
FT                   /translation="MRPSFRKAGMPASRIQACAHPRIGTLPVILLATTALAGCATTHKP
FT                   PEISYDNAAPAVQTVDPPAPVTVVELPRPLPLPGQMKPVERSRQAPEPADPAARVNQAN
FT                   AAARVQPVRDGFINSMQVYPFTQGALYQVYTAVGQITDIALQPGEQLVGSGPVAAGDTV
FT                   RWIIGDTLSGSGATQQVHILVKPTRPELMTNLIINTTLRTYHMELRSTERTYMASVSWQ
FT                   YPQDQLIALRRQNAQAEATRPVATGVDLTNVNFRYAIEGDRAPWRPLRAFDDGRQVFIE
FT                   FPRGIGQGEMPPLFVVGAEGNTSELVNYRVRSNYMIVDRLFAAAELRFGAGREQKRVRI
FT                   VRTDGRPTS"
FT   CDS_pept        complement(140245..140928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /gene_synonym="virB8"
FT                   /locus_tag="SJA_P1-01710"
FT                   /product="conjugal transfer protein TrbF"
FT                   /note="type IV secretory pathway, TrbF component (VirB8)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99123"
FT                   /db_xref="GOA:D4Z941"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z941"
FT                   /protein_id="BAI99123.1"
FT                   /translation="MFKRPATHYGKTAEPETPYQRAGQIWDDRIGSARVQARNWRLMAF
FT                   GSLFLSAGFAAALVWQSARGTVVPWVVQTDRLGQAQAVAPAMADYRPTDPQIAFHLARF
FT                   IEEVRSIPADAIIVRQNWLRAYDFTTDRGAAALNDYARANDPFTNVGRQQVAVEVSSVI
FT                   RASPDSFRVAWVERRYENGQLATTERWTAILTIVIQTPRNADVLRKNPLGIYVNAINWS
FT                   RELGQ"
FT   CDS_pept        complement(140928..142286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /gene_synonym="virB6"
FT                   /locus_tag="SJA_P1-01720"
FT                   /product="conjugal transfer protein TrbL"
FT                   /note="type IV secretory pathway, TrbL component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99124"
FT                   /db_xref="GOA:D4Z942"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z942"
FT                   /protein_id="BAI99124.1"
FT                   /translation="MGNTGVIDHFLEVFTRYIDGGFGLLGGEVTFIATTLIVIDVTLAA
FT                   LFWSWGADDDIIARLVKKTLFVGVFAYIIGNWNNLARIIFESFAGLGLKASGTSFTTAD
FT                   LLRPGKVAQTGLDAGRPLLDSISGLMGYWSFFENFIQIACMFLAWALVLLAFFILAIQL
FT                   FVTLIEFKLTTLAGFVLIPFGLFGKSAFMAERVLGNLISSGIKVLVLAVIIGIGSTLFS
FT                   EFTAGFGGATPSVDEAMAIVLAALSLLGLGIFGPGIASGIVSGGPQLSAGAAVGTGLAA
FT                   GGMVALGAGAVGAAATGGASLAGGAAAAARGGAALAGGASTAYSLGAAGQTGAASVAAG
FT                   LGGVARAGGSAAISPLRRAASRAAEGMRSSFNAGGRAVLGATGGSTTGGPSAGGPGSED
FT                   AAATAGGGGPPAWAQRMRRRQQMSHAVQATAHAVRSGDAHGGGSSVNLSEGDR"
FT   CDS_pept        complement(142289..142624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbK"
FT                   /locus_tag="SJA_P1-01730"
FT                   /product="conjugal transfer protein TrbK"
FT                   /note="entry exclusion protein TrbK"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99125"
FT                   /db_xref="GOA:D4Z943"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z943"
FT                   /protein_id="BAI99125.1"
FT                   /translation="MDGKSLARIGAIVFVAVAITATAIEMSRKEETAESWATTRPVPTP
FT                   NDPLRTELFRCQALGEAGPRDPACLRAWAENRRRFLAPGSRPAGRLPDATAPSEPAPAD
FT                   AQPGEAR"
FT   CDS_pept        complement(142635..143399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /gene_synonym="virB5"
FT                   /locus_tag="SJA_P1-01740"
FT                   /product="conjugal transfer protein TrbJ"
FT                   /note="entry exclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99126"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="InterPro:IPR025415"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z944"
FT                   /protein_id="BAI99126.1"
FT                   /translation="MTSRRTRAVRLAAALLTTTLATAPYLATPAQAQWVVYDPTNYAQN
FT                   LLSATRALQQINNQITSLQNEATMLMNQARNLTSLPYSSLQQLQQSVQRTQQLLGEAQR
FT                   IAYNVQNIDQAFRTTYGNASMSASDTQLVADARERWQNTVGGLQDAMRVQAGVVGNIDT
FT                   NRIQMSALVGQSQGATGALQATQAGNQLLALQAQQLADLTAVVSANGRAQALAVAERAA
FT                   AAEQGREQRRRFLTPGSGYQPGNARMFPNSGN"
FT   CDS_pept        complement(143396..145834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /gene_synonym="virB4"
FT                   /locus_tag="SJA_P1-01750"
FT                   /product="conjugal transfer protein TrbE"
FT                   /note="type IV secretory pathway, VirB4 component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99127"
FT                   /db_xref="GOA:D4Z945"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z945"
FT                   /protein_id="BAI99127.1"
FT                   /translation="MMNLAEYRNRNTRLADFLPWVALAGEGVILNKDGSFQRTARFRGP
FT                   DLDSAVPAELVAVAGRLNNAFRRLGSGWAIFVEAQRHEAATYPTSRFPDPASALVDAER
FT                   KADFEEAGAHFESSYFLTFLYLPPAEDAARAESWLYEGRERGGVDAHEVLRGFIDRTDR
FT                   ILQLVDAFMPECAWLDDAETLTYLHSTVSTTRHRVRVPETPMYLDALVADQPLTGGLEP
FT                   RLADTHLRILTIVGFPTATTPGILDELNRLAFPYRWSTRAVLLDKTDATKLLTKIRRQW
FT                   FAKRKSIAAILKEVMTNEASVLVDTDAANKAADADLALQELGADYAGQAYVTATITVWD
FT                   ADPRIAAEKLRLVEKVIQGRDFTAMPETINAADAWLGSLPGHVYANVRQPPLSTLNLAH
FT                   MIPLSAVWAGPERDGHFAAPPLLFGKTEGSTPFRLSIHVGDVGHTLVVGPTGAGKSVLL
FT                   ALMALQFRRYDRAQVFAFDFGGSIRAAALAMGGDWHDLGGGLTEGADDSVSLQPLARID
FT                   DAAERAWAADWISAILSRESVAITPEVKEHIWSALTSLASAPPAERTLTGLSVLLQSND
FT                   LKQALRPYCVGGPYGRLLDAEAEHLGEATVQAFETEGLIGTGAAAAVLAYLFHRIEDRL
FT                   DGRATLIIIDEGWLALDDEGFAGQLREWLKTLRKKNASVIFATQSLSDIDGSAIAPAII
FT                   ESCQTRILLPNERAIEPQITAIYRRFGLNDRQIEILARAMPKRDYYCQSRRGNRLFELG
FT                   LSDVALALCAASSKSDQAAIASTVAEHGRDGFLTAWLDRHDLGWAAQLIPNLETLETSS
FT                   "
FT   CDS_pept        complement(145845..146126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /gene_synonym="virB3"
FT                   /locus_tag="SJA_P1-01760"
FT                   /product="conjugal transfer protein TrbD"
FT                   /note="type IV secretory pathway, TrbD component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99128"
FT                   /db_xref="GOA:D4Z946"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z946"
FT                   /protein_id="BAI99128.1"
FT                   /translation="MAGGADYVGEIPGFSVPVHRALTEHILLGGAPRSIAILNGTLAAA
FT                   LGLGLRLWLVGLALWAIGHFAAVWAAKRDPQFVDVGRRHLRIPAYLTV"
FT   CDS_pept        complement(146126..146458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /gene_synonym="virB2"
FT                   /locus_tag="SJA_P1-01770"
FT                   /product="conjugal transfer protein TrbC"
FT                   /note="type IV secretory pathway, VirB2 component (pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99129"
FT                   /db_xref="GOA:D4Z947"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z947"
FT                   /protein_id="BAI99129.1"
FT                   /translation="MIQHALRIRRHIATAVSVTFLSLALAPAAHASGSSMPWEAPLQSI
FT                   LESIEGPVAKIVAVIIIIITGLTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSF
FT                   GGGALV"
FT   CDS_pept        complement(146455..147438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbB"
FT                   /gene_synonym="virB11"
FT                   /locus_tag="SJA_P1-01780"
FT                   /product="conjugal transfer protein TrbB"
FT                   /note="type IV secretory pathway, VirB11 component, or
FT                   related ATPase involved in archaeal flagella biosynthesis /
FT                   Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99130"
FT                   /db_xref="GOA:D4Z948"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z948"
FT                   /protein_id="BAI99130.1"
FT                   /translation="MANPQQRSEAVLRGARMLRTALGPAIAGFLEDPTIVEVMLNPDGR
FT                   LWIDRLSDGLSETDERLSPADGERIIRLVAHHVGAEVHAGAPRVSAELPETGERFEGLL
FT                   PPVVAAPAFAIRKPAVAVFTLEDYVAAGIMRAGQAALLRAAVAERRNILVAGGTSTGKT
FT                   TLTNALLAEIAKTSDRVIVIEDTRELQCMAPNLVAMRTKDGVITLSELVRSSLRLRPDR
FT                   IPIGEVRGSEALDLLKAWGTGHPGGIGTIHAGTAIGALRRLEQLIQEAVVTVPRALIAE
FT                   TIDLVAILSGRGASRRLAELARIEGLGPDGDYRVTPATQPPEGEIP"
FT   CDS_pept        complement(147698..148132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01790"
FT                   /product="CopG-family protein"
FT                   /note="helix-turn-helix protein, CopG"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z949"
FT                   /protein_id="BAI99131.1"
FT                   /translation="MAKPPKKQRLSVYLEPEVMKALSAHAARRGHSLSLVAEAGIASFL
FT                   SPDAAERQEAAITKRLDQLDRRLTRVERDVGIAVETLAIFVRFWFNTTPALPEHAAQAA
FT                   RAKSAERYEAFINTLGRRLANGPKLRQEISEDLNHTGEAD"
FT   CDS_pept        complement(148142..150145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /gene_synonym="virD4"
FT                   /locus_tag="SJA_P1-01800"
FT                   /product="conjugal transfer protein TraG"
FT                   /note="type IV secretory pathway, VirD4 component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99132"
FT                   /db_xref="GOA:D4Z950"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z950"
FT                   /protein_id="BAI99132.1"
FT                   /translation="MSATKILWGQILTVFMIVLFTTWTATQWTAYRLGFQPQLGHPWFE
FT                   VAGWPVYYPPAFFWWWYFYDAYAPPIFVEGAYIAASGGFISIAVAIGMSVWRAREAKNV
FT                   ETYGSARWARPDEVKAAGLLGADGVVLGKLDRDYLRHDGPEHVLCFAPTRSGKGVGLVV
FT                   PSLLTWPGSAIVHDIKGENWTLTAGFRARHGRVLLFDPTNPKSAAYNPLLEVRRGEWEV
FT                   RDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEKDKTLAGVAAFLSDPRR
FT                   PIESTLAAMMKTAHLGEAGPHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVA
FT                   QVTGRSDWRIADLVAEGNPTTLYLVVPPSDISRTTPLIRLILNQIGRRLTEDLHANPRR
FT                   PRVLMMLDEFAALRRLDFFESALAFMAGYGIKAFLIAQSLNQIEKAYGPNNSILDNCHV
FT                   RVSFATNDERTAKRVSDALGTATEMRAMKNYAGHRLSPWLGHMMVSRSETARPLLTPGE
FT                   VMQLPPADEIVMVAGTPPIRAKKARYYEDRRYQERILPPPPLSKPGKPPANDWSGLDLP
FT                   PVPEIGGALARAAADAPSTEDEEDTTESERRRQPELRRLKPVEKTVPIENEFEFEPIED
FT                   ADEDAARNSRLRDTMRQVARQASLDPGDGIEL"
FT   CDS_pept        complement(150171..151910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /gene_synonym="virD2"
FT                   /locus_tag="SJA_P1-01810"
FT                   /product="conjugal transfer protein TraI"
FT                   /note="type IV secretory pathway, VirD2 component
FT                   (relaxase)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99133"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z951"
FT                   /protein_id="BAI99133.1"
FT                   /translation="MSVEDDFRIRPGRIRSTKAQQARPFIAQALAAAQKAGGSVSRKGK
FT                   IGPGNRSRFGRGQRAAVQANRFLTARSRGAVIKARVVRSGGRSAPLATHLGYLRREGVT
FT                   RDGEKARLFGPGGDDLDPKEFAERCEDDRHHFRFIVSPDDALEMSDLRSFTRGLVGQME
FT                   KDLGTKLDWTAVDHWNTEHPHVHLIVRGVRDDSENLVISRDYIREGMRDRARDLITQEL
FT                   GPRTDHDIRRSLERQIEAERWTSLDRQLARDGYRTGVVDLAPRPDRQPDEFHALKVGRL
FT                   RKLETLGLANEIGPGQWVIAERAETTLRELGERGDIIKRIHRGLTERGIDRGAASYVLA
FT                   AENIDDPIVGRLVARGLDNELKGTAFAVVDGVDGRTHHMKLPDLDAAGDSAPGSIVELR
FT                   RFDDARGQRRVALAVRSDLDISRQVTATGATWLDRQAIAREPAALGGGGFGVEVRDAMD
FT                   RRAEHLIDQRLAERHGQSVIFSRNLIETLRRRELDALADKLAAETGRTFAKAGSGEYVA
FT                   GTYRQRLTLASGRFAMIDDGLGFQLVPWTPSLDRQLGQHVSGVARNDGGVDWSFGRKRG
FT                   LGL"
FT   CDS_pept        complement(152155..152919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01820"
FT                   /product="putative transglycosylase"
FT                   /note="soluble lytic murein transglycosylase or related
FT                   regulatory protein (some contain LysM/invasin domains)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99134"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z952"
FT                   /protein_id="BAI99134.1"
FT                   /translation="MPSRRYHAVAGRSAAVRLTALLFLPGLPAAALPALPASAQTMPPA
FT                   RIDAADPHAGFVTEAARRFAIPELWIRAVMRVESRGDARAISPKGAIGLMQVMPATWTE
FT                   MRTRYALGPDPYDPRDNILAGAAYLREMHDRYGSPGFLAAYNAGPGRYEDYRDRGRTLP
FT                   AETRAYLAMLVPVIDGAGLPSPVIVAVADPLAWTRAPLFIAQAEAPPRAEVRHDDGDPA
FT                   AASSQRRERDFAPADPQTGGLFVVQTASAGPR"
FT   CDS_pept        complement(152923..153270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01830"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99135"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z953"
FT                   /protein_id="BAI99135.1"
FT                   /translation="MSLIGQFTRDGSGFIGNLQTLALHQDIIIVPAEPSDADNAPDYRV
FT                   HVFDGMNNETGAEIGAGWKRTGEKAGDYVSLHLDDPTFGHPIRANLFQSADDKSAWGLH
FT                   WNRPPKRGERD"
FT   CDS_pept        complement(153317..153862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="SJA_P1-01840"
FT                   /product="conjugal transfer protein TraF"
FT                   /note="type IV secretory pathway, protease TraF"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99136"
FT                   /db_xref="GOA:D4Z954"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z954"
FT                   /protein_id="BAI99136.1"
FT                   /translation="MTRLGYAITTTGAVSLLGILSIVSFAPKLIWNASASTPIGLYRVE
FT                   PDRSPEVTDLVAVRPPEPLASFLADGGYLPRGVPLLKRVAALPGQRVCRTGLAITVDAV
FT                   PMGDALDHDRRGNPLPVWKGCRVVAPGELFLMNWQVRDSLDGRYFGPLPASAVIGRAIP
FT                   LYTDEDRDGRFVWRAPTR"
FT   CDS_pept        complement(153859..154377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99137"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z955"
FT                   /protein_id="BAI99137.1"
FT                   /translation="MTGLVAAPPCVGRACAEPSEHLTQVELVWIEKQTEHWIRFGRELR
FT                   EQILDRRRRLLFFPPGATFALVRWAANEHGTVLSRLDIMRAVARGAACQTVPTVTPGGD
FT                   FLLRVDGWPKVERVLQLVDAIEAAGIDPGDVSPDHWRHVHNRLAAGETPRTYTPAHHRA
FT                   FLLRREIGA"
FT   CDS_pept        complement(154374..154628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99138"
FT                   /db_xref="GOA:D4Z956"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z956"
FT                   /protein_id="BAI99138.1"
FT                   /translation="MSERSPKRSFAARPADPEGWIKAPDRHAPLGQPAEDFSARLTIDV
FT                   TSDMRGRIKIAAFQRGLTVADMLRALFEREFPPRSGEGQ"
FT   CDS_pept        complement(154625..155263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01870"
FT                   /product="ParA-like protein"
FT                   /note="ATPase involved in chromosome partitioning /
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99139"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z957"
FT                   /protein_id="BAI99139.1"
FT                   /translation="MIVALLNQKGGVGKTTLALHLAGEWARHGKRVTLIDADPQGSALD
FT                   WSQQRSREGLGRLFGVVGLARDTLHREAPELARDADHVVIDGPPRVAGLMRSALLAADL
FT                   VLIPVQPSPLDGWASAEMLSLLGEARIYRPELAARFVLNRCAARTVLARETAETLADHD
FT                   PPLLATTIGQRIVFADVVQTGRLAAEQDEDCPGAREIAAFAAEVAGIGA"
FT   CDS_pept        complement(155472..156359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SJA_P1-01880"
FT                   /product="possible replication protein A"
FT                   /note="plasmid replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99140"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z958"
FT                   /protein_id="BAI99140.1"
FT                   /translation="MSSRPQQRDERAQLDLFRALPGDLAPRDAQDLMAYPFFSLGKSKR
FT                   LAPIDFKSGSVKIRVEAVPEHGMATIWDADVLIWAASQIVEARDVGLRPSRLMATTPYE
FT                   ILNFIGRGVSLRDYDRLKAALDRLQSTTVATSIRQPTERRMHRFSWINEWKERADDRGR
FT                   PLGLELIVPDWFYGAVLDDALVLTIDRTYFRLTGGLERWLYRLVRKHGGKQEFGWSFDF
FT                   PHLHAKSGSLSPLKHFAYDLRDIVKRQPLPGYRLTIEQCVGGPEILSFVPTEPDALGIP
FT                   RRRRRSTTRSGEKL"
FT   CDS_pept        complement(156371..156646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01890"
FT                   /product="putative phage transcriptional regulator AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99141"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z959"
FT                   /protein_id="BAI99141.1"
FT                   /translation="MAETAANLPTRYLRTQEAARFLGLSERTLEKHRTYGTGPTYRKLG
FT                   GRVVYSVDDLQAWADRGLVTSTSDPRSGTVLPAKRQPASANGGLLR"
FT   CDS_pept        complement(156774..157280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01900"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99142"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z960"
FT                   /protein_id="BAI99142.1"
FT                   /translation="MILFRSGPTPRSGEPLTVEEIRAHASFAHEAVPSQLRLGGERYSV
FT                   DLAAIGDGKPLAALITLDELTPDRLTALGRFWAALTGKTVAPDPRITPQRRRRAQQMLR
FT                   VVDARATGATYRAIADQIFPQHDQDAATWVGSAIRETTIRMARDGMKLVRGGYLALLRR
FT                   PRRDR"
FT   CDS_pept        complement(157660..157941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01910"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99143"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z961"
FT                   /protein_id="BAI99143.1"
FT                   /translation="MPRGMKVTKHNFLDQPPGDAELTAYDKAHATVYLRLLDAETQGAP
FT                   WQDVVEVLFGLSAEDDPERASLVYSTHLARARWMTENGFEQLLRPQLH"
FT   CDS_pept        complement(158045..158287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01920"
FT                   /product="Xre-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99144"
FT                   /db_xref="GOA:D4Z962"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z962"
FT                   /protein_id="BAI99144.1"
FT                   /translation="MITARQSRAARALLGWTQETLADRARVSLTALKRLESPSGLEVYE
FT                   STRDEVRRAFERAGIVFLSSDQGMGVMLVHAKTES"
FT   CDS_pept        complement(158474..158800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01930"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99145"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z963"
FT                   /protein_id="BAI99145.1"
FT                   /translation="MATIGTFKKTGSNEFTGEIVTLSVQAKGVRIVPDTRATGENAPSH
FT                   RVLVGRAEIGAAWSKRSNEGRDYLGLKLDDPSFTAPIYANLFDDEDGDTFSLIWSRPNG
FT                   RRGD"
FT   CDS_pept        158848..159000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99146"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z964"
FT                   /protein_id="BAI99146.1"
FT                   /translation="MAIDGSEAIDGAPRRGWTAKEGFLASRGMTAQPAGEESLTPLLRH
FT                   RRSRL"
FT   CDS_pept        complement(159361..159804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01950"
FT                   /product="hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99147"
FT                   /db_xref="GOA:D4Z965"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z965"
FT                   /protein_id="BAI99147.1"
FT                   /translation="MIILAILASLAAIGVLCWLLFTLAVFALPAFVGATVGAWAHGTGA
FT                   GLPGAILAGLVAAAVTLAVGQLAILFVRPLWLKLIVAIAFVAPAAIAGFHATHGIVKHL
FT                   MPSDAWQITFSVIGAIAVGVTALVRVAGMATAPAPSGQSLAQA"
FT   CDS_pept        159803..159973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99148"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z966"
FT                   /protein_id="BAI99148.1"
FT                   /translation="MVVASMTIGLTVAPATTTTAHPDYSGIWPQPGAEIASDSRSARPA
FT                   APGQGAKGSIS"
FT   CDS_pept        complement(159946..160227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99149"
FT                   /db_xref="GOA:D4Z967"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z967"
FT                   /protein_id="BAI99149.1"
FT                   /translation="MRACRRCGCACAVIAVHGRTRRAPVGGGWSPAPAGAQQMSLNDAH
FT                   AYAFSLATTLMAAIVIFQAGDGTLSVMPASEYDGDASEIVHEIDPFAP"
FT   CDS_pept        160427..160636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99150"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z968"
FT                   /protein_id="BAI99150.1"
FT                   /translation="MAEFTGRDLHLVKKALAIAVLAIERQPGPFQSASDQADMKVLLDA
FT                   LIENDTELAHYARSARIAVTGEPD"
FT   CDS_pept        complement(160710..161633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99151"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z969"
FT                   /protein_id="BAI99151.1"
FT                   /translation="MDAHDDFEPHHESSQTDHVLNELQLHGYRPFADEPDQRLLPDGNA
FT                   VAGAVADIFDALIVTLEDTRLEPDLDDLLWSTVNLFHRATERVARELDDNEQAQKRAQR
FT                   EQDGSEVKSVELERLIAEGKTLIERQNAFELMRDQAAEHYERQVGKAWLPRSGSKVNHR
FT                   NLTSAMIDSRDFLMAKKRADQEVLLPPGPKIVVTGGLDFNDHRLIWAKLDQVHEKHPDM
FT                   VLVHGKSPKGADKIASLWAKNRNVPQIGFAPDWTKHGRAAPFKRNDQMLEIVPKGVMHF
FT                   PGTGIHDNLADKAKKLGIPVWKFGGA"
FT   CDS_pept        complement(161927..162961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99152"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z970"
FT                   /protein_id="BAI99152.1"
FT                   /translation="MARQDASDLAQRLGRQAEAVCRHYLSRGRREGRYWLVGDVRNTPG
FT                   RSMYVRLKDSPKGPAGKWTDAATGEHGDLLDVIRESCGLVDFKDVADEARTFLSMPQPE
FT                   PRPALLRQGPAPHGSPEAARRLVAMSQPIAGTLVQSYLRERAITDLRGTGNLHFHPRCY
FT                   YRPDDYSPTETWPAMIAAVTDLRGRITGAHRTWLDPRRRDKAPLDTPRRAMGDLLGHAV
FT                   RFGLGSEVMAAGEGIETVLSIRQVLPDMPMMAALSAAHLAAILFPDTLRRLYILRDNDP
FT                   AGDGARDSLVERANAAGIEAMVISPQLGDFNEDLRTLGRAALRSQTRVQIGPQDVARFL
FT                   ALAA"
FT   CDS_pept        complement(162961..167298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02010"
FT                   /product="putative methylase/helicase"
FT                   /note="dimethyladenosine transferase (rRNA methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99153"
FT                   /db_xref="GOA:D4Z971"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z971"
FT                   /protein_id="BAI99153.1"
FT                   /translation="MLQAPLVAAEPAATPLSVSGCAPAAAVFATARHLLPHLEQGRSVD
FT                   AATLRTAMQAAFGASDAAGAWDWKTAYDACEAATVLFLRKYGKAIFRKSASPATRLAAL
FT                   AKIAGLLPTHTRRSEEAQAFQQFSTPVPLGFAAMTAAALMPADRVLEPSAGTGLLAVLA
FT                   ETAGASLILNELAETRADLLASLFPAVSVTRFDAAQIDDHLDPAAAPSIVIMNPPFSVM
FT                   ANVSGRVADAAYRHIASALARLADGGRLVAITGANFSPELPAWRDAFVRLQGRGRVVFT
FT                   AAVAGSVYAKHGTTIETRLTVIDKAPADDPERFPASAGTAPDVATLLGWIGAQIPARLP
FT                   VSIARPAATAAPTPRTVRGYLARTATAQPARRIAEVQGVPLAYETIDWTPPESGRLSDS
FT                   IYEAYALQSIRIAGAQPHPTKLVQSAAMASVAPPKPSYRPTLPAPIVTDGILSDAQLET
FT                   VIYAGDAHSEYLAGAWTVDETGDLVTAAPDDAPKAVRFRRGFMLGDGTGAGKGRQSAGI
FT                   ILDNWLQGRRKAVWISKSDKLLEDAQRDWSALGMERLLVTPLSRFPQGSAIRLEEGVLF
FT                   TTYATLRSDDRGEKLSRVKQIVEWLGSDFDGVIIFDESHAMQNAGGGKGERGDVAPSQQ
FT                   GRAGLRLQHMLPNARVVYVSATGATTVHNLAYAQRLGLWGGEDFPFANRAEFVEAVENG
FT                   GVAAMEVLARDLRSLGLYTARSLSYDGVEYELVEHQLTPEQTRIYDAYAGAFAIIHNHL
FT                   DAAMQAANITGDSGTLNRQAKSAARSAFESAKQRFFGHLLTSMKTPTLIRSIEQDLTDG
FT                   HSAVIQIVSTGEALMERRLAEIPTEEWNDVRVDITPREYVLDYLAQSFPVLLYEPFSDS
FT                   EGNLSSRPVYRDGQPVESREAVARRDELIERLASLPPVPGALDQIVQRFGTDVVAEVTG
FT                   RSRRVVRRGERLAVENRAASANLAEAAAFMDDDKRVLVFSDAGGTGRSYHADLAARNQR
FT                   LRIHYLLEPGWKADAAIQGLGRTNRTNQAQPPLFRPIATDVKAEKRFLSTIARRLDTLG
FT                   AITRGQRQTGGQGLFRPEDNLESPYARDALRQLYLLLVRGKVDGCSLDRFESATGLKLT
FT                   DDNGIKDELPPITTFLNRLLALTIDLQGVLFTAFEQLLTAKIEGAIHSGHYDVGLETLQ
FT                   AESFVVTDSQVIHTHPGTSAETRLLTIMRRERNRPTPLADALHHLADPRARLLVNGRSG
FT                   RAAVQIPAPSMMLDDGEIERRVCLIRPMEQHYAPLRMMDESHWEEVADAAFAAAWEAEL
FT                   AELPEFSDSTIHIVAGLLLPIWKRLPNESTRVYRLQTDAGERIIGRRVSPAWAANAANA
FT                   ATTGAASLSPAHAFTALMDGTTILDLAEGLQLRRARVMSAHRLELTGFSEAMRDRLRAY
FT                   GLFSEIISWKLRFFVPADANGPAVLAKLLDTYPVARISEREAA"
FT   CDS_pept        complement(167458..168459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99154"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z972"
FT                   /protein_id="BAI99154.1"
FT                   /translation="MPLMLDQRRRLRAALADRLLAVCYGAGVDSTAMLIALKLAGLRPH
FT                   IITFADTSAEKPPTLDHLDRMDAVLARWSWPAIVRCRKQTLPGTAYGDLYGNCLANETL
FT                   PSLAFGLKSCSIKWKQKPQDQAIKGAASGPNAAEPHSIWLEAARRGARIVKLIGYDCGR
FT                   ADLRRSRRLSAADADFDYAYPLQMLGWDRPDCIRVIAETLGAHMVPIKSACFFCPASKI
FT                   WELYWLAAHYPDLLERALVLERNALTGRHSRFSEVQFGASWEDLVRSADRFPSTATTVG
FT                   LGRSFAWNQWVRVNDVVDASFRVKRGAEDRRRFLAMADHLQDHGNALDARAA"
FT   CDS_pept        168688..169047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99155"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z973"
FT                   /protein_id="BAI99155.1"
FT                   /translation="MKGSAIGITGAVCLVIGFGAGFALRPVLSPVAASPAAAAGVAQPT
FT                   EEEATAAVRRHRLFTGTSLANATLKLGDCSPGGVGPGVTCMTQLVMDPTRPNATPQNRP
FT                   IGFARVNGQWEVAVW"
FT   CDS_pept        complement(169054..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99156"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z974"
FT                   /protein_id="BAI99156.1"
FT                   /translation="MPEIVETTVYRLDELSDAAKERARAWYREAGIDHDWFEFVFDDFE
FT                   RICAILGVELRTVPVRLYGGGTRQQPCIYFSGFWNQGDGACFEGRYHHARGAARRIRDH
FT                   APDDADLHRIADALQAVQRRNFYQLRVSITHRDRYYHEYCMAIAVERDSPTWQDMTADA
FT                   EDLVIEPLRDLARWLYRQLEREYNYLTSDEVIDEAILANGYTFTGSGRRFG"
FT   CDS_pept        complement(169691..170107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99157"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z975"
FT                   /protein_id="BAI99157.1"
FT                   /translation="MADYFTHFSCLLDVGTPDNAARALDLYNALSEEGASEEPPSDGFL
FT                   LSIEPEHGGTQLWMRDDMTGDPERLIQFVRRCAAAFGLTGLWGFQYANTCSRPRVNAFG
FT                   GGAHVLDLATGATFAWTYTNGWLAEVLDGGDPDA"
FT   CDS_pept        complement(170179..170451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99158"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z976"
FT                   /protein_id="BAI99158.1"
FT                   /translation="MSDYIVKIGFWLRAYDTLTVQAASDAEAIEKAKTAAAVVVESTAS
FT                   PDHIDTDERREGVIAFIDRCTGDGRETVIEDIEFDDDRIHRPPAA"
FT   CDS_pept        complement(170448..170861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99159"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z977"
FT                   /protein_id="BAI99159.1"
FT                   /translation="MPSFTIETSYRIPVYRQRRYAANSLAEACRLAIEDDDWEGSREDF
FT                   ECAGETHVTGAWPGAVDPYSVPLLPIPSQFDETVQRKADHFAELLAQLSSVAQPTGLSA
FT                   HDFGRWLPAAQSAVRKANAIVAGARDPDAGGPS"
FT   CDS_pept        complement(170931..171152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99160"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z978"
FT                   /protein_id="BAI99160.1"
FT                   /translation="MDQPDSTTPRRVVFQYLVPVHVEVEDGLVCRVTVIDETPVRDPIA
FT                   VDGDAVYLAEAVRAADDGQAWPSWRFGY"
FT   CDS_pept        complement(171209..173341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02090"
FT                   /product="ParB-like protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99161"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z979"
FT                   /protein_id="BAI99161.1"
FT                   /translation="MATTVQKIILSPARDIPFNKLVLSQRNVRRVKAGVSIDDLAVSIA
FT                   RRGLIQSLSVRPVVDQEGKETGLFEVPAGGRRFRALELLVKQKRLAKTALVPCVVRPAG
FT                   DPILDEEVSLIENTDREPLHPLDEFRAFQDMRLKGTPEEDIAAAHRVTVQVVKQRLRLA
FT                   AVSPTLLDVYADDGMTLEQLMAFTVTDNHARQEQVWEAISKSWSKEPYQIRRMLNETTV
FT                   RASDKRALFVGVAAYEAAGGCIVRDLFQADDGGWLQDAALLDRLVAEKLKAEAETIAAE
FT                   GWKWIEVAVSFPYGHDHGLRELAGETIDLTDEERASREALRDEYDRLESEYAEADELPD
FT                   EIDQRLGEIEQALDAFEQRPVIYDPAEIARAGVFISIDADGSLAVDCGYVRPEDEAPAE
FT                   PEGDDAPAASGAANDPASPAVQRAVITIGGQSAEPDDDEEDAIKPLHERLIVELTASRT
FT                   LALRNAVADNPHIAMTALLHKLVSDRFMTRMYNGALEASVRDIYFPVQDTDLKDSPSAR
FT                   AVQDRHDAWAADVPKDDEALWDWLASLDDASRMALLAHCVSFGVNALYERPNPHSSSGV
FT                   SQHTLDMRLAQADRLARATGLDMVDVGWRPTVDNYLGRVTKPRILQAVREGAGEQAAQL
FT                   IDHLKKGDMAKEAERLLADAGWLPEPLRLLDAELAADSEAGHDEGAALPAFLNGDDEDE
FT                   VSTDADDEERHLAAAE"
FT   CDS_pept        173445..173639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99162"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z980"
FT                   /protein_id="BAI99162.1"
FT                   /translation="MIRQKISPPDVLWHRARATIIVAVGAGIGRAPFSTRVVGRIEQDG
FT                   RRVTTGRPGRSAGGSREMS"
FT   CDS_pept        173636..173926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99163"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z981"
FT                   /protein_id="BAI99163.1"
FT                   /translation="MKTAIAEERRSAPWGWIRNFAGWRPRRHRVSSADRALICAQGKAL
FT                   TLLLTALQARGHLQVGEFADMLGVFSVVVGKDDDLEGDILAVWAAIRKESL"
FT   CDS_pept        complement(173998..174762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99164"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z982"
FT                   /protein_id="BAI99164.1"
FT                   /translation="MMRFRRWPRPTAYRETPRKRAALLRKQRRERDALPLFADAIAAGQ
FT                   RDVDEEMARRHVWWIDREHEQRRQRAARWREARARLFALPAPLRRKVRALWRTCPYPAD
FT                   PASFADFLHQIAIGRLDPDRPPWLFHQQTQARITANPATFEEAFRQIGRKSVGGGPKTT
FT                   PADELLFCGNLGSGILFLTSRVRLIDPNESFYTSSNHRLRDSHVGRAGHWVDIEVRGDC
FT                   SEADLSLIRRLAQAADTRPVIVRRVNPLCGRV"
FT   CDS_pept        complement(174759..175130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02130"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99165"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z983"
FT                   /protein_id="BAI99165.1"
FT                   /translation="MILLTSELRQRLLANGRQADADPMPVVKFFNPLGEGVWLATELDA
FT                   DGDTLFGLADLGEPELGSFSLSELAAVRLPFGLGIERDILFEGLFPISAWAEAARRTGS
FT                   IRAAERVLHAVHHASREDV"
FT   CDS_pept        complement(175127..175405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_P1-02140"
FT                   /product="antirestriction protein ArdC"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99166"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z984"
FT                   /protein_id="BAI99166.1"
FT                   /translation="MISAPKICGRSHIRAGLSGYVAEMNAAFCCASIGIVPTVRHADYI
FT                   GSWLEVLREDNRAIVRAASQASKAADWLLAFLPADDQAAPSTDRRAA"
FT   repeat_region   175346..181938
FT                   /note="insertion sequence:ISland01"
FT   repeat_region   175346..175359
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(175402..176304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_P1-02150"
FT                   /product="antirestriction protein ArdC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99167"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY23"
FT                   /protein_id="BAI99167.1"
FT                   /translation="MSRSYPATPRADVYSRITTEIVSAIEAGAGDWRMPWHHDGAATTR
FT                   PQNVTSRRRYRGVNVLALWIAAEAAAYSSGLWGTYRQWASLGAQVRKGERGTTVVFWKQ
FT                   AASRADDDHDDGEAGPGRMFARAFTVFNLAQVEGYEPPPVAVLPEGERFGHAEAFVAAL
FT                   KIPITEGAYDAHYRIDLDHIFMPTFASFRDASAQMGTLLHEAAHATGAKHRLDRNFAER
FT                   FKRDSLAIEEICAELTASFVLADLRIAHHPRADHAAYVASWLRALKDDPRAIFTAASKA
FT                   QAAADWMHAQQPQPEEIAA"
FT   CDS_pept        complement(176349..178574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99168"
FT                   /db_xref="GOA:D4YY22"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY22"
FT                   /protein_id="BAI99168.1"
FT                   /translation="MTVVQLLAESDDERDALPVLMSAPLRPGCDRAHISRYGDPVWDLA
FT                   PGVFRDNARRCHVTVHFGGIKDPSIADALRQILHARLNVDLPGHRSRLEPAGVRGEANR
FT                   TLRFFDFVKAQLGRFDLARVDQALVDRYAGALRLAGLRPVAAAALLRIVFDLHELQHHL
FT                   PTARLSFEPWPGRSPFSVAGAKHIAGENRTPRIPEAIMTPLLSWSLRYVTCYAGDILAA
FT                   RAELDCLEATRNRLIAAEEGLDPAVRRLRQRQRLLDYVASLRQHGRGIPIWTTAHNGAT
FT                   RTDPQTGAVTPPINYHLIHLHAGINAQAEPAMHLGLATGAPDLIAAAIAELGTEIGGMD
FT                   TPNSADPDTGMPWRTRFDAKVLPLEEVMLQSAAYIVCAFLSGMRDSEIQAMRRGCLSIT
FT                   KAEDGTILRHRIKSTAYKGKRGGGEETEWVTIAPVAEAIDVLERLSARAGQARGTTTLW
FT                   PVLTLRANTKTHVSAEIVRQLNRFRDHLNDHFGSAQAPVIPAGPDGRPWRLTTRQFRRT
FT                   IAWHIANRPFGTIAGMIQYKHASVAAFEGYAGSSRSGFRGEIEAQRALGQIDDILVYFD
FT                   ERQSGARLGGPAANRVGVVLDTAAHELAPLPAMIADRPRLRTMLGSLARTLHVGPLADC
FT                   FFDPATALCLNRSSEPGASGPMISMCEPVRCPNACIAERHRPAWQRGADEARLLLREKR
FT                   LPEPQRVTLQAEVARIQRVLEQIAPGTATPHNGMAGEEEEAGLRVTD"
FT   CDS_pept        complement(178571..180358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99169"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY21"
FT                   /protein_id="BAI99169.1"
FT                   /translation="MTAAPRKGRKVSFAADTAAPQADPWSQISTLRFMIHPLYGGELLV
FT                   DFTGLRPRGLALAFARSLFMLAAPRGPIMVRSSLKTYANQLPSFFSYLAGTGDGINGPA
FT                   DLRAHHIDGFETWLSAQGKSCVHGPTYVAKVVSVLRRIADDSPELVDCGLRERLRYVSS
FT                   HAHVRSRPRDAYSPYVARQLRDAARADIAAIEARLRSGPQFDEVPQIDGAYCKAHAAIE
FT                   TYGVLGYRDPTFQSLYKLRKKRDLTSDRLNLSLHAAHYLTADDIVPLLVLLLIETGLEL
FT                   ECCKSLTLDCLRNAAGGTVDIAYTKLRAHGAEHKTIRVRDRGSSTAGGLIRRIIALSSK
FT                   ARVHNSSDNLWVYFQPGEITAGIRQLRLKVSAWTQRHCITDDQGKPLHLCLSYLRKTHK
FT                   ALWYLKTEGHMARFAVGHTVDIAARHYADIPSLRPLHEQTVADALEEVLAGPMILPPQD
FT                   EDRLRGELASPDPDDGGISTALLNGEQDVWLASCGNFYSSPFASAGTPCPTPFWACLDC
FT                   RNAVITARKLPAILTFLSFVDAQRIGLSAADWTAKFGHAHDRIVQQILPAFAEDVVTRA
FT                   RAQVANDPPTVYLPPEARA"
FT   CDS_pept        complement(180355..181746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02180"
FT                   /product="putative integrase"
FT                   /note="site-specific recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99170"
FT                   /db_xref="GOA:D4YY20"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY20"
FT                   /protein_id="BAI99170.1"
FT                   /translation="MDNSGASIVIQERRTADGLDSYIPVILRDGAIYDLHLERYFLDLP
FT                   LNGSRSRHSLRAHGYDVLVWVRFLASARGKSVWQADADDVGAYHRARRRSDAEFRISAS
FT                   TWNRAIASLDKLYRWAEREGLIERTPFTHRQVWRRSHDGRRAAVTGRNNAYERAARRSD
FT                   VRFIDLTDYRAFREVGLRGLTVEGTERPGARDRNGARNALFADLLVTTGLRLEEASHLL
FT                   AAEIPVCDARSERQRRVELPAALTKGDRGRSMLLPRRLLPVFDAYIAVERAAAVAKFAQ
FT                   RRGWEAIDRPIFIHSPSFGQRALHLVGGGTMDIEVVTPDERARLVICADDGTPREAAVL
FT                   WLTEVGHPVLPNSWEAIFARASRRCTDAGIPVRLSPHQLRHSFAVHMLAMLIQRRLADA
FT                   AAPVGAMEGYRQLVGDPLQQVQRLLGHSSLATTSIYLDHLATRADTVDAAVEELLALVP
FT                   GYLRS"
FT   CDS_pept        complement(181900..182646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_P1-02190"
FT                   /product="antirestriction protein ArdC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99171"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z989"
FT                   /protein_id="BAI99171.1"
FT                   /translation="MTQSSGRPSPAETITRAIIDRLEAGVRPWVRPWRSCAAQGRPLRA
FT                   NGEPYRGMNTFWLWLAAEQCGYRSRYWMTYRQAQSLGGQVRAGEQSQFAIFYKAYSKKV
FT                   DSYERPGELVDEQRRVMRSYAVFNADQIDTLPGDFYPEALSLVPPGDRLGPRAERFVDR
FT                   LPARLRCGGDRAYYDLRADVITMPPVEQFDTRAAWAATIAHEAGHWTGHPARLARSFGK
FT                   RFGDQAYAFEELVALSGQSAPCLTHH"
FT   repeat_region   181925..181938
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(182739..184751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02200"
FT                   /product="ParB-like protein"
FT                   /note="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99172"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z990"
FT                   /protein_id="BAI99172.1"
FT                   /translation="MIQSVKVKNLSLSKDNVRKSNRDADLDSLADNIAAHGLLQNLVVT
FT                   PLKKAGHFTVKAGGRRLRALQRLIDSGRLAGDHEVQVLVLEDDAGSAEASLAENFHRVA
FT                   MNPADECSAFKHFLDKGASAEDVAKRFGVTTRFVEQRVRLAELAPLVFAALAAGEITLG
FT                   VAQAYAVTPDVDRQARVFESMSRSYYGDNPDNIRRALLNGTVKATDAKARFVGREAYVG
FT                   AGGRIERDLFGEDVDESWIDVELIEQLAAQKLEAAAEALAAEQKLAFVTPVLATHVPYD
FT                   TECQLHEYHPPLRELSGDEQERVDSLSDEGDALIRELETELEDGTPEAEAASARLADIE
FT                   RELDTIEASRTMVDDAIKDQLGTFIYLAPDGSPRVHSRMFSERAIRQAGEDAEPEAPSG
FT                   KVAASRLSATLVDELATQRRQILAAHVASDAGFALDLTIFLMAHRTVFASSYVRDHATL
FT                   QAAAASFPIVSFRDEGSAASNVLTEQRQALDVSWAGGNTLSSRFDAFRQLDEQARADWL
FT                   AHVMAQTLEPTLNVDDGGRRNGFHDHLGRLLDIDVAQWWRPDAQNFFGRVKKDVMLEAL
FT                   DEIGGPVLRGRYKDAKKGDLANACAALCSGQGIVEAEVREKALSWLPDEMRFGAIEKPE
FT                   SFRSYSAFLSDEDDSDGGAGEIAPDGDAGDFEQAA"
FT   CDS_pept        complement(184863..189062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02210"
FT                   /product="putative methylase/helicase"
FT                   /note="6S RNA G1207 methylase RsmC / ATPase with chaperone
FT                   activity, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99173"
FT                   /db_xref="GOA:D4Z991"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z991"
FT                   /protein_id="BAI99173.1"
FT                   /translation="MATHPLALTLPLDDPARTAAQGIADRLSEGCPVARNDLLAEMTSA
FT                   FGGSSADGLWSLRDAYDVLELAQVLHLKNATLPADANARLAQLIAMTAALPTQSVRSET
FT                   QIAFQQFSTPAPIGFLAAKAAAITAHDIVLEPSAGTGLLAVHAHLAGARLLLNDIDAWR
FT                   TRLLRHAFPEGRLSTHDGELIDDMLDPQLVPSVVLLNPPFSRSQGRARDRHAALRHLRS
FT                   ALLRLAPGGRCAVILPDRIETEDADWLHATAGAHARLHLDLPPDAYAKHGTGQAVQLIL
FT                   LEKDGAGGSVPRQTCTTLGAALAAIDAMATPCAPQPQPISRPSGLFRGLTRRTRPVCSR
FT                   AAVTLPTTRAVAYHRLDAPAPAGEPQGIYLPYRPSRLLIADAREHPSALVESQAMGSIA
FT                   APPVAYEPVLPARILDDGLLSDAQLETLIYAGAAFERDLPGRFISSEEGLSLSPAEAGN
FT                   AYRTGFFLGDGTGAGKGRQVAGVILDQWLRGNRRHLWISKSETLVEDARRDWSALGGLP
FT                   LDIQHLNQWKLGTPIALGDGILFLTYATLRSNRGDRGTRLRQLIEWMGEDFSGVIVFDE
FT                   AHEMAGVAGGEGRFGATKGSEQGIAGVRLQNLAPRARILYASATGASDVNNLAYATRLG
FT                   LWGPQTAFADRRAFVESLRRGGIAAMELIARDLKAQGLYAARALSFAGVEYDILEHRLS
FT                   EEQIAVYNAYADAWAIIHNNLQAALAATRVTDGFSGATYNSGAKAAALSIFESTKQRFF
FT                   GQILLSMKLPSLIPAIAADLARGDCAVVQLVSTSEAMLDRALADLSPEERAWLDIELSP
FT                   REFLVDYLTAAFPVRQMRTYTDDSGTVRSEPMIDEAGQPVLCREAMAMRDQLLEQLCAL
FT                   PVVGSALDHIIGHFGTEAVAEVTGRSRRIVVDADGRQRIERRSARTNLAETDIFMRGEK
FT                   RILIFSDAGGTGRSYHASLDAPNQSRRIHYLLEPGWRADAAIQGLGRTHRTHQACPPLF
FT                   RPVSTDCRGERRFISTIARRLDSLGALTRGQRQTGGQGLFDPRDNLESDFARESLDQWF
FT                   RLLFQAKLQSVHFDQFQALTGLNLAGEGGGLTETLPTIQRWLNRILALRIDLQNAIFDE
FT                   YLGLIEARVEKAREAGTLDLGVETIAADRISILDRTVIRRDPVSGAETEILRIETEERY
FT                   RPLTLERAHWLLADPEARGLINPRSGKAAICRPTFSLTDEEGRTVRRYELVRPTRTERH
FT                   RQDLFAETHWTDVDRASFDEAWQAECDAMAAQTRTQIIYLVTGLLLPVWGKLPDDHVQV
FT                   WRLTSDDGQSLLGRLIPAPLVERIASAFGIAAHVEIDLGARVEHVRTSGEIMPIGALRL
FT                   KRALVAGDQRLELLDWKPEALPHLKAAGCFTEIIQHRTRLFVPPSRALEILARITD"
FT   CDS_pept        complement(189129..189995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02220"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99174"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z992"
FT                   /protein_id="BAI99174.1"
FT                   /translation="MPIAAPHRAKAIVEALGGIWRGTRGECRCPAHNDHGPSLSVRLGE
FT                   RAILFHCFAGCDTRDVLAALRRRKLHDAEPLTMPRPKAAADHRALALRLWKASQPIAGS
FT                   PAADYLAARGLPPPYPRCLRYNPRTIVGAGERRRFFPAMIAAVENDLGVVAVQRTCLDL
FT                   ADILHKPMPKPKIALGLLGDAAIRLAPAGEELGLAEGIEDALSAMAWFGTPTWALGGVE
FT                   RLGLVAIPERVKRIIVYGDRGAAAAAMLKKARPHLTANGRELVLRLPERHADWNDAWRV
FT                   RRAAEAA"
FT   CDS_pept        complement(190057..190383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02230"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99175"
FT                   /db_xref="GOA:D4Z993"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z993"
FT                   /protein_id="BAI99175.1"
FT                   /translation="MINFAKFEIIGRIGEIDARPKVTLLSVCANYRRKGDDNEWQEDSH
FT                   WNRVSVFSEGQRKHIADRAQVGDLVRIAGRLKDNSYERDGATHYTTDRIVEEFGILAAK
FT                   GMPG"
FT   CDS_pept        190463..190663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P1-02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P1-02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99176"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z994"
FT                   /protein_id="BAI99176.1"
FT                   /translation="MNDCIRRDADLFLKIKRIKTPLLAAEAFPIQKDSDSGGRKHSISA
FT                   GLSKLILTGRGILPALPGALP"
XX
SQ   Sequence 190974 BP; 35126 A; 58319 C; 61916 G; 35613 T; 0 other;
     atggatgacg agcaagccct agatcacgct gtaacgccct cccccaccgg cgatgacgct        60
     tctccgggac gggcgatgcg ggtggctgcc gccctgcagg caaagggcgg tgacgagttc       120
     gccaagcccg gcagcatcgt cgaggtcaag ttcgtcaaag gccagtcgct tagcctgact       180
     gcttcgcgtt tgcttgcgct gatgattttg accgcgggcg gtgatgcctg ggaggaccgc       240
     ccgcacaaga tgcgaaaggc ggacattcgc cgcggccaca agggcaatga gcgcatctcg       300
     gatatgcttg aggaattgca ccgcacgctt ttcgcggtcg acgacaagtc ctggcgcggc       360
     aagaaggcga cgctgcgctt ttcgcttatc tcgtcgtcgc gcgaagaagc ggaagacgaa       420
     gagggcgcgg acgctgggtg gatcgagtgg gagttcacgc ccgaagcccg aaagctgatc       480
     caggaatcgg agacctatgc ggtcctgaac cgccaggcgg tgctcggctt ccgatcaacc       540
     tatgcgctca agctgtacga gatcggggcg ctgaggctgc ataggcgcca gtcgctctgg       600
     aagggcgaca tgacggcgct gcgtgcgctg ctcggcatcg cgccggacgt ctacaaggat       660
     ttcgcgcagc tgcgccgcaa agttctcgaa aaggcgaagg ccgaaatcga ccagctcgcc       720
     cattttcgcg tggagtggcg ggagatccgc cagggcagaa ctgtcaccga aatcgaattc       780
     cgctttgagc ccaaggatgc tccggcccaa atcgcgaccg tggatgagat cggtcggcac       840
     tctgcgggca gaaaggcgcg gcgcgaggac gaggtggaga ccgttgccgt cgaggctgtc       900
     acacaggcgg cggtggcggc cttggtgtca aaggataagg ctggggcagg ggaggtcacc       960
     ttcccgaacg gcacgatccg ctttggctcg gacacgctcg cggccatcgg ccgttcggct      1020
     ggcggcggtt gggacatcga tctcattgcc gatgcctatc gcgcgcagat gggcgaaagg      1080
     ctggcgaagc tcaagggcgc caagctgatc gcatcctgga ccggcttctg cgagagtttc      1140
     ctggcacgac gcgggcgccc ctgagccgaa attgcaccgg tgcaatttcg gggtgaactg      1200
     cccccaaggg gtcaggttgc gagggggcgc aaaaggtctg cggcgcagat tgggcaagtt      1260
     tcgcccttcg ggctgggccg acttgcgaaa atcagccttc gattgaccta aaagtgcaaa      1320
     ttgagctatg ccccctctag tttcgcaagg gggcctctct tggctgcatc actcgacatt      1380
     gagggcacgc aggacctgct gtccgtctcg acgctcgcac aacggaccag ctctgtcctc      1440
     gagcggctcc gcgactccgc gcggagtgcc cgggcggacg agcggcgcga gccgacgttc      1500
     ccgattggca aggccgcgga actggtcggc cgaaccgcgg cggccattcg cgaggccgag      1560
     aaggacggcc gcttgccgcc gcctccgcga accgagaata atcggcgtgt cggctatacc      1620
     ctggcgcagc tcaacgacat gcgcggactg ttcggcaccc ggccctggcg ggccgcaacc      1680
     gatccctgct gcgttatcgc ggtgcagaac ttcaagggcg gggtggggaa atcgactctt      1740
     tcggtgcacc tggcccaata tctcgcgatc aagggctacc gggtggctct catcgattgc      1800
     gacagccaag cgtcggcaac cacgctattc ggctatgtgc ccgacctcga cctgaccgag      1860
     gaggacacgc tctatccatt cctgcggcac gacgacatgg agtcgctcga ctatgccctg      1920
     cgcaagaccc acttcgacgg cctcgagctt gttccggcca atctgcggct gttccagtcg      1980
     gaatatgaaa tcgcagcgcg catggcgcgg gggcagggga acctgatcga ccgcatggcg      2040
     caaggcatcg cgagcattgc cgatcggttc gatgtggtgg ttctcgatcc gcctccggcg      2100
     ctcggcgcga tctcgctttc ggtgctgcgc gcggccaatg cgctggtggt gccggttccg      2160
     ccgacggtga tggacttctc gtcgacggcg gccttcctcg ccatgctcga tgagaccata      2220
     gagacgctgg ccgatcgcgg cttggcgccg tcgctgcagt tcctgcgctt tgtggcgtcc      2280
     aaggtcgatg agaataagtc gatgcagaag gaactgctga acctgatgcg gacccttttc      2340
     ggtcacgcga tcgtccgtac gccgctcaag gattcggccg aaatcgacaa tgcaacggcg      2400
     cggctgatga ccgtctacga gctggacggc ccggtcacca gttcgacggt gcgcaaccgc      2460
     tgccttgcct atcttgatgg cgtgaacagt gaaattgagg tcgacattcg gtcgatgtgg      2520
     ccgagccatt tgacgcggct tcgcaaggag ggactcgcct gatgcgagca aaattgcacc      2580
     ggtgcaattc cgggtagaag gggtggatga tgagcaagaa gaacgccaac ttcgcggctg      2640
     atctggtcgc cggaatcgac ccgggggcgc aagccccagc ggcgcggcgc cctggcatcg      2700
     gtgcgagcgt gctggcgggc cgggaaagcc ggcttgccga attggcgacg ggcagcgtcg      2760
     tctcgcgcac ccatgagctt gtcgatcccg cgcgctgccg aatgtgggcg gggcataacc      2820
     gcgaatatgc gctcctcaat gaggagcggt gcgccgacct catcgagagc atcaaggcgc      2880
     agggcaagca agaaatgccc gccatcgttc gccgcgtgaa ggacgatcct gccttcgatt      2940
     tcgaggtgat ttgcggcgcg cgccggcatt ggacgatcag ttggctgcgc gcccacaact      3000
     atccggattt ccgctttctc gtcgatatcc gtagccttac cgacgaggag gccttccgtc      3060
     tcgctgacct cgagaatcgg gcgcgcgacg atctcaccga tctggagcgc gcgcgcgact      3120
     atctgcgcgc gctcgacgcc tattatgagg ggcgccagaa ggtgatggcc gagcggatca      3180
     atgtcacgga aagctggctc agccgctatc tcgaccttgc ccggctgccg gcggaactga      3240
     tggcggcctt cgcccttccg caggatctca ggatcaagca tgtcaccgcg atcaagcctc      3300
     tcttgaaacc ggaggatcgg cggcagcgtg tgttcgccga ggcgggacgt ctcgctcagg      3360
     tgcagtccga tcgcgcagca ccgatgccgg tccccgatat catacgcgcg ctcgctctgg      3420
     ccgccgatcc ccccaagagg tcaggatccc ccaagaagtc aggaaagccg gaaacgatcg      3480
     tgtccgaagg ggggaaacca ttgctgaaag tggaggcggt ggatcgtaag ggtctcaaac      3540
     ttaccttgct cccgcatgcc ggtggtacgc gggctgaagc ggaggccgcg ttgaaagcgc      3600
     tgctcgatca gcattggagc taggacaatc ttcagcggtt ctgagacgtg agagttttgt      3660
     cttcacatgt tgaatatgga ctgccctatg actgcagcct tccaggatga cattcgcgag      3720
     aatgagatca tctcgccccg tcgtctggcg gagcgcctgc gcttctccat ggcgcatttg      3780
     gctcgcgttg ctcgcctgga tcctaaggcc atgactctgt atccctccgc cccgaccgtg      3840
     cagattaaac tggaggaaat agcccgagtt ataacgcgag cggcagaact tgcaggcgaa      3900
     gaaggcaagg cggttatctg gttcaagcat caacccattt ctggagttgg gaaaacggcc      3960
     gcggaattgg ttgcgaatgg cgatatcgat atcgtcatgg aagatctcga tcgtatggct      4020
     gccggggtct attcctgaca ggcgtcactc aaggccgaaa ggttagcttg tccgcaggac      4080
     ctttaggcga atgtcttctt ctcgtagacg gtgacaatcg cccggccatc ccaaacgtag      4140
     cacaggtgcc gctcctgtcg gctgttggcg agtaggcgag ggcggaacac cgcggcgcac      4200
     tcgccgtcgg cgtcgcgcac gctttggtac acgatgccat ccgaaccttg ctcacgcagg      4260
     tgccggccaa gcgcctggcc ggcggcatag ctgtccgggg cgtagagggc agggcgttca      4320
     tcgcgcaggc cgcgaatatc gtggagcatg gcgtccaggt cgaccgcgta gacgcgcatg      4380
     tcgagttcct gcgccggttc gtgggtgtac gccatgaagc gggttcggtg atggcgcgtc      4440
     tcggcaaccg cagtctcgat ggtgctggca gcgtagaaca gcccgaaact gccgtcacag      4500
     aaccggctgc catcgggatt taggtgggtg aacgctgcca tgatcgccga tgttccgggt      4560
     cccgatacgc ggtcctccgg tgggacgagg gcgaggtccc cgacctcgtc gcgaagccgg      4620
     tcgttggtca tcgcctcgat cgcatagacc gcttccaggt cggccggatc cgcgacatcc      4680
     tcaaacagcg atatgggcgg gaaccggctt gcgacgatcc ggtagcacgg ttgccaccgc      4740
     acttgcgtcg tcgcaatggc atccatcagc cgcgctgcgc gtcgatatat tgacgcacca      4800
     cgtagagatc ggcgacattg cccgaggcca tccgctcgat cgccgggcgt ccggcgaaca      4860
     gcggcgcctc attgggtttg cgtacccatt cgttggcggt acggggcagg agcatcttca      4920
     gccccttgta gatccccatg acataggaga tgcgctccag cgcatccttg ggaatcgccg      4980
     cgaccgcgcc gcgcttccag gtctggaagg tcgagcggct gtcgagcccg agaagcttca      5040
     tctgctcggc ttccttgagg tcccaggcgt cggcaatgcg gaaaaaggtg cgcagcgccg      5100
     gaccgctcag atccttgcgg ctgggcgctt tggcggggac gccggaatgg gcagttgtgg      5160
     ccattggcca tctccttctt tctctgtcta tgtatgatat ctgtacataa cgtcaagaag      5220
     agatcggttt tcatacacgc cgaatgcgcg cgatgccgcg tcagggatgg ccagaactgc      5280
     cggcgagcag ccggtcgatc tcacccatcg ccgcgtcgaa ctcggcaaga gccgcatggg      5340
     ggagggcggt agcctggtcc aaagacgccg gctgcccatc ccttcccggt tcttcgacga      5400
     ccagcagggc cttccccttg accgtctccc gccgtgccat gcgcgccgcc acaagggcgt      5460
     cgccgatcgc ataggtgccg cgccgactga tcccgaacgc ccaggtgatc tgatcgagtc      5520
     ctagcggcgc aaaaccagcg agcaggatcc acacctgcgg tgcccgcgcg ctcgagcgca      5580
     ggtgccccag ctgctcgcgc atcagcgccg tgcgccgtcg cgctttcgcg accagctctg      5640
     caagccgggt agcgctggcg tggagagttc gcgctgagac aatggcgcgt tcgcccggcc      5700
     agagctgcgg ctgaagcgtt tcggcggtca ccgcgccggg gcaggggagg gcaagctgcc      5760
     acgcgccgca cgcggtcagc agccgcccca gcgaggcctc gaccgcccag agcggtgtgc      5820
     gcggggcggc ctgctcgatc gccaccgcgc ggttcccaag cgaacggatg tgcacggtgc      5880
     gctccagcgg cgcgaacagc ggatcggcgc gcagcagcgc gtggaggcgc gctagacccg      5940
     cgaagggcag gggggtctcg tcatccgcgc cggcctgttt caccagcgtg agcgctctgc      6000
     cgatcgcctc ctccgccagc gcatcttcgg cttgcatcgg gcggtcggcc ccgaagcgag      6060
     cggccagagc gatggtctgc gcggcgtcgg cgagcggttc ccacggatga tggctgagtt      6120
     cgcccatcag ggcgcggacc acggcatatg cggagcaggc ggtgaggggc gtctcttggg      6180
     ggccgcgatc gagcccggcg aaccaggcgt tgaaccggtg ttcggcgtca gcaaatcccg      6240
     cctgcgccaa ggccgagagc agcacctcgc gcagcagccc tacgcagaac agcgccttct      6300
     cgtcctccgc gagaccggcg aggagcccgt cgagcctgcc gagcgccagc gcgcattcgc      6360
     cttgcgcgag cgccagctct tcgggtgggg cgtcgctgtc ggcggcgagg ggatggaagc      6420
     gctccatgcc gaatgtgtag tgaatgtcaa aacactgcac aactacttgg atggttggtg      6480
     aatgaacatg tgataattgc agttatcata taagcggatt tgacgcctca ttgtatggtg      6540
     gagtacagcg gcggcatgga agccagtgca tcagccgggc aaaaaagcct tgaaaacggc      6600
     gatttcaacg ccgctgccgc ggtgacggcg accttgccac cggcgaccat gcccgagctt      6660
     gcctggggtg actacacgaa agtgacgcat ccgcacgcta agcgcgaacg tatggtgaac      6720
     gttacgcggc gagcaacgaa ctgatggcgc gcagtggccg caggacatcc ggatcgggcc      6780
     gatcttcaac attccagcta tagtcgccgg tgagcgagat atgttcccag cccaatggcg      6840
     cgacgtgacg tgcgatttcg tcgggcgtgc cgatatcagc cagcgccact tcgagatagc      6900
     gggtgttcca caggatgatg gcggcgacga gcaggttgag gccggaggcg cgataggtct      6960
     ggttctcgaa ccgccgatca cgcaattcgc cgagctggtt gaagaagagc gcgcgtgcga      7020
     gcgcgttgcg ggcctcgccc ttgttgaggc ccgcctgggt acgccggcgc agatcaatgt      7080
     cgcgcagcca gtcgagcatg aagatcgagc gttcgaggcg gcccagctcg cgcatcgcga      7140
     gggccagtcc gttctgtcgc ggataggcgg acaggcggcg aagcatcgcc gaagcggtgg      7200
     cggtgccggt gcgtatcgat gtggcgaacc gcagcagttc atcccaatgc gccgcgacat      7260
     gacccaatgc gatcggttcg gccgtcatgc cggcaagcaa ggggccggct tcctggccgg      7320
     gaaggaggtg caaacgacgc tgcttgatgt cgcgcaggcg cggcgcgaag cggtagccga      7380
     agaagggcat aaggccgaac acatggtccg atgcaccgcc tgtatcggtg tagtgctcct      7440
     cgattgtcag gccggtctgc tgatacagca agccatccag cacataggga gcttcgccgg      7500
     cggtcgccgc gattacccgg gtcgcgaagg ggtcatatcg atccgagaca tgggtgtaga      7560
     aggcaacgcc cggttcgttg ccgctgcgcg cgttgatgtc gccgattgcg gcgccacggc      7620
     ccccggcatg gaattgctgt ccgtcgctcg acgaggtggt gccgtctccc cacagcgcgg      7680
     cgagcggcat ggcgcgatgg gcgtcgatca gccttcccag cgcttcacca taggcggcct      7740
     cgctgatgtg ccagtcgtgg agatgggcga gctggcgcag gcttgcgcct cggcaggttt      7800
     ccgccatgcg tgtgaggccg agattgatgc catcggcaag gatgacggtg agcagcgcat      7860
     tgcggtcgtc ggcctcccgg cccgaacgcc gatggatgaa gcattcgctg aacccggtcc      7920
     aggcatcgac ctcaagcagg agatcggtga tcttcacgcg cggcagtcgg tcataggcag      7980
     cgcgacgggc aatctcggtg gcgggtggcg ttgccgcttt cagcggcgag atgataaggc      8040
     cgctttcgtc aagcctgacc tggggcagct cgccctgtcg ggcgaggacc gtcacctgtt      8100
     cgatcgccgt gtcgagcctg gcgcgccttt cctcgatatg acgatcgaag tccgtttcga      8160
     tggcgagcgg caacggcccc ttctcgcgaa gcgcgtcgaa ggtggccggc gggatgaggt      8220
     agctatcgaa atcgcggaac tggcggcttc ccgagaccca tatgtctccc gctcgcaacc      8280
     gctcccgtag ctgggacaag gcgcatagtt cataggcggc gcgatcgacg atgccgtccc      8340
     gcaggacgaa cggccgccat gcggagggca caaagcgcag cggcacgcga tcaggcaagc      8400
     gccgtttgcc ggtccggtat agctccgcga tgatggtaag cgccgacagg agtccctgca      8460
     ccgcaccggc gccgcgaaat tcgaaggtgt tgagaaaggc accggcaaag agcttcaccg      8520
     tgcgatgccg ctcgatcaat tcagcggtgc gatcgacggt ttccggtcgc ccgagtactt      8580
     cggcccgcgc gaccgccacg gcgaagcgct gccaatccag cgcctcgatc tgcgccagag      8640
     agtccacacc gttggtgcgc gcttcgatga gaatgcggca agaccctgtg agcgtccgga      8700
     gatggccttg caactcgcgc accgtcttga gggctttgtc acgggtccgg ttctcggcgc      8760
     gacgcgacat gctgcccaac agcttgtcga acatcgtcag ggtggcatcg gtcaggcttt      8820
     cctcaagacg gatgccctgc gccgccagcg tcgcatggcg gcgcagggca ttgagttcgc      8880
     caaggtgctg gggtgtgatc cggctgcctt cgtccgccag cctgtcaaaa gtcaaagccg      8940
     ggatcatgtc ggcacgggcg cgatcgagat ccagcgcgcg gatatgagtg agccgttcga      9000
     tcaggcgtag gatgttgcgc gctgccggcg actgtggtgc attgcgcagc caggatagcc      9060
     atgtcgcggc ttgccctgtt cgtcgggcca gcagatcgtc cagcccctgc agcgtatcgg      9120
     gccgcaggcc gttcgtgagc acttcatagg taagctgttc ggcctgctgg cgagcacgcc      9180
     ggagtaccgc ttcgagaacc gatgaagaag gcaggaggat ctgccggcgc cgaagttcgt      9240
     caacgatgac ccccgccatc tggccggggt ggacgatggt ctgtgcgatc gggatcgaga      9300
     atgcgacaac ttcgtggaaa gccttgcggt cgaaaatcct gaacccgtgc gatcgtcgga      9360
     tttcaacgag atgttcgcga cgggtctggt cccgatgggc atagtccgcg aaggcttcgg      9420
     gcgcgacgcc gagttgctgc gccacatagg cgagcacagg agcgggcggg acttcacccg      9480
     cttccagcgc acggccaggc catctcatat agagtaggag catcgcgtag ccgagccggg      9540
     tggcatcgcc gcgacggcgg ccgacaattt ccaggtcgtc accggtcagc gtatagtgcc      9600
     gcgcaatctc gcgctcatcg agcggcgcgc cataatgccc tgcccagatt tccgcgctca      9660
     ccagtcgccg tctcgccaag cactatctcc ttccgcgtcc ttgtccgtca gacggtcctc      9720
     tggcggccag gatgaatatg tccgtcaact ctggacctgt gatggcgatt cggacaagat      9780
     cgcaaaatga tgggaaaacg gacacgatcg ggcagcatgt ggcgctgatc ggctatgcgc      9840
     gcgtctcgac cgcagaccag aagctggcgc tccagctcga cgcgttgagc gctgccggtt      9900
     gcgatcgcat attcgacgat tatgcatctg gagcaaaagc cgatcggccc ggcctggccg      9960
     aggcgctcac ctatctgcgt accggcgaca cgctggtggt ctggaaactc gatcgtcttg     10020
     ggcgttcgat gagccacctg atcgagaaag tcggcgagct ggcggcgcgc ggcgtgggtt     10080
     tccgctcgct caccgagcag atcgatacca ccacgtcagg cgggatgctg gtattcaaca     10140
     tcttcggctc gcttgcccaa ttcgagcgcg atctgatccg ggaacgcacc catgctggcc     10200
     tgcgagccgc gcgcgagcgc ggtagtcagg gcggtcgccg ccctgtcgtc actcccgaca     10260
     agctgcgcaa ggcgcgggcg cacatcgcag cgggcctaac tgttcgtgag gcggcggctc     10320
     ggctcaagat cgggaaaacc gccctgtaca aggctctgga aagcgcatga aaccgctgcc     10380
     gatccagaac tcgtgggtgc tggttacagg ggcctcaacc ggtttgggca gggcgtcagc     10440
     cctccgtttg gcggcatcgt accaggccaa gcccctgatt gttgggcgaa ggctcgacaa     10500
     cttgcgggag ctacaatccg aaattggcga gcggtttaat gtcccgtgcg agatcatagt     10560
     ggccgatcaa cgtgaaattg agggcaggga gaagattgcg gccaaggtta tagaattgaa     10620
     agtcaatgcg gctttcttgg ctgccgggct gacgagcgcc ggtccgtttg atgctagccg     10680
     tgccgacgcc tatgccgagg tgattggaac aaacgtagcc ggcttcacgg atttgctggc     10740
     ccgcctgatt gcgatcttcc ggcagcagcc gtttgaatcc tcaataatcg cagtgtcgag     10800
     cctggcgggc gaaacatccg tacccttcca agcggtctac ggcgcgtcga aggcctatgt     10860
     gagtaccctc atgcgggcac tttccatcga gcttgccggg acgggtgtga gcgttgggtc     10920
     ttttgcaccc ggtggcattg acaccgacat ggctgccctc agcgatttga agtggggaaa     10980
     gttgggcttg atgaacgttg atcgctgcgc gacccttgcc gtcgacgctc tggttcatcg     11040
     gcgatccttc gccataccgg ggatgggcaa ccgactcaca tacttggcga gcagggctct     11100
     acctcgatcg ttggtgagcc ggcttgcggc actcccatat cggcgcccgc aatgatcgac     11160
     acatgctcaa aggataggtt gaacacgccg ttgagtacct acaggtagcc tctgctggca     11220
     ttgtaccgga tttgttcgct cttagcgtgc agatacgtca ctttcgtgta gtcaccccaa     11280
     agacttcgag cggaccatca aatccgcaac cgcgctcctc tatgccgccg ctgccatcgt     11340
     cctcatccga cgcatcgctc gttacccatg agattcaaga cagactctta acaaaatttc     11400
     gttacttgac ggatttcttg gacttagggt tgcagtgcgc cgcatgtaga tggctgttcg     11460
     tggagaaaga caacgtgata cgtatgttgg gtgaattttg gccagatata ttcgtgatct     11520
     tactggtctg ttcgctcgta tcatttgcaa accaaaaatt cggaatattt gtcgctactc     11580
     cgataacatt gggatcgact gcattaacgc tattgctcgg agccgctggg gcgacatgat     11640
     tctactctta tcttcctttt ggccttggct tgttccagca attgcgtgga tcggattttt     11700
     caccggtcgc tattttagaa gaaagagcat agcgaaaaac acatgattgc cgcaactctg     11760
     gcggcttcgc gcgcctacgc cgggccgggt tactcccggc cgtgaaagcg gcatccatct     11820
     gcggcctgca cgtcaagcgt gtcggcgctc cttcgcagcc gccaacatct cgcgccgaag     11880
     gattgcgttc atgcgagcct gatagccctt gccctgggat ttgagccaag caagcacatc     11940
     ggcgtcgagc cgcgccgtta cctgctgctt gatcggctta tagaaccgtc cacgctcggc     12000
     ggtcttccag aaatcctctg tcagcgtcgg ggcatcacta tagtcgatac cgctatccgg     12060
     catcgcctgc agggcatcca gctcggcctt ctgtgcctcg gtcaaggggg gcagattgcc     12120
     cggatcgagc tggaagcgga cggtatcagc gtctttcttc ttcataacgt cgtctttcct     12180
     ttcgatcggc ttttcgggcc gaaatgatat ggatgatctc cacatattcg ccgtcgtcgt     12240
     catcctcagc gacggtgtgg gccaccagca ggagtaaatg tccttcgacc aggcccaagg     12300
     tctgccatcg ttgctcgccg ccttcgatcc gatcatgcac gctaagcgca aaggggtctg     12360
     cgaaggcgct ggcggccgtc tcgaaactga tgccatgctt tctcagattg ctctcggctt     12420
     tggctgggtg ccaggaaaag cgcatggata acatgacggg aatataatta tatttttgtc     12480
     gttattcaag gcgtatcctt gaccggcgct gaccacccga tccgctccaa cgtgtccgtc     12540
     aatgttgatc gcggcacgct gaacgtggct ctgttgcaaa aatcgtgaag cttgagcatg     12600
     cttggcggag attggacgga cggaacgatg acggatttca agtggcgcca tttccagggt     12660
     gatgtgatcc tgtgggcggt gcgctggtat tgtcgctatc cgatcagcta tcgcgacctt     12720
     gaggaaatgc tggcggaacg cggcatttcg gtcgaccata cgacgatcta tcgctgggtc     12780
     cagtgctacg ccccggagat ggagaagcgg ctgcgctggt tctggcggcg tggctttgat     12840
     ccgagctggc gcctggatga aacctacgtc aaggtgcggg gcaagtggac ctacctgtac     12900
     cgggcagtcg acaagcgggg cgacacgatc gatttctacc tgtcgccgac ccgcagcgcc     12960
     aaggcagcga agcggttcct gggcaaggcc ctgcgaggcc tgaagcactg ggaaaagcct     13020
     gccacgctca ataccgacaa agcgccgagc tatggtgcag cgatcaccga attgaagcgc     13080
     gaaggaaagc tggaccggga gacggcccac cggcaggtga agtatctcaa taacgtgatc     13140
     gaggccgatc acggaaagct caagatactg atcaagccgg tgcgcggttt caaatcgatc     13200
     cccacggcct atgccacgat caagggattc gaagtcatgc gagccctgcg caaaggacag     13260
     gctcgcccct ggtgcctgca gcccggcatc aggggcgagg tgcgccttgt ggagagagct     13320
     tttggcattg ggccctcggc gctgacggag gccatgggca tgctcaacca ccatttcgca     13380
     gcagccgcct gatcggcgca gagcgacagc ctacctctga ctgccgccaa tctttgcaac     13440
     agagccgcgc cttgtggaga gagcttttgg cattgggccc tcggcgctga cggaggccat     13500
     gggcatgctc aaccaccatt tcgcagcagc cgcctgatcg gcgcagagcg acagcctacc     13560
     tctgactgcc gccaatcttt gcaacagagc ccatctgccc gcgatccgca tcaccgatct     13620
     ccttgctgaa gtcgatcgat ggaccggttt cagccagtgc ttcacgcatc tgcaaagcgg     13680
     tcgggttgcc gatgaacccc gcgctatcct gacggcggtg ctcgccgatg cgaccaatct     13740
     tggccataag cgcatggcag aagcctgcga tctcgtgacc caacgccaac tcagttggct     13800
     cgcctcatgg catttacgcg aggaaaccta cggtagggct ctcgcccggt tggtcaatgc     13860
     ccagcacacc gcgccgctcg ccgccctgtt tgggtccggg acctcgtcca gttcggacgg     13920
     tcagaacttc ctgcttgatc gccgtgctca ggcgaccggc gcagtcaatc cgcacaaggg     13980
     ggcggagcct gctgtctcct tctacagcca tgtctcggat cgctacgcgc cgtttcattc     14040
     caccgtcatc tccgcatccg caagcgaggc ggcgcaggtg ctggacgggc tgctccatca     14100
     tggtgccgat ctgcacattg aggagcatca cgtcgatggt gggggcgttt ccgaccatgt     14160
     gtttgcgcta tgccatctac ttggattccg gttcgcgccg cgcatcccta acatcgccgc     14220
     gcgccggctt cacctgttca acggaatcga acctggccca gatatcgcgc cgctggtcgc     14280
     gggcaggatc gacgaggccc tgatcgccgc acactgggac gacgtgctgc gcttgggcac     14340
     ctcgatccgc accggcgtcg tgagtgcatc gatcatgctg gaacggctcg gctcctatcc     14400
     acgggccaat ggcctggcct tggcactgcg cgagatcggc cgcgtcgagc gcaccctgtt     14460
     tacactcgac tggatcgagc agcccgaaca gcggcgccgc gcaacccgcg aactcaacaa     14520
     gggtgaggcc gaaaatgctc tgaaacgcgc catcttcttc caccggatcg gccgcatccg     14580
     tgatcacgcc ctgcaagccc agacccatcg ggcgagcgcg ctaaacctcg tcgccggtgc     14640
     tatcgtcctg tggaacacga cctacctgca agccgcccgc atgcatcttg ccagtctcgg     14700
     ccggtcggtc ccgccggacc tgttgcaaca cctttcgccg ctcggatggc agcacatcaa     14760
     cctcaccggc gattatcttt ggaccgaccc cgatgcgcca tcgtccgccc tcaggccgct     14820
     tcgccagatg cacgccgtcg aaggtccggc gaaaccttag cgtatatctg ggtccgttct     14880
     atgtaccgac cccgttctgc cgatgcagga acaagacgcg atcggtcaaa tgtggcaatt     14940
     catcaacaca atcccaaaat tcatcttcgg gaaatgtcat gcgcggtgac gccatgcacg     15000
     tatctattga ttgttgcaga taacaatctg cggctgaatc atcgacctca acgagtatcg     15060
     caagagcttt ttccatgaac tctagggcaa ccgctttctg ttgctctcga tagatattgg     15120
     aagaatcaac catagcctag tcctcctttc ggtcgctgta gggaggacga tgactcaaca     15180
     atagggaaat tgcacgcgca actagggcca gattgagcag taattttatt acaacggcaa     15240
     gcagccctcg cctgcccgga caggggcggc gcgtggcatc ggctagattg tttgttggtc     15300
     ttccgacgat ggctagtcct tgcgggccat cgtcggaagt ggacggccgc acaaattggg     15360
     gggcgtgggc cgcgccgggc ctctagcata aaattacggc cctgcatccc cggcgttgat     15420
     acattcgtcg cgcagggcgc tcgattgagc cgccccgatc gcggtcgcct caatcggcat     15480
     agcgagctgg caatatgcac atacgcgcat aatttccgct tgcgggctat gtatatttgt     15540
     gcataatagc cgcgatggat acggaacggc cggttcgatg ggtggcatcg tcaaagcgcg     15600
     attttcggga gttcccggac gatgtgcagg acgtaatggg ctatgccctg caccttgcgc     15660
     agcaaggcgg gcagcacgcc agcactaagc cgttgaaggg ctttggcggc gctggcgtgg     15720
     tcgagatcat agacgaccac caaggcgata cgttccgcac ggtctatacg gtcaaattcg     15780
     cggaggcggt ctatgtcctg cacgccttcc agaagaaatc caagcagggc aaggccacgc     15840
     cgcaggccga tatggatttg atccgaacgc ggctgaaatc cgccgaggag catcaccggc     15900
     aacaccagac cccgcgaggc acagcatgag cgcacaggac gaaatcattg aggaaggcag     15960
     cggcaatgtc tttgccgatc taggctttgc cgaccccgac acccaccttt tgaaagccca     16020
     gctcgttacc cgtgtggccg aggccatgca ggagcggaag ttgacgcaga tcgccgccgc     16080
     caaggttacg ggatctaccc aaccggaatt gtcgcgcatc ctgcgaggcc agttccgcag     16140
     cgtctcggtt gagcggcttc tagccatgct cacccggctt ggctgcaagg tcgatattgt     16200
     cgtgcgcccg caggggcgga ccactgaatc ggccgtgatc cacttcgcct aatgtgcgat     16260
     gatttcgcgc aagcccggct cgatatgttc gaggccgggc tattcggcca agggcctgcc     16320
     ttctggcgct ggatcgaaac cgacgcggcg caaccctatc ttgccgcttt cgccgccgat     16380
     cgacggccgc ccgaacccgg cgaacccttc gctatcgacc ttgcggccga cgacttgctt     16440
     gctcccgatc gcctcgccca gctcgcccta cagatcgagg ccgaccatgc ttgatcccaa     16500
     tccgtccgta gccgaccttg acgcattgct agatcgccac cgcaatgacg atgcggctat     16560
     ggaaaagatc gttcgcgggt atctccgttg cgcgatctac agctatcaga agcattgcgt     16620
     ttggcgcgcc ttgcgccaca tcggcaagga cgattggagt ttcaaagagg aagacgttgc     16680
     cgccttgagg gccgaaggcg cgaaatccat ttcggacttt cgagactggc tcattgagga     16740
     gctggccggg atggggatca gcgcccacac cggcttgccg aattgagcgc ctagcgcgcc     16800
     gtcgcttcaa ttgctggcgg tgattgtgcg cggaataaat cgcgggtccg ccgtgggatc     16860
     ggtaggcgaa ggatgcagca tgtcgcgccg gaaattcacc gcaacggaaa taggcgcggc     16920
     gttcggccga gccgccatga cgcgggcttg tggagctggc gcagcctcat agctggccat     16980
     cggctgcacg gccgccgagg ttaggccccc taccccgcgt tccgctctgg cgacgacaat     17040
     ttgagcgcga tcgagcggcc gagtctgatc gccggtatag aaagccagat gccaatgatc     17100
     ggcatggccc cggtcccccg gccccagcag ctccgccacg cgaataccat gttgcgccat     17160
     cacggcgcgg atttgctcgc gcgtgatcgt gtgcagcccg gcacgcggca cgaaatccac     17220
     cgcctgccca tatttgtgaa agctgttggc ggccccgtaa ttggcttcca gcgcccgcca     17280
     cgtatcggtt atgcgagcat tgaacgcagc ggccaagatc gaggcgacat agcccgccga     17340
     ggcgtcggcg ctgccttggg gctggacgat cgccggttgc gccgcgagct ggcccccgcc     17400
     cgtcgcgtcg gccgccgtga tcgtgagcgg gatcgaggcc gatcgcgcag caggagcgcc     17460
     gccgcttacc gggatgccgt tcacgctgta ggtattatag cgcgaggaaa gccacgcctc     17520
     ccagcgcgca cctttcgcca taatcagcgc ccgatagcgg gcattatgga ccggcgttcg     17580
     ggaatgataa ttggcaaccc gcgtccacag gtcgcccttg tcatcccgga tatggtttct     17640
     gatacgccat gcagcgaggt tgtagggata gcaccccgcc gcaagcacat attcgggccg     17700
     gatgccgtag cgtgccagcg attgaatata gctggaattg agctgcatcg agccaagatc     17760
     ggcggtgtta ttggtgttct ggacgcgcgc gccgggccga ccgttctctt gttccgcgac     17820
     cgccagcatg acgttcgccg gaatgttata gcgcagcgcc gccgcgatcg agcattgcac     17880
     ccgttcttct atgacaaccg gaggcagatc agcggccatg attagctgtc cccccttctc     17940
     tggacgaagg ccgcaacttc atcctctggc gtctccatgt cgcccgcatc acgggcggcc     18000
     gaaatggtat cgcccgcgaa ttgcgccgtg gggggtggcg atgaatcgga cgagctggcg     18060
     ggactgcccg cgccggtcgc gggagcgagc gtttcacttc ccgacgatgc cgaggcggcc     18120
     gacgcgcgga tattggccgc cagtcggccg cccaccgtat ttcccacccg ctctttcaaa     18180
     gcgcccaccg ccataccagc ggcagcgccg ccgaggatgc ttgcggtttt cgccgcacgg     18240
     ctaaggccgg tgcgttgcgt gccgccagtg tcgccacttt cgggcgcgcc ttcaccttgc     18300
     gagctggcgg agctggcctc cccctccccc gcaggcgagc caccggcagc gccgccgccg     18360
     ttgccgtctt cacgatcggc cgcctcgcta cccgcagcgg cgcttgcagc cgtgccgccg     18420
     cccgcgctgg cggcttccga gccgccttga aggccgctgt tgtcattggc cgggggggaa     18480
     ccgccatcgc cgcccatagc gacgctaagg ggcgtgccgc cgcccccacc gccaccgccg     18540
     ccgccgttat cgccgcctcc cggcatgtcg cccgccgacg aaagcggttg cccgcctccc     18600
     atgccggttt ggccgccttc accaccgctc ccaccagcgg cagcgaaggc ggccttgatc     18660
     gcgctggctc cacccgcagc gttcatcgcg ccagcagcga tcatagcccc acccgtggcc     18720
     gccgccccag cggccatccc ggcagcaccc agcgcggccc ctgccccaaa ggctccgata     18780
     ccgcccgccg cgtggatcga gccgccgctt ataacgcccc cgaccatcgc gggaaccttg     18840
     tttacgagcg ccagaaggac gaccgcgaag acaagcatgg tccctaaatc ttggagagac     18900
     gaaccctcgc ccgttgcggg gctctgttgc aaaaatcgtg aagcttgagc atgcttggcg     18960
     gagattggac ggacggaacg atgacggatt tcaagtggcg ccatttccag ggtgatgtga     19020
     tcctgtgggc ggtgcgctgg tattgtcgct atccgatcag ctatcgcgac cttgaggaaa     19080
     tgctggcggc tctgttgcaa agattggcgg cagtcagagg taggctgtcg ctctgcgccg     19140
     atcaggcggc tgctgcgaaa tggtggttga gcatgcccat ggcctccgtc agcgccgagg     19200
     gcccaatgcc aaaagctctc tccacaaggc gcacctcgcc cctgatgccg ggctgcaggc     19260
     accaggggcg agcctgtcct ttgcgcaggg ctcgcatgac ttcgaatccc ttgatcgtgg     19320
     cataggccgt ggggatcgat ttgaaaccgc gcaccggctt gatcagtatc ttgagctttc     19380
     cgtgatcggc ctcgatcacg ttattgagat acttcacctg ccggtgggcc gtctcccggt     19440
     ccagctttcc ttcgcgcttc aattcggtga tcgctgcacc atagctcggc gctttgtcgg     19500
     tattgagcgt ggcaggcttt tcccagtgct tcaggcctcg cagggccttg cccaggaacc     19560
     gcttcgctgc cttggcgctg cgggtcggcg acaggtagaa atcgatcgtg tcgccccgct     19620
     tgtcgactgc ccggtacagg taggtccact tgccccgcac cttgacgtag gtttcatcca     19680
     ggcgccagct cggatcaaag ccacgccgcc agaaccagcg cagccgcttc tccatctccg     19740
     gggcgtagca ctggacccag cgatagatcg tcgtatggtc gaccgaaatg ccgcgttccg     19800
     ccagcatttc ctcaaggtcg cgatagctga tcggatagcg acaataccag cgcaccgccc     19860
     acaggatcac atcaccctgg aaatggcgcc acttgaaatc cgtcatcgtt ccgtccgtcc     19920
     aatctccgcc aagcatgctc aagcttcacg atttttgcaa cagagcccgc tactcgatcg     19980
     gcgttggcgt cacaggattc gagctcgatt tctggggccg ggtgcgcaac ctttctgacg     20040
     cagcgcgctc gcaatatcta gcaaccgtgc aggctgaacg ggcgttccgc ctcgcgttga     20100
     tccgggatgt ggcctcgacc tattttgctt cccgggaagc cgacgagcgg atcgcccttg     20160
     ccgaagctac ggtacgcagc cggcaggaag gcctccgcat agccgagcgt cgccttgaag     20220
     ccggggtgac ttcagctctt gattttcgac aggcggagtc gctactgact caagccgaaa     20280
     cggagttggc cagcctgcgc ttggccgagg cgcagagtga gaacttcctg gccgtactct     20340
     tgggcggacc cgttcctgtc gggctcacgg tgccgctgac gctggctgac cagaaaaacg     20400
     gaacggtgat tgccgccgga ttaccctccg agctgatggt gactcgaccg gacatattgg     20460
     cggcagaaga gaaactgcgg gcagcgcgtg ccaatatcgg tgctgctcgg gcagccttct     20520
     ttccatccat ctcactaacc ggtagtatcg gtttcgcttc aactgatctt gggaatttga     20580
     tcggaaacga aggactgagc tggagctttg gaccttcgat cagcctaccc atcttcgatt     20640
     ggggtgcgag gaagggcaat ctgagcgtgg ctgaggcacg tgaggatatt gccatcgccg     20700
     aatacgaacg caccattcag ggagctttcc gcgaagttgc ggacgccctt gccgggcgcc     20760
     gctggcttgc tgaacaggtc gccgcgcagg ttcgtgccac tgcggcacag cgagcgatcg     20820
     ccgatcttgc ccgcactcgc taccgcgagg gcgtcgcaaa ttaccttgaa gtgctcgatg     20880
     ccgaacggaa tctgttcatc gcggaacaga cactgataca gctgcgtcgc gccgagctgg     20940
     atgctctcgt ctctctgtat gtcgctctgg gcggcggcca gcaagggtaa tggtggtaat     21000
     gttccaccga cgggccttgg ctattgatca tgacaaccta cagatcggtc cgccgataaa     21060
     ttccctgacc tatatatgat aatgtccttt ttatcacaca ttcaaaagga ccatgatcgc     21120
     catgcctgag acggcctcga caccgccgca gcgccgccct gtcatccggg ccgtgagctt     21180
     cgatgaggcc gacgcggcga tcggccgctt gctgcggatc gcgctgccgc ccacgcgcgc     21240
     ggccgagacc ggcgcgtcgg ccaaggtcgc ggattttctg ttggcctggt ggaatggcga     21300
     cgagtgcggg catttcccga tcctgcacct ttgcaacgtc gatgccgtca ttgccgagga     21360
     tatgctgacg gtcatgacct atctggcgca ggagtcgacc acctacgccg atgcctgggg     21420
     ttaccgcgac gcgatgcacg acctttgggt gcgctatcgg ggcgaccccc gccgagagcg     21480
     tttaaacgcc tccgaagatc caccgtaaaa agggatgccg gcatgatcga aaatgacgac     21540
     gaggcttttg ccgacaacta cgccgagcgc gaccaggcca aggcgctgcg cgagcaggcg     21600
     cgcgcgggcg ggctgcgttt cgaggcgtat ctacccggcg acatggccga ttggctgttg     21660
     gcgcaggtcg agcggggcca tttcgttgat ccgtccgagg cggtgttcgc gatcgtccag     21720
     aacttcatcg agatggagcc gcaccgcgat ttgcgcgacg agctgttgcg ccggatattg     21780
     gacgagtcgg ttgcacgcgg gcttgaggac gtgaaggcgg gccgcgttcg tcccgccgat     21840
     gaggtgtttg acgaattgcg ccgggagctg gcgaagcccc gccccgagcc ggcccgctgg     21900
     cagaagatcg cacgatgaac cagctcgccc ccctaccctc gcccgcgctg gtgttgccgg     21960
     ccttgatcgc ggcggccgac gagcgcgcgc ggcttcgctt ccttgagttc ttcgccgtca     22020
     ccatccgcaa tccgcatacg cgccgcgcct atgcgcgcgc ggcgggcgac ttcctggcct     22080
     ggtgcgaggc gcgcggcgtt gcctctctcg ctggcgtgca accgctccac gtcgcggcct     22140
     gggtcgaggc gctggggcgc gagctggccg cgcccagcgt caagcagcag ctcgccggcg     22200
     tgcgccacct gttcgactgg ctggtgacgg gccatatcgt gccggtgaac cctgccggat     22260
     cggtgcgcgg gccggcgcat agccagcggc gcggcaagac gccggtgctg gcccccgacg     22320
     aggcgcggcg gttgctcgac agcatcgacg tgatcaccca tgcgggcctg cgcgaccgcg     22380
     cccttatcgg gttgatggtc tatagcttcg cgcggatcgg cgcggcgctg gcgatgcggg     22440
     tcgaggacgt gttcatgcag aacaggcggc tatgggtccg cctgcatgag aaaggcggca     22500
     agcgccatga gatgccctgc caccacaatc ttgaggatta tctatccgcc tatatcgacg     22560
     gctgcgagct gcgcgaggat cgcaaggggc cgctgttccg cacgatcgcg cgcggcacta     22620
     agcgactaag cgagaccccc ctcccccaag ccaatgcgtt cgcgatggtg cgccggcgcg     22680
     cgggcgcggc cgagatcggg acggcgatcg gcaaccattc gttccgcgcg accgggatca     22740
     ccacctatct gaaaaacggc ggcacgttgg agacggccgc gacgatggcg aaccacagct     22800
     cgacgcgcac cacccagctt tacgaccggc gacccgatga cgtgacgctg gacgaggtgg     22860
     agcgggtgtt gatctaggcg gcgatcgccg gcgcacacgc ccagcggtcg ccatcccaat     22920
     gaaaccctag ccgctgcgcg ttgctgatcg cgggcggctc gcccttgcgc cagaaggcgc     22980
     gcatcttggc gcgctcgtcc agatcggcgt cggcgacgat cgtgcgcgcg gcctggatga     23040
     actgcccatg tccgaacaca tagacgagcg aagcgggcgg catggccgcg aggcgggcca     23100
     gcgccgcctc gcagcgcccg agcaaggcgc ggaaactctc cgccccttcc ccgtcgcaat     23160
     agtccggatc ggccgcgctc caatagcgtt cgaggtgcgg catccgttcg gcgctgcgcg     23220
     tgccgttaca gcgcgccggt tggagatagg taaattcttc gatcggccac acttcgaccg     23280
     gcacgccggg aaagcgcgct atcgtcggcg cggccgtttg ccgggtgcgg gtatagggcg     23340
     acgtgacgat gagcgcaggc gcttgcgtcc agctcgccgc gacctggcgc gcttgttcgt     23400
     ggccgcgctc cgtcagctcg atcgccgcga gatcatggca cggcacgccg gcgttgccgg     23460
     tggattcgcc gtggcggatg aagatcgccc gcatatgcgt catctatccg aatacctcgc     23520
     tatgcgagcc aaggcgcgcg aggcgcagcg tttcgtcgtc gggcttggcg tagatcagca     23580
     ccagatcggg cttgacgtgg caatcgcggt agcccgccca atcgccgctc agatcatggt     23640
     cgcggtattt gggatcaagc ggcgtgtcgg tcgcgagcgc ggccaggacg ggcagaagat     23700
     cggcatcgag ggtcgctcga tgccggccct ttgattcccg cttgtagtcg cgcttgaacc     23760
     gggtcgaacg atcaatcgtc cgcatggagg tccgccatca gcgcatcgac gctggcgaac     23820
     ttggtcccct tccccgccgc cagctctgcc attgcctcgc gtgtcgcggc gttcggaacc     23880
     ttgacctcga aaggcaagcg ccgttcgtcg gcgatacgca gcatcagcag ccggatagcg     23940
     tcggagatcg aaaggcccat cgcgcccagc gcggcggtgg cgcgttcctt cgttgtattg     24000
     tcgatcctgg cgcggacata agtgtcggaa acagccattg ggatttcctt ctgaaaacgt     24060
     agtcccagtg tagtcacaaa atctgatttt ggcaatgggt gcggtgatta tgcgcctgcc     24120
     gctggcgcgg caccgtggct ctagtcgctc acgctcccca agcccgcaag cggtcttggc     24180
     ccaaggtgac gatccacatg gcggaagcga gatcgctgcg cggatctcgc gcagcagtgc     24240
     cggcgtgcgc cggcgccgat cctgtttgaa gggggaaagg cggtcccggc cgcctctccc     24300
     ccgcaacggc aatcagcggg accgtggctc actcgcttcg ctccctgcgc cgcgcaccac     24360
     tcccgcagat tcccgctgcc cccctctctc gccggcgttc ttgggcgtcc gtgttccggc     24420
     cgatggcatg gccatcgccg gacaggcgat ttgaagggag taaagacgat gacccacgaa     24480
     atccgcgaaa gctggctcaa tgccgtggcg cagggcatgg ctccgctgtt cgaggcgctg     24540
     gacgcccccc tgcccgaccg cgtgcgcgtg gcgatcggct tcaccagcag aggcgcgaag     24600
     ggcaaggcga tcggcgagtg ctgggacaac cgacttagcg cggacgggca ttttgaaatc     24660
     ttcatccgcc cggacctagc gcacgcgccc gatgcgatgc cggcgcagat cgcggccatc     24720
     ctcgcgcatg agctggtcca tgccgccgtc ggcatcccgg cagggcatgg gaaggcgttt     24780
     aaacgggtcg cgctggggct ggggttggtc gggccgatgc gtgccaccac ccccggcgag     24840
     gcgttccttg cggccgtcgc atcgatcctc gatgtcgctg gccccctccc ccatgcccgt     24900
     ctcgacacgg acggggagtc gaccgcgccc aagaagcaga aaacccggat gctgaaatgc     24960
     gagtgcgcga cgtgcggcta taccgcgagg accgcgcgca aatggcttga gcaggccgga     25020
     gcgccgcttt gcccgatcga ggatcacggc cagatgcagc ataagccgct ggacgatgac     25080
     agcgaggagg agggcggcga ggacggctag acgccctgcc ctttcatccg atagcctctt     25140
     gcgctatgac cacattcaaa catgagttca tgtaaggata ttcacatgcc aacaatcgcg     25200
     atcatcagcc agaagggggg ggcgggcaag accaccctcg ccttgcacct ggccgcagcc     25260
     gccgaggatt ccgggcatac cgcgctggtg atcgacctcg acccgcaggc gacggcgagc     25320
     caatgggcgg catggcggca ggacgtgccc ccggtcgtga tcgacagcgc cccccctcgc     25380
     ctcgccgcca agatcgagca agcgacggcg cagggcgcgg agttcatcgt gatcgacacc     25440
     ccgccccatg ccgacagcgc cgccagcgcc gccgtcgagg ctgccgacct ggtgctgatc     25500
     ccatgtcggc cgagcgcgtt cgacctggcc gcgatcaaga cgaccgccag ccttgtgaag     25560
     atgcgcggca agcccgcttt cgtgatcttc acggcgggaa gcccgaccgc gccgcgcatg     25620
     tatgaggaag cgacgcagct cgtgcaggat tatgggctgg acgcctgccc gcaccgtgtt     25680
     gcggatcgcg ccgcgttccg tcacgcggcg gccgagggga aaaccgcgat ggagatcgag     25740
     ccggacggca aggcggcaga cgaggtgcgc cagctttaca agtggacatg cgagcatgta     25800
     aacatgcaag catcaacgaa gcggagggcc agcgcatgag ccggaaggga tcattgcttg     25860
     cattgcggga tcgcgatccc gcaccaacgc cggcgtcggc cgagccggag ggaagggcgg     25920
     ccgtgccgat cgccggcagc actggcgtag gcaccggcag cagttcgagc agcagcccgg     25980
     ttgcgccgag ccgtcagggc aagaaggcga tgacgggcta tttcagcccg gaaatgtcgt     26040
     tcgccatgca catgaccgcc cgcaagcacg gcatgagctt gcaggacgcg atggccgagg     26100
     cgttcaacga ctggctccga aagatggggg aaagtcctgt aggcaagtga gcatgttcac     26160
     atgcaaacat ggcagttaac gccacgacac tgtcctattg ccgccacgat tttcggcgaa     26220
     gcaatcacgc tatggtagtt attaggcacg cgatctttcc tcgtgacaca gcttcggtgc     26280
     tgggcatctg gcgtgagttc atcgctaatt cgccggtcaa tctcgactat cagaataatg     26340
     acgctgagtt tgcaaacttg cctgggaagt atgcggcgcc caaaggatgc gtgctgcttg     26400
     cggaccggga gggggaaatc gaaggctgcg tagcgatgcg ccaagtcaca cacgagatat     26460
     gcgagatgaa acgactatat gttcgtcccc aggctcaggg acggcatctt ggtcgcgcgc     26520
     tcgctgaacg tctgatcgag gaagctcgca ctgtgggcta cagcgaaatg aggctcgatg     26580
     tgcaagcgaa gttcgtcccc gcgcgcaagc tgtatgagac tcttggtttc gtcgcggcgg     26640
     agccgatttc cttcaacccg gttcccggcg catcctttct tggacttcac ctgtagtcga     26700
     gtccgtagct atcgaccaga aagtgataaa gccggatcag tcgatatgtt tgcatgtgga     26760
     catgaacgct tgtccacata agggatcagc gcagtggctt gcgttcgtgc cgtttcttgc     26820
     agaagcctag gaaagcggcg cgggggcttt tcaactcggg cttgcccatg tcgtgccacc     26880
     acgacaccca ttcgtcataa agcgcataca cgtcatagcc tggcgcggcc gtcttggcgt     26940
     cgtgcatggt ttccgggtcg atatagggcg catcgtcgcc ggcgttggcg agcggatcgg     27000
     gcttggactt gaggcccgag cggttgcgga acaggatcac gtcatcatcc atcgtcaccg     27060
     catagtcggg gaaatggccg tggtccgcgt catgctcgca gaccttcttg accaaggccc     27120
     gaaacacccg gagcgggctg ttcgagccgc atttcttttg cagcagctcc aggccgatct     27180
     tccattcgtc cttcacgccg caatgcttgc gggccagctc atacatgcgc cgctcgaacg     27240
     gcttgcggag ccggaaatag tcgcggtgaa gcgtcagaac attcttgctg atgaccgagc     27300
     gatagaccca atccgacagg gtgatttcca gatcgagcat acggccgtcg aacgtcttgc     27360
     gcgtgattct ggcttcttcg atcagcccga aaatccgcgt ttcctcgaca ccgcccgtct     27420
     ggaggctctg ttgcaaaaat cgtgaagctt gagcatgctt ggcggagatt ggacggacgg     27480
     aacgatgacg gatttcaagt ggcgccattt ccagggtgat gtgatcctgt gggcggtgcg     27540
     ctggtattgt cgctatccga tcagctatcg cgaccttgag gaaatgctgg cggaacgcgg     27600
     catttcggtc gaccatacga cgatctatcg ctgggtccag tgctacgccc cggagatgga     27660
     gaagcggctg cgctggttct ggcggcgtgg ctttgatccg agctggcgcc tggatgaaac     27720
     ctacgtcaag gtgcggggca agtggaccta cctgtaccgg gcagtcgaca agcggggcga     27780
     cacgatcgat ttctacctgt cgccgacccg cagcgccaag gcagcgaagc ggttcctggg     27840
     caaggccctg cgaggcctga agcactggga aaagcctgcc acgctcaata ccgacaaagc     27900
     gccgagctat ggtgcagcga tcaccgaatt gaagcgcgaa ggaaagctgg accgggagac     27960
     ggcccaccgg caggtgaagt atctcaataa cgtgatcgag gccgatcacg gaaagctcaa     28020
     gatactgatc aagccggtgc gcggtttcaa atcgatcccc acggcctatg ccacgatcaa     28080
     gggattcgaa gtcatgcgag ccctgcgcaa aggacaggct cgcccctggt gcctgcagcc     28140
     cggcatcagg ggcgaggtgc gccttgtgga gagagctttt ggcattgggc cctcggcgct     28200
     gacggaggcc atgggcatgc tcaaccacca tttcgcagca gccgcctgat cggcgcagag     28260
     cgacagccta cctctgactg ccgccaatct ttgcaacaga gcccgctggc gaaagcttcg     28320
     acgccgtgct gcgcggcgca cgggaaaaga tcgtgggtgg cgaagagtcg gaagctttcg     28380
     tcccgttcca tcgcgcagag ccattgtgcg ctgtcatccc agtcaatcag cgcgagcgcg     28440
     aggcagcgcg ttccgccata gggatgcggc tcgacgggat cggtagggaa acccggcaat     28500
     gtccagaagc gccagccaag cggcgggcat ggatcgatat cgacgtcgac gatccatcgg     28560
     tcgatcctgg caaggattct cgtcatgcgg ccctcttgag gtcgcgttct tcgatcagcg     28620
     cggcaaatcg atctcggatc atagtcgcgg tgggatagcg gtgctgcagc gcgtggcggt     28680
     agagaagttc agcgcgaacc tcggcaatgc gaaccgcttc gtcccatgtc ggaaggcgtg     28740
     gtggccatcc tttgacaaac cgtagaccct tggggagaga cgcttccagc gagcgccgtc     28800
     ggccggcgtc gcagcgcgct tgatctatgt cgcgcttcaa tgtttcaggg agatggtcag     28860
     gtgcgacgtc ggcgagccat cgggctggct gaaacgaaaa ggtggagtgc gcctcgagac     28920
     cgaccaggtg gtgatagagg gaaagattgt cctgaacatt ggcggcgatc gtcaggtccg     28980
     gaagcgatgc aaggacgcaa aacgcgcaag acaaacgggt cgaaccacgg gcataagcct     29040
     cgtgcagagg tacatgatat tgctcatggg ccgcgaagac atcctgcgct gtccagtcga     29100
     tcagcggatg ccagagcatc atcctggtgc cggctgcatt tccgcttgga gcgaagcgaa     29160
     tatcgagttt cgaaactggc gtcagctggc gagcgctgct ttcgtcgcga cggataccga     29220
     tgacctgaac gactgtttcg ccacgaaggc gtcgagccag ctcggggccg atgacattcg     29280
     ccttcaattc cgacgaacaa aacctcaagg ctgaactcga ccacggaccg atcaaattat     29340
     aggtcaggag gtctgcatag cgacggcagc cgtcgcgaaa ccgctgctcc cagcgatcga     29400
     ccatgtcgcc ggcgcgacgg cgcaccacga tgagtggaag gccgagatgg cgggataccg     29460
     cttcaacggt cgaaggggtt gtacgccatt cggcgcgtcc aagatcagcg tgaatggcca     29520
     ggcgtctgga gcgcgggtgg ccgatggaat ccagcagcgc cgaaacggtg gcagccgtgg     29580
     cgccgctgtc cttgccgccg gacaggctga agacgaacca ggctcgatcg cggatggccc     29640
     gttctatcgt tgcgtcgatg gcgacgggtg gcagcgcgat attggctgcg agggcgggcg     29700
     tcatgatcgc gtgccctccc ggagacgatt ccaaacgtac aaggccgtgc cgatggcctc     29760
     gatgacgtct tcgcagagat gttcgatgca gcaggcataa aagaagctcg cgccacttcc     29820
     gatcagcgag gtcgatcgtc caaagaagcg cggtccgcgt tcgcaccaca ggatcgcacg     29880
     atgggttgcc ggcttgtcca tgcgccatgg ttcatcccag aatagccgaa cctcgatatg     29940
     gatttgatct tccagaaggg gatcggccgg cgtcctgcgc aggaagattg aggcgccgtg     30000
     ggcgacagat gtcgggacgt caccggcaaa ccaatatagt tcgccgggag ggaccagcca     30060
     ttcatgatgg gggaccggct tgatcaaccg cagacgggat tcagcacaag caaagtcggc     30120
     aatgatccgc tccgcgagat ctaaggtcgt catgccgccc tcgactgcgg gagcagttgg     30180
     agcccgaagg gcgcgtcgcc actaggggtc acgcctttgc gatggaggaa gcgatagccg     30240
     tcagagatgt cgttgatgtg cgcgcggatg acggtggtgg tgatttctcg gggggaccgg     30300
     tagatcggtg gcaccgggtt ggcggtcatt tcggggaaaa tcgcgtgaag cagcaccgcc     30360
     tcgatctgtt tggcgatgcg atcgatgtcg cggccggcat catatttggc gaggccgggt     30420
     tccatcctga gccagtcgag cggcgcgatc acctcgggca ggcgggcata gggaccgcct     30480
     tcgacgccgt agttcgagcg catcgagatg agggcggacc gcgtgggcgt gatcgcatcg     30540
     aaagggatca ggatccggta ttcggcaagc gggagcgttc ccgcaatccg tttgcgggca     30600
     gcgagtatct gcatgatgtc ctccgtcagg caaagaggcg ggccggggcg gcggccggcg     30660
     gggtgagctg gagttcgcgg gtcaggcgtt ccacgaagat gtcgggcgag aggacctctt     30720
     tgatcgaggc ccaatgattg gggcctccgg tgtagtcctg ccggctcgag acgcggcgga     30780
     agaggacgtg gcgccgttcg tcgggccagt cgatgccgat catgacgtag aggttggagc     30840
     tgtgcaggga aatttcgcct gcgacagccg gccccccgac gcaactatgg atgtcatatt     30900
     cgccgcgctc cagccgcagc gcgtcggcga ggcgcttgag aactcttcgt ccctcggcat     30960
     ggtaacagcg ctttgccgcc tcatcgtagc tgacgaagcg gcgggcaagc aggagcaaca     31020
     acggatttcg ctcgatctcg ccgatttcgg tgatgcaggc acgccgcagg tccgaggcgg     31080
     caggtttgcc atcggttgcg accgaaccga ggtggcgcgc gagcagcaac acggcggggt     31140
     cggtctcgat gtccttgccg gcgttccgac agtccgtgat ggccgcgcac agcgcatgca     31200
     aggcccccgt cgtggtgatg agggcggcgg gatcgagcgc ctggcggtgg cgaaaggcaa     31260
     catcatagga catggcggca ctccggtttg gggcgaccaa gcgcgcccgc ctatcccctc     31320
     cccctcacct cctgctggct ggatgacggt cgaaatcgcc gggaaatggc ctcactcggg     31380
     gtggtcttgc caaacgaggt gagggggcac agcggtggcg ggttttgaac tcaggccgtt     31440
     gcgagcgcgc cgtcatgttg cggaagatgt tggatcgccg ctttgcccag gcgcagaacc     31500
     gcgcggtttg ccggggcggc ttcgagcatt ctcgcgatat ggaatgcgtc gcctggatga     31560
     agtttgcccg ctggcgggta agcacggtag tggtccagtt cactggcaac accacattcg     31620
     ttgagcgcat aatcgaggag cgcgccgcag atcatgcagt ttttggatgt gtcctcatgg     31680
     tggagttccg tcgccgagac gcggtgatct tctctttggt cctcgggaag aagcggaagc     31740
     aacttggcca gcagcgcgtc agcgcaggtc tcgcaatatt cgtgcgcttc gtcgctgtag     31800
     aggctttcgc cattccattc gatcctgaac tcaccccaga tatagaatgg ccggagcgga     31860
     acgatgccgc cttccttggc gaacctgtcg aggcgggttt cgatgtggcg ggcgtccatg     31920
     acgtttctcc aggcttgaga catccgtgat gctatgatgc cgcgaggccg actcagtttg     31980
     tgcgccgctg gatgaggcgc gctgtgtcgg caccggaaca accaggcgga atgatgatgc     32040
     gggaactcga cgaagaagag cgccaagtgc tgcgtgacct cgatgccgga gtgtccaccg     32100
     ccgacctgat cgctatggtc cgcgatcttg ccgagatttt gcgcgggcgc ggccatgtgg     32160
     ttcaagccag cgtcgccgag attgcggccg atcggctgaa cctgttgagc acaggcgttc     32220
     gggcctgatg gcaaagcggg aagagtgtgg aatttcttct accaggtgaa caggggaagg     32280
     tcatcggtgg tgccggcatc gcgatcgatc aggacatgct cgaagccgcg ttcccggcca     32340
     aattgcatca ctgccaatag atccgccggg atgtccgcgc gcgtcgcttc atcgacctcg     32400
     cgcgtgggaa tgaaccaccc atagggtgtc tcggccagcg gcagagggcg atcatcggat     32460
     ttttcggaac accattgatc gaggacatct gcggtgggca tcgagagatg cccgatgccg     32520
     agaacgcaat attggcctgt ctcgatcgga aatccggacg cagaaggcca tgccgcttcg     32580
     agctgcaccc ggtcagtatg aacatggtcc tcgggatgct tctcggaata gacgctcgcg     32640
     acctcctcgt caccgagcgt cgccggatcg cgattgtcgt tgatctggtc ccaccattcg     32700
     cggcagaatt cgccgatttt ctccatcagc tcggatcggg acgcgccaac atagccattg     32760
     acgccctcgc tatgctcgat cgtgccgaca tggatttcga tcggccatcg atcacccagg     32820
     gcgcccagat tctgagaggc ttcggtcaaa tcctggatga gcgccatccg tgcaggatcg     32880
     tggcccggta ggaattgaat ggccgcgcag gcgcgcgtca aaagtcgcgc gagatcgcgc     32940
     ggagaggttg tgctcatgct tgtctccgga aaaaatgctg gaaggggatt ccagtgcaga     33000
     tcctgcttat gtgggcgggc tgttcgccac ggatccgaga gggggattgg agccagctaa     33060
     ggcgctggtc gttcggttcc cgggccatcg cgagcgtcgg gcggttgcgt cgtcagccag     33120
     acgatcctgc gtttgcctgt gcgggatcgg ccattcgaga gcagtccttt gcgtccgcaa     33180
     ttgcggcaga agacgcgatt gaagttgagg gggatatcct ccagttcggg gatatgcttg     33240
     cggcagcggt tcatcggact cagccttccg ccgacaagcc agctgcgtga agcaactcat     33300
     cagcgtccca gccgaaatcg ctggcaaatc cctgggcgac acatctggca tggtcggcac     33360
     cacaattgat acgggactgg cgaaggtgct gcgcgaggcg gtcgaattcg agtggattgt     33420
     ccgcccgaga gggtttgcgg tgtcggcgta attcctcgcg acgggtttcg aaagcctgaa     33480
     acccatcctc aatggcgata ggccgaggca gagccagaac ctcaagaaat ccggtctcga     33540
     ccagttcggt tttgtccgtc ttttccctgc tggttctgtc gagcttcacg tagaagccgg     33600
     cgaaatgcgc ctttacgatg acgccctcgc gattgcggaa gcgatcgcct ccgacccggg     33660
     ggcgttcgag gatgcgaacc cgcgcactga ggcaaggctc cagcggggtt gggtcggctg     33720
     gcggaagcgg cacccatttg caaagatcgt cggactcggc cgaacattcg tcacagaagg     33780
     tgcaatcgta gaccccgctg atcgcccagt cctgagcgtc ggcatcccag cgggcgctgg     33840
     cgtcgcggac aagactatcg ctgccgcaat gtgagcagac cgggcggacg ggtcgctctg     33900
     ccgggatggc ttgggcgtcg acagccggtt cagcgagaca ggcaaggaag cggtcgccat     33960
     gggcaaatag gccccacgcg cggacaagcg ccgcatagcg ggtccgctcc cgttcattgc     34020
     ggaattcatg ctcggtcgcg gtagaaatgc tcagatactc gttggcgaca gtctccgccg     34080
     cggcatggat cagatgatcg atgcttgttg aatgctggat gcgcatggtc ttctcctcaa     34140
     ggcgcgcgat agtgtcggtc cctcaatccc gggctggatc gaggaggcag gtgggctttg     34200
     cgctgggcat gacgaaagtg gcggcgcctt gctggcaaac gcgcgtcgca aaggggctgc     34260
     tgagatcagt atggggtcgt gtaatgcagt tcggagcgga cccgagcggc caaaatgtcc     34320
     gggcggagga gttcgcagat cgaggctgcg ataaaggtcg agccggagcc atcgccggat     34380
     cgcgtgatcg ccagttcctc gccgatcata acctgatcca gtgtgaggct gaagacgaac     34440
     tcgccggcga acatatagag atcgccggat gtgctggctt cgccatattg ccacaggttt     34500
     gaacaggcac cggatgcgaa acccagcgcg gtggcaagcc gagccaaagc cgccatgccg     34560
     agatcgtgaa agagatgctg ggcatcatcg tccagcggac agagtgacca tgccagcagg     34620
     acaagattga cggcgtcgtt gatacacggt cgagcgctcc gggagatcgg gctgtcgact     34680
     ggactgattg gcatgaggca gccagggccc agaagctgag cggcgcgcag aatcttctgc     34740
     tcggcctcag ctgccggtgt cgcgatataa gcctctatga gatcgtggat ggccatgaac     34800
     gcctccctat ggattggtga cagattggcc gggtgcagat tgccggccgc gctgcatccg     34860
     gcaggccctg tctgagtgcg atgccgcggg cgtgatcaga ccgcgatcag aaatctgcgt     34920
     ggatcatagc ccattcggcc ggtgtggctc tggttcgtag cgatgcccgg atcctggcag     34980
     gatggcgccc aatatatgtc gtccagtcgc agaccgtttc gaggcgaatg gtggtgcctg     35040
     cgggggaatc gaagatgaag accggttttc cctgaccagt aagccggagg gcattgagcg     35100
     ctgaacccgg gctagcgccg tcccagatca tgaaacccag gtcggcggca tcagacatcg     35160
     cacggtcttt gacggcatgg aattcatagc cgtgggcgca aaacggggcg tggatgcggt     35220
     gtatggtcca tggaccatga tagttgcgag ggcgttcccc agagcagaag atggtgacat     35280
     cccgatagcc tgtttcggcg aggaagcgtt gcagggcgct gtcgatcccg tcggcgtctc     35340
     cgatcaggat ccgatatccg cccgccacga tccgcgacat ccggtcaatg atcgcggggt     35400
     gaaggcgggt gatgctgcgg gatccgccga ggaagatcgt gggctgtggg gacatgacgg     35460
     tttccttgca tatcagctgc tcatcgcccc cttccctcct tcactcttgc cgccccgatc     35520
     agcagtcgcg ctgcgcgctt gaatccgtcg tcaccctgct cctggataac cacaagatcc     35580
     ggcttggtgc gacggagatg aacggcaaaa gcgtctggat cccgaccctt cagaggtcgg     35640
     ctgaatattt gaccatcttc gatcgtgagg agatgtgttc tggccttgcg ccggagggct     35700
     gccacctgtt gatgctccgc aatcaggtcg gaaacctcga tctcgaggct gtgatccagt     35760
     tccacatcag cgatgaggat tttcggacgg ttggccttga gccaggcatc aacctcctgc     35820
     tcggagagtg ttccgacctg acggtaatga tccgcaccac catggccgtg gtttccggcg     35880
     agaaaggcgc gcacgccatc tatccagatt tccgcggagt agcagttggt ctcctccgag     35940
     agctgccggt tgagcttgag cttgcgaagt tcgatgttca tcgatcctgt cctagtggtg     36000
     ggatgtaatg cttcatctga tgcaggactt gcggccttta cagtccaatc tgcagccact     36060
     cgtagacgag gtgtctatcg ggttcgtatt cgctgccgat ggcaaaacgg acgcgctttc     36120
     catcacaagc aaagcaggat gcacggggaa agctgagata gattttgcct tcgaagatga     36180
     ggtcccccga tcgcacggcc tgtaccgtcc gcgtggcccc cagcgcggga tgacccgccg     36240
     aggcggaaac gagtttgagt tggtcgccgg gtttgagctg gcgtttgaag gcagtgagcg     36300
     ggatcagcga tgccaccgga ttggcgttgc cgcgccgcgc ggcaagcgca gcccaatagg     36360
     cggggccgat gcgcacgtcg gtagagaagg cgcaactgat atagtcctgg tagaaattcg     36420
     atcgggtgaa gctgaagcgt tcgatctggt cgcggaccct ggcggtgaac gcatcgcgtg     36480
     ccgccctgtc ctggagatcc tccgctgcat cgagaagttc ggcaatgatc gtccggctgc     36540
     ctgtggagga ttggcgtcga accgaaaact gagcgtcacc gaagatctgg ggcaagtgcc     36600
     gttcgatgcg cttgcagatc gatggcaagg gttcgcgctc acggtagaga tcgccttgat     36660
     agtgaaagtt gccccgatca tcatgttcgg tctggctgta caaacgtggc gaggggttcg     36720
     ctggcgctgc ctgcgtcatg tggattttcc ttttcggatt gtcaggccag gagtgctggg     36780
     tcgaatccgt cggtctcggc cgtgtcagtg ctccagagga tggagtcgat cagcatcggg     36840
     ccgcctgcaa tgacgtcggc ttccggcagg ataaccggtg aagctgcggg cgaccgctga     36900
     acgatacagt gaggaacgcc cgtgcttagg tgacgggcta tcgcgaggtg ttcgagccgg     36960
     cgaagatggt cgccagcctc gtttttgaaa gggaccgaca cgtcaggcca ccttggtgac     37020
     ggactccgct tcgccgacga tttcgatata ggcgttggga tatccgtggc gatcgcgcca     37080
     gctttcagcg gcagcgcggt ccgcggcaac atgaagcagt tcgggttcgt cgctccatcg     37140
     gtgcaagacc agggcagctc ccggggatgg aacatcaaca atctcgaaag cgcgctcgtc     37200
     ggcgactgaa aatatcctgt tcaccgacag gatgatgacg ccctcgctgc cataattgcc     37260
     ttcgtgcagg gtgaaggttg caggataagg tcggctgccc ctactccccg gagaccggcg     37320
     ggtaagacgt cccctgccgt tacgggcttc ccaggcgcgc aacttgcgtt tgaagcgatc     37380
     cggtggccgc ggtgtgccat ccgagtaaca aatggtcgcg cctaaaaccg cttcgtcata     37440
     gatggattgg gctgtcttgg tcattgatct tctcctgata tgaaaaagcc cggcgtgtgc     37500
     cgggcgggtt gagagttatc gagatgcggg aggggcacca cgcgcgccgt ggttggcgga     37560
     cgcaggcaaa ggcggcgcac agatcagttt ggcaaggagg gtataggttc gtccgcctga     37620
     gcgtcgtgag atgcgaccca gctccaatat ccgagcctgg tttcgccatt cacgacttca     37680
     tatttccagt cgtccactgg atagtcggga tgttcacccc aaggtccgca tattgacact     37740
     gcattttcca tgacttcact ccttctcctc tttgctacgg aggatagatt attggaaatg     37800
     gctcgtgcaa aatgccccga gtacacggag acagcagccc agtaactcgc catgggcgct     37860
     ttacgctggc gccagctctt ttccgccaaa gcgcgggcat cggcgcggag ttcgagcaat     37920
     attgtgcgga tgatctggcg gatcgcagga tcgagggcct gcaagttcgc aatggctggc     37980
     aggcggagta ccggattgcg gacctcggcg cggctggatc gctcggtcat tggacgagcc     38040
     tcatgatatc gcccattcca tcgagatcgg tcgccgcctg ccagctatcg acagctagtg     38100
     cgacgcggac cggggaaacc cagatcgtct tttcggagag cgtgaaggtt tcacccattt     38160
     cggcgagaag gatcgcctcg ccgatgacgc tgccgatctc ggccgcgctc tcgcttggga     38220
     ccgcgttgcc gatccactcg cgtttctcgg aatcgctttc actctcgagg tcaaagggca     38280
     tgcgggcatg ccagacaccg tcacgatcct gatagaaaat ggcttcggga tcgacgatcg     38340
     actgtagcgc agcgagatcc agcgtcgtga acggtcggtg ccaggttccg tcaagcgcaa     38400
     tgatgcgggc aacgagccga tcatccggcg ccggaagtga agggcttggc ccatcatcgc     38460
     acgagggatt cccttcctcg tggcggggat cggcgaccga ccaatggcct cggtcatatt     38520
     tggcgtaggc tggaaccgca tagctgcgat ctccccagcc gacgacgcca taatggcctt     38580
     gcgtcgcata tccgtcgcgt ccggggctgt tgaggccgag tggacgtggg tcggcgacgg     38640
     acagcgcgcc cgaacccacc cgatcgctgc cggtgaccgt gggagccggt gcctcggccg     38700
     agacgacgcg catcttgttt cggtgcgaat taggcccata gccggtacgc ggatcggcaa     38760
     cggcataggc tccgtctccg gtcgtgctgg cgccaatgac ggtccgagtc tggccggacc     38820
     aaggcgtgat cttatatttt gttgtcttgt agtccctggt ctccatcctc ggatcagcga     38880
     cggagggtgt ggcagcgttg aaggcgacga cccgatagat gttgttgaag cgcgggcttg     38940
     cgctgatgcg ggggtcggca accgagttgg ggccgccgcc agcgaccatg ctgcccgtga     39000
     cgacaccggc gggtttcgtc catgggcgaa cgcccatctg aacggatttg ggatgaccag     39060
     cgatgcgggg atcggcgacc gcgaaggatc ccgaactcgg cttggccgag ccgatgatgg     39120
     tatatgaggc gcgtgtccag ggattgacgc cgagcacatg gcggtgcgtg cttatcccat     39180
     aggccgggcg cggatcagcg acagagaagc tgccattggt cggatagctt tcgccctgaa     39240
     ccgtgccggc ggtttccgtc caggcgcgta caccgagcgt cgaggcacgg tctcgcgccg     39300
     cgtagcgggg atccgcgacc gaatgggcgc cgttggtggg accgcttcgg ccagggacgg     39360
     tacccgaagc gtcggaccag gtgcggacgc cgagcacgtc ggaattccag tccgccgagt     39420
     gggggcgcgg gtcggcgacg ctgtgccgtc cgtgaagggg ggagcgctga ttgccgatga     39480
     cgacgccggc cgtatcggcc caatccatca cgccgagcgc attctcgcgg agcggccggt     39540
     ccgggacgat cccgtagtcg cgcaatacgc catcgacgac ggcaagttcg ttgagcgccc     39600
     gccaatcgcg gcccgcgggg acaagcgcca gcctgagcca tgttttccac tgcagcatcg     39660
     gaatgcgatg catggcgccg gccaccggat cgccgggaag cggcagcttg ccaatcacct     39720
     cgccgacgcc gcgcaggcgc tttttctcgg gctcgtaaat gaagttaggg atgatctcgc     39780
     gctggcgcgc gatgagcagg aagcgcttgc ggctctgcgc cagaccgccc aattcaccgc     39840
     aatcatgcac cgtctccgcg atgttgtagc gataggcccg caggatcgcg gagatatgat     39900
     caagaagagc gcgaccccgg gtttggattc gcggcacgtt ctcgaaaaga atgatgggaa     39960
     tgggcccatc cttgaacgcc tcgcagatga gccagacgcc gcgcagggtg agcgcgttca     40020
     aagcctggta gcgttccgtc agcgcctgtt tcgaactcag caggccggag aagcccttgc     40080
     atggcgcgga gaggaaaatg acatccggcc ggatgccgtc ggcgccgacg agcgcgcgcc     40140
     aaacgtcggc aggcgtcgcc tctcgccagc caggaggcgg ttcatgaccg tggaaggcgc     40200
     gatactgctc gcgcgagaac aggtccatga ccgtacctgg tgtaccggtc agccgctcga     40260
     aattgcggat ggccccggca tcgacgtcga tcccgccggt gcagaggaaa cgcgcgacga     40320
     cattgccgac ccgtgccttg gccatattga agccgcgggc accggcacca aggccgcaga     40380
     agacatgggc gtgacggatc acgcgcgtag agggcgctgc atggagcatt gggggacttt     40440
     ccgggctgga ggacgtttcg atccccttcc cccgctcccc tcttggccgg cccgatggcc     40500
     ggaagggtca tggcgtcacg atgctcggcc ggccggcgcc tcacgcatct ttggtatgca     40560
     gctttgctag tgcaggctgt cccgggacag cgtcaccaag gcactgaact gcgttcataa     40620
     tcttcgagaa ttacgtccag tgcgcgggct tcctcataat tgaggttgcg gtggtcatct     40680
     gcattggcgt cgctcgccat ctcgatgacg ggatggacgg atatgacctg tccgccgggc     40740
     aggcggacca gatttgcgga gccaggaaga aaggcggagc cctccggcac cgaaaagctg     40800
     ccctggatgc tgtagtcaat gcgcatgaca tacctcctgt gaatgcagtc aagggcgttc     40860
     agcccggtgt ttgtggaaat ccggaaatct cgcgggtcag ggattttgcg cgtcgtcgcc     40920
     ctcttcagcc gtatagatgt cggccgccca ttcctggatc catccggccg taatttcatt     40980
     atgatcgagg tcgcccatct cgattttagc gcggatttcc tgatatgctt gggcgatggc     41040
     gcgctgccag cggtcagccg ggcggggttc cggggccccc agaccaagtt cgccctgtcg     41100
     aggccgggct ggctctgagc ggcgctgcaa ttggcgcgcc gtccatcgtt ccatatggtc     41160
     ggcaaccagc ctgtcggttt ttgcgacacc gcgctgattg gcatcgactc tggcaagggt     41220
     accatatgcc tggctatcga ccgcgatcac gcgatgctcg agccccttca gataaggcaa     41280
     gcaatctccc tttactccga atccatggca aaaaacgccc tttgggagga tgcggtcgag     41340
     atgctcgaag acggcgataa gaccttcagg cccgaaaatt tgtcttctgc aaacgctgcc     41400
     aattccgatg atggtgcccg gcttcatgga ttgccagagt gcatcgacgc agcgttcata     41460
     gtcagtgggc agacggcctt ggatgactgg cataaggcgg tcgaggatac cgagatcggc     41520
     ggcgcgcatc ctgcagtcgc ggttcgcgcg gattgtgcgc gatattcggt caagcacttc     41580
     ctcgcgatcc cgtgcaacgg cttcctcgca acaatagtcg aggctcgcga agcggcgaaa     41640
     cggatagctg gcggcgagcg ccatatattc atccacgctc cacggtattc cgttgtaccg     41700
     gaccattgct gaaaatccgc cgcaatcgag gtcaaggcta cggaggcctg cggcattggc     41760
     cagggttccg agcctccatc ccgcccattc ccgccaccca tcacggcgct tccatcgtga     41820
     cagacaattg gctgaaataa gggccgggac acccatcgca cgggcgcgct gaaggatcgg     41880
     gccttccgac agatggggaa ggccgacaac gatctcgatg ggcatggcgt gctcgcaagc     41940
     gtcagttatg actatgggcg aggaggtcga tgaaccagaa tttgtcgacc ttgcggatat     42000
     cgacgacggc ggcattgtcg atgatgaagc cgcgcacgtc gcgcagatgg atccagtgct     42060
     ggtcgccgcc ctgcgccgcg gtgcgctcgg tgccgcgtcg gcgggccttg aggaggccgc     42120
     gcgcgatcca gcctgaaacg gtcttcgcat cgacgcccat tagcgttgca aggccatggg     42180
     cggtaacgtg gtgggggtcc tcacgggtgg cccccatgcg tttgcccata accgtgatcg     42240
     cggtttcggt gcggacaaag cctaagcgtt tgagcatgcg ctgaatggtt ttcgcggacc     42300
     gatggaaatt atcatgcacg acgtcgcgtt ccgcatcggt ccatgcaggc tctttgaagc     42360
     ggggcgtgac aagcccgagc ttgctggcgc gcttggtcac ccaccagcga gggcggccga     42420
     ccgcaacggc gagagcgtcg atgtccccct ttgccggggt tcgctggtag gcgcggcgga     42480
     tcacggcatc gatatgatcg gagctggtcc agcgctggcg gcggaaatca tgcttctgtg     42540
     tgctcggagc ctgcagcccg agtgttgcgg catggttgta gatggcagta gccgtgcgtc     42600
     caggcaggtg gagcaggcag gcttcgacac cgcccgcggg gtaatgctcg ccgagaagtt     42660
     tctcctcgcg ggttgtccag aagcggcgag gcccgcgcct cggctcgcct atgactgggt     42720
     tgcggtcaag aagtgcgcgg aggtccgcgg ccggttggac ttggagctgc atcgggtgtc     42780
     tcctgcaaga tcacccatcg cttcccctct ctcctctcag ccgcggtcag cttcgagggc     42840
     aatgccgcat agcggagctt gaccctgcgg ccagcctcgc tgatcgcatc ggggttcgct     42900
     gcttcagaaa tagacggcgg aggctatgcg cggtcgctct cccgcccgca gtagctatcc     42960
     agctcctccc gcaggacagg atcgtcgagt atgtcgcggg catcttcata gccatcggct     43020
     atcaagtgca acgcaacggt ttcccagctc ctgtaggcgc cggatttcgc aagctcgcgg     43080
     gcacgctcaa tgatttgagc gcgacgcagc gcccagggcg ttaaccgagt gtcattgttg     43140
     gcgcttttac tcatgaaact gctccagcaa gaagctgcgc gctgtggagc acccatagcc     43200
     cttcaccgga ttccaaatcg agggaggcta taaagtgtgc gaggggtcgc gtcagttgtg     43260
     ggtttggcgc catggtcgag ccgatagctg gttggtccgt ggtcattcga cgtgtttgct     43320
     atcaatgttc agacaatagc ggcagcgccg tcgcgatggg tagatacaat gtcagaggtc     43380
     gcttggtcag cggcgtgaag ccgtaagcgg tataaaaaat ggcagcctgc tcgtcgatcg     43440
     cgtcggcaaa aatcgcatgg gccccgatgg gggccgtcgc gacagtctcg atcgcatcga     43500
     aaagcagcgc ttcaccgaga ccaagccccc gatagtcaat gtgccggcca agccatccaa     43560
     tcatcacggc cgggacggtc gggtagcggg gcagcctcgc ggcgagcgcc tctggaacct     43620
     cggtgagcgg cacattgctc gacgataacg tatagaagcc ggcaactttg cttgtgtcca     43680
     ccgcgcgcgc gacgaaacat ttcgcatagt tccgcctcac atcctgggtc acggtttccc     43740
     ggaaatagcg gtctatgcgt tcgttcccac aagtgaagtc cgaccgccgg tgagatttta     43800
     ccagcggctc gatcgcgaaa cggtcgctca ctgtggttcg atcagctcgc gatgacgact     43860
     tgcggcacgc ttcagccggt cattcggcgt aggcgggtcg atcaatgctt gcgcgaagcg     43920
     gatctggtcc tcacgcgcca ggcggaggat atcggcatct tccaccgcgc gccgcgcatc     43980
     ctcgccggcg gtcgcgagaa gatagccggt cagtgtcatg ccgcgcaggc gtgcggcgcg     44040
     ctgcatctga tcgtagactt gcaccggaat gcgggcttcc aatcgggcgg tttccgtctc     44100
     tgcattttgc cttggcatga tcgcaacctt tcgaccttta tatacggcaa tatgccgtat     44160
     ttttcaagat cagaaagtgg ctatgtgagc gtggcggatc ccctgtcgat gtgctgtctt     44220
     tcgtgaatcg gcgatttgcg aatgctgaat ccgcacacgg gtttgactcc attggcgacg     44280
     tcgcatgtct gtgaaatgat ccgggagtgt ctcaaacgtg ggggccatca ggttgcgcgt     44340
     ccgatatccg ttttagcgaa atcatcacca acgaagagca gtgggcaagc gtgttctttg     44400
     gccacctcgt aggcaaaaca gtcgccgaaa ttcagcgacg cgggatgaat acctttgccc     44460
     caacgcgcgt aggctagggc aacgcgtcgt gcggcggcgg gcgtcacgtc cacgatgtca     44520
     aacccgaggc catcgatgag ggtcccgacc tcctccccga cattgcgccg ctccgataca     44580
     atcagggctt cggcaactgt cccggccgag atcagaatct cgtcctcggc ttcaagtaca     44640
     gcgatgcagg cggtggcttg gggctcatca aggacaatag ccatcagcgc agacgtatcg     44700
     atggcgatca tgcaggcaag ccatcgtcac cataaaggaa atcctggcta tgagccgcat     44760
     caggtccggc caccgccttg gtggcgccag cacgtcgagc ggcttcaagc agctggcggc     44820
     gctttttccc gtcaggagca cgcttgatcg gcactagccg caccgctgcg tgcccatgac     44880
     gcgtgagaat tacctcatcg ccagcttctg cacggcggac cagttcggtc aactgccctt     44940
     tggcatcgct aacggaaact tgcatgcacc cgtcctttcg catctaaagc gccggtcgat     45000
     atttggacca ttagatagtc caggtcaaca tgccgtgcat catcaacagg cgaagctgtc     45060
     gttgcgaggt tttgcgaacc ggggcaggtg tgtttcagac ttggtgttgc gaccctagac     45120
     aacgatatgg cggacggcca ggcttgggga tcgctattga agccgatggt aaatggggtg     45180
     acgtggtgta tccgcgccaa gggctagaat tggcttgccg ctctcaactc gcgttccagc     45240
     gttgcaaagg gcaatataag cgtaagcggt ttgtcgtgca gcggaacggc gccatagctg     45300
     gcataccaag cggcagcgcg ctcgtttttt gcatcgacga taagcatgac cccgccaacc     45360
     tccgcggcaa cccgaatgca tctgcgcgcg atcgcaccca agagctgacc gccgaggcct     45420
     ttcccctgca cccgaatatc cgtcgcaagc cgggcgagcc ggaaaccggg cacctcatgc     45480
     cgggcgagtc ctcgtctcac cagttcgggt gtatcggcat agtccatgct gccgggcgcg     45540
     atactgtaga aaccgagaac cgtcttgctg tcggcgtcgt cgatcgcgag gaaggtcttg     45600
     gccccgccta gttcgtggct ctgccgcgcg tagcgttgca aaaaaatatt gaggtcgtcg     45660
     tcgccacaat cgaaagagac ccggtcgtgc gctttcgaga tggcttcctc ataccatgac     45720
     ggaagcgtca tgcctgcttt ggcatcgcgg cgatggcggc acgtaatttc gcattcgccg     45780
     gcggcgggtt ttcgagcaga tcgagaacga gcaggctgtc tctctcgctc agcttcgtcc     45840
     gctccgcctc ctcgatcacg ctctcggcct cacggagggc cgaccgtgtg acaaaggtgg     45900
     ttaggtcggt atgcttgagc gcagccgccc gggcgagcaa agccttttgc tccggtcgaa     45960
     tccgcagact catgcgcctg ttatcttcca ccacagctcg cggcatcgcg cacctccatt     46020
     cgtgcaactt caattagtac gctattcctc agcgcttcgt caagcatgtg cgccttgaaa     46080
     gcgcacaccg gaaatcggtc gcttttcgag tagcatccga gggggaccat ggaattgcgc     46140
     ctggcggtgg cctcgaagag aggcctaacc cccacgcttg agacacatcc gaggtcgctt     46200
     cacaaacatg ggacattact tatgccgcca agccgttgtt cggattcaat tttcagaatc     46260
     cgccgattca cgaaactgtt cgcgccgaca gaagcgctct caagggaacg aatggctcca     46320
     ctaggcttga ggcactctga atcgagtcta cgatcgatgg agccggttca cgaaaaaacc     46380
     ggcatccgct gcaaaacaca tgcgaggggc gccagcaaga ctattttacg cgatctcact     46440
     tgtgggatcg tgttggcgcg gcgcgggcag gaggcgtagc ggcacccagt cgtcgaagat     46500
     cgtcccacct cgccactggg tgagccggat agttaacggt tcggcgtagt caccgcgcgt     46560
     cgtccagtag ccggcagcta gaatatcgag atcgccgcgc catcgcgcaa tcggggtggg     46620
     atcgaaaaag gggatgtcgg catattcgtc accctcgagt ttgcgttcga cgatatggcc     46680
     ggtcgcgaca tgaacggtca ggcttccatg tgagccgtgg atcgtggcgg tggtcatggc     46740
     acgtctcgct attatatgac gtagcgggcc atgtgctccc agcagagcga cagggcctca     46800
     tcgattgttg tgacagtgac gatgtcacac tggatgtagc gatggcggcc ggtacggagt     46860
     tcataggcgg taacgtcgat cgcatcgcct tccggatagc catggccacg tgcttcgttg     46920
     aacagcgcgg ggaagaaggt cagccggtag gatgcataaa ggccgacctg ccgcgccgaa     46980
     ggcgaacgga tctgtcgctc cgtcgcgatc tgccggagca gttggtcggc ttcctcggat     47040
     tgtcggggat actcggcgcg caaatgcgcg atcgcggcgg cttcggccgc cgttccgaag     47100
     ccatcgattc gctggcgttc caaagtgagc atgacccggc gcgccgcctc gaagtgatcc     47160
     tgatagatat attcctctat ctgggagtcg tcgcgatagc gcactggcgc gaggaagccg     47220
     gcatccagcc agcgcgcgag gccattctcg atctgctcgg cataggtgca ggccgtagga     47280
     tcggcgggat catagtgcgc ctggatctcg acataggacc cgaagtcgtg ggcgcagcgc     47340
     gcgggacgga gggaaacgcc gtcgggaggg cgtccgtgcg tggcgatgat cgcggcgcga     47400
     tagcaacagg cttcgaggaa agcagcgcga tcataattcc gggtcacgcc cagttgtgcg     47460
     caggcttctt cagccggtgc actgccgatg gaaaggatat gaggtcggga catggggaag     47520
     ctccgtaatg ggcaacattc ccctgccctt tccctctttc ctcccgacga agggaaccaa     47580
     gacgatgtgc agtttctcag ctcactcttg ggccgaaccg ggctattggc gggccttcag     47640
     gcggccttgc tcatctcagc gggaacatcg tcgtcgttat cggcctcatc cccgacaatg     47700
     tcgcccgccg gatcgtcgtg tcgtccggcg aggccgagta gatagcttgc ggcctcttcg     47760
     gccttcgagg cgaccgtcag cagggctttg ctgtcggccc tcagtacatc aatccagctc     47820
     tgaatatagc ttgcatgatt gtcgagcaac atgacaggga gattcagttc cgatccaagg     47880
     atcgccgaag tcaattcggc acacaattcc tccacagcat agtcttcatc accaaatctg     47940
     tgaccgaatt ttcggtccaa tctgctttct gcaccagacc aatgcgccaa ttcgtggcat     48000
     cttatcgcag aatagcagtg gaagtctgca aatgattcga ccggaggcag ttgaacatag     48060
     tcttcctgaa tatgaaaata ggcgcgatcg ccgccatggc gcacctcggc cggtatggca     48120
     tcgaagaacg ccatgagatc cgcgacgcgc gcgggatcgg gctcgttgcg cgcgacggcg     48180
     agttcgggct gcgcataata gcgatcaggg aggtcatcga tttgatcgca gttgaaaacc     48240
     ggataggagc gcagcacgcg ccgggtctga cgatcctctt cgccagtgat gggatcggcc     48300
     actgacttcg catagctttt atagaagatc gcaatggttg ctttttcgcc cttgcggact     48360
     tgcccgccca gcgcggcgga ttggcgatag gtcatccagg tcggggagcg gtagcccatg     48420
     agatcggcta ccagccacag ccagaatatg ttcgcgccgc gatagggtgt tccgcaaacg     48480
     cgcaaaggac gttggggcgc actgcctgtc cagggcttga cccacggctt ggtgccggtt     48540
     tcaaggcgtg cgatgatagc gtcggtgatg gtctgcgcgg gcgaaggagc atcgctgcgc     48600
     ggcgcaaagc gtcgaggcat aaggaatctc cgggaggttc ggtctccaca ccatgcggag     48660
     agccgatcct cccttccccc cttccctcct ccgctcagtc ggcgatcagc cgggcgatca     48720
     cctcgtccgc ctggtcgacc gggatgaaga gcctcgtccg atactgcacg acctccgtga     48780
     aggcgccgcg cgacttgtaa agcggaagcc tggcggcatc gaactccttg agttcgtagc     48840
     gttgctggcc attgacccgg cttcggatca acctcgcctt gccgagcgcc gggatgacga     48900
     tcccgtccgg tcgccgggcg gccgccagga tttcctgaac ggacagcgta acggctattt     48960
     cgataccaag ctggtccgcc atgcgtgcga cgtcggccgc ggccacgatg cgtcccagca     49020
     agccgttgcc ggccttgtcg gcgatccgcc agacctccat cgaccggtcc ggcagcttgt     49080
     gccagatcgg aagcaggagg ccggtcgcaa gatggatggt ttcgacgtcg atttttgact     49140
     gcgcttctgc aacctcctcg tgccagagcg tctcgaaagt ctcgctgtcg caaaactccc     49200
     aatggctctt tgcgaactcc gccccaccga tccgttccga tccagtcggc cgctgtagcc     49260
     gccatgccgt tctgaatttg ccgtcatcgt ccatgtccgg ccaggttggc acgcgcaatg     49320
     ctatgcgccc ggaacggctg tttcgcactg gtagcgcatc gggcacatcg ctccagtccc     49380
     gcatcagcgc cgcgtagctg agcgcatggc gccttcggtg cagttcgaga tgaacaaggc     49440
     gggtttccgc gccgctgtgg ggatcggttc gcagcacggt cgagtccagt tcgaccaggc     49500
     gttcggtcat gatcgtctcg acgcccacat cgagtgtacc agcctcgcgg gctgcctcga     49560
     cacgggcctc gatgagagcc agatattcgg tgaagatcgc gtcctggacc gaaatgcgca     49620
     gtgcaagaag gcggttcagc cagcgctgga tgggcggcag gttctcgaca agttcgccac     49680
     tgtccttgtc gacaagtttc agggcggtca tccggcaaaa gtcgccaaga ctgacgctct     49740
     ggagcttgcc ggcgtggagc atttgatacc attggcgcag cgcctccaga gcatattcgc     49800
     tctcgagatt gtcggcagga tcgaacatgt tctggccgcc agtctgccgc tgcccgcgcg     49860
     tgatcgcacc gaggctgtcg agcctgcgag cgatggtcga gatgaaccgc cgctcgccgc     49920
     ggcaatttgt tgtgcagggc cggaacacgg gcgcggaggc ctggttggtc cggttcgacc     49980
     gtccgaggcc ctggatcgct tcggccgctc gccagccagg ttccagcaag aagtggatgc     50040
     gccgatagcc cgcactgcgg ctgtcgcggt cggcgtgata gcttcgcccc gtgccgccgg     50100
     cgtcagaaaa gaccaaaatc cttttcgaac catcggtgaa ggccgccgtt tcgcctagat     50160
     tgctgcgcgc gctgcgtgtt tccaaccgct gccgaccatc gcggtcgcgg acaagtcgct     50220
     tcgagcggcc cgtcacctcg gcaacctggg ctgttccaaa atgcgcaatg atctcatcga     50280
     gcgcagaccc gatctccggc agcacgcaaa gctgctctat cagtgcgtcg cgtcggtcga     50340
     ttgcctcctt gctgtggacc ggattgccat cctcatcggt catcggttcc gagtacggat     50400
     tgccattctc gtcggtaaac acctgcatct gccgggtcgg gaaggcattc atgagataat     50460
     cgatcatggt ctgggtcgga gaaagctgga tatcgagctc cgcgcgctct tcgggcgaaa     50520
     ggtcggcaag gcgccgattg agcagtgcct cggatgtcgt caccaactgc acgacagcgc     50580
     tgtgcccggc atcaatctcc ttttcgattt cctggattac ggtaggaagt ttcatcgcca     50640
     ggagcgtgct tgcgaaaaac cgctgctttt ggctctcgaa gcgactgaga gcggagccct     50700
     ttgcatgcgc gttgagcgtc cgcccaccca tgcgatcgac gatgccggtg gcctcgagga     50760
     ccgcttccaa gccggcatga atcacggccc acgcatcggc ataagcatca taaacggcaa     50820
     tctggtcggc cgaaagctgg tgaaccagca tgtcatattc aacgcccgca aaggagagcg     50880
     cgcgggcagt atagaggccg agcgccttca ggtcgcgggc aacgagctcg agagcggcca     50940
     caccgccttc ggtcatctgg gacatgaaga catcgcggct accaaaggcg gtcccagggc     51000
     cccagaggcc caggcggctc gcgtagcaga gattggcgat gtcggtcgcc ccggtggcgg     51060
     agacgtagag gatccgcgcc ttgggaagga ggttctgcag gcgcaccccg gccaacccct     51120
     gttcggagcc tttctgggtg ccgaacttcg tctcggtccc ggcagcgttt gccatggcat     51180
     gggcttcgtc aaagacgatc acaccgtcat ggtcggatcc aagccacgcc aggatctgct     51240
     gtaggcgcga ctgttgatcg tgccgttggg atcgcaatgt ggcgtaggtt acaaaaagga     51300
     taccggtgtc catcgtgatc gatgtgccgg gagcgaaggc gtccagcggc tggatgtcga     51360
     gcggaaggcc gcccagcgcg caatggtccc ggcgggcatc ttcgatcagt gctgaagacc     51420
     ggctcaccca gacggccttg cgacgtccct ggctccactg gtcgagcatg atggccgcaa     51480
     cctgccgtcc cttgccggcg cccgtcccgt ccccgaggaa gaagccctgt cgatattcgg     51540
     ccccgtcatc ctgctctacg aggagtgtgc ctgcttcatt ggccttgaag cgccccggaa     51600
     gcatgcgctc gaacgcctgg ccggcatgga taaccgtctc gagctgcgca tccgacaggg     51660
     cgcggatggc actggacgga agcatcggac gataggtggg cgtgggcggc aggatagatg     51720
     ccattgccgc agattcgacc aggggtgtcg gatgaagccg cgcgccctct atgtcgattc     51780
     gtgcgacgcg atacgggaca tagacgccga cgggctcttc tgcaggaagt gggtgttcgc     51840
     gcacggcata gtcgagtggc cggggagcat tgtcggtggc ggcaactgct ttgggagcga     51900
     gggtgcgcgg tgccgagagc ttgccgagga ggctgcctgc ggccggacgg cgaagcagcg     51960
     gcgcgggttt gcgcatgatg ctggcagcgg tgggttcgcc tacgaggcga tcgcatttgg     52020
     tgacatgggc aagagcgtcg gcgaggccgt cgcaggcgac gcgctgcgtt tgcacatcgg     52080
     cgatcttgtc gaagaccagg atgcgcgtat cgatgctcgt gccatgtttg acgaaggcct     52140
     tgcccacgag caggtcaagc cgaggcggaa gcagcttctc gacaacagcg tatccgtctc     52200
     gaccgctcga atgcggggag aaccaggccg gcatgatcgc aacgcagcga ccgcccgggg     52260
     caagccgcag aagtgccgag cggaggtgac gggcgccggc atggggatca tcgccgcgcg     52320
     tcgtgctgcg gctgtaaggc ggattgatga gaatgacgga cgggcggacg accggcgaga     52380
     gaagatcgtc gatatattcg gcatcgtagc gcgtgacgat ctggccgagc acgccttcga     52440
     gcagtgcggc gcgctgggga tcgatttcat tgagatgcac agggatgtcg cggggaagcc     52500
     atgccgcgag catcccggtc ccagctgagg gttcgagaac cagatctgac ggaaggatat     52560
     gggcagcccg agcggcgacg aaggccaggg tgagcggcgt gctgaactgt tgcagttcga     52620
     tctggccttc cgagcggtag ctctgcgtgg acaagccgag catgcgatca tgaaggcgag     52680
     caaggatgtc ggcatcgccc gcctgattga gccagccctt gggattgcgc acgctgagaa     52740
     cctgtgcggc ctcgagcgca tcataggcat cgcgcatggc ccatcggccg gtggcgtcgg     52800
     tagagccaaa gtgcgccgtc gcgcggtcag ccagcgtctt tcggtcgatc gtcgtgccgc     52860
     ggagcaggtc cggtacgagg ctatgggcga tggcgagaag atgcggtgtc ctgtcgttcg     52920
     atagggcaac gtgcgtgaag aggtcagggg caatgctggc catgggaagt ctccgtctct     52980
     ggatgtcggc tccctccctt ccccctctct ccttctgtcc tgctgcccgg aatgacgggc     53040
     acgctcagcg cgcggtgatg cagcggatgt cgggaaggca gaaaggccgg cgtgcgatat     53100
     cgcgtcgcgc ccgaagggtg agtggtcgag gagcaaaaaa aggaccggac gcatgatgcg     53160
     tcgcggtccc attccgtgcg atcaggcagc gtcggcgaag gtgtcggggt tgtgcatcgc     53220
     tcccgtgtcg gaagcctcat cgccgagatg tgcaacctcg acggccgggt tcgaggcgtc     53280
     caggcgggcc gagaacgaca tttcggtagg cacccaggcc agggcccgtt ccttggcatc     53340
     agcctcgatc aggctgtcgc cgcggaacag cttctcggcg gttgtcgcaa gatcgccctt     53400
     cttggccaga gcgtagcgat gcctgagctc gggaccgcct acccggtcga tggcgtcgag     53460
     cgtcacgtgt ttcggcgcgc ggtcgaaata gttgagcgct gtgggcctcc accaggccgc     53520
     gacgtcgatc tcgagctgct ctccgacgtg gctgatgaag atgtcgcccg tttcgccata     53580
     ggcggtcggg atgagagtgc gggcgacagc ccatccgaac catgcggcgc gcatgtcatc     53640
     atcgagagcg cggaacgctt cgaagcgttc gatcggcgtc accaattcgg cccagctacg     53700
     gtccagcgta gattcaagct cggtccagcg ctcggcggcc tgtgtaccgc tcttgaagtc     53760
     gctgagggcg ctttcgggag tgcggcacgc caacgtgctc ggcagcaggc tgccgtcctg     53820
     atcggcatat cggcagacca ccttgtccac catcacgaac gtgccgagca tgagcgcgaa     53880
     gtgggggtcg ctggcgacat ggagggcgac cagttcggtc ttctggtgcg caagttcgtc     53940
     ggtgagccgt ttggacaatc ccttggcctt cggctcctca gccactccgg ccaaaccttc     54000
     ggaagatggg ctgcgttcat cggcgacagc atcttgcgct ggggcgcccg gcgccggcgc     54060
     ctccaccagc ttgccataga agtcctggtg gagttgaagc gagccgtcgc gggacagata     54120
     gacgaaaccg attgccgacg atttctgttc gtcactgatg gtcggcatcg gcgcgagcaa     54180
     gcgctcacgc tccacgccga ggccatcgta gcgcgcttgc tgttcgtccg agaggccgcc     54240
     ctcgccggca gtcgtctgaa gctcctcgat ctcctgctcg atcacggcca cgcgggcctg     54300
     agcttcatcg tcgagtgcgg gtgaatcgag cttgatcgtc tggagagcgc gcgcctcgga     54360
     ccagatgtcg gccgaatccc cgaccacgcg aacctccgcg agacccatgg catcgcgcgt     54420
     gtcgctggcg aagcaggcaa gcttttcggt aacgaggcga tcgagcagtt cggtgtccaa     54480
     ccatgtctcg ccgccagcgt cgtcgtagag atcggcatcg atccggcctc ccgctgcttc     54540
     atagacctcg cgtccgacca ggcgggcgcg cggatcggtg ccgcggcaac cgccttcctg     54600
     gaccatgcgc cgcacggtgt aggcgttgat gccatagccg ccgcgcgaga gctgctcgta     54660
     cacggcctgc tggcgcgctg tgtcgctggt ggtcgcatag gccatggcga tatcgaggct     54720
     gatcttgccg tcgcgaaggg catcgaagac gacgtcggcc agcttggcaa gccgcatgcg     54780
     gccgagcacg aaccgttcgg tcagcccgaa gcggcgtgcc acctcggcgg gggtctgtcc     54840
     gtcgcgctgg gtggcgtgaa ggaaagcgat gcattcgtcc gttggcgaca tcttgaggcg     54900
     ctggaaattc tcggcgaggc tagcttcctg tgcatcgcct acatccgcca tcggcttgac     54960
     cggaatgaca tagtcggccg gcagttcacc ggcggcgatt gcagcctgtg cctgtgtcag     55020
     acggcggcca cccgcggtga tttcataatg gcccttcctg cgcgccttgg gcacgccgat     55080
     caggttttgc agcacgcctc gggcgatgat gtcggcgcgc agctgtgcgt cggccactgg     55140
     atcttgtgat tttcgtacgt tcagcggaga tacgctgagc ttcgatgcag ggatgtagag     55200
     gatctcggtc atgtcggttc tccgtcatgc ccgacgtcac catgacgttg cgggcgcgga     55260
     gcgccggcat cgaagatgcg atggcggaca ctccgcccgc tttactccct ctctccctcc     55320
     tggcaccgcc cgatagggcg gcattcaaaa gccctgcttc aggcgacgca gccagacatc     55380
     gttccagtcg ccccacccgc gaggaggcca aatcgtttcg atggtgcggc ccggccgggc     55440
     atgggcctca agcgcgagcg cctcggcgcg ccgtcctgcc tttcccgggt cgggaagcag     55500
     gatgagccga gtgacatgat cggggatagc aatctgccca aagcgctcgc tgccaagggc     55560
     agcccagaca ggaatctcat gaagaaggga ggccgaccaa ctcgtctcaa tcccttcggc     55620
     aatgccgagg atgtcctgcg cgggcattag ccggacagcg cctgcgtccg gcgctccgag     55680
     cgccatcttg gggttttcga gatcgagcgc cttggccggg atcgtgatgt cgaggaagtt     55740
     gcgctggatg gcgacgaggc tgcgcgtgtc gcggatggct gcgatcagtg ctggtctgta     55800
     gcccagccct cggtcggtgc cgatcggcgt gcgggccaag tagcgaagct cggaattgta     55860
     ccccggcagg ccccgctcct gcagatagtg ctgcgctggc gtgcccgcga gcggccgcgc     55920
     ccgatcccaa atctcttgcg cacgctgacg tcgccagagc gcagagctat caggcgcata     55980
     atcgtcggcc ccgcttgctt cgacagtcgg cacatagtcg gtatcgagga tacgcgcgtt     56040
     gcggatcgct ctgagaatgt cgacgcggtc acaaccggca aagcaggtga agagcaggct     56100
     cgtccgcccg acgcggaccg aaaggctggg atcacgatcg gcatgcgcgg ggcagcgaca     56160
     catgccgctg ctttttcgcc aatgtccctt cagggcttcg acgatacggc ggcctgcagt     56220
     ctcgagttcg atggtggcag tcatgagggt agatccggtc tgatgatacg atcgacccct     56280
     tcccccctct cctgattttt ggttgtcgaa gactggcccg tgtcggccag atcgaaccgg     56340
     ttgaccaaat acactgccgg cggcgcatga cagcgatgat gtaccctggc caagttgcgc     56400
     gccgaacgct ggatcgtacc tctcaaaacg agccaggcag accgcgatga gtgagatcgc     56460
     gcctgcaatg tttaggtgct aacggcgtca tcatgagccc atgcgggtta atcatggttg     56520
     aatagcgaga atttggatcc gacactttga ggttcagcag agaggcggcc cgcctttgcg     56580
     gctgctacat cgcgatcagg tcgacatcct gtgtacggaa gcttgcgacc aaggccattg     56640
     ccttggccgg ggctttgaca tctgtttggt aacacggcag gaagtttacc tgttcgaaaa     56700
     cagggccgcg tatcggtttg agcccgcgca ctcgtcgcac aatccaggag attctacatg     56760
     tccgaggcag aaaagcccga tctcacctcc ctgacggttc aattgttgag cgcctatgtt     56820
     tcaaacaaca cggttgaaag cagtgagttg gccgggctga tccaatcgac acgcgccgcg     56880
     ctgtccgagg acaaggcgcc tgacgctccc gcggcgcccg aatttgtccc ggcgacgacg     56940
     gcgcgcaaaa gcctggcctc gcgcgatcac atcatcagca tgattgatgg aaagccgtac     57000
     aagacgctca agcggcacct cgcgacaaat ggcctgacac cgtcggaata tcgcgagcgc     57060
     tatggtctgc cacgcgatta tccaatggtc gcgcccggct attccgaaca acgccgtgaa     57120
     gttgcgcagc gacttgggct cgggcggaag cccgctgttg caaagcagga tgaggaaaac     57180
     aagattgtgg atgccgctcc cgcggcttct gcggaggcac gcgcgctcga caatgccgct     57240
     gccccggttg cggcgcctgt cccgagcgaa gcgcctgcca aaccggcgcg tacgccgaga     57300
     aaggctgcga aggctcccgc aacgaaggcg cgttcggtga aaacggcagc ggcagctgag     57360
     cccgaagtcg cgccacagga agcgcccgca acggatgatg tcgccgtgtc ggaggccgca     57420
     cctgtcgtca gcgaagcccc tgcgaaaccg gcgcggaagc caaggaagag cgcaagcgct     57480
     gtcgcaaagg aggccagcgt tgctgagaag ccggcaaatg gggatgcagc aaaacccacg     57540
     cgcggacgtc gaagcaaagg gaacgaagtg acatccgtag tcgaagccaa ggctccccgg     57600
     cgccggaagg cgcccgcaca gcctgccgtt gaggcgggtt gagagagact atagggggcg     57660
     cccgtaggcg cccccttttg tgatcccgaa tgaggaggca cctctgggat agtcgggcag     57720
     acgacccgat tgttcttcgg cctcgagctt tctaaagctg gctcatgagc agctcgagac     57780
     caacattgcg cctgaagctt ccggacgaga cggaagatcc accggtagtg gatttgctta     57840
     cgcaagcgat ccgcgagcag ctgtgtatca gggcaacgta caaccggggg ctcgttcgca     57900
     tggcaccgca cattctctat acgcgccatg atgctctttt cgttgatgcg gtcgtgacgg     57960
     aacgtaacgg tgccgcgcct gcggaagcca agctggggtc gttccggctg actggcctga     58020
     gcggcgtcgc aatgaccatg gagcccttcc ggcggtttgt ttcgttcgat ccgactgacg     58080
     aacgatacgt cggcaggacg atcgctaccg tcgaacaaga ctgaacgcag gtagccgtag     58140
     atcaggatgc atcggcgtcc aacttcaacc gaagattgcg ttcatggcgg catagagcat     58200
     gtcgcggcta tgattcattc cagcgcatca tcggcggctc tgctcggaga tcgcgtgaag     58260
     agttctcgaa aaagccgctc accttcggcc agtccttcgt gagtgagaag aacggacttg     58320
     gactttcgga ctggatccgt gatcaaattt cgatcatgta gccgttccat ggcggaccag     58380
     tcgaagccct tccatgctgt gcctgtcgta tcgagattga gccagagcaa cgcaagcact     58440
     agctcatcga ggcgttcggt gtcgtaattc actcgccgat cctccacaat gtctttgttg     58500
     aaaatgggca tcgcgacact ctacctcgac ccttgggtac gggccgccgc gtgtctatgc     58560
     tcagaaatag atgaatcgac cgtgcggcgc gagctgttgg atcaagtcga actcgtcccg     58620
     gtttgcggtc agcaccggca ggcccgcctt ggcggccgtc aggaaaatga gcgcgtcgtt     58680
     gagcgcttcc ttgcgctgat gccgctggta ggtctgggtt cgggcgagcg tgccggcgat     58740
     aaggcccgct tcgctccaaa cctccgggtc cggagtcaac agccgcgtag gttggatgct     58800
     gacgatgagg cccgcataat ggtcgcgcag ttccttccag ccagcgctcg acgggtcggc     58860
     attggcgacg ccggtggtca gttcgccgat gcatatcgcg caatgaaata gcagcccgcg     58920
     atcgaccagc gacaccgcag cggctggcag cgtgccggcg gcatcgtgaa tatagacggt     58980
     ggtatcgacg aggatcgctg ctcgtccttg gccggcgatg tcagcggctg cgaccagcgc     59040
     ttcagatccg cgcggtgcaa gctgactgag atgtttgtcc ggtttaacgc atctgagatt     59100
     ctgacacagg tcaatagtca agctcatggt ccgcacccag cttgccgcgc gttctctgca     59160
     tatagctcgc cgctggatcg ggctgggcca gcatcgccag cgccagcaga ccgagctcgg     59220
     tcggcttggt cgcgccgctc tcgtgcttcg ctgcgtcgat cagcgccttt ggagcgcgaa     59280
     agctgacatg ctcggtcgaa tcgccgtcca gtaggcccgt gcgacgggct tcttccatca     59340
     ccacggacgc tactgtgata cgcttgggtg tggccgaacg cgctcgcccg gcagccccgg     59400
     ccttccccgg acgctttccg cctttcgacg atgctgtgca ggtgaccatg gcggactcct     59460
     tatgtgtgca cgataatcgc ttttgtcaca caaaacaagg tggtcgccca agcccgtcgc     59520
     cgcactggga gcggggaaac gccgcgatgg taatgatggg atcgataatt aaggtcgctt     59580
     cggcctctgc ggatagcgct gctacgcgtg ttattcctga ggcaaggccg tactattccg     59640
     gacataccct gcggcgtgat tgatatgatc ggcgacgacg gctggccttt cacgaagatt     59700
     aggaagcccg agccggttcc gcaacggccc cgggccgata agtggcgcgc tgtcgttccc     59760
     ggcctgtcgc ctcccaaaac ggaaaagaat ttcctccgaa atggatgttc cggagtcgaa     59820
     agcatcctta tgacggtatc gggattcgtg agcacgtgag ttaagcgagc gtgctttcgc     59880
     gccaacagaa tccgcgaatg agaatggaag gtgtcgataa tgcctcatct ggcctggtcg     59940
     agagcgcgcc atcgcatgca agcggatgat ccaatggtcg ccgaagccat ccgtcttatg     60000
     gagaaggcgc tcaatctgtt cgacaatgca ggcataggaa cagccgcctt tgcctgccac     60060
     ctgtcgatgg ccattgattg cgctcaagca gcgttcgacg cggatggggt gagcatgctt     60120
     cggcaatttg gcgacaatga agccctacca gagggtggga gcctccatta ggcagcggac     60180
     gggcatcgtc tcagagcgat cgactatcca gacaggcgat tgcctggagc aagtagcgac     60240
     gcgtctttcg tcggctcatt ccaagcaagc gggccacctc cgcgacggtc aggccatagg     60300
     atgctgtgag gtaaaagatc tgccgggctg gaggtggaag catgtcgagc ttttgtgctg     60360
     ctcgcattgc ggtgctcaga aggtcggctg gcatgtcgtc acggccgaca atgagccagg     60420
     cccggatcgc tatacccgat gcgcgaacat ggaattcagt ttcgagggca tcgatttcga     60480
     tatcccggcg ctcgctgcag tgggcgcgcg cgaaggcgat caccggcggg ccagagcgac     60540
     ggccggaacc gagtgattgt cgagatggac tattttgagc cgagcgacga agacggtggg     60600
     caatggcgcg aatcaagcgc gcgagcgtga gccatgacat aagctgttcc taggcggggc     60660
     cgagcttcca acgaccagcg caggaagatc gaacggggga gactgcccct ctcccaccct     60720
     cttccctcct caggcttccc tcctcaggcc attatgcgcc tcaatcatgc ccggtggcat     60780
     ttgcttgcgg gaaaatctcg attcgactcg gcgaaatgcc ggcgaaaccc tctttgtagc     60840
     gggatgaacg gcgacgattt cccggtgacg atccctgtct tctgaacagg gagtgccgaa     60900
     gcatgatcca gattttccaa ggttcgctcg cgctgggaac caacgcgctg tttgatgcga     60960
     tgcatcgcga tcgcaaacgg atcttcgttg atttgctaaa gtgggatgta cccgttgtcg     61020
     agggtagata cgaggtcgat caattcgatg acgagcgcgc ggtctatctg gtggcgcccg     61080
     actccgatgg cggccatcgt gggtcgatca ggctgctggc cagcgacggg ccgcacattc     61140
     tcggctcggt ttttccctgg ctttgcgagg atgacgttcc ccgctcacga cacgtgttcg     61200
     agatcagccg gggatgcctt tccccccgat tgcgggctgc ggagcgactg caggtccgaa     61260
     atgccctgac taccgctgcc gtggaatatg cgctgctcca tgacatcgag agcttcacct     61320
     gcatcgctga ctctggctgg ctgagccaga ttctctcact cggatgggac tgctggccgc     61380
     tgggtcttcc tgtgaagatc ggccgcgttc tgaccggcgc tctcaagatc gacatcggct     61440
     cggacacgct gcgaaagttg cgcgaggcgg ggacctacgc accggcacag ctcatctttg     61500
     cggtacaggc cgaaggagtc gcggcatgaa aatcatgtct ttcgccgcgg cgcggccccg     61560
     ctatgacggt cacacagata tcgtcacccg cttgttttct cagggatatt gcgtcgtcga     61620
     ggacgcggtt ggacaaggcg atttagcggc ccttcggcgt gaccttgaac cgctgttcga     61680
     gcagacacag cgttcggtcg gaccattcta cggtgatgcc acgaagcggt ttcatggttt     61740
     gcttcgccgc agccgccaca tggagacgtt cgtgcttcag cacgatattc tccgcgcggt     61800
     cgaaacggtc ctcggaaacc actgcgactc gattcagctc aatcttaccc aggcaatcga     61860
     gatactcccg ggaggcgaga tgcagccgcc ccaccgggat caggacatgt ggccgcttcg     61920
     cacgccgggc gtcgaatatc tcgtcaatgt catgtggccg ttcacgcctt attcggctga     61980
     caatggtgcg acggtcatat ggccgggaag ccaccgccga caggacgaga tcgtcatcga     62040
     cgagagcgag gcgatcccga tcgagatggc gccggggtca gcgctgctgt ttcttggatc     62100
     aacacttcac gccggcgggg caaacaggac tcgcgctccg cggcgcggta tgatcgtgag     62160
     ttacagcctg ggctggctga aaccttatga actgccgtgg ctggcctacc ctcccgaggt     62220
     agtcagcgcc ttgccccggg agttggccga attggccggc tatcgggcac acaggcccaa     62280
     tttgggaacc cacgaaggac gttgcccatc ctaccttctg tcgggcgagc gtgcagatct     62340
     cggtgcgatc gacgctttgc tgcccgagca agaggaactc atcgcccttt atcggacggg     62400
     cgccttggcg ccatccaaca gccatgcggc tccctgagag cggcaaccag cgagtatgaa     62460
     ccatgaatag aacgacaaga agccgcgatc ccgcggcgct ttgccgggtg gaggcgtgtc     62520
     gcctgctcat tgccgaacgc aagcagatcg gtacgcatct gggtttcgat ctttgtccgg     62580
     tgccggcatg ggatatgctg ctcgacctgt atattgcctt tcacgagggt cgagagacgc     62640
     atatctcttc tctgtgcctc gctgctaata tcccactgtc gacggcacac cggaaagtcg     62700
     gcgagatggt gcaagaggga atcctgcagc gcggctttgc cggtgggcgc gtgaccgtcg     62760
     acttgaccgg gaaatatgtc gagaagcttg atcgcctttt cgacgacttg attgcagccg     62820
     tgttcgccga tgggatgtat tttccgaacc tgccgtgcca gaccttgggc ggtaagtcct     62880
     cactcggtaa tcaggatgtc gcgcaaggcg caggtaaatg aaatcctgcg cggtatcctt     62940
     tcactccgag tagctgcccg gtgagtcgcc gcttggatca acctgagatt attcaataag     63000
     atgctgagag cgcttgatct ctcgcagttg atcccgttag ctatcgcgtc aggccgcgca     63060
     tcggagcgat tgccgagacc acattgacct gttgaaagga atatagacgg atgaacaata     63120
     gcgatctagc cgaggcggtt gcaggcgcac acgggctcag caaagcggac gccaaaaagg     63180
     tggtcgacac cgtcttctcc acgattggcg aggctgcggc aaaaggcgat gaaatttcgc     63240
     tcaacggttt tggcaagttc aaggtgaaag cgtcttccga acgccaaggt cgcaatcccg     63300
     cgaccggcga gacgatcacc atcaaggcat ccaagaaact tggctttaca cccgccaaag     63360
     tcatcaagga caagcttaac ggttgatctg gaatttggcg gcgtctcatg tgcgcatgag     63420
     acgtcgtcac gttgccatcg caacaatttt caggacagta gaccaagagc cttaagtgcc     63480
     gttggtctgc cgacggcatc aggtgagatg atggccgcgt tagcgcgagc gattgagcgc     63540
     gcatgagaag cgagcttgga tcgggcagat catgcccgag cgttgcacgc gaaggcaagc     63600
     tgtcgacatg caatgattgg caccgtcctc aatgaaaatc gtcgtttcgt atgcgcagga     63660
     tttcctcctg ctcggcggcg gtgccgtagg gaggtgatgc cagggtccga ccgcgcggcg     63720
     cccagctcgg atcgcgcgaa ttggagtcac cgccgttctt tgcgccatca ctgcgtcccg     63780
     gcgcgaccgc gaagtccatg cggccgatgc tgcgcagcat gtcgtcatgg tcggcgatcc     63840
     cgttgcagct gatgtgtgtg acctcgcccc ctttctggag tagcgaaatc agcgagcgag     63900
     aatttctgcg tcagatggtt tcgcatgcct tatttcgagc gtcatcggcg gcgaatgtcg     63960
     ttccccgcaa cgcgttgcgc gtatcgaagc gtcccgcatt caggcatagt ggtgaccatg     64020
     cgagcgtttg ttctgaccaa atatggcggc cccgaagcag ccgaattgcg cgaggtgccg     64080
     cagccgcgcc ccggcccgaa cgaggttctg gtgtgggtga aagcggcggg actcaatccc     64140
     gtcgatttca aaatccgcca gggcatgttg aaggtcgtcc agcgctaccg cttgcccacg     64200
     gtgatgggca acgacctggc cggcgtcgtc gaggcgctcg gcgaaggtgc atcccgcttc     64260
     gcgatcggcg accgggtctt cgcccgcgtc gcgaaggacg cgctcggcgc atttgccgac     64320
     tatgcggtca tcccggaaac ccctcctggc gaaaatgccc gcctcgctcg atttcgagac     64380
     agcagcgggc gtcccgctcg ccggtctcac cgcgctgcaa gcgctgcgcg acgaactgca     64440
     tctcaaacca ggcagcagcg tcttcatccc cggcggtgcg ggcggcgtcg gcacattcgc     64500
     catccagatc gccaagtggc tcggggcgga ggtcaccacc accgcgtcac ggcgcggcag     64560
     ggctttggtt gagcggctcg gagcggatgt cgtgatcgac tacacgacgc aagacttcgc     64620
     ggatcaggtc cgcgacatgg acggcgcgtt cgacctgctc ggcggcgaca cgcttcacaa     64680
     gattttcggc gtagtgaagt ccggcggaaa gatcgtgtcg atcgcgggtc tgcccgagcc     64740
     ggagaccgcg cgtaaagatc tgggccgcgg tatcggactc gcggctctgt tctggtttgc     64800
     aagctatcgc tcgcgcgccg aggccagacg gcacggcgtc gcctatcggt acctgttcat     64860
     gcacccgagc ggcgccgaac tcgccgaact cggccagctc atcgaggacg agaggctcga     64920
     acccgtcatt gaccgggtgt tccccttcgc cgatattgcc gaggcgttca cctatctcga     64980
     ggcggggcga gccaagggca aagtcgtggt gcggatggac gacgacgccg gctaatcggc     65040
     tccaagcaac tgcaaggtct ctgcatcacg ctcgccgccg aaccagcgat caagtgctga     65100
     ggccagaagc gccgagggct gcacggcctc gaacaaggtc agcgacgatc gcagcttcat     65160
     cgcgtcgatc gcaccgaaca ccgcgacggg atcgctgatc ggcagatcct gaagcgccgt     65220
     cacgcaatcg cgataccggg tgcccagcac cggatgatcg agataggtac gcgcttcgtc     65280
     gaccgagcgg atgccgtaaa atctcacttt ctggctgcgg cagacccgca agctgcagga     65340
     agatgaacct gatccagtgc gaccgcttgg cgtcgcgccg tatctcggca agcgccgtcg     65400
     cataggagga tcgctgcact tcgacgaaac gctccagcga ccggtcgtcg gcgtcacagc     65460
     agctcgggct gcgccgcgag cggcggatag cgtaccgacg cccctcttgc ttaaaatgat     65520
     ggactttcca agtgaccatc ttatatgacc agtcgtaaca gttgaccatg aggaagagcc     65580
     atgcgtgctg agacatacgg cgcggccgat ttcaaaacga aatgcctggc gatcctcgat     65640
     cggctagcaa gccgcgacgt ggaccaagtg acgatcacca agcgtggccg cgcggtggcg     65700
     gtgcttacgg ccccgccgag tactgccgat gccgttggaa ccctccacgg cttcatgcgc     65760
     ggttccgttt ccgtgccacg gggcatcgat ctcctcgctc ccagccttga tgaaaccctg     65820
     actgcggaag acggcaagct ccacggatga cgaacggtca aaagccgacg actgcccctc     65880
     gcgcggtgct actcgataca tgtgcggtca tctggctcgc caatggcgat tccatcgcgc     65940
     ctgcggcact cgaagccatc acccacgcgg cattggcgga tggcgtgttc gtgtcgcctg     66000
     cctcagcgtg ggaggttggt ttgctaagcc gggttcgggg cgataaatct cctagtgttg     66060
     cctttctgcc cgatccacaa agttggttcg ccagtttcat ggcgggaccg gcaatcaggg     66120
     aagcgccgct cctgccggaa atcgcaatcg cctcttcgct cttaccagaa ccccttcacg     66180
     gcgatcctgc ggacaggttc atcattgcga ccgcaaggca tcaccgggtt ccggtcatca     66240
     cacgcgacgg caagatcatt gaatatgctt cggctggcca tgtaagcgtt attgagtgct     66300
     gaacagcgcg accggtgagc ccggagcaca aggacgagcg ttacccatgg ctgatgaggc     66360
     gtgcgctcgc acggtcaacg atctgaagcg gctacatacg catcgctgat gtccaccatc     66420
     gataagccag gttgcacgcc cagcgagatt tttgcatagc tcgtccgcag ctgaaacgag     66480
     cgttcgaaaa aaatcgggct gccgcggatt ccccccaacc tgaagagcct gatctgcgga     66540
     tcagttggga gaaatgggga tacccgtggg atcttgcacc cgcgctgctc tccttgcgag     66600
     gtgttaaata caccaaaagc ttgacggtgt gatccacatt cggcttgcgt caccatctcg     66660
     atcgcgccaa ctagagctgt tcccgtgaac aggacgggaa tggggcctgg aaaacccctc     66720
     aagcaacgca gctcggtcac agcaatgcgg ccgggtggca tgcgcgcatg tccaaccggc     66780
     aacggtaaag gcgcatgcgc tctgcgcgtt gccagggttt ttccacatcc ggctttggcc     66840
     gtcgccccga gtggacatag ggcgcgacgc gaatggacca gagcacggaa cgaacatcgg     66900
     tgaatctcgg ctgcattctg ccgcatcggg cgtgtgcgtg atgccgccgc ggctgaacgg     66960
     acacgcacag ccaaacggca tcgtggccga aaagtccgat ggaggccccg agcctgctgg     67020
     ttttcctgaa ttctatagag atgaagtgcc tgccctggtg cgcttcttcc gcaggaggct     67080
     gaggtcgtct gatgaagcag aggatcttgc ccatgaggcg cttgcccgct tcctgcgggc     67140
     atcccctgtg acgcagatcc tgatgccgca ggcctatctc aaacggatcg caggcaatct     67200
     cctgcgcgat cgggcggaaa gtgcatcgac ccgtttggcg gatttgtcag ttcccttgga     67260
     cgagagtatg gagccaccaa cgccctatga tcagcatcgc gaacttgtcg gtcgcgagga     67320
     gctcgagcat ttcaatgtag tccttcagca gttgaagccg cgcacgttgg agatcttctt     67380
     gatgagccgc gtggatggct acacatacaa agaagtagcg aagaagttgg gaatgactct     67440
     ttttggcgtt aagtggcaca tgttgagagc tatcgagcat attgatcggc atcggaggga     67500
     caggtgagcg gtggccgata tttctcaagg gcgcgacgca tcgatcggca ggcccataaa     67560
     tgggttatgc gcatgctcga cgatcctcaa cgtcatgccg cgaagctaca gcgctggatg     67620
     gctatcagcc ccgatcatca ggcagcatat aagcgggtcg taaccgaggt cggctatgcc     67680
     agcgatgccg ccacgcttat gccgtcgctg cgcgcgagca cagaatccag ccgatcgact     67740
     tggcagcggc ctacctattt cgccgcagcc actgcgatcg ccggtggtct cctcctcgcc     67800
     gtcggttggc atttctattc ctccagcacg gcagtccttc ccagcccgct cgagcaggtt     67860
     caaactgtgg cgatagccga tggtgaaaag gagataaggc tcgcggatgg ctcgaccgtg     67920
     ctcatgcacg gcgcaaccac actcagcatc cgctacggct ctacagaacg cgctgtccat     67980
     cttctgagcg gccgcgcgcg ttttgacgtc aaacatgatc gagctcgtcc ctttgtcgtg     68040
     tacgcgaagg gtggcagcgt gaccgctgtc ggaacagtct tcgaggttag cgtagagcgg     68100
     gacgtccagg tgcgcttact cgaggggcgt gtgcgggttg cgatgccacc gaaggtccac     68160
     gaggcgaaag gtcgagaagt gcttctcgcc cccggggaga aagccgcgtt ttcgccggcg     68220
     ccagaaccgg cacaacagcc atctatcagc gagaggcaac ctcctcagcg gagcctcaac     68280
     acgttcgatg atgtgcccgt ctctgtaatt gttgccgagg tcaacaagcg atcttcgacc     68340
     aaaatcgagc tggtcgatga aactgcgggc cgggaaagaa tttttgcaga cctcaacctt     68400
     gatgatgccg acgctgtagc tcgaagaatc gcgagaggcc ttggattgac gatcgaccgc     68460
     agcacacccg gtgtgatccg gctttcgaaa ggccactaac cgctttcgcg catattccgt     68520
     ctgacccaat gcagccgccc cacggaaagg ggcggcctca attgggggct cggaatgaga     68580
     tactatcgaa gcttcgttct ctgcggcgcg gccgcactgg cactgacgat cagcaatgcg     68640
     agctgcgctc aggagcctgg tgagcgtgac tacaacgtcg cggcacaaga cctcaaatat     68700
     gcgttgcgcg atatggcgcg acaatccggg ctggaactgg tcgcccaaag tgccgcgctg     68760
     gcggacaaga aagcgcccgc actgcgcggc cactactctg ccgttgaagc actgaatttt     68820
     cttctggccg gcaccggcct gaccgctgag atcagcgaag gtacgatatt cataaggggg     68880
     cgatcggagc cgcccgtcgc ggcggctgtc gctgaaggcg gaagttccga tatcgttgtg     68940
     acgggctcgc ggatccgcgg agcggcgccg gcgtccccgg tcattgcttt atcccaaacg     69000
     caaatacgcc tacaggggca aaacaacctc ggagaagcta ttcgtagctt gccgcagaac     69060
     ttctccggtg gtcaaaaccc cagcgtcggt gttgggaatt ttggagcgac caccaccaat     69120
     ttcaacggca catccagcct aaatctgcgg ggcctcggcc cagatgcatc ccttacattg     69180
     ctgaacgggc atcgcttggc atatgatggc gcaattcagt cagttgatat ttcggctatt     69240
     cctttaggtg ccgtcgatcg tatcgagata gtcgctgatg gcgcttctgc gctctacgga     69300
     tccgatgcag ttggcggtgt cgccaacatt ctcatcaagc gtgactacga tggcctggag     69360
     gcttcatttc ggtttggtgc cgccacagat ggtggaaacg tacagcagca atacacgctg     69420
     gtgggtggcc gtaagtggtc gagcggcggt ttcatagccg cttacagtta cgaacatgat     69480
     acacccattt tggcgaggca gcgatcctat gccagcggtc tcttcggaca ggaagacctc     69540
     ctacgctacc agagtgtgca caacgcgctc ttcagtgggc atcaggatat tgtcgaaggc     69600
     gtagaactgg ggctcgatgc aatttacagt caccgcgcga ccggtgggaa tctcccatat     69660
     accacgacta acgatgtctt ttttagcggg cagatcgatc gaaccaaagc agagtctttc     69720
     tcaatcgcgc catcgataaa ggcagaactc ggtggggact ggagagtcag cctaactggc     69780
     acatatggca aggacagcac ccgcgcccac tcggactatt acagcgcggg agatgtcgtc     69840
     ttcgtctacg ccggctgcaa ttgcaacgaa ctgaaatcgg tcgaactaaa cggagaaggg     69900
     gcgctcttcg agctacctgg aggaaccgcc cggctggcta tcggcggagg ctaccgctgg     69960
     attggttaca aggtcactgt cggaggagtc ttcaactata cggcttcacg cgacagctac     70020
     ttcgcttatg gtgaagtgaa ccttccattc gtaagccagc accaagggat tccattcgtc     70080
     aactcactca cactgacagc agcgttgcgg tacgaaaact atcccggaat ggataaggtc     70140
     gtgacgccaa aggtcggatt gatctacgcg ccgaccgaag atttgaccat caagggtagt     70200
     tggggaaagt cattcaaggc gcctacgctc gttcaggaga attttccgca gtttgcctat     70260
     gtctatcccg cgagcgctat cggcgctgtc ggtgtgccgt ctgcagcgac ggttctttac     70320
     ctcgaaggcg gcagcaaaac gctgaagccc gaacgcgcca atacctggag cggtaccgtc     70380
     gtcctccacc cgcgcgccct tgccggtctc aatctggagg tcagctactt cgacatccgc     70440
     tatcgcgatc gcgtcatcca gccgattgcg tcactgggcg gcattctatc caatccgatt     70500
     taccaaggtc ttatcaccta ctccccctcg ctgcagctga tcgattcggc gatcgggcgc     70560
     gcagcaactg gactgagcaa ccctttcaac gtcgcctatg atcccaatga tatcatcgcc     70620
     ttgatagaca atcgaaacgt gaatgtcgcg gcgcagaagt tgcatggcat tgacctcctt     70680
     gcgtcctatc gcagcgatct gggtgatggc cggtcactga cgttcagcgc gaacggaagt     70740
     tacctcaaaa gctcgcagca gctaagcagc gcacagccaa gcgcgccgct tgcggggacg     70800
     atattcaatc cgccgcatta ccgtgggcgc gcaggcgtcg tttgggatga cccttcgctc     70860
     gtattggcgt catacctgtc ctacattggc ggtgtgaccg acaatcggtc cacgagcacg     70920
     cgccatgtcg ggtcgatgac gacactcgat ctgaccgccg tggtgcatct gaaccgagcg     70980
     acaggaatct tcggtgggat tgacctcacc ctttccgttc tgaacgtcct gaacgacaag     71040
     ccgagtgtga tcagaaccgg cgtagactac gagaccccct acgattctac aaactactcg     71100
     tcggtgggac gctttgtcag cctcacgatt acaaagcgcc tctgatgcgc attttagcgt     71160
     ggacaacagg agccttgatc ctgttgttat cctgtccggc gctcgcaagc gcggagtacg     71220
     ccgcgcaagc gtcgccggac tgcgctgata tcatttcagc gaccgggcat agtcgggcaa     71280
     gccgcctgca gccggaagat atgataaggt tgagggatat aggtccgcct gacggctctg     71340
     cagcggcggc cggtttgatc agcgcttcgc cggatgggcg tcatctggct ttccagatac     71400
     gacgggcgga tcccgcagca aatggctact gccttgcgat ggtagtgatg gaggcgcggc     71460
     ctggcgcggt gccgcgcatc gtcgatcagg gtggtgtgct catcaggtat cagtacgatg     71520
     atctttgggg cttggccggg tggccaaccg gctggccggt cgagattgta ccgcgctggt     71580
     cggctgacgg ccaatggatt gctttcctga aaaaacaggg cgcccgggtt caggtttggc     71640
     gagcgcgcgt cgatgggagc tcctcccaag ccgtcacgcg ttcaccagac gatgtcgtcg     71700
     gttttgcgtg gacaggggac ggcggcatca tcttttcgac ccgccccgaa tacggtcgtc     71760
     gactggccgc aatcgaaagc gaagggctat ctggctttct tttcgacgat cggttttggc     71820
     cgcttgctcg cagccgccca atggtacgag caggctcttc attggtcgcc tttcacgtga     71880
     acgtcgaaag ccaggaactt cggtccgcta cgccggagga agcgcgcacc gtgggtgcag     71940
     tacaggagga ggagcgcgtt gagcggccgc ttctttcggt ggtgcgggaa gggcgaaggg     72000
     cgtgggtcac gaagcgcgag ccgcagcgtt atgtgtcgcc tacatccctg tcggtgacat     72060
     tgccggacgg gaccacagcc acatgcacat ccacggcctg cgatcatatc gttgaccttt     72120
     ggtggtccgc cggcagcgct ggcgtgctgt tcctcgcgcg aacgggttgg ggaagcagcg     72180
     atctttcact ttttgcgtgg gatccgtcgg ttggatcacc tcgcaggatt ttggcgacgg     72240
     cggatctcct ggtgggctgt cagccgaccg ggagacactt cttctgtctg cgagaaggat     72300
     cgactacgcc ccgacatctg gtcgacatcg atctcgtcac agggacgtcg cgcaccctgt     72360
     tcgagcccaa tccggagatt gcatcgctgc gcctcggaca ggttcagcgc cttcagtgga     72420
     gaaacaaccg ggggcaggag tgtttcggcg acctcgtgct tccaccaacg cataagcccg     72480
     gggagaagca tccgctcatc gtagtccagt atcaaagtcg gggcttcctg cgcggcggta     72540
     cgggcgatga atatcccatc ttcctttttg catcacatgg ctatgccgtc ctgagcttgc     72600
     agcggccacc ggaacggggc ggtcttggag acgcaaaaga tcagatatcg ttcgagcggt     72660
     cgaacatagc gaagtgggcg gaccgagaaa gtgtgttgtc agccgttctt gaaggagtcc     72720
     gtctcgctga atcgatgggc gtcatcgacg aggaccgcat cggattgaca ggactgagtg     72780
     acggagtctc aaccgtcatg cacgcgctca tcgagacgca tatcttcaag gcggtgtcga     72840
     tcagccagtg ctgcgacgac ccaaagatcc agactaacta tgtgggctcg cagttctccg     72900
     acttcctcca tcaggttggc tatccttcac tggatgaggg ccgcctcgac ttctggcaac     72960
     ctcattcgct ggcactgaat gctgcacgtg tttcggccgc gatccttatc caggtatccg     73020
     aggatgaata tcgctccgcg ctggagtcgt tcgctgctct tcgccatagc gggaggccgg     73080
     ttgaaatgta tgtcttcccg gacgaacatc acatcaagtg gcaacccgcg catcgcatgg     73140
     cggtgtatga gcgcaatctt gcgtggttcg acttctggct gcgcagtatc gaggatacat     73200
     cggtggagag agcctccgag atcgctcgtt ggaaagcgat gagagacagc tcggcatccg     73260
     ccccagctag gcaggttgcg acctggccca cgcctcgacg tcggccaggt caagaaggcg     73320
     gatatagtcc gtgccggtcg tcgggccgga tcgagcaagt tgggcccgga cgctgtcgac     73380
     atcgatgatg tttcggctgg cgagcaaccc gtcgcacagc catttaatca gcgcaggcct     73440
     gttcaattcg agaatggcga ggaggaggct gtccggactt cccttggatc gtcgctggat     73500
     gatctgccgc ggaaggtctc gctcgaaggc tgctcgagcc aaggctcgat tgacgccgcc     73560
     cgcgcaccac atccagcttg gtacggcaag gcaaagttct accagcggct gagacagaag     73620
     aggcgacacc atgaaaatcg gccctccgct tgcaaaccct tcccgatgat agtgcgattg     73680
     ggcgaggccg gcgagttgtc ccagtttgcc aggcaacagc gtggcatcag agtcaagcca     73740
     gggatgggct gaggcatcgg ggccagccgc gatcacgtcg gcgtgaagat atctcgtgtc     73800
     catccgccag cgatagggcc ggcgccagga ggccgctcgc gagattccac ggtgtagcac     73860
     ggaccatatt cccacaccgg tgatatggct gacatcgacg gatgtctgga gggcaccgcc     73920
     aatgccatcc gcaagcaacc gatcggcaac gggactggct gattgaagaa agcagaaaac     73980
     cgcgtctcct gcgttcccgt tgaaaacgac ttcggcaccc acggccttcg ccgcaagcag     74040
     ggtcaagcgg tcggtttctt gcacatggga gcgagcgcat gggcgcggaa gatgggcgcc     74100
     gtcgcagacg gttatatcga cccttcgcgg gtcgaaaaat gcgtcctgaa gcggaaatcc     74160
     aagatggtct gccaccaggc ttgcatggtc tcgttcgtca ccctcgggtt gtgtcgttgc     74220
     tatcgtcaat gcggaaagtt gcgctcggtt gccccgcaag gcggccgcaa ggatcgagct     74280
     atcgagaccc cctgatatct ggataagaat gttacggtag caggaggccc aagcgtgaac     74340
     gctattgagc gtcacgcgac gcacacgttc gatcgcctct tgcttcccga tcacgttgtc     74400
     tcgcgggcgg gcgaatttcg caggcgacca cagttcctcc agctttgatc catcttgtct     74460
     caacgtcagc cggtgccctc cgggcaattc ggtgacccct gaaatgcatg tcgtggccgt     74520
     tctcagatcg ggccgcaaga gctgctgggt gattgccgac cagtcgattg aggcaggcgg     74580
     ctctgtgaat tggcgggcag tcgcgatgtc tgacgctacc aaccagagtt cgtcgcatcg     74640
     aaaataatag cacggggcag tttcgagggg gtcgcgcaaa atatggactt cgtcagcgcc     74700
     gtttccgccg aaaactgcta cataagatcc ccagtgcctc tcgacgaatt cgtgtcccga     74760
     gcttttctgc acccgctctg ccagtgcgcc gtcgagttcc accactcgtt gcggttggac     74820
     tgtccagaat agatgcccga tgaccgctga ggaccatcgc ttgttcgtaa ccgcgcttgt     74880
     tccgtcggct gcatagatac tgaactgtgg agcttcaaag agttcgcgaa gtgcgaattc     74940
     cgggtcgtcc tgtggacgga ttctcgctct cgctgcggct gatccgacaa cgatgacgta     75000
     tcgcaaggcc atcagattga aaggatcggc gtgaaaagac gcgtgtggtc gagatcgtcg     75060
     ttgagcacgc aatcaccgtc ctgcacccag cagtgggcgg caaagggcgc gagcttcacg     75120
     ccgaatatca acgtcgggga ggtgcccgat gatagcagga gctttgcgag cgcgagcgaa     75180
     tagagcagac agcgctcgtg ctggccaaaa accgaaccca gcgttttgag agccccggca     75240
     attgcgaggg agcgcgccgg tcttctccgc ggccccagcc cgctctttcg ccgacggatg     75300
     ctttcaagga tcaaatgaag gcggcggtac ttgaggagga gtgccgaatg acccagagct     75360
     acaaccgcgc gagcgatgtc ggccgcagtt ggaatccgct cgatgaccgc gcaatcaata     75420
     cgggcgattg ggtggacaga gggagaaagc cgggtgtgac aatccttctc cacgagataa     75480
     ccttggtcga gcaacgctcg caatccgggg gcgacgcggt cgatctcttt gccagccatc     75540
     atgcatagca acgccgagga tgtgctctcc ctaacgccaa aatatctgtc gtttgctacg     75600
     tcgaggaaaa gcacatgctg ttcgatgatg cagaacgaga gctggtcacg cagtgccagc     75660
     gccattagct cctccgttga atggtgaaac tggcgcgcgg gcagccgcgc gccagcctct     75720
     gctgcagtca gtcgtcagaa atgccgccga tcaggttttt gggctgaccg ttctgatcgg     75780
     tcgagccgct tcccatcccc tgggtaacgg cgctggcggt gccgaggtcg atgatctcat     75840
     cgacctcgga gttgtcatga cgatccatct tcatctccat cgtgcgcgcg atattgcgcg     75900
     aagggaagac tatcgagcag tcgccatatt cccgatctta tattctccca atttgagagc     75960
     atatttaccc ggcatggcta ccttccaccg ggttttgaaa tgagagcagg caaatccttg     76020
     aatctatgtg gctcagtcgt ggttcagcgc gccatcatct cagcgacaag cttcgccgat     76080
     cggcgtagcc ggcgccgatg gtacccccag acggcgtgtc gaatggatac ggcgtctccg     76140
     gttgcggata cagtgacgag agactcaagc tcggacaaaa ctcctttgat gagatcaatc     76200
     tccgctagtc gcacccgaaa caggcgagct gaggcattcg cgatggcttc aatatgctcc     76260
     gcatttcccg atgcgccgcc gaggactgca aatagcgttg tgaccgctcg agcgagtatt     76320
     tcaggatcaa ggtctggact tagtgcgggc aatattcctc gttcttccgc agtgagacgt     76380
     cttgttacag cctgtcgaat gagcttgtcg tgccagctgt agaggtcgtg aagagactcc     76440
     ttcgatggaa ttggcagttg gaacccgcca accggcagtg cctcgattat tctctctccg     76500
     accaggcggt gcatggcgtc gcgcaacggg gaaacactta cattgaactc ttcagcgagg     76560
     cgttgcagat ttagaggcca acccggcttg attgcaccaa taattattcg ttcccgtaga     76620
     agacggtatg ttcgttctgc tgcgacaggt tcgggcgaca tgatgagtcg tcacgcagcg     76680
     gtgagtggat caccgggctc ggcgttgggc cgaaattgcc gtgcgatgga ctccatatag     76740
     tagtcgccga tgcactggat gcaccgcttc tccacgccat ccgggtcgtc gaggaacagt     76800
     tggagtggaa acttcatatc attctccatg aagatcagag gaaagatcaa atgcgatgcc     76860
     gccatcccga gcgcgaatgc gcagcggaag tggttctcga tcgtcgattt gggatttccg     76920
     gactcgattt cgcgaagcca gcgaacaccg atgccgactt ttgccgcgag ttggctctgt     76980
     gtcatccgta catgtttgcg ccgctcctcg atgatcttgc cggataacag cttgatctgg     77040
     ccgagacgtt cgggctctgt cacctgggtt gtacttcgaa gcggcatgtc caggtactcc     77100
     ctgaaacttg cccgaagatc ccatgcgcag tccgaggctt gacgatgggt gttattcacg     77160
     ccctacgtca aatattttct ttcccaactt gggagacgaa gttactgaac ttccttggaa     77220
     atcttacctt gcggagtaaa cagcttgtta gccttgccgg cttctccgcc gcggcggcgc     77280
     tacacgctcg aaggcctcga caagctgtcg atcttctgcc gatgccaagg acaatagtgc     77340
     gatgatgtag agatgaccca tttgcggcgc cgatggacat tcatgtcgat tcaataactt     77400
     atcagacacg cgcttggtcg cgtcaataag cgccgtcgac gatccgacga accggatatt     77460
     gtcgccgatg cagtgatgta gccgctgctc ttcgagttcc gcgacgacgt cacatgcgtc     77520
     ctggccttcc aatatcgcaa cagccaccat cagggtcaca ccgtaaggaa taaagttctg     77580
     cagcaaatgc gcgagacggc aatgacattg aaggaaaagg tctatgccct ctttcgaaag     77640
     tcgtaatttg tacgtccgcg actgcgccat ggctgtcctt ccttcgagtc tccgactcgc     77700
     tctctttctc cttcgctaga cgaagcttgc gccgaaatgg ccagcgcatg aagcacagga     77760
     cacataagca accggcacta cagtgccgat tgcggcttct gtagagccgc tagcggcgcc     77820
     gccagtgcct tgaccggctc ctggagtgcc ctggcccttg cggacggctc cggcgttcga     77880
     tcatgagttc gccatcccga cagggggacg gcgagcacag tccgagaagc ccaagctccc     77940
     agcccgaacc cggaaacatg gaaacggaag atcggaacac ccgattttcc gaacaggagg     78000
     tgctgtgtcc aatgtacaaa cattcgtcgc gtctggtcgc cctgctctgc gccgtggcgt     78060
     ccggttcgat cgccgaagcc cggggcacgc gcctggtctt gccaacgccg gcgatcgaga     78120
     gtcgcgcgga aatccgcgca acggagggtg gcttcgcaat ctacaccttg cctctgtcgc     78180
     tggacatcca cccctcgccg gtagcggtct cggtcggcag ctccgtcagg atcgacaagg     78240
     cgatcctcgt gcaaccgaag ctgccggcca ggaacgcagt gcaatgaccg gcgcaaagcg     78300
     aggtctcctc gcggcgagcg cagcactcgc gtttgtcggc ctcatcgcag gtccggcttc     78360
     cgcgcagtcg caatcggcgg cagacaagga tctcgcaaag gcggcggcgg aagctgagca     78420
     gcagctccat cagaccttca cgaacctcaa gttcgacgat ttcggcccgg cgccggtcaa     78480
     aggtccgatc taccaggcga tcgccggcgg caagatcatc tattatgcgc cgcagagcga     78540
     gcacatcctg cttgccgcga tctacgataa gaacggcgtc aatgtgaccg cgcttgcgca     78600
     ggatgccagc acgaggcgca agctgggcgt ggtcgatcct gcaaaggcgc tggtcatcgg     78660
     tccagcgggt gcgccgacgg tcatcgagtt cacggatccg gattgtccct attgccgcgc     78720
     gctcgagaaa ttctgggcag tcaaggaagc ggaaggcaag ccggtccggc gcctggtcta     78780
     tttcgtgagc ggcatccatc cggaggcggc cgcgaaagcc gagcatatcc tgtgctcccc     78840
     ggacaaagcg gcagagttca aggcgatcta cgccggagcc gcgcccaaag aactccataa     78900
     atgccttccc ggccggtcga aggtcgaggc cgatgctgaa atcgtccgtc aggtcgggat     78960
     cagcggcacc cctacgttga tcgtcgacgg gcgggtgatc tccgggttcc agcagggcga     79020
     gctcgaggaa ttcctctcga aacccaagca ggaggggaag gccccgcagt aggccggcca     79080
     atccacggga acaaacaggt ttttggcggc cgccaggtgc cctgcccaac atcggcagag     79140
     cgtcgacgga ccggaatgcc gacggcggcg cgctccaagg gggagccgtc caacgccacc     79200
     atcggtgcca ccgagacaaa ctcgagcggc gatcgtccgg acggctcccc aagcggagta     79260
     atgggaatga tcaggaaaat cggtaaacat gcggtgtcgt tcgcgaatgt cggcgtccct     79320
     ttggtgctgt tcgcggcgat gagcggtggc gcgcatgcct tcaccgcgcc cgccacgggc     79380
     gaccttggtt acgacatcta cgatatcgtc gtgaacaagg gcgtgaaggg gccgctgggt     79440
     ttcgtcggcg gcgtcgcggc cttcctcttc ggcgtctcgc ggctgttctc gaacgtgatg     79500
     gtcggcattc cgaccatcgt cgccgcggtc tgcctgatca agtcggacac gatcctccag     79560
     accttcggaa tggtgatctg aacgatcggc ggtcgcacct tatcgaaggc gccgccgcgc     79620
     acaggtcggg tccatcccgg gcccgaacga ggacaaccgg cttggccggt gtgtcttgaa     79680
     gcaggaggag aagagcgttg gacgaacgtc tgccccagta tctccatcgg ccggtgcaga     79740
     tcctctggtt cggctcggac gagttcatat tggtcatgtc gaccatcttc gtcgccgtca     79800
     tcgtcggcgg agtgatcggc tggacgctga tcggcgctct tctccttttc attccctgga     79860
     agcgcaccaa gccgcgcggg ttcatcccgc atctcgcctg gcgttggggc ctgctgcgct     79920
     tccgtcacta tccgggtccg acacagaccc gcttcttcga gtgaggcgcc ccatgccgtt     79980
     cctcaaatcc tgggccaagt cacaggccga cccgcttttg ggaaagcccg caagctgggg     80040
     catccaccgc tatctgcaag gttcctcgaa cctgttcgaa gagaaccggc tgctaaagtt     80100
     cgcgatcgtc ggcctgttcg gcgtggccgc ggtgcttggc gcgctcatat acacctccaa     80160
     tcagaatcag cggacagtcg tcgtgccatt cggtgcaggt ggcgatctgt acgtcaccgg     80220
     gaacaccccc tcgcccggat atctgcggat gatgacccgc aatatcgtca gtatggcggg     80280
     gacctattcg gcctactcag cggatcggca gttccaggag ttgctcgcga tcgcgcaccc     80340
     ctcggcctat aacggcctgc gcgatagcct gagcggcatt ctcgacgagc ttgccgacaa     80400
     tccgaccttg tccatcgcga cctatatccg tcccgatcag ccagtcctga ccaccaatac     80460
     cgacatattg gtgccggtcg aaaaggtgcg cgtcatcggc ggcgtgatcc gcaagttccg     80520
     cggcaatctg cgcatcggtt acgcgctcga gaacggccgc ttctggctca cctcccttca     80580
     cgaggagaat ttcgatgccg atcgctgatc gatccggcgt ggcacgtccc tacgcacaag     80640
     ccgccgctct tatcgccttt gccgccgtga tcgccggcca ggcccaggcc caatccatca     80700
     cggcactgcc cgatcagaca agcagcatcc gcctctccaa tcgcgacatc aaccatgtcg     80760
     tctgcgaagg cggcgagatc gaggatgtca aattctcggc cgagaaggcg atagcggtcg     80820
     aacgtgctgg atctgacgcc tggatcaaat tcctggtgaa ggaggtcgaa accgagggcg     80880
     tgccaacccg cacctacgcg acggccgcat ctgaattctt tatcagctgc aatggggcgg     80940
     tctatccgct ctatgccgag ccgtccgata tccccgcgca gacagtaatc ctgacgccgg     81000
     gcgctgccca gcgcgcccga accaacgccg atttactcgg tcctctggtc gaggaagaac     81060
     gcgcggtctc gatcactctg gccctgctgc aggaccgcgt tcccgcaagt ttctccgagg     81120
     tagcgcccat cgcgcgcgat tttgccctgc cctctctgcc ggccgcatcg ctgcatgaaa     81180
     ggcggcggat ctcgatcgac ggcgcggggc tttccgcgag tgaatatctc gtcagcgtat     81240
     cggcggccca gcgcatcgac gagcgagcgt ttctggtttc gaacctcggc gccaatattt     81300
     tcgcgattac gctcgatcgc acggatcttc gcgcaggcga taccgcccgg ctgatcgtgg     81360
     tgcgccgagg agcggtccaa tgagcggcga acgcgaagag atcgcgcccg aggatggcgc     81420
     accgatcgag catagcccct atcagcaacg tcttgccgag caggcatccc tcgatcttga     81480
     cgtaccgccg ccaggttcaa gctgggacgc ggtgcgggcg cggtgggacg gcctaagttc     81540
     ccgtcagaag ctgcgggcca agcagttggg tgtcgcggcc gccatcggcg tgctcggcta     81600
     tggcctctat tcggcaagca gttcggatac gcctgccgcg acggcgccgg ctgcatcgaa     81660
     gctcgacatg ggcgccggcc tgcgcggtga cagtctcgaa gtcaaactgc gcggcgacct     81720
     gaaaaaggtc ctcgacggcc aaaatctgct tggcgaccgc atcaccgcga tcgaggaagg     81780
     aaagacgcca atcggcccgc atgctgcccc cggcagcgat gcggatggtg ggccgctgcc     81840
     gccagcgctg cctggcagtc ctcccgatct gcccgcacca ccctccccgt ctgagatcgg     81900
     cagtgccgat ggcagcttgc ccgcaccgcc ggtgccacca tctgcgcccc cggcgccccc     81960
     cgcgccgcct gtcgaaaaag tcgtaggcgc gatcggacaa gcgacgacgc ccgtcgttcc     82020
     caaggacgcc gcgggcggat cggcggactc gaaaaaaaag aatcggacga tctatttgcc     82080
     acctggtttc atgaaggcga ggctgctgac ggggatcgac gcactggcga gccgggacgc     82140
     gacgtccaat ccggaaccga tcatcgctcg cgtccaggcg cccgccgtgc tccccaatga     82200
     cgtcaaggcc aacctgtcgg gctgcttcgt gatcggcaac gcgaccggca gtctcgcgaa     82260
     agagcgcgtc gagatccagc tcgtctcgct ctcctgcgtc gacttcgatg agcattcggt     82320
     ggtcgaccag ccagtgaagg gctttttcgt cgacgcggat gggaagaagg gtctgtcggg     82380
     caaggtcgtg acccgcgccg gcgcggcgct ggcccgcacc ttcattgccg gcacgatcag     82440
     cggaatcgcg cagacggtcg aaaacacctt cggcgacacg tccacctcgg cacttgggac     82500
     ggtgcgcacg ctcgacgccg gcgatgccgc caagtcgggc attgccggcg ggctctccaa     82560
     gtcctcggac aagctcaccg acttctatct cgacctcgcg cggcaggccg gacccatcgt     82620
     cgaggtcggc gccgcgaagg acgtggtcgt cgtcatccag gagggcgtga ccctcgagat     82680
     caagccaacc gcggggagca aattctgatg cgcgttcaat ctgtcatctg tcagccgacg     82740
     tttccgaacg gtcgcctggc tctcctcccc gccctcgcgc tgctctcgtc ctgcgcgaca     82800
     gtcggttcgc tgatgtcgcc ctattcggag aagttcagct gcaagaacag cgaccatggt     82860
     caatgcatcc atcccgagaa agcgtatgaa gatgcggtcg cgggacgggc gtcgcgctcg     82920
     gatcccaccg tcaccgccga tcgcaagctg cttaagagcg gcgcggcgga cggcgcggtt     82980
     ccatctgcgc ccgtcggcgg ccgcacggcg cggcaacagg cgccggcacc aggtgccttc     83040
     gccggctacc gggacagcgt ctatcgcgag cttcagggcc tgatcgatga tccggtgacg     83100
     ccgatgctca aatcgccgcg tacggtgcgg actctgatcc tgccctatgc tgaccgccaa     83160
     cggcccgacc ggctgtacat gccgcgctac gtctattcga tcctcgaggc gccaagctgg     83220
     gtcgtgggcg actatttggt caatccggta tcgccggcag cgcaggcgcc tgtgctcggt     83280
     caggtccgcg acaagccgtc agacgacggc gcccctgcct cgtccccgga gccgcggccg     83340
     tgagggcgcc gggaacccga catgggggcg ggcttacctt cacccggttg cgccagagcg     83400
     tggcacgcga tcgcttctcc gatttcctgc cgctcgtcgc ctgggacgaa agagaggaag     83460
     ctttcctctg catcgatgat ggctttggct atgcgtggga gctggtgccg tccgcctata     83520
     tgttcgcgca cgtccatcag gcactgctcg ggttgctcaa tgtgcatttc gatccaggca     83580
     cggttcttca gattcacagc tttgccgatc cgctgatcga cgccgcgttg gacggattcc     83640
     ttgatctcaa gacccgcgcg gatccgctga tccaggcgtc ggcccggcgc accgccgact     83700
     atctggggat gggtcgccac ggccttcgcg ccttgcacgg cattccgctg cgcgactttc     83760
     gcacgatcct gtcggtgaag acgcggcggc cgatggcgag cgacatgaag cgccaaatcg     83820
     aggagcagct cgacaagctt ggcatcaccc ggcttgcgcc cgaagagacc gtgtccttct     83880
     atcgccgcat cttcaatggc gtctacacgg gcgcgccggg cgtattcacg agcgaagcga     83940
     acgcgcaagg gtcggcgcca ccgatccgca agcagatcat cgacgccggt cccgatctgc     84000
     ttttcgacgg tccggaggtt ttcctcggaa accaggttgc ccgttgcctg acgccaaaat     84060
     cacctgcgcg gcgtatttcc gccgaacgcg cgaatcgtct gaccggcggt atgcgaggaa     84120
     gcgccgagga cagcgaccag atcggcgggc cgttcctcta caccctcaac gtcctgttcg     84180
     accattccgc gttcgagatc cacaagcgtg ctcaggtcct ttccgcgcaa aaagcagccg     84240
     gcagcttcgc ggtcgaagtg ggcaagcaga ttgaggagat cggctgggtc ctggacgagg     84300
     ctggcaactc gaaattcgtc cgcgtcatcc cgacggtctg ggtgttcggc cgagacagcg     84360
     cgcacgcccg ggagatggcc gcacgcgcca agcggttatg ggagagcgag cccctgccct     84420
     tcatgatgca ggaggaaagc tatctcaacc cgatcctgct gccgttgagt ctgcctttcg     84480
     gcctctatcc cgacaatcgc acgatgcgaa tgctcgaacg cgactttcgc atgcccgtga     84540
     aggcggcggt actgatgtcg ccgatccaga ccgattttcg tgggggcggc cgcccggccc     84600
     ttctctatac cggccgcaag ggccagttga tcacgctcga tctcttcgat ccgcgcatca     84660
     acaattataa tttcattgtc tccgccgaaa gcggcgcggg caagagcttc ctgctcaaca     84720
     atctctgcca gcaatattat gcgcagggcg cgctgatccg catcattgat atcggcggca     84780
     gctaccggaa gctctgcacg ctctgctcgg gtcgctacat cgacatcggc gaggagcagc     84840
     tcgtcctcaa tccgttcgat atgggtttcg ccttggacgg cgaggataag cagtccgcaa     84900
     tctcgatggc ggtcgccatt gtcgctgaga tggcgaatgc cgcgacccgc aagggtgtct     84960
     caacgtcgga gtggaacctt ctgaaatcgg cggtccaatg gacgatcgac gaaggccatg     85020
     ccgaggaagg gatcgacgcg gtgcgcgcct ggctcggcgc ctatcccgaa ttcgccgcgt     85080
     cggatctcga ccgcgtcgat catctggttc ccgtcgcgcg ggagcttgcg ttcaacctac     85140
     gcgatttcgc gagcgagggt gcctacggcc acttcttcaa cggtccatcg accttcgaca     85200
     tcaccagcga cgaattcgtc gtgctcgaac tcgagcgcct gaaggcgatg ccggaccttt     85260
     tcaacgtcat cgtcatggtg gtggtgaacg cggtcaccca ggaactctac ctctccgccc     85320
     gcgatcggcc tcgcttcgtg ctctgcgatg aggccgcaca gttcatgacc aagaccgagg     85380
     ggcaggatct gtcgcgcttg gccgaagcct tcggtcaagg ctaccggcgc gcgcgcaaat     85440
     atcagggcag ctttggcatc gtcctgcagt cgatgaatga cctgttgctg ttcggcggca     85500
     ccggccaggt gatcctggag aacgctgcca cgcggttcct gttgcagggc tcgacctacg     85560
     ataaggccgt cgagaacaaa atcctcgact attcgggatt tgttctcgag ctgctgaaat     85620
     ccgtccgcaa ttccaagccg cactattcgg aagtcttcat agactcgccg cttgggctgg     85680
     gtatcgcgcg gctcgtcgtc gaccccttct cctactggat caacacaagc gctccccaag     85740
     aggttgccgc tttcgaagcc aagctgcgcg cgggcaagtc gccgctcgaa gccgtgtgcg     85800
     agctcgccgg cgtcgatgcg accgagatcc tcgggccgcg cgccgaggca gcggagtgag     85860
     atcgatgctc aaacgcaaac cgaacctcga tcaattcgcc ttcgatctgt cgaaggatgc     85920
     tgcgctcgag cgtatgatcg aggcacgcgt agcgatccgc tgcgagaatg acgcaattcg     85980
     ctggcgcttc cggctcattc tgatcgagac ctgcatgatc gcgagcctgg tgttggtcgc     86040
     ggggctcgcg ctcaagcagc cgacggcgct tgtcatacgc ggatcattga tcgtcggcgc     86100
     gggctgcttt gcaagtggcg tgatgctgat cggcctgtcc gggctcaccg gccatctgct     86160
     ttcgatctac cggcgatgga ggcagcggtg agaggcattc tctctggctc gcccgcgccg     86220
     tccgcaatcc gccttctggt cggtagccat ttgctgcttt tgatccaggc cggactggtc     86280
     ctgaacagca ggcagcccct cgacaggatg ctggcggcgc tcgtcctgat gctcgccatt     86340
     gtcgggctcg ctgcgctcat cgccgcgatc atcggtgagc ctcgcgaaca gcactgtgat     86400
     ccgcgccgga gatatcgcca tgtccgctga tcctcctatc ctgtctgcgc gcatcgcctg     86460
     gtttcaggca ggcaccgtcg ctatcctgct gatcgcgtcc atctttgtcg cgggcgcggc     86520
     gcatggcgag acatctacga tcgggcgcac ctggccgatc gcggaacctg atgcgctggc     86580
     cgagatcgag gcgaaggccg cgacattgcc tatggacttt ggcgctaaat tcgggcctcg     86640
     ctcgcgctgg tcggcgatga aatcagcgag ccttgcgcct gcgactgcag cgcgcgtgcg     86700
     caccctcgtg cccttctaca cgctcgacat ggatgtaacg ctgccggacg gtcgcgtgct     86760
     ctatcccaag ggcttcactt tcaacccgct cacctatgtc tcgctgccgc agcggctcgt     86820
     gatcgtccat gcacgcgagc ttggctgggc actcaagact gcagcgccga ccgactggat     86880
     actgctggcc gctggcggcg gcaccagcgc cgatcccatt gcgcttggcg aaaaggtcgg     86940
     acggccgctc ttcatcctcg aagagcgtgt gaaggaccgc cttggcctca cggtcgcacc     87000
     cgtgatcgtc cgccaggtcg ggcagaagct tgagttgacc gaagtccgat tggcgcaaac     87060
     ggggagcgcc gcgcgatgac ccgcctgaaa cgcctcttct gcgctggcgc tgcggccatt     87120
     ttgaccgcac tgctgccatc cgcgctcgca caggcctcat cctgccccgc cggcgcggtg     87180
     ttcaacccga tcaccaaggt ccgctggacc tgcatctttc cgatcacgat cggcggcgtg     87240
     cgcatcggca ccttcgacaa gctttcgaag gagctcgacg cgcagtcctc gtcgaagccg     87300
     ctttgcgcgt gccgcaaggg cgcgaccttc tggtttgggg tgaaagtaag cttctggtcg     87360
     cccaaccgca tgatcgacgt ggtgaccgaa ccgggctgca tgatggcctt gggcgccgac     87420
     ctgatgccga cgcatggcaa gctgcagggc agccagtcat cgatctctga cggcacgaac     87480
     acgcgcaaga tgttcgcgca gatgcactac tacatctctc ccgtctgggc gatgctcgat     87540
     atgttcaccg atcttccctg cctggaagat aatggatttg acgtagctct gatcaccgag     87600
     gtgctgccga cctggcagtc gggaaccttg ggagcgataa tccagccgga gggcattctc     87660
     ttcgggaacc cggctgcggg cctggcctgc atggcggaca gcgccgctgc ggctgccggc     87720
     aaggtcatcg atccgctttt ctggtgcatg ggcagctggg gcgccaccta tccgatcgcc     87780
     ggggacatcc atttcgatga ctcggtcgag gcttgggcag gactcgccgc gcgcggcacc     87840
     ttcatgatgg ggaggctcgg cgcagcaacg atcagctccg ccgacggctg ctcgttcaag     87900
     gcggcgccga tctggaccaa gtcccgctac aaatatcagc tgatggagcc ggtcaaaggc     87960
     ggctcctgcg tcaatgtcgg ccgcccgggt gcgctctggt cttcgatgaa acacgcgccc     88020
     ggcaaggaca atgcccaatt catggtcttc gaaaaggtga tctgctgcgc gggaatttcc     88080
     acgccatgag caggtcgcct tccacccgtt ccatgccagc ccggcccagt gcccggtctg     88140
     tccgccacag ccaggatggc ggtcgcgagc ggcgtggaat cggggcggtg tcctcaagcc     88200
     ccctggacgc cgtcccgccc ccggtcagcg cggtcgatcc tctcccgccg cggcaagggc     88260
     acgcccccct cgcccgcgtc gcggcggcgg ccgcgctgac caccctggac ggacaggcag     88320
     tgttccggat catcgggtcc gaggattcac ggctgcccct gggcgaaata ttccggctcc     88380
     ggcgcggcac ccgcgcgcac cggctcttct tcctggaagc gcggacatga agcgggtgtc     88440
     tctgatcgcc cttctctgcg cctgtgtatg ccattcggcg caggcgcaga cgctcgagga     88500
     tcgcgcacgc tcagcggcgg cagccgcgca ggccaagacc ggatcgagcg atgcgctgca     88560
     gcagaattat gtgacaccgg gcatgagcgg gcagccgatc acgactgtcg ataacagcaa     88620
     gagcttcacc ccgacgatca actgccaaaa gaccgcaagc ctgctcgaag tgctcatcca     88680
     gccttcctcg accggcgaca tcggtacagt ccgcatatcg caggacaccg attttgacgg     88740
     cagtttcgac aaatcaagca ccttgcccgt ccctgtgtca ggcatttgcg ccaatggcat     88800
     cgtctcctgc cagcccggca catggaatca gtgtcattcc ttcaaatggg acgtggacgg     88860
     cgccaaggcc ttgaagctca cggaagtcgc gatgcccgag ctggccggct gctactgtgt     88920
     caacaacagc tgcgggacga acctcgtctt cggcaatctt gccgaggtgc tgaaggacct     88980
     gggcggcggc atggtcggcg cactcacgac ggtcgatccc cggattggtg tcgcgcaggc     89040
     gcaggtcaac ggcccggtga tcgactatgt cggcgcgcag gcgacggcat gtgccgccga     89100
     tccgaccatc ggccagaccg cctatcgcgc gaaccccgcc gcgatccagg gcgacgccgg     89160
     gtcgatcgcc gccggcaaca gcatcttcca ggcgctcaag ggctcgccag ccgggatcgg     89220
     caaggccgag cagctgcgca gctgcacgat cgaacgtgaa gtgacgttga cctctgccac     89280
     tttcgacgac atcgtctcgg tgagtggcgc gttgcttggc gtttcgagct gcggcacgga     89340
     ttgccgccgc tatcggatcg gggggacagg caattgcagc gccgcacccc cgattttctc     89400
     cgcccgcttc gacattcaca aaccaggccg cgtcgtctcg gcgcggatcg tcggcatggc     89460
     tgccgaggac tgggtccagg gtcgggtcga tggcgcgatc gtcggctatg cgggcaagcg     89520
     gccttggctg accgaagcct tgccgtccgg cgattgcgcg gtcgacggca cttggggcaa     89580
     cggcgtggtc atcgacttgc tggacaagtt caaagcgggc ggcgcggtcg tcgcggccag     89640
     ggtgcgaggc ggcaaggatg aacgctgggg ttatgtcgat gtcgaggtga aggtcgacac     89700
     cagctgttca acgtcggagc gattggtcga tctctgtgct ggctatgcgg cagattcagc     89760
     ctgccggctc gacgatgaag atgtcgacgg tgtcgagacc ttccggaacg gcgtgggcac     89820
     cggccttaaa ccattgcccc agacccggct gtttggaacc gacagttgta ccgttcagct     89880
     cacgcgggat ttcttcaagc gcagtcggtc ctacaaatgc gtcctggata ccggcagcat     89940
     gcccgagccc gaccttagcc gcggtgccta cattatcgat cattcgaccg aaacgttgct     90000
     cgccgaccag atgaagaagc ctgacggcag cgtgacgcag acgagttcgc ccttctccct     90060
     tcccgaccgt ggatcggtgc ctgcttgcga ggcgatctgc aagacccggg ccccaaagat     90120
     gaataccgca gcggctcccg caggcgtggt ggcgacccag cagaacaatc cgatcggttg     90180
     ggacacgttc taccatgtct gcgaggtagc gaacgtttgc ccgacgggtc ccggcgagga     90240
     ggtcgtgagc gcgtgtggtt gcctcgacga tttccctgag gcggtcgtaa tgatgcagtc     90300
     tgttcgcctc gccggtgccg acatgacgtg cacgagtgct gtaccatgaa gcggccttct     90360
     ctcctgcgcg gcgcgctgct cggcgtatcg ctggcctttg cgggtggcat aaccggacct     90420
     gtccatgcgc agcagctttg cgctgtcgat ctcaatggca atggtgacgc tgccgatcca     90480
     ggggagaccg caagctgtct cggtaccgcg tcgggcggat ggcagtgccc gatccagcaa     90540
     gttgcctgca cggtggccgc gccaggtgtc tatgcctgtc cgctcgggga ccaatatgcc     90600
     tgcgaggcgc cggcatcagg cggcgcgccg acctgttcgc ccaatgcctg tatcgacggc     90660
     ggtgcgaacc cgatcgagga tgaacccgtc gtcgatgatc caggtgtgcc ggctgatggc     90720
     gagatcgacg ccgacggcaa ttgtacggcc aatatcgaga ttttctcagg ccgcgcggtc     90780
     cgctgccggc cacccggtct caaaaccacc ttcagcaact gctgcaagga caagggaaag     90840
     atcgtcaagg acggcatggg atcgtccatc tcttcgatcg ggaccaagat cgccatcgca     90900
     aagggcgtgt tcacgggtat gaaggcggcc tacacggcat tcaaagccgg agcgacggcg     90960
     agtcaggccg ccacgtcggg cgccaatgcg atcatagcgg gtatcgatcc cacctcaatc     91020
     gcaatcagcc tggcggtaaa tttcatgatc gaagtgctgc tccagggctg tgaccagcag     91080
     gacatggaga ccggcatgct gcgcggctcg ggcatgtgcc atgaggtcgg cagctactgc     91140
     tcatcgaaga tcctcggcat ctgcgtgcag aaggccaagg gtcattgctg cttcaacacc     91200
     aagctcggcc ggatcatcca ggagcagggg cggccgcagc tcaaatcgtt taatggcatc     91260
     ggttggggca cccccaagaa tccgatgtgt cgtggtttca cgccggagga gttccaggcg     91320
     ctcgatttca gcaagatgga cctctccgaa tattattccg agatccaagc ccgcaccgcc     91380
     ggtgagatcc aggtcgacat gaaggacaag atcgatgcct acatgcagac ggtcggccac     91440
     tgacgtgcgc ctgagaccga tagtcatcat gaccctatgg ggtttggcgc tgcctgtcat     91500
     ggtccaagcg cagacgcagc ctgatggcgc aaaagcgcag atcgaacagc aaggtgacgc     91560
     cgccgtcgac cggctcaagg gcgcgattgc tagacagaaa ccgcacgatg caagcaggac     91620
     gccaacaacg ccttccgagg cgacgccgga gacccgtcgg cgcgcctttg aggcgatgcg     91680
     ccgccgtgca ccggcacccg cgatggatgc gcgcgctcga tcagcgctcg aggctggtcg     91740
     cgcggacgta gcacgcgaac gcgaggcgat ggcgaaacgc ctcggccaag cgctcgggct     91800
     cgaagcgcct gacaccacgg cgcttgcaaa gactattgcg ccgcccgcga aggcaggctg     91860
     ggtgccggtt ctcttcgtgt cttcgtcgat accggtctcg accttgcgta cttatgtggg     91920
     acagctcgaa aaggcgcgcg gtgtgatcgc gtttcggggc atgccggggg gcctcaacaa     91980
     ggtcgcgccg atggcaaagc tctcggcaga aatcctgcgt atcgaccccg gctgcgaggg     92040
     accggcttgt gcgatgcgcg atatccagtt gatcgtcgat ccgatcatat tcagacagca     92100
     tggcatcacc cgtgtgccgg cactggccat gatccctggt gacccaacac agccctattg     92160
     tgagcgcgaa gacaatagtc cgcgtagctc gcacattgtc cagggggatg ccgcccttcc     92220
     cggactgctc gaagaatatg gccgcctcgg cggcagggag gaggtgcgcg atgctcaggc     92280
     tcgcctggaa tctcggtaaa agagcctggc cggaggtcaa gctcctgcca ctgcgggcgg     92340
     ccgtggcgct tggcgcttcg ggcctgggac agccgctgcg ccccgagcag ctcttcaagg     92400
     cttattgcat cgtgctgccg atcggactgc tcacctggtg ggcgatcccg caggtcacgt     92460
     gggtgatgag tccgtcgatc gacgcttggg cggtccgtgc ggatcccggc ccgatccatc     92520
     gcggcgacct tgtgtccttc atgctgtcgc atccactggc tggaccaaag cccgtcgcgg     92580
     tcaccaaata tgcgctctgc atgccgggtg atcggctcga catgatcgag aagccctcaa     92640
     tggtgcatgg gcaatgggat ggctggtatt attgcaacga caagctgctc ggtgtcagca     92700
     agccgatagg ccgcaacgga cagcacctcg agcatttccg accgacgcag cgactgattc     92760
     cggccgggtt catattcgtc ggctcgcgcc atcccagcgg gttcgacagc cgctattatg     92820
     gcccgatttc gatcggacgg ctaacgcgaa tggagcgcgt gctgtgaagg ggagcgcgat     92880
     cgtcctcgcc gctgcgctcg gacttgcgcc gctgtcggct tccgcgcagg cgcagtcaga     92940
     ccccgcgcgt gagggctatt ggtggtatgc accgaagcct gagccggccg aacccaagcc     93000
     ggccgaggaa gatgcgttgg tcaagccggc gatcccgccg atggcagagc ttgcgacatg     93060
     gacaccccct aagattcgca agctcattga acagcagcgc gactatgctg caaccgtgct     93120
     cacggtcgat gcagtcgccg acttctggcg gctccaggat tttgcacggc gaaaagccag     93180
     ggcgttcgcc ggcgtcacgc aactcgcgat gctgcagcat cccgagctca actcgaagtc     93240
     cgccaatccg atggtcggcg atgcacgcga tcaactgctt gcctacaagg acgacacgcg     93300
     ccgccaatat ctgcgggcgc acgccggtga gttcgcgctg gtcatgttca gccgcaccac     93360
     ctgcggttac tgccgtgtcc agtggccgat cgtccaacgc ttccaggacg agatgggttg     93420
     gcaggtgacg ctcatggaca tcgatcgccg cccggagctc ggggcccgct ttggggtcga     93480
     ggtgaccccg accacgatga tcattcgtcg gaacagccag cagcgcatga tcatcgcaag     93540
     cggcgtagaa gcctatccga atctcgcgca gatggcctat caggcagtgc gccttctgac     93600
     cggcgatatt cggcccgagc agttcatgac cggagccggc gaggaaggtg gtttctttga     93660
     cgctctgggc ctggggcctg tctcagcaag cgatccacga gccgcagaag agatggtcgg     93720
     tggcaatctc atcagctcgc cgccggacca gaagccacga tgaatcgggc agactatgag     93780
     cgcgttgatc gcttctcccg actacttcgg tgggcgcgcg gcctcgccat tcgcgcgaag     93840
     aagccgcacg gcttttttgt cgaagctcac gaatgcctcg gcgccaagcg actttcccgc     93900
     tgcggcaatc accccatccg cgaaatcccc accggcatcg agcatctgaa gacctgcatt     93960
     aatggcgata tgatctgcgg ctacgttgct cgcctcaagc aacttgcgga tcgaggtagc     94020
     gatatcggcc ggcgccagtc gataattact cgagagcacc caaccgaact cgcacaacgc     94080
     aggcagagtc aaagccacga gagcggcctt gtcgagttca tgttcggctg cttcggtctg     94140
     acgcacgtcg tccagaacga tcgcgcggac aagcagattt gtatcggcgg taatcttcac     94200
     agctttccgg cccatccttt ttcgatcgtc tcattcatgt cctcaatcga gatcgtcggg     94260
     ccgtcgtgct tgaacagccg gaaggcatcc gagattttcc cagtcgcctt cgtcgcagta     94320
     attttgatgc ttccgtcagg caacttgtcg atattgatcc tctcgccggg atgcacgccg     94380
     aggtgctgca tgaactcctt gcgcagtgtg atttgtccct tggaggtcaa ggtatacgca     94440
     ttcatcgcgg cactccttcg gccaaagttt gtaaggggaa accaccttaa agtcaacgtc     94500
     tgcactgcta tcgttaaacg gctcgacctc gtcgtggctc ccactgcagc gatccatgtt     94560
     aatgtccagg acgcgcctac caacggtgac gtttcggatc gtgcttcagg atcgccagcc     94620
     aagctcaaac atagccacgc gaccgtctac gaacgaggag accggctatg agaacgcctc     94680
     tccgattcct tcttggaata ccgggaatcg tgattggcgg gctgactgtc gatcccgccg     94740
     gcgcacagca ggtttcgcag gatgcatcgc ggcgtgctgc gatccacccg gtggccgatc     94800
     ccgcggcaat gcaggcctgg ctgtcgcgcg tccccctcac ccgcgatttc ccaccggatt     94860
     ttagtgcgac gctgaaagga gatgccccgg cttttgtcgt ggaaatgacg acttcgcctc     94920
     aatgcgcgcc ctgcgccgac ctgtgggcca aactccagat cctgcgccgt cagtacggtg     94980
     tgaatgtcgc tgtcctttcg cgcgaggagg cgatcgtgcg atctggccgg ctggggctcc     95040
     cctgggtcgg acatcccgtg gcgtgggtgc gagccaccaa cgatcccaat cgcgtgatcc     95100
     cgatcgcgat cggaaccgac catagcgtca atctcgcgcg gaacatctat cttgccttca     95160
     agatgatgac cggtgtgagg ccggacgtcg gcgtccgtgc catggccaag ttcaccggca     95220
     ttgtcggcat cgcagcatca cctccaccct attcgaaggg gaattgagca tggcgggctc     95280
     actcctctcg atcgcagctc caacccgagg acatccgcca tgtctcgctt attgtcgcgc     95340
     ctgagtatct cgctaattgc cgtggttgcc gcgtgcggca caaccgtccc cgcgcatgcc     95400
     cagagctggg ccgagagctg gttcgacaat gtcacctata ccagcccggg aagcttcgag     95460
     gatcaaaccc ggggctatct gaccgccggc gggatgtcgg gacgcgtcga cgtgcacaac     95520
     gactatctca tgtcgctgag cctgcccaag gtgaaggcag ggtgcggcgg catcgacatg     95580
     ttccttggcg gcatgagctt cctggacccg gactatctcg tccagaagct ggagagcatc     95640
     ctgcaggcag cgcctgcggt cgcattccag tacctcctcg aaacgctcga cgagaagatg     95700
     ggcaacatca tttcgaagat ggaggcggcc accaatttcc tgaactcgat ccaggtcaac     95760
     gactgccgcc tcgccaaccg tatggtccag atcgccaagg gcgacgacaa tatgtccggg     95820
     atcatcgagg agatgactgg ataccgttcc gtcaagcaag gcttcgccaa gagctatcaa     95880
     cagagccgcg agaagatcca ggccaacaac aacaacccga ccgaagatct gaaggacgcg     95940
     ctggagaact gcccggcgga ggtcaccgac atcttccgta ccggctctct gctctctcac     96000
     gcggcctcgc gcgtcggcgc ggccgactgg gccgaggtca tgcgggcgcg ggtgggcgac     96060
     gtctatatgc ggtgggatcc gaacgacaag gttccgctct tctcggcgat ccccgcctgc     96120
     ccgcgccagg acaccgaatc cccggatgat ttcctgagcg gccgcgttca gcgccgcgtg     96180
     ctcaacatcc cggcaaccgg cgccgactgc tcaaacgatg gaggcaaggg cgccctggag     96240
     ctggcgcgca cgcgcatgga ttcgattgca accaagattc gaacgcgcgc ggcgctcaca     96300
     gccgaggaac gacagttcgt agccaatgtc agcacgctgc ccgtctaccg tatgctcgaa     96360
     tggggcgtcc gtcagggcgt ggcaggctcg gtaatcggcg ataccgacga attggtcgcg     96420
     ctcacccttg cctatcagat gctgaatgac ctcacacggt caatcgactt tgcgctgagc     96480
     aatgccgagc gcggcacaac ggctgcgggc gcggccgatg ctgccaacac cagcatttgc     96540
     cagactcgca tcctgaccaa ggggatcgag cagctgcgcg atctccgaga agaagttctg     96600
     cgccagcgcg cgcagatgcg acaatcgtac ctggcggcgt tgggagccgc gaacctgtcc     96660
     gccaattatg cgggcttgat gagacagcgc gatcgcgatg cccgcgacgc tgccggcgcc     96720
     gccgccgcac gggagcagtg agatgatgat ccgccgcctt atccgcgtcg cgcttgccct     96780
     cgcaatggtg ggcgccgcaa cgcccgcttt cgcgatcgac gccagcttct atacctatga     96840
     cgggtttgcc gagacggtcg atgcctttcg cctcgtcgca atgatcttcg ctgatccgcg     96900
     ctacgagacg ctcgtgatcg tgatcgcgac cgtcggcatc tcgctcggcg cgctgctggc     96960
     gagcgttcgc ggacaaggga tgggtctcgt cgccttcggt ttccagatgc tgatcgggat     97020
     cggcctgttc gtcggcatga tcgccaccac tgggaccgtc cacgtctacg acaaggtccg     97080
     caacgcctat cagccggtcg gtgacgttcc caatctgctg gtgttggtgg ccggcaccac     97140
     taaccttatc gagcgcgcgt tggtcgagac gatcgacgac aatacgctcg atcccaacat     97200
     caagatcgag tttggtgcag gcggacacac gttcgacctc ttcttcaatg ccgtatctcc     97260
     gcgcggccca attaccgaca cctttctcga cgcgacgatc aaggattatg tgcggcaatg     97320
     ctatcccgtg gcccgggtct ccgcagccta tggcgtcgat gatgataggc tgttccgaac     97380
     tgccaccgat ctgcctgcgg cgttcgcagc aatggccgga ccagcgacat tctcaaccgt     97440
     ctatacggcc gccgacaagg gcggaacgac ggtgagctgc gacgaggcat ggcagcatat     97500
     ctcgacagcc ctttcggacc ccgcgctgtt cgacgactac agccggcagg tctgcacacg     97560
     gaccggcttc gatgtgaccc agcccgacca gctcaatcgc tgccggagcc agctgggcga     97620
     aatgggcgac atgatgatgg gcactccgct ctctctccag gcgttcatga ccaatatcct     97680
     gctcggcaac agcgtcggcg acgttctctt cgaggatagt ccggcttctg cggccagggt     97740
     catggccaat cgtgccgtga tatcgaacgg ccttgccacc atgtcagtgg cgaacgaatg     97800
     gatgccaacc atccgtgccg tcgtgttcgg gatcatgttg ttcatgatcc cgatcgcgct     97860
     gctcttcatc ctgacgccga tcaacctccg cgtggccagc ttcgcgctcg gcctgttcgt     97920
     gttcgtggcg ctctggggtg tgatcgacgc cggcatctat cagctgacac tgggccgcgc     97980
     gatggatgcg ctcgccgaga tgcgctcgaa tgcggtggcg accaatgcgt ggctcctggc     98040
     gccgtcggca gcgcaaaagg cgctcgccat cttcggcagc ttcaggacag cagcggcggg     98100
     tctcgccggt gcctttgtct tcacggtgtt ccgtttctcc gggaatgtct tcacatcctt     98160
     caccagcgga tctctcggcg tacatggcca ggcgagcgcc gcggcagcac cgctcgccac     98220
     cggcgaaggc tatgcctcag ccctcgaggc gcaggcgtcc gcaacgggca cgatggcgcg     98280
     ccggaacgcc tcgtcgaact tcggagattt cggcgagcgc tcgacgttcg gagcaaatcg     98340
     aagctttggc gcagccggcg gtctgctcag cgagcgggca tccggcgttc cgggcgttcc     98400
     tgcgtttgga atgggcggca tcgatgccgc ccgggaattg ggcggcctga cccctgccct     98460
     cgtcaacggc gatctctcga acccggccgt tcaacgcgcc gtgcgcgcga acgcgacgac     98520
     ggccgccatc catcagttcg cggagaaaga cgcgctcaga tctctcggga atcgatattt     98580
     cggagagggc caggcgggcg agcgcgcttt tgcatcattc gcgcagaata tggtgcaatg     98640
     gcgggcgttc ggcgaccagc gtgcatacga catgatgctg cagggcgcga cacggcactt     98700
     ttcccgcaac ggttatggcg cggacgatgc gcagctaaag gcggctagcg tcatcagtga     98760
     ggcatcggct gatccgacgt tcgccaagct tatcgccaat accttcgatc aggaggcgat     98820
     gctgcaaaat gacctcacgt cagcgcaggt gcaggtaggc gcgatggagg ggcggcggga     98880
     ctatgcgggc gaccgggtcg cgcaggttga gcgcggcaat gtggctaccg agcaggcgca     98940
     ccgaaccggc agcaatgaag gtcagcgcaa cgcagcggcc atgctcggcc tctcggtcga     99000
     cgaaaccagc cggcgcatct ccttcatcaa tgcgctgtcg ggtgaagcgc gctcgtccgc     99060
     catcagccaa ctctcccgcg caacgggtcg caatgaggct caggtgatgc acgcgctgga     99120
     gagctacaat gcggcggtcc atgtcggaac cgcggacggc gctacagccg aggcggcgcg     99180
     tgaaggaacc agcgtctacg gtcggacacg cgaagcggcc ggctatgatt ttgcggagcg     99240
     cgccggcaag ctcgatgcac agcgcgaagt tggtcacgat ggaacgcgca acgcggcgcg     99300
     gatcggcgag caacgtcggc agtcggagaa tttcgggttc gccgagggag ctgaagcggc     99360
     aggtgtctca acacgcgagg ccgctcggct cgacagcttc atccaaacgc tgtcgagaac     99420
     tgccggcaac caggtcgaca tggcggaagg cggatctgcc ggcgtcgccg atcgcgctcg     99480
     gaacgagcgg cttacccgca tcgtggacaa tgagcgcctt acaagggctc aaggattgct     99540
     gcggagtcat ggtatcgatc tgacgaagcg ccagatcgcg atggatcaaa atggagactt     99600
     tagcctcaat ctgacaccgg aaactgcagc gcagatgtgg cgggccgggc tgatcaacca     99660
     ggaccagctt ggcgcggtcg ccaatggcgg cagcgcgcgg ttcagctttg ctcacaatga     99720
     tctgctcatc tcgagcagta cgggcttcca gcggtcggcg cggagcgata ccagcacacg     99780
     gttcgaggcc ggcaagcaag cgggacccga tacgatcgaa cattttctcg gtagtggcac     99840
     ggaaggccag gcggcgatgg cgaattggct caagggcggg ttcgagatgg atcgcagcgg     99900
     caactggcgg ctcaaaccac aggttgccga cacgttggaa cgcgatgtaa cggcgatcat     99960
     ggttcaaact ggttggcaac gctccttgtc tcgcggtgcc tcccatcaag ttacgaatgg    100020
     cgatgccgaa agcatcggaa ttagtggcgg agttggggga cgcggtagcc aaaccgccaa    100080
     aggaaaagca gggcaagcat ctgggaacga aggtggatct accgctagta tcaatttgca    100140
     aacatccgac ttaggcgtcg gctcgacaga tgcgcgttcg tccattgata tcgtgaatca    100200
     tgacgtacgc aacgctatcg caaatgctga acgagctgcc tcaaggtccc gcacaccgga    100260
     ggcggcattc agtagcgagc tgggtcgcgc gatcctcggt gctgacggcc tccgaaatcg    100320
     ttatttggat caagcggatg cggggcgtgg cccttgggac gcgacagcgc cattcacatc    100380
     gattgaacaa agccaaatct tgcgaagcgg gcgcttcact ggcgatcgaa ccaatggcct    100440
     ggaagacggc gatcctgaat ttaagcgccg ttaggaatgg ccgcgaacgt gctgattacg    100500
     ccatgcctca ctggccggat tgcatggaag gcccacaaat cgaggatcgg ctggattcgt    100560
     cgggtccata ttgcgcccga gaaatccgaa gccggtcgaa caatcatagg cccctgcgat    100620
     ccaaccttcg ccctcaccac gtggttggtt ggacagcgcc cacagccaac cgaaggcgag    100680
     gacggggacg atcaagaaag ggtggaacag gagcagcgcc ccaagaatcc agccttcata    100740
     ttgatcgaaa agtgcgtgcg agagagaacg gggaacgaaa gcctcttcga ggatgaaagc    100800
     gacccagaaa atggctgcgg tcttccacca aagcttggcg taccacggac gccacagcca    100860
     ctgggacagg cgcggtgcct taggctgcgc ctcggtcgga caatccgaag tcttaggtgt    100920
     cgcgccttgc gggtccatcg ccggctcctt tcagtcctac tcatagcact gaggctgtga    100980
     aaaaggaatc ggcaatgatt tccattatgg gagcgatggc cgccctcact atcgcggagg    101040
     tcaggcatga tccttcgtgt ttcccgctgc ctcgatcgag ccgttagcag cgataatgtc    101100
     ctgcctaatc atcggggaca gcatcgctgt ggggatcgcc ggggcactcg gtgcgctcca    101160
     tccgcatgat tgtgatgttc gcgctacggt tggtgccagt gtcgaagcgg taagtgccat    101220
     gcttcctcag cgccgctatc gatcagtcat cgtggctgta gggtcgaatg attcgacccg    101280
     cgagcttcga gtacgccttc cagatcttcg cgcgagactt ggtggggctc gggtgacatg    101340
     gatctatcca tatggtcgat cggtggcgtg ggagatctat gccgtcgcga gactgaacgg    101400
     cgatcgcgct ttcggctttt ggaacgtcgg atcgagcgac aaggttcatc cagccgatta    101460
     ccgcgcagtt atcaaaatgc tagggaggcc aaaatacatc agctgggagt tcgggcgaag    101520
     gtgatcatgc actgcaccaa atcgattgaa cagcaagaag gttccgtcgc cgaagcaagc    101580
     acagcggcaa tcttactcgc cgcggggcaa tcggtgcgat tcggcaaaga acacaaaatt    101640
     gccactgccg tgcgaggtaa ggcccttggt cattacgccg cgaagcgatt ggcagccata    101700
     ccttttgccg cgcgtttcgt tgtaacaagc aactcgacgc tgcaatggcc ccattttcag    101760
     gctttgataa acaatcgacc cgaggatggg attgcgcgct cgatagcctt gggcatagcg    101820
     gcagcccaca agcgcggtgt agaagctgcc ttgatcgcct tggccgatat gccatttgtg    101880
     ccgatcgttc atttccaacg attgttggcc caatataaag gaacgggcac cctcgttgcg    101940
     tcaggggttg atggaagccg gatgccccct gccctattcg gtgcggaatg gttcgagatg    102000
     ttgcagcaac ttaatggcga ccaaggcgcg cgtagcctca ttagccgtgc tacgttggtt    102060
     gtagctaggc ccgaagacct tgtggatatt gactccccgg cggaccttga acggagcatg    102120
     aagcatttcg attggtgatg ggccacttga agttaatcac gatttgagcg tggtgagctt    102180
     taggctctcg tcattccacc gagaggtaat agtaggactg ccacgaagtt catcgcggcc    102240
     gcgatgaaca aaaaagccgg caagacgagc ccgaggccaa tcacggccca agtcgcattt    102300
     ccttcagggg cgccggcctg ataatgaaac agctggagca ggccattgac gatcccgacg    102360
     gcgacggcgt agccaatgtt gttggtcatg gcgagcagcg ccagatgcag acttacctgg    102420
     tcgcgtccac tctcagcacg gtccaggctc gcgagggcga ccatggcggc gttgaggatg    102480
     aactgatagc cccggtgaaa aggccgacca agctgtaggc gatcatggcg gtcgttgcgc    102540
     cgccggacgg gatcgccgtg aacgccaggc tcgagagagc agcgcccagc atcgcgcaag    102600
     cgacgccgaa gcgcgtgccg cgcaactggc tgagccgtat caacacggga atgcccagaa    102660
     ccattccgag catgaagcac agcatgatcg tcggctagct ggcgccgagc cgaagatggt    102720
     ccgaaacgat gaagaaggcc cggggtcgcg tctcggttaa acatccgaag tatctcggag    102780
     cttttctttc gacacgattc gcagcctttt cttgtcgtag agggtcggga ctgaggttca    102840
     cgccgaacct tcagtctcat agatctgccg tgcgagtctg tggtgcgctc ggctcgcgcc    102900
     ttgccgtggg caacggaccc tgcctgactg gagaccgttt cgtcgaagct gatctgtgcc    102960
     tgttcccgac gctctacagc gatgaccccg tctactatct gcgcaagaag ctgaactgcg    103020
     ccgatgtcct cgattacacg acgaagaaca acgagttcgc gccagtcgcc agacgctaat    103080
     gcaggaagcc gcgaaatggg gctatacccg agtccggctt gaccaaagcg gctcagctca    103140
     atggctcttt gccagttgga acgcggagca agcagtgacg cgagagaaac gctgctccgg    103200
     taaggatcga ggccgtcacg gccacgaggc cgatcagttc gagcgttgag ccgtttgccg    103260
     aaaacatgat gccggcattg gctatggcgg gcgggtgaag tcgatccgcg acaaggacaa    103320
     tcagcagcgc aaagccgacg gcggccgcaa ccgaccatgg gcttatcggc aaaaaggatc    103380
     gtagcacgag tcccgtcaag gccgcgacta gatggctcgt gagcacacgg gcaggatagc    103440
     tcgccttgct cgcaggcgcc gtgatgatca cgacagcgct cgatatgagc gaagtcaaaa    103500
     ggatgcttgt gtcgacgacc atctgtccca ccaggatcgc caagccgacc agacacgcgc    103560
     agatcagcga aaggagtatg ggtcgcgcaa atgcaccgcg agacccgtcg ccttgagact    103620
     tcgcagagtc ctcgggcgcg ccggcggttc tgtcgcttgc ctcagaccga ctgtttccat    103680
     cctgatcacc tgagcagaac aagttcttct gccattgtcg gatgcaacgc catcgtgtca    103740
     tcgaagtgct gtttggtcgc accggcgcgc atggccacgg ctgcgatctg caggatctcc    103800
     ggcgcctcgg gtccgagcag atggagcccg atcacggcgc ctgacgcgcg atccacgatc    103860
     atcttgtaga aagcgcgctc gcatgatcct tggagggcat gcttcatggg gcgaaaatcc    103920
     gatgagaaga tatcgacttc gatgcctgcg gccttggcgg ccgcctccga gagcccgacc    103980
     gaggctaggg gcggatcgct gaatacggcc gaaggaacgg cagtatagtc gatgtcggcc    104040
     ggcctgttgt tgaagaagcg gtcggccagc gcatggccct ctcggattgc aacgggcgtc    104100
     agctgaatgc gatcggtcac atcaccaacc gcaaaaatac tcgccaccga ggtccgattc    104160
     tcggcatcga ccgtgacgcc gtcgttgggt ccggtcgcca ctcctacctc gtcgagcccg    104220
     agcgcagtga tgttcggcga gcggcccaca gcgaacataa gcgcatcggc cacaagatga    104280
     tctccgttgc tgagttccat ggcgatgcgg ccgttgacgt cccgctcggc gcccaccagc    104340
     gacgtgctga agaggagctt gatcccgcgc gcccggtaga tgtcgacgag tttcgccgtc    104400
     agctcggcat catagctgcg caggatcgtg tgcgtacggt tcaggagggt cacctcgctg    104460
     ccaagactgt tgaggatgcc ggcgaactcg atcgcgatat agccgcctcc aatgatcacg    104520
     atgctgcgcg gcaaggattc gagttcgaat atctcgttcg acgtgattcc atgctcgacg    104580
     ccgtgaacat caggaattgt cggctttgcc cctgaggcga tcagtatttt ctcagcggtc    104640
     aggtgcgaac cagcaacgtc cacagcattt gggccgacga tccgcgctcc gccgcgaaag    104700
     aggttgatat tgtgcgtgaa aagcgtctgg cgatacagcc cctctagcct ggagacttcg    104760
     gcgctcacat tgtcgcgtag aacctgccag tcgaacgtgc cctcggtgcc ggcccagccg    104820
     agtctttcgc ggtatcgccc gtccttggcg aactgggcac catagacgaa catcttcttc    104880
     ggcacgcacc cgcgaatgac gcaggtgcct ccgacccgcg acacctctgc aaccgcgacc    104940
     cgcgcgccag cagccgcggc aaccctagca gcacgaatac ctcccgaacc cgctccaatc    105000
     acgaagaggt cataatcgaa ttggggcatt ctgttttcct gttctagcga ttggagctcc    105060
     gaccgtcacc cttcgcgcgg cgcgcggttc ggaagtctcc ccgggtaggt cgcggccgag    105120
     ccttagcgat cagagccgac tcgcatgcca attcagatgg tcttccatga aggtcgagat    105180
     gaaataatag ctgtggtcgt atccggcgcg caggcgaagc tcgagctcga tgccagcgcg    105240
     ctcgcaggcg ccctgaagaa gctcggggcg cagttgtttt tcaagaaaac tgtcggcttc    105300
     gccctggtcg accaggagcg ccggcacccg agcgccgtcc tcaatcaaag cgaccgaatc    105360
     atgtctgcgc caggcagctt gatccgcgcc tagatatcca cccagcgcct tttgtcccca    105420
     ggggacttgg gagggtgcga cgatgggagc gaacgcggat acggctttga accggctcgg    105480
     aaaactgagc gcaatcgtga gcgctccgtg cccacccata gagtggccaa ggatcgactg    105540
     tcgatccaga tcggccggaa aattcgcgcc tatgaggcag ggcagttcct cggtcacgta    105600
     ggtccacatc ttgtaatgct gtgcgaaggg cgcctgcgtt gcatcgacat agaatcccgc    105660
     gcccagccca aagtcatagg ctcctgtggg atcgtcggcg acgtcttcgc cgcgcggcga    105720
     ggtatcaggc gcgacgaaga tcaggccaag atccgcgcac gcccggcgat actccccctt    105780
     ttcggtgacg ttcgcgtggg tgcaagtcag cccggagaga taccagacga cgggcaggct    105840
     gcttccgggc gcatggaccg gcacgaagac agagaatgtc atctccgtcc ccgtgctggt    105900
     cgaggcatgc ttgtagacac tctggacacc gccatggctg ttggtggtgc tgacttgttc    105960
     gatcatcaaa tgtcactctc cagccacggt cgaaaatgct cagacgaagg tgtaggcgca    106020
     caccttgttg cccgccgggt cgcgcagata cgcggcatag gcgttaggca gatggccacg    106080
     cggcccgggc gccccctcat cgacgccgcc cgcggcaaga ccggccttat ggaacgcgtc    106140
     gacatcggcc tggctcgatg ccgcgaaacc gacggtgacg ccgttgctcg atggggcctc    106200
     gccgttgccg ggcgtgagga tcaggagcgc gggcttgtcc ttgccgtaga gcacgatgtt    106260
     atcgccaaac gggccgaggt tcgcgacacc gagtggccgg agcgcggcat cgtagaaagc    106320
     cgtcgactgc gccagatcgc tggcaccgag acatgcgtgc gaaaatacac catcaccgga    106380
     aataactgcc ataataattc tcctttactt gaaattattg aattcttctt tgagtccctc    106440
     agtgagacgg cgtgtaccac ttgcgcgaat gccttcgcca agccacagtt tgtccccggt    106500
     gttggggctg atcgcgagcc gctccagaat atgctctggc ttgcgacatt cccggcgccg    106560
     ctccatctgc ccgcacgacg ataggatcga tcctgtgtgt tgcggcgcgc aacgaaacac    106620
     cgagcgtgtg gatttggccg ccatcagaaa accacgacgg aacgaatact ctcgccggcg    106680
     tgcatcaggt cgaagccttt gttgatctcc tcaagcgaga ggacgtgcgt gatcatcggg    106740
     tcaatctgaa tcctgccgtt catgtaccaa tcgacgatct tggggacgtc ggtgcgaccc    106800
     ttcgcgccgc caaatgcggt gccccgccaa ttgcggccgg tgacgagctg gaaagggcgc    106860
     gtggagattt ccttgcccgc ttcggcaact ccgatgatga tgctcgtacc ccagccgcga    106920
     tggcaggctt cgagcgcctg gcgcattacg gtcgtgttgc cggtgcagtc gaaagtatag    106980
     tcagcgccgc cgtcggtcag ggccaccaga tgcgcaacga tatcgtcggc gatctccttc    107040
     gggttaacga aatgggtcat gccgaacttg cgcccccatt cttctcggtc gggattgata    107100
     tcgacgccga tgatcatgtt ggcgcccgcc atcttcgcgc cctgaagcac gttgaggccg    107160
     atgccgccga gaccgaaaat gatgacattg tcgccgggaa cgaccttcgc cgtgttcacg    107220
     actgcgccga cgccagtggt gacaccgcaa ccgacatagc agctggtctg gaacggcgcg    107280
     tcttctcgga ttttcgcaac cgcgatctcg ggcaggacgg tgaagttgga gaaggttgag    107340
     caacccatgt aatggaagat gctttcccct ttgtagctga agcggctcgt cccgtcaggc    107400
     atcaggcccc tgccctgcgt ggcgcggatc gcggtgcaca ggttcgtctt gcctgagagg    107460
     cagcttttgc actgacggca ctcgggagtg tagagcggga tagcatggtc gccgggtttt    107520
     aacgacgtga cgccggcgcc cacttcgcgg acgatcccgg caccttcatg acccaggatg    107580
     ctggggaaga tcccttcgct gtcgtagccg tcgagcgtgt aggcatcagt gtggcagatg    107640
     ccggtcgcca tgatctccag caggacttcg ccagctttcg gcccttcgac gtccacttcc    107700
     acgatttcta atggcttttt gggttcgaac gccacggctg cacgcgattt catacacctt    107760
     atctcctagt ttcgatgagg aatattcgcg ctcgcagcca ttcggaatag ctgttacggc    107820
     aagacattat tccagattag gcataatcaa atgacatcag aatgggatgg gattgaggag    107880
     tttctggccg tctatgatcg cggccgcttt gcgcccgctg caaagtcatt gcgcaagtct    107940
     ccgtcacatg tgagccgggc gatttctaga ctggaggcgc ggctcggcga acggctattt    108000
     caacgcaaca ccaggatcgt gaccccgacc gagttcgcgc acgcttttgc ggaccgctgc    108060
     cgacacatgg tcgaagacag gattgaggct ttcgcgttga gcgacggtca ggggccgccg    108120
     cgcggcgcgc tgaatgtgac gtgctccatt gccttcggcg agcgcgttat tgcgccactc    108180
     atccgccact ttgtcaaaca gtatccgcag gtgatcgcga cattggatct caacaaccga    108240
     gtagtcgatc tcgtcagcga gaattacgat gtggcgatcc gcaccggcca tctttcggat    108300
     tctcgattga ttggtcgccg gatagggtca cgaaagcttt atttgtgcgc gacaccggat    108360
     tatctggaga agcacggcgt tccctcggac atcaatgatc tcaagtatca tgcctgtatc    108420
     caggggaccg cggacgtctg gcacttcatc gttgatgata aactcgtcga ttttcgtccg    108480
     aagggcccct tgcgcgtgaa tagcggcacg gccgtcgccg acgcggcgct cgccagcttc    108540
     ggcatctgcc agcttcccga tttctatgtt gagccgtaca tcaattcggg ctcactggtc    108600
     tcgctgctcg agacgtcctc cgtcccggaa gaaccgatct gggtcgttta tgcgcatcgt    108660
     caacatctgc ggttgagcac aagattgttc atcgagatgc tgcagggcgg cgtcgctcgc    108720
     aatccctagc gtcgattgcg ccgccggaac cgaccctaat cggctcaccc ccaattctgg    108780
     cactgtcagt ttcgccgttc ggtagcgcgt cgaaaatttg ccggcgtcat gccgttgaac    108840
     ttcgtgaaaa cgttcgagaa atgctgttga tgtgagaagc cgcacgcgaa cgcgatctgg    108900
     gcgatgggct gactggtgcc gcgcaagagg tgctgggctt tctccacgcg tcggcgaacg    108960
     atgaactgat gcggtgtctg acctgtcgcg actttgaaca ggcgcaagaa atgcgaagga    109020
     cttaagccgg caacgttgct caatcgcggt atggcaatct cgcctgcgag attctcgtcg    109080
     atgaactgcg tcacgcactt gagcttgttg ggtgcaagac ccctctgatc ctggggatcc    109140
     tcctccctta tgagcatgtt ggactcgatc aggcgggcgg cgatcgcaca tgccagccaa    109200
     tcgacataga cgtgagaggc acggtccttg cgcgaggcga gccggcgcgc ttccagtgcc    109260
     aactgctcga gcagttcatc gtaaacgccc aggcgtggtt cgagcacaag atcgatgccg    109320
     tcatatccca tcgccagccc tacctcttcg acgagcgaac gccgcacata gagatgaaga    109380
     gtttccaccg gcgcatcgac gctgatctga aacccgtgcc cggctggcca gacgaacagg    109440
     ctacggcggg gaatgaccgc gcaagccgtc atgttgtcgg cttcgagctg gacccgcgcc    109500
     ggatcgctga gatgcatgac gatcagatga tcattggtcg cattcacctc cgcactgaac    109560
     ggcgcttcat cctgctcgga gagaaagagg cttgaccatt ccagttcggc gctcgagcgg    109620
     cgcaccctgc agcccggcag ttcaaagatg ccgtgggtct cgcagagcgt gaaagggctc    109680
     aacggcgcgg ggggcggcgc gagcatgctc agaccttcgc cgcatgcagc ggcaacggag    109740
     gatgtcccct tttgactggt tcgattgctc tctccatggc cctgcctttt cgttttctct    109800
     cttctacctc attgcggacc atcgcaacaa gcgctgcaac atcatcccgc gaggttcctt    109860
     cactccgcta aagatcaaga acgagccgaa gtgatcgcgc gcgcgagcag catggcgtaa    109920
     actggtcgtt cgcggcatgc tcctggtccg tcatgaagag gtctcggtgg tccggctcgc    109980
     cgcgcagcac gcgtgtgacg cacgtcccgc atatgccttg ctcgcacgac accggtatat    110040
     cgatgccgtt cgcggcaagg atctcaagca ccgtcttgtc tggcggtatg tgaaaagtct    110100
     ggccggagct ggcgagctcg acttcaaagc tttggtcctc ggcgctcgtg gtcgccgcgg    110160
     ccgcaaaata ctcccggtga acgcagctac cgctccagcc gagctgactg gcagcgccca    110220
     aaacgaaatc gaggaaaccc gacggaccgc acgcataaag atgggtatcg gcactgggcg    110280
     atgccaagat ggcgttcaca tcgaggcgtt gctcctctgg cccatcgtcg aaatgaaaat    110340
     gcgcctgttt ggagaaatgc gaggacgaaa tccggtcgag gaaagccgtc cgcgatcttg    110400
     agcgcccaca ataatggagt tcaaacggcg catcgatttg cgccagtctt tcggccattg    110460
     cgaggatcgg cgtgacgcct atgccgccgg cgaacaagat gcttcggcgc gcgtcgcgcg    110520
     caagcgcgaa caagttgcgc ggctggctga tggtgagggt gtcgccctgc tgtactcgat    110580
     catgcatgaa agccgaccca ccacgggtgt ttggatcgcg gagtaccgcg atgagatagc    110640
     ggtccgtctc accgggcacg ttgcacagcg aatattgccg cacgagtccg ttggccatgt    110700
     tcacgtcgac gtgcgagccg gcgctgaaat ggggcagcga tgagccgtcg cagttcttca    110760
     gctcgaagct cgcgatatca tccgcctcaa gggtcttttt tgttacgcgt acttcgagaa    110820
     gtgtttgatc catataagaa atccatgctc gtcctggatt cgagcgctgt tgaatggtct    110880
     cggccctgcc ggacgacgcg ttcagggcat ggaccgcgtc gcttgcggac ggcgcggtgg    110940
     ttgcctttag gcgttgctca ggagatggat gacattctcg ctcggcggat ggccgggcca    111000
     ctggatgatc gcatccttga cggagggccg cgcgaagagc cgattggcat aggcctcgac    111060
     acggggcttg cctgcaccgt ctttccagaa acccgaatag ccgagccaga ggaagcggta    111120
     gagactgacg gcccagaaca ggtcggcgag cgtgaagcgg tcgccgaaca gccaaggtcc    111180
     ggtggacgcc ccgaggtcgc gatcgagatc ggtaaccagc tgctccgcct tcgagatggc    111240
     ggtccgcatt tgcggctcgt tgatgacgaa cgaggcggcg gcttcctcct tcacaatctt    111300
     gtgttggtag gcttcgagga gaagcgggtc gccgtccgcg agcgggatat tgcggcgcac    111360
     ggcgtcgatc ttgtgtgcgt ggatgccggg catgaccgcc tgcatgcttt cgggccgacg    111420
     atcaccgtcc ggatcggcgc cgtagagcag ggctacatgg ggcgtcgtgt cagcgagctg    111480
     gacctgcttg agcacagcct cccgtatgtc ggcgggcaga agatcggtac cgccggacaa    111540
     ggcgtcgcag aggtagaggc agattgcctt ggaatcggcg aggatccggc cggtctcatg    111600
     gtcgacgagg gtcggtacga cgagcgggtc gaacccttcg gaatcaacag acgactgccc    111660
     agtgaacgag ctgacaggac ggtgcttggc tgcggcttcc gatcgcaacc gcagccggac    111720
     atattgcgga caataattct cattctgcgg gggaaggatc gtcaactcgt tggagccgaa    111780
     ggtcacgccc ttctccatta gggtgccgcg caccttttgc gagcagactg agaacacgaa    111840
     gtggaacagt tcgaaccgcg gttcgaccgt cgcttcgcgg cgaaggaggc tcggtgactg    111900
     tcgatccggg ctaatcagag tcgattgctc aggcttgata acctcttcac ggactttcct    111960
     cgccagggtt tctgtatcag cgctcatatt tttatgatcc ttttgcctgg aactgagacg    112020
     ttcggggatt tttgcgggct aaatcgtcat gtagaatgag tgtgttccgc cggcggccgg    112080
     atggctggtg aactttcccg gcgctcctgc cccacgcagc gcgcaaggcc ggtaagcagc    112140
     ggcagtgcaa cataggtcgc ggcgggcacg acaagcccca cgaccaagaa ggagcgcagc    112200
     aaaacgggaa gatgggcaat ggtgtcgccc aagagaatgt tgacgagggc cactagcggc    112260
     gcgagcgtgg tgatcagcag caacactctg agatggcgtg tgcggagcga aggttggggc    112320
     gcagcgctca ccccttcctt attcagactt tgatgcgctg cgtcttgtct ctcgacgttc    112380
     gccccttgcc aggggtatcg ccgatcgaac ccgcccatcc gccattcaag aatgtcgatg    112440
     ctttgacgtg ccccggacac ggtcatgggg tcttcggcga tgaaggcccg ggctgcgttc    112500
     caatcgtcga catcaacgag atatgtcgat ccgaccaaat cgccgccttc ggcgaaggtg    112560
     gtccccactg ccaaaatgct tgcggtgtgc gacgcaagat aggcgcggtg tgccggtatg    112620
     gctgctgtgc gctctgccag cttttcaggc gagatggtgg ttatgacgga gaacagcatg    112680
     ggacgttcaa tccgtcagac ttggcgtgct ttgcggcacg agcggctgat gtcgcggccc    112740
     gcgcgtaggg accggcgggt tcagctcgaa gcgtgcgatc agggtgtctc gcaacaacgc    112800
     gatctcgtcc gccccaattc catggtcctt gatcggttga atatactcgc cgacatcagc    112860
     accagagagt ctaaagcgct cagctgtctc ccgcacatgc tctgccttga cccaatcgtc    112920
     gttcagacca cctgtgaata tcgccttgag accggtaaac cgaggctcaa ctggcgcggt    112980
     tgggagctca aaacccggga ggcttccggt cagcgagccc aggaacccca ttttcgcagc    113040
     gccgcaccac atgaagtgac tggcgaggca ggcaccctgg ctgaagccga ctatgccctg    113100
     acggtctagc gcgacccagg ctgcttccag ccgcgaggag atctcagcca aggcggtgca    113160
     ggcgtcagcc acagacctgt cgccgtctgg atcgaacccg tcatatttgg gcgagtacca    113220
     cgccccggcg ggcgcttgca gggcaagcca ggcgacagag ggcagatcga gctgtctcgc    113280
     aagttccagc atcgcttgcg cacgctggcc acggccgtgc agaagaatga tcgcagcatt    113340
     tgcctgttcg acaggcgggc cggtcacgat tgtcccatag ggtccttcag gggaaaacgt    113400
     catcgcggcg ctccagcaat atggcggcat agccggtccg caaaggcgac aggatgctgc    113460
     atcgcgacct ggtgcgcggc acccgtcaca acttcgaatg cggcacctgg aatgagagcg    113520
     gcggtcgcgc ggaccgcctc cggtggcacg gcggcatcgt tcgcaccggc tatgacgagc    113580
     gttggcgttt cgacctgcgg aagaaggctt ctcgcgtcat ggcccttgat cgctgcgaca    113640
     gcgccggtga atccggcaac tgtcgtggcc aagatcatcg actcagcaag atccagcaga    113700
     ccttggtcga ccgctccgga aaaccatgcc ggatacacga tcggcacctg cgtaatgagc    113760
     ccgccgctgc gcactgcggc cacccgcttg tcccagatcg gccaagctgg ctctggaacg    113820
     agagaacctg ctgccacgag tgtcagcgag ataagccggt gtcccgccgt ggcgccaaga    113880
     tattgcgcga ccatcgaccc gaccgacgtg ccaacaagat gaactcttgc aaacgcgagg    113940
     ttatccatta cattaagcac gtcggccgcc agttcggcta gactgtagtc gccggcactc    114000
     ggcgaactcg ttccatgacc ccgcaggtcc atcgtgatcg catatacccc tgaaggtaaa    114060
     cgaccggcca cgtcattcca ggaccgccag tcggccagca gggaagaaag gagcaggatc    114120
     ggctcaccgc tcggcaagcc agtggtatga acaccgatcc gcgcaccatt tcggctattg    114180
     actgcccgat gtcgccacat tctcttcacc cagcctgcgg agtcatcctt gcgatcaaat    114240
     gacgatcgga tcgttcatcg tccggaggag ctcgtccttt acaccttcga gctgcggcgc    114300
     gaccttgacc tcgctgccga gcttctcggg gctctcgtca tgggtgaaac caagcgtgac    114360
     cgaggcttcg aacaacacgc cgcccggcgt acgaacgtag atcgattcga agtagccgcg    114420
     gtgcttgcga tctgagaaat cggtgtagcc gaggccttcc acgtcaaatt tgagcgcggc    114480
     ctgcacgtcg aggtcggcga cttcaaacgc ggcgtgatga acttggcctt cgccaagcgc    114540
     ccaggtgccg ggcctttcgt cctcatcgat atagacgtct agcaccttgg ccgcaccgcc    114600
     attgccgaaa gcgtagcgct ggtaattgcc gtcgcgtccc tggggcttca ggttccaggc    114660
     attgcgcatg aaggagtcca tctcctcatt gcgatttagg gtggccgtcc agctgtgaaa    114720
     gccccgcagc gcgacctcct tgggcacata gggagagtcc cagggctcga actggccgtc    114780
     cgtgtcctgc tcgatgattt cgaagccgac accgcagtcg gggtgctcga acgacagata    114840
     tttctgcccg aaccgctcac gcacttccga gacggtcaca gcgcgcttta tgagatgctc    114900
     ctgccaccag gaaagcgtac cgacgggtgc gttataggaa accgccgata tctgccctgc    114960
     accacgcttt ccggtgtagc cagcctggcg aacggggaaa gtggtgtaca gcgtgcccgg    115020
     ttcgccaagc tcattgccga aatacagatg atagaccggc cgtgcgccgt cgtagaacat    115080
     cgtcttcttg acgagccgct gtcccagcgt cttgacgaga agatccacgt cgccttgcgc    115140
     ggatccggtc gcgacggtga tgtgatgaag tccttcgacg cgttcgggca gttgcatcat    115200
     gatcgctctc cactattttc tgcgattgcg gatcgtctct tcaaacctgc acaacgatcg    115260
     ctgctgcagc ctgtttgagg gatcagggag tatttgacaa ttggcggacc ttcatagata    115320
     caattcagat tgtgaatata gatgacctgg attttcggca cttggtgctt ttggatgcgc    115380
     tgttaaagcg gcacagcgtc agcgccgctg cacgagaact cgacctaccg cagcccaccg    115440
     ccagccatgg gctggcgcgc ctgcgcaaag cattgggcga cccgcttctc gtccgggcgc    115500
     gcgacggcat ggagccgaca ccacgtgccg aggcgatcgc cggggttgtt cagcaactgc    115560
     tggaactgcg tcgcgacctg gctgaaggcg ggcagacatt ctcacctgac cgtctcaagc    115620
     gcgaattcat cattgccgga tcggacatcg cccatcttgt cgttttgacg gcgttgcatt    115680
     cggcggcgcg gttcgaggca ccacacacca gctaccgcgc actcacgctg agcggcgatg    115740
     aaatggtgag cgcgctcgag accgggcatg tcgatatcgc cgtcggcgcc tatccgagcc    115800
     ttgttgccgg catcaagacg caacggctct accaggagga atatctgtgc ttcggaaagg    115860
     aaggtcatcc gttcatcaag tccggtgaga ccgatgactt catggccgca gatcatatcg    115920
     tggtcagcac caagggtatg gcccatgccc atcgtgccgt cgaacgcgct ctcctcgaca    115980
     agatccatcc cgatcggatc aggatcgtcg cgagcagctt tctcgtggcg ttggcagctt    116040
     gcttcgagtc ggaccttatt cttaccgctc cggctcgcgt gattggtcgg ctcgccgagg    116100
     tctacggact ccgggccgtg cggccgccaa ttcttatgga agcatttgag gtcaggcaat    116160
     attggcatgc gaggaaccaa gacgacccgc ctcaccgctg gttgcgacag ctcctgcaca    116220
     aggtgctgtc cgcgcggatg tgagaaagct gccatcgacc tagcaaagaa agcccggcct    116280
     aggttaaacc cgggccggac agataggagc atccggagtg ggatcagtcc gggtcgatca    116340
     gaatttaaac ctcaaagtcg cataatattc agacggcctg ttcggcaccg cgctcagcag    116400
     gccagctcca ttgagctgat tgacgccatt tgcgatgtag cgtttgttga aaacattgtt    116460
     cccgccaatt gcgagagacc agtcgtcgcc gggcgcgctg tacgtgagcg aggcattgac    116520
     gaggctgaca ttcccactga acaactcggg cgtgttttcc gcatccgccg ccatggtgga    116580
     cttgtaggaa taatccgccc gcagtgtgac ccgaccttca ttggccagga aaacgttgaa    116640
     ctcgggagat agcgtcgcgg tccacttcgg gacacgcggc agccggctcg ccagcgtgat    116700
     cgtgcccgac ggatcgttga tcctccgata gtaagcgtca atgtatcccg ccgacgcgct    116760
     cacgcggaag acgcggctcg gcgcgaagat cgtctcgacc tcgaaaccct tgattctggc    116820
     gttgccggcg ttctcgaagg aggcaccgat gccgcgctgg atctggatct ggatgccctt    116880
     gtagtccgtg tagaatgccg cagcattgac ttgcagcatt cgatcgaaaa gctgcgactt    116940
     gaagccgatc tcgaacgtgt cggctttctc cggattgaag ctcggcgcct gcttgtccgc    117000
     aggcttggtc ggatccggcg ggaccggagc ggcgacgcgg gtcgtccagc cgcccgactt    117060
     gaaccccttc gagaatgatc cgtacagcat tatccgctcg gtcggatgga gttcgatgcc    117120
     gacgcgcggc gaaacattgc tgaacgagag cttctgctcc cctgtcgggt agaattgcga    117180
     caggtctgtc ggatccggga acagaaatgc cggagtaccg agtttggtga gaagcatatt    117240
     gaggtcccgc tggcttccaa cgagcgtctt atcttccttg gtataacgtc cgcccagcgt    117300
     gatcccgatg agatcgttca cacggtagtt gaggtgcgtg aagagcgcgt aggacttggt    117360
     gttgaaccga tagtttccga cgatctgcaa cagaccgccg ggaaatgcga catcctccga    117420
     ttccctacca ccttctgaga aataatacgc gccgacgaga taatcgagtt tgtcattgaa    117480
     cgccttgccc gaaagctgca gctcttcgct gaactgatgc tgcttcaccc ggaatgagcc    117540
     ctcgaacccc acgaccggtg agttgtcgag atcctgtccg aaacgggtgt cgagattgcg    117600
     ataggcggtg atcgacttca aggcaggtcc acccaagtcg atatcgacgg tccctgtgaa    117660
     tccgaaattg cgcgtgttgg taaaattgat acccgtgccg taaccacggt tgaggctacc    117720
     ggtaacgaag cggttatcga tcggaagccg actattggtg ggatcggcgt ccgcgttcgc    117780
     gccggcgata gccgggaggc cgcccgcacg cgggccacag gcgccgccga gaccaatcgc    117840
     gccgagcact gactccggaa ggctgatgca ggtattatag aggtcggcca aagtggagtc    117900
     cgggacgccg tttccgtccg catcgactgg cgttccggcc ggtgacaaca cagttgaccg    117960
     tgtaccgaga agagtgcttg gcgaagcgct cgtttccgag ttgagatagt cgccctccag    118020
     cgtcacatcg atcgcattgg tcgcgttcca tagcaattta ccgcgaacgc cctgttcgct    118080
     gatgccgcct gctgcggtcc gcgaggtata atcgatctgc tggaaggctt ctgaaggatc    118140
     cgaagcaaag cctgcagctc cagggaacgg gatccgtttc tgccaagcgt tccggttctt    118200
     cgacgagaag gcaatgctgc tcttgagctt gccctcgacg atcgggatgt tgatgacgcc    118260
     accgacatcg attcggttga agcgaccgcc cgagacctga cccatcacgc tgaaatcgtc    118320
     tgtcggtttg cgggtgacga cgctgatcgc gccaccgatg gtgttgcgtc cgaacagcgt    118380
     accctgaggg cccttcagga tctcgatgcg ttccacgtcg agaagatcga cattcgaccc    118440
     ggcggtacgc gcgaggtaga caccatcgac ataggtgccg acgcccgggt cgaagttgag    118500
     tgcgaagtcg tcctggccga tgccgcggat gaatccggac aacatcgatg gcgaactgaa    118560
     aatctgcgac gtggacgata gctgcacgcc gggggtgagg ttcgcgagct gcgaaacatt    118620
     gtcgacgcct ttttcctgca gggccgcacc ggaaaaagct gcaacggcaa tcgggacctg    118680
     ttggacattc tccgcgcggc gctgcgccgt gaccacgatg tccccgatgc cgacattgga    118740
     cgcggggtct gtgctttccg cctgagcagg cgccacggct tgaggcagcg ccggagcaat    118800
     ctgtgcctca gcgggggcct gcgcgtatgc cggggtccag ccgagcgcac cagccgtgcc    118860
     gagcatcagc ccaattttga tgcggttttt catattgtac ctctccctcc ctctttattt    118920
     ttcgcaagct ggctggctgc tttggcagcc agtggcactt gcgcgctttc aaacagcgtt    118980
     aatgcaagaa gtcatcacac ctgactttca actcacgtgc agactggatc tcgctagact    119040
     tacgacagaa gcgacagtca gccaggaaac aggcggactg aatcctaagc gtccactgac    119100
     tgcttctgat cgctcgcctc ttcgccgttg gattgctcct gcgcgataag tttacgcagc    119160
     atgcgacgag cgcgcaccgc gccagcatcg ccagccagga gcacaggccg catggacatg    119220
     atgtcccgat cgccgacttg cgcctgttgg agagcgatca tcggcttgtc ctcttcctcg    119280
     aacgcatatt cgatgccggc gcgcaatttt gcggagaact cctcattgtc cggatggatg    119340
     tcgcgcccga aagcccagaa ataatgtgtg gtgtccggtg actccggcgt catcacgtgg    119400
     atggacgtgt gcatatgccc gtcctccttt ggcgtgccag gctcggcata atagctgagc    119460
     agcgacatcg acccgggcgc tgtccactga acgtccgtcc atgcgtcgaa gcgcttgcca    119520
     tgcgagttga acatgttgtt catgatgtcc gagatgaagt cgttaggatg agagacattg    119580
     ctccacaccg tgtcgccatc ctggaacacg tgcctcttgc cgatggtgaa ggccggcgcg    119640
     cttagaccag tatgcaggaa tgccgcatgg ccaaggtcga gaatattgtc ggtgaaaagc    119700
     tcataataac ccgagccgtg aatatgaccc ttcacgtagg tccagcgcgt gtcgtccatg    119760
     aagtcgaagt ttggaagctt tgcgggatcg gcggccttct gccccatcca cacccagacg    119820
     agtccgaatt tttcgaggac cggataggtc cgggtgaccg cggccttcgg gacgaccccg    119880
     tcgccgtgcg ggttgaagac acattgacca ttcgaattga aacgcaatcc gtggtagggg    119940
     cactgtagtt gatccgagat gatctttccc ttggacaagg gcgcgaacct gtgcgggcac    120000
     atgtcacgca acacatggag ttcaccatca gcggttcggt agatgacgag cggatcttcg    120060
     ataactttgc gaccaaatgg ctggtcgccg atctcgtcac tccacgcaac cgcgtaccaa    120120
     gtattccatg cttacaccct ctccggcgcg agctcgattg tggatccgag ttcgtgcaac    120180
     aaccttcctg tcgcccgggc cttgtcgagc gaaccaagcc gcatcgcggg cccgttctat    120240
     cggatttccg cgcgccacct tttttcagtt atcggacata tcacagcttc tgcattcgaa    120300
     agattgcgaa tttcagctct tttggtgcaa attctcgctt tgtttccccg ggccgatatg    120360
     ggacagatcg ttgaacctac aggcacttac cgatcatatt cgtcttcgga ggtctgcatc    120420
     gccgaaccgg gcatgacctt tggttagaac ccatcgctcg aagacgacgg tgagtctccg    120480
     gccgctccct atgcacatcg cctggactcc ctagcgcagg tcccgctggc gcagttcgtg    120540
     ggcgagtgtc cctcgaatgc gagcgccgga taccccgata ggatgaccaa acgagattcc    120600
     cgacccattg acgttgagcc gctcgtgcca gctattatcc gcactccgtc cccaagcctt    120660
     gactactgcc agaacttgcg gcgcgaaggc ttcatcgagc tcaatcagat cgatagcgtc    120720
     cattctctac gacgagaaga cccttccagg cgaaggggcc agatggaggg gtgccttcgc    120780
     ttgcccccgc ctatagtcgt tcgagatcgc gaacggtgcg ctcgttggtg acattgcccg    120840
     tgttgagcgc cgatttcggt tctagcagga taacgctgca ttcgtcggtg agcgcctcag    120900
     ggcgatgctc gatccccttg ggcacgatga tgaactcgcc ggcatccaga tcgatgtcgc    120960
     cggttcggag ccccataggc aagcgaccgc tgaccaccag gaacagttcg tcctcatgct    121020
     cgtggtggtg ccagtggaat tggccggaga atttcgcgag cttcacgaag gagtcattga    121080
     gttcgcccgc gatcttcggg ctccagtgat cgctgaagcg accgaacgcc tcgccaagat    121140
     tgattttgta catgtcgggt cccttgccta ttcagtccat gagagcgtgc gcgtccctat    121200
     ccgcttcatc gctcgatcga acactgcatt atcgtccagc gagcgggcaa tgacgatcgc    121260
     gccctggatg gcgagcacgg cgtcctcggc aagcgctgcg gccacgccat ttgaagcccc    121320
     tttgcgctgc agcgtcagct cgcgacgacc tacggtgacg cccgctgcca atcgatcagt    121380
     gcgcggccgg tcgacaagct ggtcacgacg ctgatccttg aagcgctgtc gcctgcggca    121440
     atcgatgtga gcctgcaggc ggccgaggat atcgaactcg aacgtcagca gcttcatgag    121500
     caatggaagc tgcgcctgga acgcgccggc tacgagacgg cgctcgtgcg ccgtcgttac    121560
     gaagcggtcg acccggataa ccgcttggtc gcccggacgc tcgagcgaga ctgggaatgt    121620
     gcactctcgg ccgaacaggc gcttcgggat gagcaacagc gtgccctggc cgaggaaccc    121680
     gagcatctca ccgacgccga tcgtgaagcg atacgacagt tagcgcagaa tatcccggcg    121740
     ctatggagcg ctgcatcgac gacgccacgt gaccgacaaa ccatcgcgcg catgctgctg    121800
     gaacgcgtcg aagttctggt tctgggcgaa accgagcacg ccgagctcac ctgtcattgg    121860
     tctggcggcg ttgtgaccaa acatgcgttc atccgacccg tgcggcgctt cgagcaactg    121920
     gagcacttcg acaaactact cgcccggatt acccaactcc gaacccacgg ggcgacggcg    121980
     cagagcatag cggacatcct gaacaccgaa ggttgggcgc cgcccaagaa ggacagcttc    122040
     aacgccccga tgatccaccg cctgcttcag cggtgcggac ttggcacgac acgcccgatc    122100
     tggtcaggaa acgtcccgcg ccaacatgat ggcgaggtca ccctccagga atatgccgat    122160
     cgcgtcggcg ctcaccgcca aaccgtttac ggatggctcc gtcgtggcca gatcaagggc    122220
     cgactcgtca aggttggctc ccagcgcatc tggctcgtca acgccgacga cacctcaaca    122280
     ggaatctgca ctggagagtc atcatgaaca cacgatcgag atgctgttcg cgcacctcaa    122340
     gcgcatcctg aagctcgacc ggcttcgcct tcgcggtccg aacggagccc gagacgagtt    122400
     cctcctcgcc gccaccgcca agaacctccg caaaatggcc aagcttcttc cgatgccggt    122460
     cccggcagtt gccgcctgaa gctcacgaaa gctgccgtcg cgctccggtc ccgctctcag    122520
     cttcgatctc gaacgccctt tttcaacgct atcgaccagg ctcggtcgtc cggcctcttg    122580
     tccgaaattg caaaggcgga cacgcaaggc cataccggag ggcgtgggac ggccccgatg    122640
     ttctgctaaa gggtcgaaat gctcatccgc catctcgcct atttcgtgac gctcgccaaa    122700
     gagaggcatt tcgcccgcgc cgccgatgcc tgccatatca cccaaccgac cctgtcggcg    122760
     gcgatccgca aacttgagga ggatctcggc gtaccgctcg tggcgagagg ccatcgcttc    122820
     accgggctca cgcctgaggg cgagaagctc ctcgcctggt cgcgccagat cctgaccgac    122880
     tatcagagcc tgatcaacga tctcgccggt gctcggacag gtctggtggg tgagcttcgg    122940
     tttggagtga ttcctgctgc catgccggct gtgtcgttca tcacggcgcg tttctgtgac    123000
     gccaatcccg gcgccacggt ttcgatccgc tcgctcacct cgcgcgcgat cgctgagggg    123060
     cttgacgctt tcgaactcga tggcgggctt acctatctcg agaacgagcc gatcgaaaat    123120
     gtccggcgtg tgtcgctcta tcgggaacgc tacaagctcg cggttccggc gaaccacaaa    123180
     tatgcacggc gaaaggctgt gagctggctg gaagcagcgg gcgaacagct ttgcctgctc    123240
     agtcccgaca tgcagaatcg cagaatcatc gaccgcctca ccagccggat cggcctcacc    123300
     gtgcatccgg cgatcgtcag caactcgttt ctcggggtct gcgcgcatgt gcgacagggt    123360
     ggttgggcga gtatcgtgcc gcacagcttc tttcatgtgc tcggccagca gccggacatc    123420
     gtcgccatcg acatcgtcga cccggtccac agcgaggcga tcggtctcgt aatatcggat    123480
     cgtgagccgc gctcccccat ggctgctgcg ctgctcgccg ccgcgatcga tgccggcatc    123540
     gaggaatctt tctcaagtct ttgatagaca tcgtctatcg atccttcgaa agctttcatt    123600
     ggatcgcaag caagccgagg atcatggtca acctcaccga cgcgtcgcca taacggcgct    123660
     atcggaagag gatgcgctga gaggctctgt tgcaaaaatc gtgaagcttg agcatgcttg    123720
     gcggagattg gacggacgga acgatgacgg atttcaagtg gcgccatttc cagggtgatg    123780
     tgatcctgtg ggcggtgcgc tggtattgtc gctatccgat cagctatcgc gaccttgagg    123840
     aaatgctggc ggaacgcggc atttcggtcg accatacgac gatctatcgc tgggtccagt    123900
     gctacgcccc ggagatggag aagcggctgc gctggttctg gcggcgtggc tttgatccga    123960
     gctggcgcct ggatgaaacc tacgtcaagg tgcggggcaa gtggacctac ctgtaccggg    124020
     cagtcgacaa gcggggcgac acgatcgatt tctacctgtc gccgacccgc agcgccaagg    124080
     cagcgaagcg gttcctgggc aaggccctgc gaggcctgaa gcactgggaa aagcctgcca    124140
     cgctcaatac cgacaaagcg ccgagctatg gtgcagcgat caccgaattg aagcgcgaag    124200
     gaaagctgga ccgggagacg gcccaccggc aggtgaagta tctcaataac gtgatcgagg    124260
     ccgatcacgg aaagctcaag atactgatca agccggtgcg cggtttcaaa tcgatcccca    124320
     cggcctatgc cacgatcaag ggattcgaag tcatgcgagc cctgcgcaaa ggacaggctc    124380
     gcccctggtg cctgcagccc ggcatcaggg gcgaggtgcg ccttgtggag agagcttttg    124440
     gcattgggcc ctcggcgctg acggaggcca tgggcatgct caaccaccat ttcgcagcag    124500
     ccgcctgatc ggcgcagagc gacagcctac ctctgactgc cgccaatctt tgcaacagag    124560
     ccggtgacgg aaactgcgcc gccgaagttg gaggcgctga tgctgcctgc cacttcgccg    124620
     ttgttggtcg ccgtgaagct gttggacgca ctggccgcgc cgacaccgcc gaagctcagg    124680
     ccggtcacat tgccatcatt gttgacgatg accgcgccat cgccctcgcc tgcagcaaag    124740
     ccgcccgcaa cgaaatcata accgatattc gcgccgctga tgtccgcgcc gttcgcgatc    124800
     gttaccgtca gatcaggatt ggccggcgtc gtaatggccg tggcaatgtc ggcgttcacg    124860
     gccgcgccgg tccctgcgcc gctcggtacg ttcacggtgg cgggagccgc caacgcgcca    124920
     ccggcgtttg cgagcaatgc cgccgccggt atggaagctg acaacagcag catccggttg    124980
     aacctcgaat tcttattcat tcaaaacccc tattgcctgc gcttctcagg tggattgggt    125040
     ggtgaacgac gagcagcagc gctgtacgga cgcaatcggc cgtgcatcga tactgtttgg    125100
     aacgccccca aacacctgcc gttgcgcaaa tgtgcgcaac attcgcaaac acctattcac    125160
     tgaaagcaaa ccgcgcaaat cttttttgca gcgcaatggc gtataaaatg acagaactgg    125220
     tcgtatgcaa gcttgatccg ctgcgcaggt gcgccatttt gtaaaagttt gcgcaaatat    125280
     gcgcttgctt atttgcgcta ttattatttg cgccgatgcg tcggaagcgc ataatgatgc    125340
     aggtgcggcg ggagggcgcc cggatcaacc ggccgccgtc gaatgtcgcg ctaaaaaaat    125400
     gcgggcgcaa acacatgtct tttgtcgatg aatgggatca ggatagagcc cgcaacctgg    125460
     ttggctgcct ggtcaaggaa accgggtttt cagcaagcca gattgcacgc cgttctggcc    125520
     tggcgccctc taccctaacc cggatctatc ctaatcctac cgtcggctat tcgctatcag    125580
     accgaagtgt cgccaagctc aaggccacat tcccagacgc attttccacc tgcgaaactg    125640
     gagcgttgcg gctgccatct ccagtatccg agatcaccgc taacaggccg ttgacgaagt    125700
     cggcggtggc tgattcagtg cggcagtggg attgtctggc gggttagcgg cgatggcgat    125760
     ggggcgtgat agcgaggtcc agtccgattt gatcgtgacg tgggcggaga taccgcgttc    125820
     accggggcat gttttctacg acaagctcca gaagctgctg gccgaggcgg gcttcgatgg    125880
     ctttgtcgag aagacgtgca agccctatta tgcgccgcgg atgggagccc cgtcgctgcc    125940
     gccgggccgc tatttccgca tgctgctgat cggctatttc gagggcatcg acagcgaacg    126000
     cgggattgtc tggcgctgtt cggattcgct gtcgctgcgg gagttcctgc gactgtcgag    126060
     ccgcgacaag gtccctgatc atagctggtt gtcgaagacg cggagccgcc tgccgcacga    126120
     ggtacatgac cagatcttcg gctgggtact ggccctcgtc gccgggcacg atctggtgaa    126180
     aggcgagcgg atcggcgtcg atggctcgac catggaggcg aacgccgcgc tgcgtaccat    126240
     cgtgcggcgt gacaatggcg agacctaccg cgagatgctg gtgcgcatgg cgcaagagag    126300
     cggcatcgac acgccgacga tcgacgacct tgtccggctc gatcgcaaac gcaagggcaa    126360
     gaagctgtcg aatgcggact gggcgagcaa gaccgatccc gacgcgaagg tcgcgcggat    126420
     gaagaacggc tcgacgcgtc tggcctacaa gcccgaacac gcggtcgatc tcgacacggg    126480
     tgttatcgtg gcagcgccga tccacccggc cgacaagggc gacacgacaa cgctcgacgc    126540
     cacgctggag acggcagcac gcaacctcgc cgacattggc ctggcgccga cgtccgggga    126600
     tccctgcgat cttgtgaccg ataaaggcta tcattcgcgc gagctcctca agggtctcga    126660
     cggcgacatc tggaagacgc gcatcgccga gccggcaccg ccgaatggat atctgcgctg    126720
     gcacggcgac gaggctgccc agaaggccgt ctacgccaat cggtctcgcc tgaaatccgc    126780
     cgtcggacgc aaggcgatgc gcaagcgtgg tgagatggtc gagcgtagct ttgcccacgt    126840
     cctggatcgc ggcggcatgc gccgcgcgtg gctgcgcggg cgcgagaatg ttcacaagcg    126900
     ttatttgatc cacgtcgccg ggttcaatct tggcattctc atgcgcgccc tgttcggttg    126960
     cggcactccg aggggcgcca ggggcgcatc caaggcattc ttgttcgtag ttcagaccga    127020
     tgttgcgctc gtcatcgccc tcgtcgccga gttcgacgga gaaagggcca tgctcctcat    127080
     cgtttttacc cctgaaggcg ctgacagacc cggctgaaaa ccgacttcgt caccgcgctg    127140
     ctaggtgatg cctattgatg cgactgcggc gcggatgctc ctgatctccg gccgtaagcg    127200
     gccgcgaacg cctcaactgc tgagtcgacc aagtagttga tttcgccgct atccggggcc    127260
     tcgcggacac agagcagaaa ctcgagccag atatccgcct ggcaaaggcg aacgaactga    127320
     gacgctgcga gtgagacatc tggaatcgcg aagtgacctt gctcgacgca acgatgcagg    127380
     aaagctgtga gcttatcgtg tgcggccttc gggccgccat cgtagaatag ctttccaatc    127440
     ttcgggaacc ggcttgcctc tgcgatgact aggcgcagga tcgccgagac ggtcggatga    127500
     gtggtcagct tcaaatatct gacacctagc tcgcgtagag ccgcggccgg attttcggta    127560
     tgttctggca gctcaaagac gaggttcgcc cgcgcctcga tttccgagtg catgaactcg    127620
     tcgaacatct gctccttgct atcgaagtag gtgtagagcg tgcctttcga gccggcccct    127680
     gctttcgcga tatcgcccat cgatgtacca gcgaaaccgt tctcgagaaa caatcttccc    127740
     gcgacattga gaatgtgcgt gcgtttatcg ctggattgct ggctcgccat cgtcattcct    127800
     gcgttttctc tgcccgacat agctccgctc caagccactg gctctgggat tcgtgtcata    127860
     ccgaacggtt cggttgacag cgtagtgggt tccatagcgg aacactcggt caatatgaag    127920
     cgagcggcgg gatgcacatt tcgtttcgtg ccagcttgcc gtgctggcgg gcgcacgtcg    127980
     aaatttcccg cgcgacgggg gcgcgcgcga gattgagctt atcggtttcc aggtttattg    128040
     gactggctat gccgaagcgt gggttgacgc cttcatgtgg tgatcgcgtg ctggatgcag    128100
     caattgatca gttcggacgg cacgggattt gcggtgctag tacgcgagcg atcgcggcgg    128160
     ctgccggaac tgcgatgtcg tcgattacct atcactatgg cggaaaggaa ggcatctacc    128220
     tcgctgcggc ctatcacatt gcagagcgct gtgagcgtgt gcttgctcca accctagaga    128280
     gggcaagcct ggacggcgaa ctggacggag aggcagctat cgagaagatc gatgaactcg    128340
     tcgtcgatct ccttcatctg atgctggatg accaaagtgc gccgtgggcg agattcattt    128400
     tgcgcgaaca actggagccg acggatgcgt tcgatattct ctactccgcc gtattggagc    128460
     gtgtgggcga ccggctgatt gacgtaatgg cgcagctcgg ccgggggcta tggagcagca    128520
     ccgaaattcg cctaaaggcc tttacaatcc tcagccaggt gcggatgttc cgtacggcac    128580
     ctgagatgct gcagcgtatg accggcctcg atccgacgaa gtcggagaat gcggacgcta    128640
     tcgaacaatt tgtgcgccgg atttgtagag caaccctgct ggcttaaatc gctatacgag    128700
     cccgcttcca ttcttccatt taaccggccg tcgattgcgc cgccttcgcc gggagagcgg    128760
     tcatgctcga gatagatcgc gccttcagaa tggttctgag gtcgtccgcg cgctgatgga    128820
     tgcgttggat taggtgtgcg cctcttcatg agtttggtca cgctcgatct tgttccgacc    128880
     tgcatgacat tgcacctcgc tctctgccgt ccgtgtcacg acttgtcgcg cgatcatcgc    128940
     gcgcgccgcg gacgaatctc tttacagtcg tgcgcgccct cagatcgagt tcagcaggcg    129000
     tcggaatccg gccgatctga aggacagctt gcaaatggac gtctccacgg agcatcgcga    129060
     ggaaccgccg ggcgccggct tcgcagtcga cgagatcaat gtggccgtcg cagacggccc    129120
     tgtccaaaat cctggatacg acagcgattg cgcgtttggg gccgtgttcc gcgtagactc    129180
     gtgtagcggc gggataacgc tccgcctcaa ggatggcagt gtagcagacc tcgataagcg    129240
     agggagtcat catcgcctcg agcaggttgc gcccgatgat cgtcagaagc tcctctaaag    129300
     gaagcgatag ctgatccgcg ctcacggcga gcgcgtcggc ggaatgctgg ctgatgactc    129360
     tcgtgaattg ctcgacgagg agatcttcga cattctcgcg acgggttgac gtctctctaa    129420
     gcaggcggcg gaagagcccg tggggtgtcc aggtccagct ccggcggccg aggacgaatg    129480
     cagtgagaac ggcgcaattc gaccagccgc ggagttggct ggcgtgtccg ggcaccgctt    129540
     cacgaaccct gagaatgtcg ccggtgccgc cccagcgcag gaacttgacg gcgtctgcgg    129600
     gcggcagaat tgtcaccatc atgcgcgtcc accacggctc aacgaggagc cagcttccgg    129660
     tgcttgttgg tcgcattgca tagacgtgct tgtgtttgct gagcacgaag cggtgccacc    129720
     actgcgactg aagcccggga acgaagcaga cgatccagtc tacgggcgga acggtaacga    129780
     gggagccgtt ctcgtcgatg ctgttggcaa ggtcgcgggg gacgcctggt accgccttct    129840
     gatggagggt aggatggtcc cggcgccgaa atcgggcggc tcgtacctgc gcggtttcgt    129900
     cgcttgggat cacggcgccc gcctccgctt gcagccgtct agaatgaggt ccacgctcgc    129960
     tgcgaccgct ccggaaccgt cgcatgcaga ggcggcggcg ggattcagca caagcgcctc    130020
     ataaagcggc tctctgagca tgccgagcaa ttgctcggcg gccagaccgg cctgcggaac    130080
     gttgaggacg cctgctctat gcgccttggc gaagaactgg cagagttcga aagcgactga    130140
     ggacggaccg gcctcgtaga cgcgctttct caggtcgggg ctgtgcgccc cttcagcgac    130200
     catcaagcgc acgagagcga tgatggatgt ggaatattct ttccatgcca aaatgccaaa    130260
     gttcgtcagg acacgacgcg caaattccac gtcgatgatc tgcccgcagt tgacgagagg    130320
     atcggagagc aaggctgcct tgcgctccgc gatcgtgacg aggagatcgt cgatgctacc    130380
     gaaggccgag aggatttcct gcttggaata ccctccacgt ttgaggacgg ggtcgatgcc    130440
     gttgagcgtc tcgctcgagt cgtcgagctt cgcgctgagc gtatgcagca tgtcatcctg    130500
     ctgtccgctt ccgcctgggg agtcctcggt cctttcgccg ttcatgccat gctccttccg    130560
     gtatagagag gggcgcgccg ccgacagtct tgagaagatg ccgtgtcgcc ttgtggcgcg    130620
     cggcgtgacg tgccgcgcta tctcgccgat ctgggcggct tcaaatcctg ctcgtctgat    130680
     caggtcatat tcatcagcat catcgggtgt tcgcaggtgc cttaggacga cgaagcgacg    130740
     aagagcctca agacgcggat ccgccagacg attggcttgt cgggtcccaa agaggattcg    130800
     aagacacctg cgcagcctgg attcgtccaa tatgcttgcc aagttgtcgg tcagggcgag    130860
     ctttaagact gtccattcga gtgatgacag ctcgctggac cttacagacg tctcttcccg    130920
     ttcgacttcc tcttcatcgc ctgctgcgaa actctcagag gaattgcgtg cggcgatctc    130980
     attgtcgttc gcgaccggac tgcgacacca aaggtagcaa cgccgatggc ggtcggaggc    131040
     cgagtcggat ggagcaccga catgatcgcc cggcggctgt tccgagtccg cagccattgc    131100
     tcaccgtcct ttgggccggc cggcgcgatc aatgccatag atgccgtgca ggaagatccc    131160
     gacggcggat gtcaccgctg cttcggcctc tgccggcgac ggcggaggcc gcagaccgag    131220
     caccacgcgc aggtggagat tgtcacggaa catgccgacg aaatggtccg ccgctgcgtg    131280
     acaatcatcg agatcgattt cgccgcgatc ccttgcctct gccaagactt ccgcaaggcg    131340
     gtctgaagct cggccaggtc ccttgtcgaa gaaatccttg gcgagttcag ggaagcgcaa    131400
     cgcctcaggc atgatcgagc gatagacccc gatcaggccc ggtgacatgt agatttcaag    131460
     caaacgccgg ccgaattcga gcagaacctc gttcaggctg cggccctcga atccgccgac    131520
     ggacagcgca gaaagcgcgg tgtcggcgct ttcagaaacg agcgcagtaa agaggccctc    131580
     tttgttcccg aactcattgt agatgttgcg ctttgagccc ccgatgcgct cgatgatcgc    131640
     gtcgatgctc gtcgccgcat agccctgctc aaagaagacc tgcgcggctg cttcgaggat    131700
     ggcggttcgc cggctatcct gggacgggcg cttcgcgcgg ctatcggcaa ccattggcaa    131760
     ctccgttcgc ttttccctct tgactggtaa tgtacgttac cttaccagtc aagccggtaa    131820
     cgagcattac cggcggtgga cgatgcggcg aatagcgatt cttgtgcttg tgggtgggtt    131880
     aggcggatgc gcgactgtcc cggacttggg acctcggcct gatccagccc agcccggcgc    131940
     ctttgcagcg acgcgctcac ttgccggtac gtcccaggcc tggccccagg acgattggtg    132000
     gcggacgttt ggagacacgc agcttgatac actggtgggg gaggccttgc agggttcacc    132060
     cacagtcgcg caagcagccg cacgcatccg gatagctgtt tctcaagcag atcttgcgcg    132120
     agccgcgctc ttgccaagcg tcggcgccac cgcgaccgcg cgcgactctc gtctcacgca    132180
     aagtatcgga ctccctactg atggcgattg gcactggctg ctagcgggcc tggtgaacat    132240
     gagttgggag cttgatcttt ggggaaagaa cagttcggca ttacgcgcag ccgtgtcggc    132300
     gagaacggcg gccgaggcgg atgaggcggc ggcgcgattg gccctagctt cagcggtgtc    132360
     cacggcttac gttgactttg ctcaactgct ggtccgtcgc gacgtcgccg cagatgcggt    132420
     ccgaatacgt cgtgagacac gggacttagt cgtgcggcgg ttcgatgctg gtctcgagcc    132480
     gcgcacatct gtggagcagg ccgaaggcgg tgtcgatgct gctgaagctc agctcgcggc    132540
     gatcaacgag gcgatcggac tcggccgaaa cgcccttgcg gccttggttg gcgcaggacc    132600
     ggatcgcgga ctggcgattg agccgccgtc gctgacgacg cggcgtcccg acgctctacc    132660
     cgcgaacatt cctatcgaac ttgtcggccg gaatcccgag gtcgtatctg caaggtggcg    132720
     tgttgaggct gcggctgagc gaatcggtgt agcacgcgcg ggtttctatc cgaacgtcaa    132780
     catcagcggc ttgataggcc ttgcgtcgtt cggactcgac aatttgttca ggtccgaatc    132840
     ggtgatcggt tcggtcgggc cggcgatcag cctgcctatc tttgacggtg gccggttgag    132900
     cgcacgatat cgcggcgctc gcggtgagta cgatactgcc gtcgccacct ataacgagac    132960
     gcttcttcaa gccttgcatc atgcggctga cgccgcgacg tccctgcgcg cgctgcgcga    133020
     acgagtggat cggaccaacg cctccgtcgc gcgtcaggag gcggcgtatc gcctcgcgaa    133080
     aatgcgctac gagggcgggc tgtccgacta ccagagagtg ctcatcagcg aggacgctct    133140
     tctgagtgct cgtgagcaag cggccgccct gcgtctacgg ggcttcatcc tcgacattgc    133200
     cttggcgaaa gccctgggcg gcggcttcag agcggctgtt ccagcccgtg acaccaattc    133260
     atgactggga aaagccgatg acggacgtca ccctcgatca agatcacaat actcccgaaa    133320
     accccccatc gcccaagagc cagaagcgaa agcggctttt cctctttttc ggagggggcc    133380
     tcgttcttat cgccctatct tggtggatct gggcgacctt catcgcgggt gacaccgagt    133440
     cgacggagaa cgcctacacg aatgtcgagg tggcgcaggt cacgcctctc gtcggcggcc    133500
     cggtcaagcg ggtgctggtc gtcaacacgc aagctgttcg cgctggcgac gtcttggctg    133560
     aactggatga tacggatttg cgccttgccg tcgcacaagc tgaggcagcc ttagggcggg    133620
     cgcgtcggca ggtccggcag gtccaggaga ccgacgccaa tctggctggg caggtagccg    133680
     tgcgagctgc cgacgaagcg actgcacgcg ccgatttggt tcgcgcacag gccgatctcg    133740
     acaaggccca gcttgacgaa cgccggcggc gccggctcgc gggccctggc gcgatttcgc    133800
     agcaggaatt gagcgatgca cagactgcgg tccgggtcgc gcaggcggcc gtggagcaag    133860
     caagggcgcg cattgcagcc gcggaagcgg cccggaatgc ggcctctggc gctcgtcgcg    133920
     ccaatcaggt cctatttgag gacacgaccg tcgagacaaa tccggaggtc cttgcggcta    133980
     cggcgcggct tgaccaggcg cgtgtcgacc tctcgcgagc ggtgatccgg gcgcccgtcg    134040
     atggggtagt ggatcagcgc catgtcgcgg tcgggcaacg cgtccagccg ggcgtgccga    134100
     tcatggtcgt tgttcccgtg cagaacatgt acgtggatgc caactttaag gaggggcaac    134160
     tcagtcaggt tcgaccggga ctccccgtga cgctgacgtc ggacctctac ggctcggatg    134220
     ttgtgtatca cggtcgcgtg gaagggttcg cgggtggctc ggggtcggct ttcgcggcga    134280
     tcccggcaca gaatgcgacc ggcaactgga tcaaggttgt acagcggctc cccgtccgca    134340
     ttcggctcga cccgagagag ttgcaggaac acccgctgcg cgtggggctc tccatgcacg    134400
     cgacgatcga cttgtcgggg gcgcattgag atgtccgcga agggtggaga gcacgaaggg    134460
     agcggttatc cgccgttgac gggcgcaaag ctcgtcatgg cggcggccgc tttgtccttc    134520
     ggcaacttca tggtcgtgct cgacacgacg atcgccaatg tcgcgatgcc gacgatttcg    134580
     ggcgacctgg gcgtttcgac gaccgaaggg acgtggatca ttacggccta tgcggtcgcc    134640
     gaggccatca cggttccgat cacgggctgg ctctcgcgca ggttcggaga agtgcggctg    134700
     ttcacggcct gcgtcgtagc cttcgtgatc tgctcgatcc tgtgcgggct gtcgggttcg    134760
     ctgggcttcc tcgtgctgtt ccgcatcctc cagggcttcg cgggcggtcc gattatcccg    134820
     ctttcctcca cgctactgat ttctatattt cccaaggaca aggccaacat agctttggcg    134880
     atctggggca tgacgacggt ggttgcgccc atcttcggcc cgatcctcgg cggctatatc    134940
     tccgacaatt atcattgggg ttggatcttt tatatcaaca tcttcttcgg gatcgctgtc    135000
     ggcagtgttg cctggtggct catgcacaat cgggagacgg ccatcacgcg cagccggatt    135060
     gacattgtcg gccttctcct cctcgtcgtg ttcgtcagcg ccttccagac aatgatcgac    135120
     aaggggcgcg aactggactg gttctcgtct tcgttcatcg tctggatggc gatcgttgct    135180
     ggcatcgcgc tcggcgcgct gatcctgtgg gagctgaccg acgatgaccc ggtgatcgat    135240
     ctatcggttt tccgaaaccg cacctggctc gtttcgaccc tttcgctggg actaatgttc    135300
     gggctgttct tcggaaatat cgtgctgacc ccactttggc tccaacagat gatgggctac    135360
     accgcgacat gggcgggctt tgccaccgct ccgatgggaa ttctggccgt tttgaccgcg    135420
     cctattgtcg gtcggttgat gtcgaagatc gacccgcgcc tgatcgtcac ctacggcatg    135480
     gtggttctgg ccatctcctt cttcatgcgc gctcatctga acgcgcaggc cgatttcatg    135540
     tcggtcgcaa ttcccatgtt cgtgctcggc gccggcgtcc cggcttgcct tgtcacgctc    135600
     acgtcgcttg gggtgtcgga acttccaccc gaaaagattg cgaacggatc tgggttgcag    135660
     aacttcattc gcatcatggc gatggccgtc ggcgcgtcgt tgacctcgac ttattgggag    135720
     aatgcgacga aaggaaaccg cgccgagctg gttgcgatca tcgacccctc gacggctccc    135780
     gcggctctgc ctgggttgca gtccggttca gggctcgccg ccttctcgag aatggtcgat    135840
     atgcaggctg tgatgctcgc caccaacgac ttctatgcga tggcgacgat cctgatcctg    135900
     gtcttcgctg ccgtggtctg gctcgcgaag cggcccaaag gaccgctgaa gcaggtgagc    135960
     cactgaggcg gtctcgtgtc gcgcatcatc gctggagaca gacgggccgg ctcggaccgg    136020
     cctgcggatc gggcaagtgc catcggacga gtgtaatggt gcgccaagga agttcgccga    136080
     ggtctggaag ggtcaatcgg cgtcacgaca agcgcggaga gcgccgctcg gcgattgtgg    136140
     cgatcgcaca gcaggcgttc agcgagcagg gatttggcgg cacgtcaatg tcggccatcg    136200
     ccgcgcggat gggtgggtct aaggctacgc tctgggccta tttcccctcg aagaaggact    136260
     tgttcgcggc agcgctcacc gcttggatcg aagagagcac gccggttcgc aggccagact    136320
     ggtcgggtga tccgagaagc gtactaatct gctattgcgc cgagttcatg cgggcgatgc    136380
     tttcgccaac ggcggctacg ctgtttcgtc tcatggcggc cgaaggtcgg cgctttccgg    136440
     agcttggccg cgagttctac aagtgcgtcc cgcgccgcca gcacagcgtg ctggccggtc    136500
     tccttgagga cgaaatccgc gcaggccggc ttcgcgcgtc ggatagcctg cgagcggcgg    136560
     agcagcttca cagcttatgt atatgcggct tggtcatgcg gcacatgtgt agctggcagc    136620
     caggcgcctc tgaagttgag attgagagag aagtggtcga tgcagtcgac ctgttcctca    136680
     acggctatgg cgttcggccg aaacgaggcg atccgcagaa agaccattga aaggagaagg    136740
     ccgcgactga tgtcctctcc ggcgtccggc cgataaacaa acttaaggag gggaaatgcc    136800
     ggacctgtcg ctcgaccttc ggaatctgcg atatgcgatc gcagccgcgc agcaccgaag    136860
     cttcaggcgt gccgcagccg ctctgaatat ctcgcaatca acgctgacgc ggcgggttca    136920
     gctcttggag catcgcatcg gctttcgcat tttcgatcga agtccgagcg gggttcagct    136980
     caccaatgct ggacagctct tccttgaaga ggcgtccacg ggcatgcatc aactcggtca    137040
     agccatcctg ctcgctgctt ccgttcacaa aggggaacgg ggcgagttgc aggtgggagt    137100
     ggtcgtccct ttggcggcag gccgccttca cctcgcgctc aaggaatttc accggcgtta    137160
     cccgcgtatc cgtgtctgcc tccacgaagg atcttcggag caggatctcg cccgcgtgat    137220
     gaccggcgag ctcgacatct cattcctagc cggaacgccg aaaacgagtg ggcaagatgt    137280
     gcagttgctc tggacagaga gcatctatgt cgcactgccc tcgagccata ggttggcgaa    137340
     gcgcgaggag ctgcactggc gggatattcg cgacgaagtt tttgtcgtca ctcaacgtgg    137400
     cgccggcccg gagatccgca actatctggt ccggaagctt tcaatgcctg gcttcagccc    137460
     aaagatcgat gttcacgatg tgagcaggca aagcctcctt agcgtcgtcg caatgggata    137520
     cgggatcacg ctcacgagcg gttccatcgt ggacggcatg gcggagggtg tcgcgttccg    137580
     ccctatcggc ggcgatcccg agcagcttcg atattccgca gtctggtcgc cgtccaactc    137640
     caatcccgct ctgggttgca tgctgcggct catcagggat gtggcggccg ggcggcgcgg    137700
     cttgaatggc gccgtgaggg cctagcgctc gcgatcagcc tccaagggat tgcgcatctt    137760
     gttcttgcgg gctcgggcaa atcccctatc ggtctgtatg aagcgctgca ccatcgcgac    137820
     aatcagcctg ctcggctccg tcgctggcac gccctcctgt tgcgcgagga tctcgctata    137880
     ttcctggagg tcgcggaaca gcgctccagg cagttcaagg gagaccttga ccggcttgtc    137940
     ttcagtgatc gctccgagtt tcagcttggc cacgctcagc ctccatacgg ttcgagaacg    138000
     agatcgcgcg tgacgatcac gcggaccggg aagcccggcc ggatcgtcag cgtcggggcg    138060
     atgttgagct gtcggcggac gatctcctgg cccgcctgat tgaaggtgtc ctggccgccg    138120
     ttgcggatag cgcgcagaag gcggtcatca tcgtcgatgg cgagctcgga gccgatgctg    138180
     agcagcgtgg acagtcccgc ggccttggca agttcaaacc agtggtaatc aacgccgtcc    138240
     tgaagacccg caaatccctc ggaatcggcg ccgggctgtc gctcgagcac gatcgagcga    138300
     ccattcggaa agatcagccg attccatacc agcagcacgc ggctctgccc gaactgcacg    138360
     ttgttgtcgt actggccgac aacgcgcgtg ccctggggta cgagaaggac tcggccggtt    138420
     gggctgtcat agatgttctc cgtcacctgg gcggtgatct gcccgggaag gtcggagcgg    138480
     atgccggtga gaagagcggc cgagatcacg gcgccggcct ggaggacata gggggatgcc    138540
     ggcgccacga cgcgatccgg tgccacggtt cggcgatcgg cggcggcgtt gaggaaggcg    138600
     ttctgccgat cctgggcggt cggcgtcgcc ggcggcgggg cgaggccgag atttgtcagg    138660
     gttggtggcg gcgaaacagc gtccggcgcc gctggagcgg ctacaggacc agcggatctc    138720
     gtctctgtcg aggcaaacaa gcgcgcggtc ctcgcggcct ccagctcctg aagacggcgc    138780
     tgctccgcgg ggtttggacc aggattgggc gcggcgacac cgggcgcagg cacgggctga    138840
     ccccggttct gcgcgccgag catcggacgg ccgaggtcgc cgggcagcgg tgggccgagc    138900
     tgcggcacgc cgctatagtc gcgcggcagg ccggaaatcc cgtcggcggt cggacggttc    138960
     tcggtcgagt agagttcttc attcggtcgg ctgccgtccc gggtttgcag cgcgtagacg    139020
     agcgcgccgc cgatgccgac gctcgcgacc agagcgagtc cggcgagaac cttgcgcgag    139080
     agccgtgtca cgcgcggcgg ctcggcgcgc aggcgcatcg cagccgggct cggcggctca    139140
     ccggtcagcg gccgcgcctc ctcctctgga ctttcctcgc tgcggggatc ggtgtcgctc    139200
     acgaggtcgg cctcccgtcg gtccggacga tgcggacgcg cttctgctcg cggccggcac    139260
     cgaagcgcag ctcggcggcg gcgaagaggc ggtcgacgat catgtagttc gagcggaccc    139320
     ggtagttgac gagttcggac gtgttgcctt cggcaccgac gacgaacagc ggcggcatct    139380
     caccctggcc aatgccgcgc gggaattcga tgaacacctg ccgtccgtca tcaaaggccc    139440
     gaagcggccg ccatggcgcg cgatcgcctt cgatcgcgta gcggaaattg acgttggtca    139500
     gatcgacgcc ggtggcgacg ggacgggtcg cctcggcctg cgcattctgg cgacgcagcg    139560
     ctatgagctg gtcttgggga tattgccagg aaaccgacgc catgtaggtg cgctcggtcg    139620
     agcgtagctc catgtggtag gttcgcagag tggtgttgat gatgaggttc gtcatcagct    139680
     ccggccgcgt cggcttgacc aggatatgga cctgttgcgt cgcgcccgag ccgcttagcg    139740
     tgtcgccgat aatccagcgg acggtgtctc cggcggcgac cgggccggac ccgacgagct    139800
     gctcaccggg ctgaagcgcg atatcggtga tctgcccgac cgcggtatac acctgataga    139860
     gcgcgccctg ggtgaacgga tagacctgca tcgaattgat gaagccgtcg cgcacgggct    139920
     gcacgcgcgc cgcggcattg gcctggttca cccgtgcagc cggatcggcg ggttccggcg    139980
     cttgccggga gcgctcgacc ggcttcatct ggccgggaag cggaagcggc cggggtagct    140040
     ccacgacggt gacgggcgcc ggcggatcga ccgtctgcac ggcgggggcg gcattgtcgt    140100
     aggagatctc cggcggcttg tgcgtggtcg cgcatccagc gagcgccgtc gtggcgagca    140160
     gaatgaccgg cagcgtgccg atccgtggat gcgcacatgc ttggatgcgt gaagccggca    140220
     ttccggcttt acggaacgac ggcctcattg cccaagctcc cgtgaccagt tgatggcgtt    140280
     gacgtagatg ccgagcgggt tcttccgcag gacatcggca ttgcgtggtg tctggatcac    140340
     gatcgtcagg atcgcggtcc atcgttcggt cgtggcgagc tggccgttct cgtagcggcg    140400
     ctcgacccag gcgacgcgaa agctgtcggg agatgcgcgg atgacgctgg agacctcgac    140460
     cgcgacctgc tggcgtccga cattggtgaa cgggtcgttg gcgcgtgcat agtcgttgag    140520
     ggcggcagcg cctcgatcgg tcgtaaagtc gtaggcccgc agccagttct ggcggacgat    140580
     gatggcgtcg gccgggattg aacggacctc ctcgataaag cgcgccagat ggaaagcgat    140640
     ctgcggatcg gtcgggcgat aatcggccat ggccggcgcc accgcctgcg cctgtccgag    140700
     ccgatcggtc tgcaccaccc agggcacgac cgttccccgg gcggactgcc agaccagggc    140760
     cgcggcgaaa ccggccgaga ggaagagcga gccgaatgcc ataagacgcc agtttcgcgc    140820
     ctggacgcgg gccgagccga tgcggtcgtc ccagatctgg ccggcgcgct ggtagggcgt    140880
     ctcgggctcg gctgttttgc cgtagtgggt ggcgggtcgt ttgaacatca gcggtcgcct    140940
     tcggacaggt tgacggagga gccgccgcca tgggcatcac ccgagcggac ggcatgggcc    141000
     gtcgcctgga cggcatggga catttgctgg cggcggcgca tgcgctgcgc ccaggcgggt    141060
     gggcctccgc cgcctgccgt agcagccgca tcttcggacc ccggtccgcc ggcgctcggt    141120
     ccaccggtcg tggagccgcc cgtggctcca agaaccgcgc ggccgccggc attgaagctc    141180
     gagcgcatgc cttcagcggc gcgggaggcg gcgcgacgaa ggggcgagat cgcggcactc    141240
     ccgccggccc gggcgacgcc gcccagaccg gcggcgacgc tagcagcgcc cgtctgcccc    141300
     gcggccccga ggctgtaggc ggtcgatgcg ccgccagcga gggcagcgcc accgcgggcg    141360
     gcggcggcgg ccccgcctgc cagggaggcg ccgcctgtcg cggcggcgcc cacggcgccg    141420
     gctccgagcg cgaccatgcc gccggcggcg agacccgtgc cgacggcagc gccggcgctg    141480
     agctgcggac cgcccgagac gatgccggac gcgatgccgg gcccgaagat gccaaggccg    141540
     agcaatgaga gggctgcgag gacgatggcc atcgcctcgt cgaccgatgg cgtggcgccc    141600
     ccgaagcccg ccgtgaattc ggagaacagg gtcgatccga tcccgatgat gaccgcgagg    141660
     acgaggacct tgatgccgga cgagatgagg ttgccgagca cccgttcggc catgaaggcg    141720
     gactttccga acaggccgaa ggggatcagc acgaagccgg cgagcgtcgt cagcttgaac    141780
     tcgatcaggg tgacgaagag ctggatggcg aggatgaaga aggcgagcag caccagcgcc    141840
     caggcgagga acatgcaggc gatctggatg aagttctcga agaagctcca atagcccatc    141900
     agcccggaga tcgaatcgag cagcggccgt cccgcatcga gcccggtctg cgcgaccttg    141960
     ccggggcgaa gaagatcggc cgtggtgaag ctggtgccgc tcgccttcag gccgagaccg    142020
     gcgaagctct cgaagatgat ccgggcgagg ttgttccagt tgccgatgat gtaggcgaaa    142080
     acgccgacga acagcgtctt cttcaccagt cgggcgatga tgtcgtcatc ggcgccccag    142140
     gaccagaaga gcgccgcgag cgtcacgtcg atcacaatca gcgtcgtggc gatgaacgtc    142200
     acctcgccgc cgagcagacc gaagccgccg tcgatgtaac gggtgaagac ctcgaggaaa    142260
     tggtcgatga cgccggtgtt ccccatgcct atcgcgcctc gcccggctgc gcgtcggcag    142320
     gcgctggctc agacggagcc gtcgcgtccg gcagtctccc ggccggtcgc gatccggggg    142380
     cgaggaagcg acgacggttc tcggcccagg cgcgcaggca ggcgggatcg cgagggccgg    142440
     cctcgccgag cgcctggcag cggaacagtt ccgtgcgcag cggatcgttc ggcgtcggga    142500
     ccggccgcgt tgtcgcccag ctctccgccg tttcctcctt ccggctcatc tcgatcgcgg    142560
     tcgccgtgat cgcgaccgcg acgaagacga tcgcaccgat gcgtgcgagc gatttcccgt    142620
     ccatcgccgc gtcctcagtt gccgctgttc gggaacatcc gcgcgttgcc cggctgatag    142680
     ccgctgccag gcgtaagaaa gcggcgacgc tgttcgcggc cctgttcggc ggccgccgcg    142740
     cgctccgcga cggcgagcgc ctgggcgcgg ccgttggcgg aaacgacggc ggtgagatca    142800
     gcgagctgct gcgcctggag cgcgagaagc tgatttcctg cctgcgtcgc ctgaagcgct    142860
     ccggtggcgc cttggctttg gccgaccagc gcagacatct gaatgcggtt tgtgtcgatg    142920
     ttgccgacga cgccggcttg cacccgcatg gcgtcttgca agccgcccac ggtgttctgc    142980
     cagcgttcgc gcgcatcggc gacgagttgc gtgtcggatg ccgacatcga ggcattgccg    143040
     taggtggtcc ggaacgcctg atcgatgttc tggacattgt aggcgatccg ctgcgcctcg    143100
     ccgaggagct gctgggtccg ctgcaccgac tgctggagct gctggagcga ggaatagggc    143160
     aggctcgtga gattgcgggc ctggttcatc aacatggtcg cctcgttctg cagcgaggtg    143220
     atctggttgt tgatctgctg aagcgcgcgg gtcgccgaga gcaggttctg cgcatagttc    143280
     gtcggatcgt agacgaccca ctgcgcctgg gccggcgtgg cgaggtatgg cgctgtggcg    143340
     agggtggtgg tgagcagcgc ggcggcaagg cgcaccgcgc gcgtgcggcg cgaggtcatg    143400
     aggaggtctc cagagtttcg aggttgggga tgagttgggc cgcccagccg agatcgtggc    143460
     gatcgagcca ggcggtgagg aagccgtcgc ggccatgctc ggcgaccgta ctggcgatcg    143520
     ctgcctgatc ggacttggag gacgcggcgc agagcgccag cgcgacgtcc gacaggccca    143580
     gctcgaagag gcgattgccc cggcgcgact ggcaataata gtcgcgcttc ggcatcgccc    143640
     gggcgaggat ctcgatctgc cggtcgttga gcccgaaccg tcggtagatg gcagtgatct    143700
     gcggctcgat ggcgcgctcg ttggggagca ggatgcgggt ctggcagctc tcgatgatag    143760
     cgggcgcgat ggccgacccg tcgatgtcgg aaagcgactg ggtagcgaag atgaccgacg    143820
     cgttcttctt gcgcagcgtc ttcagccact cacggagctg gccggcgaag ccctcgtcgt    143880
     cgagcgcgag ccagccctcg tcgatgatga tgagtgtggc gcggccgtcg aggcgatctt    143940
     cgatccggtg gaagagatag gcgagcacgg cggctgcggc cccggtcccg atcagtcctt    144000
     cggtttcgaa agcctggacg gtggcctcgc cgagatgctc ggcctcggca tcgagcagcc    144060
     ggccataggg tccgccgacg caatagggcc gtagcgcctg cttgaggtcg ttggactgga    144120
     gcagcaccga caggccggtc agggtgcgct cggcgggcgg cgccgaagcc agcgatgtca    144180
     gcgccgacca gatatgctcc ttgacctccg gggtgatcgc aacgctctcg cggctgagga    144240
     tggcggagat ccagtcggcg gcccaggcgc gttctgcggc gtcatcgatc cgggcgagcg    144300
     gctgaagcga gacgctgtcg tccgcaccct cggtcagccc gccgccgaga tcatgccagt    144360
     cgccgcccat ggcgagcgcc gcggcgcgga tcgagccccc gaaatcgaag gcgaagacct    144420
     gggcgcgatc gtagcgacgg aattgcagcg ccatgagcgc cagcagcacg gacttgccgg    144480
     ccccggtcgg accgacgacg agggtgtggc cgacgtcgcc gacatggatg gacagccgga    144540
     atggggtcga gccttcggtc ttgccgaaga gcagcggcgg cgctgcgaaa tgcccgtcgc    144600
     gctcgggccc ggcccacacc gccgacagcg ggatcatatg ggcgaggttg agggtcgaaa    144660
     gcggcggttg gcggacattg gcatagacat gccccggcag gctcccgagc caggcgtcgg    144720
     cggcgttgat cgtctcgggc atggcggtga agtcgcggcc ctggatgacc ttctcgacga    144780
     ggcgcagctt ctcggcggcg atgcgcggat cggcgtccca gacggtgatc gtcgcggtga    144840
     cgtaggcctg gccggcatag tcggcgccga gctcctgcag cgcgagatcc gcgtccgccg    144900
     ccttgttcgc ggcgtcggtg tcgaccagca ccgacgcctc gttggtcatc acctccttca    144960
     ggatggcggc aatcgatttg cgcttggcga accactgccg acggatcttg gtcagcagct    145020
     tggtcgcgtc ggtcttgtcg agcagcacgg cgcgggtcga ccagcgatac gggaaggcga    145080
     gccggttgag ttcgtcgagg atgccgggtg tcgtcgcggt cggaaatccg acgatggtga    145140
     ggatgcgcag atgcgtgtcg gccaggcgcg gttcgagccc gccggtgagc ggctgatcgg    145200
     cgacgagagc gtcgagatac atcggcgtct cgggcacgcg gacgcggtgc cgcgtcgtcg    145260
     agaccgtgga gtgcagatag gtcagcgtct cagcgtcatc gagccaggcg cattccggca    145320
     tgaaggcgtc gacgagctgg aggatgcggt ccgtgcggtc gataaagccg cgcagcacct    145380
     catgggcatc gacgccgccg cgctcgcggc cctcatagag ccagctttcg gcgcgggcgg    145440
     cgtcttccgc cggcggcaga tagaggaagg tcaggaaata gctggactcg aaatgcgcgc    145500
     cggcctcctc gaagtcggcc ttgcgctcgg cgtcgaccaa ggccgatgcc gggtcgggaa    145560
     agcggcttgt cggataggtc gcggcctcat ggcgctgcgc ctcgacgaag atcgcccagc    145620
     ccgagccgag gcggcggaag gcgttgttga ggcggccggc gaccgcgaca agttcggccg    145680
     gcacggcgct gtcgaggtcc ggaccgcgga agcgggcggt ccgctggaag ctgccgtcct    145740
     tgttcaggat cacgccctcg ccggcgagcg cgacccaggg caggaagtcg gcgagccggg    145800
     tgttgcgatt gcgatattcc gcaaggttca tcatggcgac gccctcagac cgtcagatag    145860
     gccgggatgc gcagatgccg gcgtccgacg tcgacgaatt gcggatcgcg cttggcggcc    145920
     cagaccgcgg cgaaatgacc gatcgcccag agcgccaggc caaccagcca gaggcgcaga    145980
     cccaatccaa gcgcggcggc gagcgtgccg ttgaggatgg cgatggatcg gggcgcgccg    146040
     ccgagcagga tgtgctcggt cagcgcgcga tgcaccggca ctgagaagcc tgggatttcg    146100
     ccgacgtaat ccgcgccgcc tgccatcaga cgagcgctcc gccgccgaac gagaagaagg    146160
     acaggaagaa gctcgacgcc gcgaacgcga tcgacaggcc gaaaacgatc tggatgagcc    146220
     gccggaagcc gccggacgtg tcgccgaagg ccagggtcag gccggtgatg atgatgatga    146280
     tcacggcgac gatcttggcg accggcccct cgatcgactc gaggatcgac tgaagcggcg    146340
     cttcccacgg catcgaggag ccggaggcgt gggccgccgg tgcgagcgcc agactgagaa    146400
     aggtgacgga aacggccgtc gcgatatggc ggcggattcg aagcgcgtgc tggatcacgg    146460
     gatctctcct tcggggggct gggttgcggg ggtgacgcgg taatcgccgt cagggccgag    146520
     cccctcgatg cgggcgagtt cggcgagccg gcgcgaggcg ccgcggccgg agaggatggc    146580
     aacaaggtcg atggtctccg cgatgagcgc ccgcggcacc gtgacgacgg cttcctggat    146640
     gagctgctca agccggcgca gcgcgccgat cgctgtgccg gcgtggatcg tgccgatccc    146700
     gcccgggtgc cccgttcccc acgctttgag caggtccagc gcctcgcttc cgcgtacctc    146760
     gccgatcggg atgcggtcgg gccgcaggcg gagcgatgag cgcaccagtt cggacagcgt    146820
     gatcacgcca tccttcgtcc gcatggcgac gaggttgggc gccatgcatt ggagttcgcg    146880
     cgtgtcttca atgacaatga cgcggtcgga ggtcttggcg atctccgcca ggagcgcatt    146940
     ggtgagcgtc gtcttgccgg tggatgtgcc cccggccacg agaatattgc gccgctcggc    147000
     gacggcggcg cggagcagcg cggcctgtcc ggcacgcatg atgccggcgg cgacataatc    147060
     ctcgagcgtg aagacggcga cggccggttt gcggatggcg aaggcaggcg cggccacgac    147120
     gggagggagc aagccttcaa accgctctcc cgtttccgga agctcggccg agacacgcgg    147180
     agcgccggca tggacctcgg cgccgacatg gtgcgccacc aagcggatga tccgctcgcc    147240
     gtctgcggga gaaaggcgct cgtcggtttc cgagaggccg tcggaaaggc ggtcgatcca    147300
     gagccgcccg tcagggttga gcatcacctc gacgatcgtg gggtcttcca gaaacccggc    147360
     gatcgcaggt ccgagcgcgg tgcgcagcat gcgcgcgccg cggaggactg cttcggatct    147420
     ctgctggggg tttgccacgt cgtccccgtt ctcttgcggg cgcgcccacg cgcggccctg    147480
     gatcggggac gagtagaaga ggcagaaatc agggcctgac aacaaccgaa atgtggtcgt    147540
     cgtactgtgg cgtacaaaga cagggaaacg gcggaacgcc gctatacttc aaggcaatgg    147600
     cagcatgact atctcgcgcg cgcacgatgc tgcggcgcga tcgcgcggaa gcgccgagtc    147660
     gacttgccgc atcgtcaccg cgcgggcggt gcggtcgtca atcagcctcg ccggtgtgat    147720
     tgagatcctc cgagatctcc tgcctgagct tcggaccgtt cgcgagcctg cggcccaggg    147780
     tgttgatgaa ggcctcgtag cgctcggcgg acttggcgcg tgccgcctgg gccgcatgct    147840
     ccggcagggc gggcgtcgtg ttgaaccaga agcgcacgaa gatcgcgagg gtctcgaccg    147900
     cgatgccgac gtcccgctcg acgcgcgtca ggcgtcggtc aagctgatcc agtcgcttcg    147960
     tgatcgccgc ttcctggcgc tctgcggcgt cgggcgaaag gaacgacgca atgccggcct    148020
     cggcgacaag ggatagcgag tggccgcgcc gcgccgcatg cgccgatagc gccttcatga    148080
     cctccggttc gagatagacg gaaagccgct gcttcttcgg aggcttcgcc atgatcgcct    148140
     cctacagctc gatgccatcg ccggggtcga gggaagcctg tcgcgcgacc tggcgcatcg    148200
     tgtccctcag ccggctattg cgggcagcgt cttcgtcagc atcctcaatc ggttcgaact    148260
     cgaactcgtt ttcgatcgga accgtcttct cgaccggctt caggcggcgt agttcaggct    148320
     ggcgtcggcg ctcggactcg gtcgtgtctt cctcgtcctc ggtcgaaggc gcatcggccg    148380
     cggctctggc gagcgcgccg ccgatctcgg gaactggcgg aaggtcgaga ccgctccagt    148440
     cgttcgccgg cggcttgcca ggtttgctca gtgggggcgg cggcaggatc cgctcctggt    148500
     atcggcggtc ctcgtagtag cgcgccttct tggcccggat cggcggcgtc cccgcgacca    148560
     tgacgatctc gtcggctggc gggagctgca tgacttcgcc gggggtcagc agtggccgcg    148620
     ccgtctccga gcgcgagacc atcatgtggc cgagccaagg agatagccga tggccggcat    148680
     agttcttcat cgccctcatc tcggtcgcgg tgccgagggc gtcggagacc cgcttggccg    148740
     tccgttcgtc gttggtcgcg aagctgacgc ggacgtggca gttgtcgagg atggagttgt    148800
     ttggcccgta ggccttctcg atttggttca gcgactgcgc gatcaggaat gccttgatcc    148860
     cgtacccggc catgaacgcg agcgcgcttt cgaagaagtc gaggcgccga agcgcggcga    148920
     actcgtcgag catcatcagc acccgggggc gcctgggatt ggcgtgaagg tcctcggtca    148980
     agcgtcgtcc gatctgattg aggatcaggc ggatcaacgg cgtggtccgg ctgatgtcgg    149040
     acgggggcac gacgaggtag agggtcgtcg gattgccctc cgccacaagg tcggcgatgc    149100
     gccaatcgga ccggccggtc acctgcgcca ccacgggatc gcgatagagg ccgaggaacg    149160
     acatggcggt cgagagcacg cccgatcgct cgttgtccga cttgttgagc agctcgcgtg    149220
     cggcgctggc gatgacgggg tgcgggccgg cctcgcccag atgagcggtc ttcatcatcg    149280
     ccgcgagtgt cgactcgatc gggcgtctgg gatcggatag gaaggcagcg acgccggcga    149340
     gggtcttgtc cttttcggcg tagaggacat ggaggatggc gccgaccaac agggcgtggc    149400
     tggtcttttc ccagtggttt cgcttctcga gcgatccttc cgggtcgacc aggatgtcgg    149460
     cgatattctg gacgtcgcgg acctcccatt cgcccctgcg gacctcgagc agcggattgt    149520
     aggcggcgga cttcgggttg gtcgggtcga agagcagcac gcggccgtgc cgggcccgga    149580
     agccggccgt caacgtccag ttttcccctt tgatgtcgtg aacgatcgcc gagcccggcc    149640
     aggtgagcag cgagggcacg accagcccta cgcccttgcc ggatcgggtc ggagcgaagc    149700
     acagcacatg ctcgggccca tcatgacgga gatagtcgcg atcgagcttt ccgagcacca    149760
     cgccgtcggc gccgagcagc cctgcggcct tcacctcgtc gggcctggcc cagcgcgccg    149820
     acccgtaggt ctcgacgttc ttcgcctcgc gggcgcgcca cacggacatc ccgatcgcga    149880
     cggcgatcga gatgaatccg cccgaggcgg cgatataggc gccctcgacg aagatcggcg    149940
     gcgcgtaggc gtcatagaaa taccaccacc agaagaaggc cgggggatag tagaccggcc    150000
     agccggcgac ctcgaaccac ggatggccga gctgcggttg aaagccgagc cggtaggccg    150060
     tccactgcgt ggccgtccaa gtcgtgaaga gcacgatcat gaacacggtg agtatctggc    150120
     cccagaggat tttcgtcgcg gacatggcgg cgttcccttc ttgatctgcg ctagaggccg    150180
     aggccccgct tgcgcccgaa gctccagtcg acgccgccgt cattgcgggc gacgccggag    150240
     acatgctgcc cgagctggcg gtcgagggac ggcgtccagg gcacgagttg aaagccgagg    150300
     ccatcgtcga tcatggcgaa gcggcccgat gcgagcgtga gccgctgccg ataggtgccg    150360
     gcgacgtatt cgccgctccc agccttggcg aatgtccggc cggtctccgc ggcgagcttg    150420
     tccgccagcg cgtcaagctc gcgtcggcgc agcgtctcga tgagattgcg cgagaagatg    150480
     acgctctggc cgtgccgttc ggcgagccgc tggtcgatca gatgctcagc gcgccgatcc    150540
     atggcgtcgc gaacttcgac gccgaagccg ccgcctccca aggcggccgg ctcgcgcgcg    150600
     atcgcctgcc ggtcaagcca ggtggcgccc gtggcggtga cttgccggga gatgtcgaga    150660
     tcggagcgga cggcgagcgc gacgcggcgt tgaccgcgtg catcgtcgaa gcggcgtagc    150720
     tcaacgatcg atcccggcgc gctgtcgccg gcggcgtcga ggtcgggcag cttcatgtga    150780
     tgggttcggc cgtcgacgcc gtcaacaaca gcaaaggccg tccccttcaa ttcgttgtcg    150840
     aggccgcgcg cgaccagccg gccgacgatt ggatcgtcga tgttctccgc ggcaagcacg    150900
     taacttgccg cgccacggtc gatgccgcgc tcggtcagcc cgcgatggat gcgcttgatg    150960
     atgtcgccgc gctcgccgag ctcgcgcagc gtcgtctccg cccgctcggc gatgacccat    151020
     tggcctgggc caatctcgtt ggcgaggccg agcgtttcga gcttgcgcag gcggccgacc    151080
     ttcagcgcgt gaaactcgtc gggttgtcga tccgggcgcg gcgcgagatc gacgacgccg    151140
     gtccggtagc catcacgggc gagctgccga tcgaggctgg tccagcgctc ggcttcgatc    151200
     tggcgctcga ggctacggcg gatgtcgtga tcggtgcgcg ggcccagctc ttgggtgatg    151260
     agatcacggg cgcgatcgcg catgccctcc ctgatgtagt cgcgggagat gacgaggttc    151320
     tcgctgtcgt cgcgcacgcc gcgcacgatc agatggacgt ggggatgctc ggtgttccaa    151380
     tggtcgacgg ccgtccagtc gagcttggtg ccgagatcct tctccatctg gccgacgaga    151440
     ccgcgggtga aggagcgcag gtccgacatc tccagcgcgt cgtccggcga gacgatgaac    151500
     cgaaaatggt ggcgatcatc ttcgcagcgc tcggcaaatt ccttcgggtc gaggtcatcg    151560
     ccgcccgggc cgaacagccg ggccttctcc ccatcccggg taacgccctc gcggcgcaga    151620
     tagccgagat gggtcgcgag cggggcggag cggccgccgc tgcggacgac acgcgccttg    151680
     atgaccgccc cgcgcgagcg ggcggtgagg aagcgattgg cttgcaccgc ggcgcgctga    151740
     ccgcgcccga agcgcgagcg gttgccgggg ccgatcttgc ctttccgaga gaccgagccg    151800
     cccgccttct gggcagcggc gagcgcctgc gcgatgaaag gccgggcctg ctgcgccttg    151860
     gtcgagcgga tgcggccggg ccggatgcgg aagtcgtcct cgacgctcat ggtcgaagcc    151920
     ccgcacatcg cgcaacggcg cggaaatcct tgatgaaatg cgcgtcgcgc accttgcgcc    151980
     gatcaggcgc acatcgcgca aacgcgccat aaccccttga aaaaccacaa ccgcccaagg    152040
     ccgcacatcg cggcccttta tcctgccatc gtgcggttgt ggtgcctgtg cttccctccg    152100
     ctcccgccaa tcctatcccg gagcccgaca acgccgcctg gagtgccacc gtgctcatcg    152160
     cggccccgca ctggcggttt ggacgacgaa gaggccgccg gtttgcggat cggcgggcgc    152220
     aaaatcccgt tctcgacgct gcgatgatgc tgcagccgga tcgccgtcat cgtgccgaac    152280
     ctctgcgcgc ggcggcgcct cggcctgtgc gatgaacagc ggcgcgcgtg tccaggccag    152340
     cggatcggcg actgcgacga tgacagggga tggcaggccg gccccatcga tgaccggcac    152400
     aagcatggcg aggtaggcgc gcgtttccgc cggcagggtg cggccgcgat cgcgatagtc    152460
     ctcatagcgg ccgggaccgg cgttataggc cgccaggaag cccggcgagc cgtagcggtc    152520
     gtgcatctcg cgcagatagg cggcgcccgc cagaatgttg tcgcgcggat cgtaggggtc    152580
     cggtccaagc gcatagcggg tgcgcatttc cgtccaggtg gccggcatga cttgcatgag    152640
     gccgattgca cccttggggg agatggcgcg cgcgtcgccg cggctttcga cgcgcatgac    152700
     ggcgcgaatc cagagctccg ggatagcgaa ccggcgggcg gcttcggtga cgaagccggc    152760
     atgagggtcg gccgcgtcga tgcgcgccgg gggcatagtc tgcgcgctgg caggcaacgc    152820
     cggaagcgct gcggcgggca ggccgggaag gaaaaggagg gccgtcagcc ggacggcggc    152880
     ggaccgcccg gcgacagcgt gatagcggcg ggacggcacc gctcagtccc gctcgccgcg    152940
     cttcggcggc cggttccagt gcaggcccca ggcggacttg tcgtcggccg actggaagag    153000
     gttcgcacgg atcggatgtc cgaaggtggg atcgtcgagg tgaagcgaga cgtagtcacc    153060
     ggccttctct ccggtgcgct tccagcccgc gccgatctcg gcgccggttt cgttgttcat    153120
     gccgtcgaag acatggacgc ggtaatccgg cgcgttgtcg gcgtcggacg gttcggcggg    153180
     aacgatgatg atgtcctgat gcagcgcgag cgtctgcaaa ttgccgatga agccggaacc    153240
     gtcgcgcgtg aattgaccga tcagggacat gattgcctcc gtggatgtgc ggtgaggttg    153300
     gacatgggac gcaccgtcac cgcgtcggtg cgcgccagac gaagcggccg tcgcggtcct    153360
     cgtcggtgta gagagggatg gcccgcccga tcacggcgga cgcgggaagc ggcccgaagt    153420
     accggccgtc caggctgtcg cggacctgcc agttcatcag gaacagctcg ccgggcgcga    153480
     cgacgcggca gcccttccag accggtaaag gattgccgcg gcgatcgtga tccagcgcgt    153540
     cgcccatcgg cacggcgtcg accgtaatgg cgaggccggt tcgacagacc cgctgcccgg    153600
     gaagcgcggc gacccgcttc aggagcggca cgccgcgcgg cagataaccg ccatcggcaa    153660
     ggaagctggc cagcggttcg ggcgggcgca cggcgactag gtcggtcact tcgggtgacc    153720
     ggtccggctc gacgcggtag agaccgatcg gcgtgctcgc cgaagcgttc cagatcagct    153780
     tcggcgcgaa cgagacgatc gacaggatgc cgagcaatga caccgcgccc gtcgtggtga    153840
     tggcgtagcc gagccgggtc atgcgccgat ctcccggcgc aggaggaagg cgcggtggtg    153900
     cgccggcgtg taggtccgtg gcgtctcccc ggctgcgagg cggttgtgga cgtggcgcca    153960
     gtgatcgggc gaaacatcgc cgggatcgat cccggccgcc tcgatcgcgt cgacgagctg    154020
     gagcacgcgc tccaccttcg gccaaccgtc gacacgaagc agaaagtcgc cgccgggcgt    154080
     gacggtcggc accgtctggc acgccgcgcc acgcgcaacg gcgcgcatga tgtcgagccg    154140
     cgagagcacg gtgccgtgct cgttcgccgc ccagcggacc agcgcgaagg tcgcaccagg    154200
     agggaaaaag aggagccgtc tgcggcgatc gaggatctgt tcgcgcagct cgcgaccgaa    154260
     gcggatccag tgctcggtct gcttctcgat ccagacgagt tcgacctggg tgaggtgctc    154320
     ggacggctcg gcgcaagcgc ggccgacgca tgggggcgcg gcgacgaggc cggtcattgg    154380
     ccctctcctg accggggcgg gaactcacgc tcgaacaggg cgcgcagcat gtcggcgacg    154440
     gtcaggccgc gctggaacgc cgcgatcttt atacggccgc gcatgtcgga ggtgacgtcg    154500
     atcgtcagcc gggccgagaa gtcctcggcg ggctggccaa ggggggcgtg gcggtcgggc    154560
     gccttgatcc agccttcggg atcggcggga cgcgccgcaa agctgcgctt cggggaccgc    154620
     tcgctcatgc gccgatcccc gcgacttccg cggcgaacgc ggcgatctcg cgcgcgccag    154680
     ggcaatcctc gtcctgctcg gcggccagcc gaccggtctg aacgacatcg gcgaagacga    154740
     tgcgctggcc gatggtcgtc gcgagcagcg gcggatcgtg atcggcgagg gtctccgccg    154800
     tctcgcgagc gagcaccgtg cgggctgcgc agcggttcag cacgaagcgc gcggcgagct    154860
     ccgggcggta gatgcgcgcc tcgccgagca aggagagcat ctcggccgag gcccagccgt    154920
     cgagcggcga cggttgcacc ggaatcagca cgaggtcggc cgcaaggagc gccgagcgca    154980
     tgaggccggc gacgcgcggc ggcccgtcga tgacgacatg gtcggcgtcg cgggccagtt    155040
     ccggcgcctc gcggtgcagg gtgtcgcgcg ccaggccgac gacaccgaac agccgcccca    155100
     gcccctcccg gctgcgctgc tgcgaccagt cgagggccga tccctgcgga tcggcgtcga    155160
     tgagcgtgac gcgcttgcca tggcgcgccc actcgccggc caggtgcagc gcgagcgtcg    155220
     tcttgcccac gccgcccttc tggttgagca gcgcgacgat catgacggtc tcgcgggaca    155280
     aggggactcg tccacagcgg ccgaaaagcg ccggtccgtt agaaagattc cgaaggaatc    155340
     taggttagag aagttagggg gcgcgcaagc tactgatttg gcgagcagaa tcgacgattc    155400
     tggtccccga tagcacgagg atcgggtcct cgatggcacg atagcgccgg tccctgatag    155460
     cacgagacga ttcacagctt ttccccagag cgagtggtcg accgccgacg tcggcgcggg    155520
     atgccgagcg cgtcgggctc ggtcggtacg aaggacagga tttcgggccc gccgacgcat    155580
     tgctcgatgg tcaggcgata gcccggcagc ggctggcgct tgacgatgtc gcgcaggtcg    155640
     taggcgaagt gcttgagcgg cgagaggctg ccggatttgg cgtggaggtg cgggaagtcg    155700
     aagctccagc cgaactcctg tttgccgccg tgcttgcgca ccaggcggta cagccaccgc    155760
     tcgagcccgc cggtcagcct gaagtaggtg cgatcgatgg tgagcacgag cgcgtcgtcc    155820
     agcaccgcgc cgtagaacca gtcgggcacg atcagctcga ggccgagcgg ccggccgcga    155880
     tcatccgcgc gctccttcca ctcgttgatc caggagaagc gatgcatccg ccgctcggtc    155940
     ggctggcgga tggacgtcgc cacggtggtc gactgcagcc ggtccagcgc cgccttcagg    156000
     cggtcgtagt cgcgtaggga tacgccgcga ccgatgaagt tcagaatctc ataaggcgtc    156060
     gtcgccatga ggcgcgacgg gcgcaggccg acgtcgcgcg cttcgacgat ctgcgatgcg    156120
     gcccagatga ggacgtcggc gtcccagatg gtcgccatgc cgtgctccgg caccgcctcg    156180
     acgcggattt tgacggagcc cgatttgaag tcgatcggcg cgaggcgttt cgacttccca    156240
     agcgagaaga acggataggc catgaggtcc tgcgcgtcgc gcggcgcgag atcgccgggc    156300
     aatgcccgga acagatcgag ctgggcgcgc tcgtcgcgtt gctgggggcg ggacgacatg    156360
     gggaccgggg tcagcgcaga aggccgccgt tggccgacgc gggctgacgt ttggcgggca    156420
     gtaccgtgcc gctgcgcgga tccgaggtcg aggtgacgag accccgatcc gcccaggctt    156480
     gaaggtcatc gacggaatag acgacgcgtc cgccgagctt tcgataggtc ggaccggttc    156540
     cgtaggtgcg gtgcttctcg agcgtgcgtt cagaaaggcc gaggaagcgc gccgcctcct    156600
     gcgttctcag gtagcgtgtc ggtagattgg cggctgtctc ggccatgatc gcacctccgt    156660
     ggtctcgcgg gcggccgctg cgaacgagcg gcgcattgcg agcacggtgg cgcgaggacg    156720
     gcgcctcgga cgatgtcgaa gtaaggattc taaattcgac accttgcgcg gcgtcagcga    156780
     tcccggcgtg gtcgccggag cagcgcgaga tagccgccgc gtacgagctt catcccgtcg    156840
     cgggccatgc ggattgtggt ttcgcggatc gcgctaccga cccacgtcgc cgcatcctgg    156900
     tcatgctgtg ggaagatttg gtcggcgatc gcgcggtagg tggcgccggt ggcgcgcgcg    156960
     tcgacgacgc gcagcatctg ctgcgcgcga cgccgccgct gcggcgtgat acgcggatca    157020
     ggcgcgaccg tcttgccggt gagggctgcc cagaatcggc cgagcgccgt caagcgatcg    157080
     ggcgtcagtt cgtcgagcgt gatgagcgcg gcgagcggct tcccatcgcc aatcgcggcc    157140
     aggtcgacgc tgtagcgctc accgcccagg cggagctgcg atgggaccgc ttcgtgcgcg    157200
     aaactggcgt gcgcccggat ttcctcaaca gtgagcggtt cgccggatct cggtgtcggg    157260
     ccgctgcgga agagaatcac ggccggatct atctgggccg accaggagac cggttgggaa    157320
     gtggcgggga tttcggggtc ggcggcgaaa tcgcaacccc caacgagaag cgaaattcgt    157380
     cgccgcttcc caggtcatat gaccggctga cagtaattca tgatagccag cgcggtactc    157440
     gggatttcga cggaggaact cccaagcgag ctcctccgca ttcaactgat cgatataggt    157500
     ataggcggat tcagaccgcc agctttcttc gtcgggcatt tcctaccgcc ttcccgcctt    157560
     atctttgacg cgagcgttgc ggacggtacg attccaagtt gagaggcggt ggggaagaac    157620
     ggactgggat cagcgtgatg catgatccgc atcacggggc tagtggagct gaggtctcag    157680
     gagctgttcg aagccgttct cagtcatcca gcgcgctctc gccaagtggg tggaatagac    157740
     gagcgacgcc cgctccggat cgtcttcggc actgagaccg aacagcactt ccaccacgtc    157800
     ctgccaaggc gctccctggg tttcggcgtc gagcaggcgg agatatacgg ttgcgtgagc    157860
     cttgtcgtag gccgtcagct cggcgtcacc gggtggctga tcgagaaaat tgtgcttggt    157920
     caccttcatc ccccggggca caggttctat ccattctgga ggagattgtt aacgctgatt    157980
     tgaccatagc ccagcggccc ggcgactcca gcaagaccga gcgccctgac agtgccgcga    158040
     gctgtcagct ctccgtcttc gcatgaacca gcatcactcc catgccctgg tcggaactca    158100
     ggaaaacgat gccggctcgt tcgaaggctc gtctgacctc gtcgcgcgtg ctctcgtaga    158160
     cctcgagacc gctcggcgat tcgaggcgct tcagcgcggt cagtgatact cgggccctgt    158220
     cagcgagcgt ctcctgtgtc caacccagca acgcgcgtgc ggcccgcgat tgtcgggcgg    158280
     tgatcatgca tgatcacctc ccactcggac ctacgcgcac gccagaacta cgactataat    158340
     agtcgctcct tcttcgcctg gccacccatt tgccgttctg cgggtgcgcg ttcggcgaat    158400
     tcgccgccga ctgattcggt cgccttggac gtcaaaggcc ccggcctttc ggccggggcc    158460
     ttgcgcgggg gccttagtcg ccgcgccgcc cgttggggcg ggaccagatc agcgagaagg    158520
     tatcgccgtc ctcgtcgtcg aagaggttgg cgtagatcgg agcggtgaag ctcgggtcgt    158580
     cgagcttgag gcccagatag tcgcgaccct cgttggagcg cttggaccag gcggcgccga    158640
     tctcggcgcg gccgaccaga acccggtggc tgggggcgtt ctcgccggtg gcgcgggtgt    158700
     cgggaacaat gcgcacgccc ttggcctgga cgctgagggt gacgatttcg ccggtgaact    158760
     cgttcgagcc ggtcttcttg aaggttccga tggtcgccat tgtaagtctc cgttttccgt    158820
     attcgagccc gcaccattgc ggcctcgatg gcgatcgacg ggtcggaggc gatcgacggc    158880
     gcaccccgca ggggctggac agcaaaggag ggctttcttg cctcgcgagg aatgacggcg    158940
     cagccggcag gggaagaaag tttgacgccg ctgttgcgcc ataggcgatc gaggctttag    159000
     ccgcccttcg gccagatcag gccattgaag aggccgtttg gagcggtcga ggcacgggtc    159060
     agataacgga gatgatggcg gccaccctgg atcggcaatc cggcgcggac aaaggacttg    159120
     ccggccttcg ctccctcgtc caggctgctt gctgcatcct cggcttagac gccaccgcag    159180
     agagcgccgc gcccgatcat aggtctgccc cgagaccgtg cagccgccgg tagcgctcca    159240
     gccccggtcg tgaccccggc ccagcgtcga accgcgcggc acgctccacc gcatccgccc    159300
     tcatacgatg tggatgtctc gtgcgaaccg ctttccggtc cgccgcatga ggctgagcga    159360
     tcaggcctgt gcgaggctct ggccggacgg ggctggcgcc gtcgccatcc ccgcgacccg    159420
     caccaaggcg gtgacgccga ccgcaattgc gccgatgacg gagaaggtga tctgccacgc    159480
     gtcggacggc atgagatgct tgacgatgcc gtgcgttgcg tggaacccgg cgatcgccgc    159540
     cggggcgacg aaggcgatgg ccacgatcag cttcagccat aggggccgca cgaacaggat    159600
     cgcgagctgg ccgaccgcga gcgtgacggc agccgcgacg aggccggcga gaatggcgcc    159660
     tggcaggccg gcgccggtcc cgtgggccca agcgcccacg gtcgcgccaa cgaaggccgg    159720
     aagggcgaag acggccaggg tgaacagcag ccagcacagc acgccgatgg cggcgagtga    159780
     ggcgaggatt gcgagaatga tcatggtggt ggcctccatg acgataggtc tgacggtcgc    159840
     gcctgccacc accaccacgg cgcacccgga ctatagcgga atatggcccc agccgggagc    159900
     ggaaatcgca agcgactccc gctcggcgcg gcctgctgcg cccggtcagg gggcgaaggg    159960
     gtcgatttca tgaacgatct ccgaggcgtc gccgtcgtat tcgctggcgg gcatgaccga    160020
     gagcgtcccg tcgccggcct ggaagatgac gatggccgcc atcagggtgg tggcgaggct    160080
     gaaagcgtag gcgtgagcgt cgttgaggga catttgctgg gctcctgctg gagcggggga    160140
     ccatcccccg ccgacaggtg cccgacgtgt ccggccgtgg actgcaatca ccgcgcaggc    160200
     gcagccgcag cggcggcatg ctcgcatagc cgacccttta cgggttgatg gcgacaagtc    160260
     cgcggtcgga ccaaggatca gcgctgacag gcggaggtgg ttctcgcgtc aggaacccac    160320
     atcactcgcc tcgatgctct gctctgcttt gcctgcacca tgtcccactc ggcgcggcta    160380
     ttggctatgc tgctggcggc aggcttggag tcgcgaggaa cgaacaatgg cggagttcac    160440
     aggcagagac ctgcatctcg tgaagaaggc cctcgcgatc gccgtgctgg ccatcgaacg    160500
     tcagccgggt ccatttcagt cggcctccga ccaggcggac atgaaggtgc tgctcgatgc    160560
     gctgatcgag aacgacaccg agctcgcgca ctatgcgcga tccgcccgga tcgccgtgac    160620
     gggcgagccg gattgaaaag cgcgtttgcg gaaatacgcc gatacgcatc tgcgtaatgg    160680
     cgacagtgag agaaaagcga aggcggcgct cacgcgccgc cgaacttcca gaccgggatg    160740
     ccgagcttct tggccttgtc ggcaaggttg tcgtggatgc ccgttcccgg gaaatgcatc    160800
     acgccctttg gcacgatctc cagcatctgg tcgttgcgct tgaacggcgc cgcgcgaccg    160860
     tgcttcgtcc agtcgggcgc gaagccgatc tgcggcacgt tgcggttctt ggcccacagc    160920
     gacgcaatct tgtcggcgcc cttcggcgac ttgccatgga ccagcaccat gtccggatgc    160980
     ttctcatgca cctggtcgag cttggcccag atcagccggt gatcgttgaa atcgagaccg    161040
     ccggtcacga cgatcttcgg gccggggggt agcagcacct cctgatcggc gcgcttcttc    161100
     gccatgagga agtcgcggct gtcgatcatc gccgaggtga gattgcggtg gttgaccttc    161160
     gacccgctgc gcggcagcca tgccttgccg acctggcgtt cgtaatgctc ggccgcctgg    161220
     tcgcgcatca gctcgaaggc gttctggcgt tcgatgagcg tcttgccctc ggcgatcagg    161280
     cgctccagct cgaccgactt cacttcgctg ccgtcctgtt cccgctgcgc gcgcttctgc    161340
     gcctgctcgt tgtcgtcgag ctcgcgtgcg acccgctcgg tagcgcggtg gaagaggttc    161400
     acggtcgacc agaggagatc gtcgaggtcg ggttcgaggc gcgtgtcttc cagcgtgacg    161460
     atcagcgcgt cgaagatgtc ggcgacggcg cccgccaccg cgttgccgtc gggcaggagc    161520
     cgttgatcgg gttcatcggc aaagggccga tagccatgaa gctgaagttc gttgaggaca    161580
     tggtcggttt gagaggattc gtggtgcggt tcgaagtcgt catgcgcgtc catgggatgc    161640
     tccgtcgatt ggaccgcgac cgtcgcggcc ttcatggcga cgaagcccac gggccggacg    161700
     gctcggcacc cggagcgcag cgcagggctc gatggctaag gccggctatt ttgtctcgcg    161760
     atggaaaggc ccgcagggcc gccggaaaat agtcggccgc cgccattgcc gggctggccg    161820
     gcttgtgggc cgatcgccct ctcgaaggcc gaggcgcggt cccttagacg gatcgatgca    161880
     tccgggcgcg cacggcggcg cagccgtcac gcccgttcct tgccggctat gccgccaacg    161940
     ccaggaagcg tgcgacgtcc tgcggcccga tctgaacccg agtctgactg cggagggcag    162000
     cgcggccgag ggtgcggaga tcctcgttga agtcgccgag ctggggcgag atgaccatcg    162060
     cctcgatccc ggccgcgttc gcccgttcga ccaggctgtc ccgcgcacca tcgccggccg    162120
     gatcattgtc gcgcaggata tagagccggc gcagtgtgtc ggggaacagg atggcggcga    162180
     gatgggctgc cgagagcgcc gccatcatcg gcatgtcggg caggacttgc cggatcgaca    162240
     gaacggtctc gatgccctcg ccggccgcca tcacctcgct gccgagaccg aagcggactg    162300
     catgcccaag aaggtcaccc atcgcccggc gcggggtgtc cagaggcgcc ttgtcgcggc    162360
     gtcgcggatc gagccaggtg cgatgcgccc cggtgatcct gccacgcagg tcggtgacgg    162420
     ccgcgatcat ggcgggccag gtctcggtcg gtgaatagtc gtcgggccgg tagtagcagc    162480
     gcggatggaa atggagattt ccggttccgc gcaagtccgt gatcgcgcgt tcgcgcaaat    162540
     acgactgcac gagcgtcccg gcgattggct gggacattgc gacaagacgg cgtgccgctt    162600
     ccggcgaacc gtgcggcgcc gggccctgac gcaggagcgc cggtctcggc tctggctgcg    162660
     gcatgctgag gaaggtccgg gcctcgtcgg cgacgtcctt gaaatctaca aggccgcagc    162720
     tttcgcgtat cacgtcgagc agatcgccat gttcgcccgt ggcggcgtcg gtccacttgc    162780
     ccgcgggacc cttgggcgaa tccttcagcc gcacatacat cgagcggccc ggcgtgttgc    162840
     gtacgtcgcc gacgagccag tagcggccct cgcgccggcc tctggacagg tagtggcggc    162900
     acaccgcctc ggcctgacgg ccgagacgct gtgcgagatc ggatgcgtcc tggcgagcca    162960
     tcacgccgcc tcccgctcgg agatgcgcgc caccggatag gtgtccagca gcttcgccag    163020
     cacagccgga ccgttggcgt cggcggggac gaagaagcgt agcttccatg agatgatctc    163080
     gctgaacagg ccataggccc gcagccgatc gcgcatcgcc tcggagaagc cggtgagctc    163140
     caggcgatgc gcgctcatga cccttgcgcg tcgaagctgg agaccttccg caaggtcgag    163200
     gatcgtcgtc ccgtccatca gagccgtgaa ggcgtgcgcg ggcgacagcg atgccgcgcc    163260
     tgtcgtcgcg gcgttcgcgg cgttcgcggc ccaggccggg gagacccggc ggccgatgat    163320
     acgctcgccg gcgtccgtct ggagccggta gacccgggtc gactcgttgg ggagccgctt    163380
     ccagatcggc aggagcaggc cagcgacgat atggatcgtg ctgtcggaga attcaggcag    163440
     ctcggcgagc tcggcctccc aggcggcggc gaaagcagca tcggcgactt cctcccaatg    163500
     actctcgtcc atcatgcgga gcggcgcata gtgctgctcc atcggtcgga tgaggcagac    163560
     gcgccgttcg atctcgccgt cgtcgagcat catcgacggc gcgggtatct gcacggcggc    163620
     gcggccggaa cggccgttga cgaggagccg cgcgcggggg tcagcgagat gatggagtgc    163680
     atcggccaac ggggtcggac ggttgcgttc gcgccgcatg atggtcagca ggcgcgtctc    163740
     tgcggaggtg ccgggatggg tatggatcac ctggctgtcg gtgaccacga agctctccgc    163800
     ctggagcgtc tccagtccga cgtcatagtg gccgctgtgg atcgcgccct cgatcttcgc    163860
     cgtcaggagc tgctcaaagg ccgtgaagag aacaccttgt aggtcgatgg tgagcgccag    163920
     caggcgattg aggaaggtgg tgatcggcgg cagctcgtcc ttgatgccgt tgtcgtccgt    163980
     cagcttgagg ccggtggcgg actcgaagcg gtcgagcgag cagccgtcga ccttgccgcg    164040
     cacgagcaga agatagagct ggcgcagcgc atcgcgggca tatgggctct ccagattgtc    164100
     ctcgggccgg aacaggccct ggcccccggt ctggcgttgg ccgcgcgtga tcgcgccgag    164160
     ggtgtcgagc cgccgggcga tggtcgagag gaaccgcttc tcggccttca cgtcggtggc    164220
     gatcggtcgg aagagcggcg gctgcgcctg attggtgcgg ttggtgcgac cgaggccctg    164280
     gatcgccgcg tcggccttcc agccaggctc aagcagatag tggatgcgca ggcgctggtt    164340
     cctggcggca aggtcggcgt ggtagctgcg gccggtgccg ccggcgtcgg agaagacgag    164400
     gacgcgcttg tcatcgtcca tgaacgcggc cgcctccgcg agattggcgg acgccgccct    164460
     gttctcgacg gcaaggcgct cgccgcgtcg gacgacgcgg cgcgaccgcc ctgtcacctc    164520
     ggcgacaacg tccgtgccga agcgctggac gatctggtcg agcgcccctg ggacgggggg    164580
     cagcgaggcg agccgttcga tcagttcgtc gcgccgggcc acggcctctc ggctctcgac    164640
     gggctggccg tcgcgataga ccggccgcga cgacagattg ccctcgctgt ccgagaacgg    164700
     ctcgtagagc aggaccggga aggattgggc gagatagtcc agcacatatt cgcgaggggt    164760
     gatgtcgacg cgcacgtcgt tccattcctc ggtcgggatc tcggccaggc gacgttccat    164820
     aagggcttcg cccgtagaga cgatctggat gacggcggag tggccgtccg tcaggtcctg    164880
     ctcgatcgag cggatcagcg tcggcgtttt catgctggtc aggaggtggc cgaagaagcg    164940
     ctgcttggcg ctctcgaagg ctgagcgcgc agccgacttg gcctgccggt tcagcgtacc    165000
     gctgtccccg gtgatgttgg cggcctgcat cgcggcgtcg agatgattat ggatgatggc    165060
     gaaggcgccg gcataggcat cgtagatgcg ggtctgctcg ggcgtgagct ggtgctcgac    165120
     cagctcgtat tcgacgccgt cgtaggagag cgagcgggcc gtgtagaggc cgagtgagcg    165180
     caggtcgcgg gcgagcacct ccatggccgc gacgccgcca ttctcgaccg cttcgacgaa    165240
     ttcggcgcgg ttggcgaagg ggaaatcttc gccgccccac aggccgagcc gctgggcgta    165300
     ggcgagattg tggacggtgg tggcgccggt cgccgagaca tagacgacgc gggcattcgg    165360
     cagcatgtgc tggagcctca gccccgcacg gccttgctgc gatggggcga cgtcgccccg    165420
     ttctcccttg ccgccgccgg cgttctgcat cgcgtggctc tcgtcgaaaa tgatcactcc    165480
     gtcgaaatcg gagcccaacc attcgacgat ctgcttgacg cgcgaaagct tttcgccgcg    165540
     gtcgtcggat cgtagcgtgg cgtaggtggt gaaaaggacg ccttcctcaa gccggatcgc    165600
     cgagccctgg gggaaacgcg acagcggggt gaccagcagg cgctccatgc cgagggccga    165660
     ccagtcgcgc tgcgcgtctt cgagcagctt gtcggatttg gagatccaga ccgccttgcg    165720
     gcggccctga agccagttgt cgagaatgat gccggccgac tggcggccct tgccggcgcc    165780
     ggtgccgtcg ccgagcatga aaccacgacg gaagcggacc gccttcggcg cgtcgtccgg    165840
     cgcggcggtg acgagatcgc cggtctcgtc cacggtccag gcaccggcga gatattcgct    165900
     atgggcatcg ccagcgtaaa tcaccgtctc gagctgggcg tcggagagga tgccgtcggt    165960
     gacgatcggc gccggcagcg tcggtcggta gctcggcttt ggcggcgcga ccgaggccat    166020
     ggcggcggac tggaccagct tggtcggatg cggctgcgcg ccggcgatgc ggatcgactg    166080
     gagcgcatag gcctcgtaga tcgagtccga caggcggccg ctttccgggg gcgtccagtc    166140
     gatggtctca taggcgagcg gcacgccttg aacctcagcg atgcggcggg cgggttgggc    166200
     cgtcgccgtg cgggcgagat agccccgcac cgtgcgcggg gtgggggccg ccgtcgcggc    166260
     gggacgcgcg atcgagaccg gcaggcgcgc ggggatctgc gcgccgatcc agccgagcag    166320
     cgtcgcgaca tcgggcgcgg tgccggcgga ggctgggaac cgctcggggt cgtcggccgg    166380
     cgccttgtcg atgacggtca ggcgggtctc gatggtcgtg ccgtgcttgg catagaccga    166440
     accggcgacc gcggcggtga acacgacgcg cccacgcccc tgcagacgga cgaaggcgtc    166500
     ccgccaggcc ggaagctcgg gcgagaagtt cgcgccggtg atggcgacca ggcgcccgcc    166560
     atcggccagc cgggcgagcg cggaggcgat atgccggtag gcggcgtcgg cgacgcggcc    166620
     ggagacgttc gccatcacgg agaatggcgg gttcatgatg acgatgctcg gcgcggcggc    166680
     cggatcgaga tggtcgtcga tctgggccgc gtcgaagcgc gtgacggaca cggccggaaa    166740
     gagagaggcg agaagatcgg cgcgggtctc agccaactcg ttgaggatga gcgatgcacc    166800
     cgcagtctcg gcgaggacgg cgagcagccc ggtgccggcg gagggctcga gcacacggtc    166860
     ggccggcatg agtgcagcgg ccgtcatcgc agcgaagccg agcgggaccg gcgtcgagaa    166920
     ttgctggaag gcctgggcct cctcggatcg gcgggtatgg gtcgggagca gtccggcgat    166980
     cttggcgagc gcggcgagcc gcgtagccgg cgatgcggat ttgcggaaga tcgcctttcc    167040
     gtatttgcgc aggaacagga ccgtggcggc ctcgcacgcg tcgtaggcgg tcttccagtc    167100
     ccaggcgccg gctgcgtcgg acgcgccgaa cgccgcctgc atggcggtgc gcagcgtcgc    167160
     cgcgtcgacc gatcggcctt gttcaagatg cgggaggaga tgccgggcgg tggcgaaaac    167220
     ggccgcagca ggagcgcaac cggagacaga cagaggcgtg gcggccggtt cggccgcgac    167280
     aagcggagct tggagcatgg aggtcacttt caggagagcg ggacacggat gagccgcgtc    167340
     ggcgctctct ctggaccgga cgggctcaaa cccgtcccgg ccatcctctc actctgactt    167400
     ggtgccctcc ggcgcggcct tgccctgacg gatggggctc gatgccggcg gaccgcgtca    167460
     tgccgcgcgg gcgtcgagag cgttgccgtg gtcttgaagg tgatcggcca tcgcgaggaa    167520
     ccgacgtcga tcctcagcgc cgcgtttgac gcgaaatgag gcgtccacga catcgttgac    167580
     gcgcacccat tggttccagg cgaaactccg gccgaggccg accgtggtcg cggtgctggg    167640
     gaagcgatcg gccgagcgga cgagatcttc ccaggaggcc ccgaactgca cctcgctgaa    167700
     gcggctatgc cgtcctgtca gcgcgttgcg ctccaggacg agggcacgct cgagaagatc    167760
     gggataatgg gcggccagcc agtagagctc ccaaatcttc gatgctgggc agaagaagca    167820
     ggccgacttg atcggcacca tgtgcgcgcc aagcgtctcg gcaatgacgc ggatgcagtc    167880
     tgggcgatcc catccgagca tctggagcgg ataggcgtag tcgaaatccg catccgcggc    167940
     tgacaggcgt cgtgaccgcc gcagatcggc gcgcccgcaa tcataaccga tgagctttac    168000
     gatccgcgcg ccgcggcgag cggcttccag ccagatcgag tgcggctcgg ccgcgttcgg    168060
     gcccgatgcg gcgcctttga tggcctggtc ctgaggcttc tgcttccact tgatcgagca    168120
     ggacttcagc ccgaaggcca gcgatgggag ggtctcattg gccaggcaat tgccatagag    168180
     atcgccatag gcggtgccag gaagagtttg cttccggcaa cgaacgatgg ccggccagga    168240
     ccagcgcgcg agcacggcgt ccatccgatc gagatgatcg agcgtcgggg gcttttccgc    168300
     ggaggtgtcg gcgaaggtga tgatgtgcgg gcgcagcccg gcgagcttca acgcgatgag    168360
     catggcggtt gagtcgacgc cggcgccata acagacggca agcaggcggt cggcgagcgc    168420
     agcgcgcagc cgacggcgtt ggtcgagcat aagtggcatg tgcggctccg gaagggagag    168480
     cggtgggagg gcgagccggc tcctcgctct ctcgacgggc gggctcaacg cctccccgcc    168540
     gatcctctcg ctctggcgtt cgcggagccc ggctcgccgc gcagcctttc ggcggcgagg    168600
     tgggaacgct agacttcgcc aggaaaagaa acgggggcgg ctcgccgcat gcgagctggt    168660
     cccgcaggct ggagatcggg aggcgatatg aaaggcagcg caatcggcat cacgggggcg    168720
     gtgtgcctgg tgatcggatt cggcgcgggc ttcgcgctcc ggccggtgct gtcacccgtc    168780
     gcggcatcgc cggcagcggc ggccggcgtg gcgcagccga ccgaggaaga ggcgaccgcc    168840
     gccgtgcggc gtcatcgcct cttcacgggt acctcgctgg cgaacgcgac gctgaagctg    168900
     ggggactgtt ctccgggcgg tgtcggcccc ggggtgacct gcatgacgca gctcgtgatg    168960
     gacccgaccc gtcccaacgc gacgccgcag aatcggccga tcggcttcgc ccgcgtgaac    169020
     ggtcagtggg aggtggcggt ctggtagggc cggctatccg aaccggcgcc cgctgccggt    169080
     gaaggtgtag ccattggcga ggatcgcttc atcgatcacc tcatccgagg tcagatagtt    169140
     atattcgcgt tcgagctggc gatagagcca gcgcgcgaga tcgcgcagcg gctcgatcac    169200
     gaggtcctcg gcgtccgccg tcatgtcctg ccaggtcggg ctgtcgcgct cgaccgcgat    169260
     cgccatgcaa tattcgtgat agtagcggtc tcggtgcgtg atgctcacgc ggagctgata    169320
     gaagttgcgg cgctgaaccg cctgaagcgc atcggcgatg cggtgaaggt ccgcgtcgtc    169380
     gggcgcgtgg tcgcggatgc ggcgcgcggc gcctctggcg tgatggtagc ggccctcgaa    169440
     gcaggcgccg tcgccctggt tccagaagcc ggagaagtag atgcacggct gctgccgcgt    169500
     gccgccgccg tagaggcgca ccggcaccgt gcgcagctcg acgccgagga tggcgcagat    169560
     gcgctcgaaa tcgtcgaaca cgaactcgaa ccagtcgtgg tcgatgccgg cctcgcgata    169620
     ccaggcgcgg gccctttcct tcgccgcgtc cgaaagctcg tcgaggcgat agacggtggt    169680
     ttcgacgatt tcaggcatcg ggatcgcctc cgtcgagcac ttcggcgagc cagccattgg    169740
     tataggtcca tgcgaacgtg gcgccggtcg cgagatcgag gacgtgcgcg ccaccgccga    169800
     aggcgttgac gcgcgggcgc gagcaggtgt tggcgtattg aaagccccat agccccgtga    169860
     ggccgaaggc ggcggcgcag cgcctgacga actggatcag ccgctcgggg tcccccgtca    169920
     tgtcgtcgcg catccagagc tgggtgcccc catgctccgg ttcgatggaa aggaggaagc    169980
     cgtcggaggg cggctcctcc gatgctccct cctcggagag cgcgttgtag aggtcaagcg    170040
     cacgggcggc gttgtcgggc gtgccgacgt cgagcaggca cgagaaatga gtgaagtaat    170100
     cggccatgtc aggctccttg aaacgcaagt gcccggcgcg atggccgggc ttcggagttg    170160
     cgggtcgatg ggtgaggatc aggcggcggg cggcctgtgg atccggtcgt cgtcgaactc    170220
     gatgtcctcg atcacggttt ctcggccgtc gcccgtgcag cggtcgatga aggcgatgac    170280
     gccttcccgg cgctcgtcgg tatcgatgtg gtctggagag gccgtcgact ccacgacgac    170340
     ggcggccgcc gtcttggcct tctcgatcgc ttccgcgtcg ctcgcggcct ggacggtcag    170400
     cgtgtcatag gcgcgaagcc agaagccgat cttgacgatg tagtcgctca tgacgggcct    170460
     cccgcgtcgg gatcgcgcgc accagcgacg atcgcattgg ccttgcggac ggcggactgc    170520
     gccgccggca gccagcgccc gaagtcatgg gcggagaggc ccgtaggctg agcgaccgag    170580
     gaaagctgcg cgagcagctc ggcgaagtgg tcggccttgc gctggacggt ttcatcgaac    170640
     tggctcggaa taggcagcaa cggcacgctg tagggatcga ccgcgccggg ccaggcgccg    170700
     gtgacatggg tctcgccggc gcattcaaag tcttccctgg aaccctccca gtcgtcgtcc    170760
     tcgatggcaa ggcggcaggc ttcggcgagg ctgttcgcgg cgtagcgacg ctgccgatag    170820
     acgggaatcc ggtagctggt ttcgatggtg aagctgggca tgctgatctc ctgaaacgaa    170880
     aggagcccgg cacggggccg ggctcgtggg tcgcatggcg gtggcgacgg ctagtagccg    170940
     aaccgccagg acggccaagc ttgaccgtca tcggcggcgc gaacggcctc ggcgagatag    171000
     acggcgtcgc cgtcgaccgc gatcggatcg cggacaggcg tttcgtcgat gacagtcacc    171060
     cggcagacga ggccgtcttc gacttcgacg tggacgggta cgagatactg gaagacgacg    171120
     cggcggggcg tcgtggaatc gggctgatcc atggttcggt ccttcggcca gggagatgcg    171180
     gagcggccga agccgccccg ctggtccgtc actcggcggc ggcgaggtgg cgttcctcgt    171240
     cgtccgcgtc ggtcgagacc tcgtcctcgt cgtcgccgtt gaggaatgcc ggcaacgcgg    171300
     cgccctcgtc gtgcccagcc tcgctatcgg cggcgagttc ggcgtcgagc aggcggagcg    171360
     gctcgggcag ccagccggca tccgccagca accgctcggc ctccttggcc atgtcgccct    171420
     tcttgaggtg atcgatgagc tgcgcggcct gctcgccggc gccctcgcgc accgcctgca    171480
     ggatgcgggg cttggtgacg cgcccgagat agttgtcgac cgtagggcgc cagccgacgt    171540
     ccaccatgtc gagcccggtc gcgcgcgcca gacggtcggc ctgcgcgagc cgcatgtcga    171600
     gcgtgtgctg cgagacgccg ctggagctgt gcgggttcgg ccgctcgtag agcgcattca    171660
     cgccaaagct gacgcaatgc gccaggagcg ccatgcggct ggcgtcgtcg aggctggcga    171720
     gccagtccca gagggcttcg tcgtccttcg gaacgtcggc ggcccaggca tcgtgacggt    171780
     cttgcaccgc gcgcgcggag gggctgtcct tcaggtcggt atcctgaacg gggaagtaga    171840
     tatccctcac cgacgcctcc agggcgccgt tatacatgcg cgtcatgaac ctgtcggaga    171900
     cgagcttgtg gagcagcgcc gtcatggcga tgtgcggatt gtccgccacc gcgttgcgca    171960
     acgcgagcgt ccgagacgcc gtcagctcga cgatcaggcg ctcgtggagc ggcttgatcg    172020
     cgtcctcctc gtcgtcgtcg ggctcggccg actgtccgcc gatggtgatg acggcgcgct    172080
     gcacggccgg cgacgccggg tcgttggccg cgccggacgc ggccggggca tcgtcgcctt    172140
     cgggctccgc cggagcctcg tcctcgggac ggacatagcc gcagtccacc gcgagcgatc    172200
     cgtcggcgtc gatgctgatg aagacgcccg cgcgggcgat ctcggcggga tcgtagatca    172260
     ccggacgctg ctcgaaggcg tcgagcgcct gttcgatctc gccgagccgc tgatcgatct    172320
     cgtccggcag ttcgtcggct tccgcatatt cggattcgag ccgatcatat tcgtcgcgca    172380
     gagcctcgcg cgacgcgcgc tcctcgtcgg tcagatcgat cgtctcgccg gccagctcgc    172440
     gcagcccgtg gtcgtggcca taggggaagc tgacggccac ctcgatccac ttccagccct    172500
     cggccgcgat cgtctcggcc tcggccttga gcttttcggc caccaggcga tcgagaagcg    172560
     ccgcgtcctg cagccagccg ccgtcatcgg cctggaacag gtcgcggacg atgcatccgc    172620
     ctgcggcctc ataggcggcg acgccgacga acagggcgcg cttgtccgag gcccgcacgg    172680
     tggtctcgtt cagcatgcgc cggatctgat agggctcctt cgaccagctc ttgctgatcg    172740
     cctcccagac ctgttcctgg cgggcgtgat tgtcggtgac ggtgaacgcc atgagctgct    172800
     ccagcgtcat gccgtcgtcg gcatagacgt cgagcagagt cggcgagacc gcggccaggc    172860
     gcaggcgctg cttgacgacc tgcacggtca cgcgatgggc ggccgcgatg tcctcctcgg    172920
     gcgtgccctt gaggcgcatg tcctgaaagg cgcggaattc gtctagcgga tgcagcggct    172980
     cgcgatcggt gttctcgatg agggacactt cctcatcgag gatgggatcg ccggcggggc    173040
     ggacgacgca cggcacgagg gccgtcttgg cgagccgctt ctgcttcacc agcagctcga    173100
     gagcccgaaa ccggcgaccg ccggccggca cctcgaacaa gccggtctcc ttgccctcct    173160
     gatccaccac ggggcggacg ctgaggctct ggatgaggcc gcgacgggcg atcgagaccg    173220
     ccaggtcgtc gatcgaaacg ccggccttca cgcgccggac gttcctctgg ctcagcacca    173280
     gcttgttgaa gggaatgtcg cgcgccggcg acaggatgat cttctgaaca gtagtagcca    173340
     tcgggattta ctccgcgacg ggcggtcgag agactctctc tcaacctcca acccgtcacg    173400
     aaatcccggc cctcctctgc ctctcttctg ccggcgcggc gaccgtgatc cggcagaaga    173460
     tatcgccgcc ggacgtcctg tggcataggg caagggcgac tataatagtc gccgtgggcg    173520
     ccggcattgg gcgggcgcct ttcagcacga gggtggtggg acgtatcgag caggatggtc    173580
     gtcgcgtcac cacaggccgg ccgggccgta gcgcaggcgg gtcgcgggag atgtcatgaa    173640
     gacggccatt gccgaggagc ggcgctcagc gccctggggt tggatcagga acttcgcggg    173700
     atggcggcca cgacggcatc gcgtatcgag cgccgatcgc gcgctcattt gcgcccaggg    173760
     caaggcgttg acgctgctgc tcaccgcgct ccaggcgcgc ggccatcttc aggtcggcga    173820
     gttcgccgat atgctcggcg tgttcagcgt cgtcgtcgga aaggacgacg atctcgaagg    173880
     cgatatcctg gcggtctggg cggcaatcag gaaggagagc ctgtagggac tggcgcgcag    173940
     gcgctaagcc ggaaagacgt cattgcgtct ctccggcctc ccgggtcctg ccgctattca    174000
     aacccgtccg cagagcggat tgacgcgtcg gacgatgacg ggacgcgtgt cggccgcctg    174060
     cgcgagccgc cggatcaaag aaagatccgc ttcggagcaa tccccgcgca cctcgatgtc    174120
     gacccagtgg ccggcccgac cgacatggga gtcgcgcagg cgatgattgg acgaggtgta    174180
     gaagctctcg ttcggatcga tcaggcgtac ccgcgacgtc aggaagagga tgccggagcc    174240
     gagattgccg cagaagagca gctcgtcggc cggggtcgtc ttcggcccgc cgccgaccga    174300
     ctttcgtccg atctggcgaa aagcctcctc gaaagtggcg ggattggcgg tgatccgcgc    174360
     ctgggtctgt tgatgaaaga gccatggcgg gcgatcggga tcgagacggc cgatggcgat    174420
     ctgatggaga aagtccgcga aactcgcggg gtcggcgggg tacgggcagg tacgccacag    174480
     ggcgcgaacc ttgcgccgga gcggagcggg cagcgcgaag agcctggccc gggcctcgcg    174540
     ccagcgagcc gcgcgttgac ggcgctgttc atgctcgcgg tcgatccacc agacatgacg    174600
     gcgggccatc tcctcgtcga catcgcgctg gccggcggcg atcgcgtcgg cgaagagcgg    174660
     cagggcgtcg cgctcgcggc gctgcttgcg gaggagcgcc gcgcgtttgc gcggcgtctc    174720
     ccgataggcg gttgggcgcg gccagcgacg gaagcgcatc atacgtcctc ccggctggcg    174780
     tgatgaaccg catgaagcac gcgctcggcg gctcgaatgc tcccggtcct gcgcgccgcc    174840
     tcggcccagg ccgagatcgg gaacaggccc tcgaacagga tgtcgcgctc gatgccgagg    174900
     ccgaacggca ggcgcaccgc cgcgagttcc gacaggctga acgacccgag ctcaggctcg    174960
     ccaagatcgg cgagaccgaa cagggtgtcg ccgtcggcgt cgagttcggt ggcgagccag    175020
     acgccttcgc ccagcgggtt gaagaacttg accacgggca tagggtcggc gtccgcctgc    175080
     cggccgttcg ccagcaggcg ctggcgcagc tcggaagtga ggaggatcat gccgccctcc    175140
     tgtcggtcga aggtgcggcc tggtcgtccg cgggcaggaa ggcgagcagc cagtcggccg    175200
     ccttgctcgc ctggctggcg gcgcggacaa tggcgcgatt gtcctcgcgc agcacctcca    175260
     gccaggagcc gatatagtcg gcatgcctga cggtcggcac gatgccgatc gaggcgcagc    175320
     agaaggcggc gttcatttca gccacatatc ctgacagtcc agccctaatg tgacttctac    175380
     cgcaaatttt cggggcgctt atcatgcggc gatctcctca ggctggggct gctgggcgtg    175440
     catccaatcg gcggccgcct gcgccttgct ggcggcggtg aagatggcgc gagggtcgtc    175500
     tttgagtgcg cgcaaccacg atgctacgta ggcggcatga tcggcccgcg gatggtgagc    175560
     gatcctgagg tcggcgagta cgaacgatgc ggtcagttca gcgcaaattt cctcgatcgc    175620
     caagctgtcg cgcttgaaac gttcggcaaa gttgcggtcg agccggtgct ttgcccctgt    175680
     ggcgtgggcc gcctcatgca aaagcgtgcc catctgtgct gatgcatccc gaaacgaggc    175740
     aaaggtcggc atgaagatgt gatcgaggtc gatccggtag tgcgcatcgt aggcgccctc    175800
     ggtgatcggg atcttgaggg ccgcgacgaa agcttcggcg tgcccgaacc gctcgccctc    175860
     gggtagaact gcgacaggtg ggggttcata gccctcgacc tgggcgaggt tgaacacggt    175920
     gaaggcccgc gcgaacatgc ggccgggtcc ggcttcgcca tcgtcatgat catcatcggc    175980
     gcgcgatgcg gcctgtttcc agaacacaac cgtcgttccg cgttcacctt tgcggacctg    176040
     tgcgccaagc gatgcccact ggcgataggt cccccaaaga ccgctggaat aggcagccgc    176100
     ttcggctgcg atccagagcg cgagcacgtt gacgccgcga tagcggcggc gagaggtgac    176160
     gttctgcggc ctggtggtgg cagcgccatc atggtgccag ggcatgcgcc aatcgccggc    176220
     cccggcttcg atggcagata caatctcggt ggtgatgcgc gaataaacgt cggctcgcgg    176280
     cgtcgcaggg taggatcggg acatggcagg tctccacgac gggcggaggg aaactgtctt    176340
     ccgctccttc aatccgtcac ccgcaaaccc gcctcctctt cctctcccgc cataccgtta    176400
     tgcggtgtgg cggtacccgg tgcgatctgt tcaagaacac gctggattct ggccacctcg    176460
     gcctgaagcg tcacccgctg cggctctgga agccgcttct cgcgcaacaa caaccgtgcc    176520
     tcatcagcac cgcgctgcca tgccgggcga tgccgttcgg cgatgcaggc attggggcag    176580
     cggaccggtt cgcacatgga gatcattggc ccgcttgcgc ctggctccga actccggttc    176640
     aggcacaggg cggttgccgg atcaaagaag caatcggcca gcgggccgac atgcaatgtc    176700
     cgcgcgagac tgcccagcat ggtgcgcaga cgtggacggt cggcaatcat ggcaggtagc    176760
     ggcgccaact cgtgggcggc agtatcaagc acaactccga ccctgttcgc ggcaggtccg    176820
     ccaaggcgtg cgccactttg ccgctcgtcg aagtagacaa ggatatcgtc aatctggcca    176880
     agcgcacgct gggcttcgat ctctccccga aatccggacc ggctgctgcc agcatagcct    176940
     tcgaaagccg caacgctcgc atgcttgtac tggatcatgc cggcaattgt tccgaagggc    177000
     cggttggcga tgtgccaggc gattgtgcgg cgaaactgac gcgttgtcag acgccatggt    177060
     cggccgtcgg gtccggcagg aatgacgggt gcctgcgcgg atccgaagtg gtcattgagg    177120
     tgatcgcgga accggttgag ttgccggact atctctgcag agacgtgcgt cttggtattg    177180
     gcccgaagcg tgaggactgg ccacagggtc gttgttccgc gcgcttgtcc cgcccgcgcg    177240
     gaaaggcgtt cgaggacatc gatggcttca gcgaccggcg cgatggtaac ccactcggtc    177300
     tcctcgccgc cgccgcgctt gcccttgtaa gcagtggact tgatacgatg ccgcaagatc    177360
     gtaccgtctt cggctttggt aatagacagg catccccgcc tcatggcttg gatctcgctg    177420
     tcccgcatgc ctgagagaaa ggcacatacg atataggctg cggactgcag catgacttcc    177480
     tcgaggggca aaaccttggc atcgaagcgg gtgcgccaag gcatgcccgt atcgggatcg    177540
     gcagaattgg gcgtatccat gccgccaatc tcggtgccga gttctgcgat ggcagcggcg    177600
     atgaggtctg gtgcacccgt ggccaggcca aggtgcatgg caggttcggc ctgcgcgttg    177660
     ataccggcat ggaggtggat caggtggtag ttgatcggcg gcgtgacggc gccggtttgc    177720
     ggatctgttc gcgttgcgcc gttatgtgcc gtggtccaga tcggaatgcc gcgcccatgc    177780
     tgccgcaagg atgcaacata gtcgaggagg cgttggcgtt gccgtaaccg acgaacagcg    177840
     ggatccagac cttcctcagc ggcaatcaga cggttgcgcg ttgcttcaag gcaatcgagt    177900
     tctgcccgtg cggcaaggat atcgcctgcg tagcaggtca cgtagcgcaa cgaccaggag    177960
     agcagcggcg tcatgatcgc ttcaggaatg cgcggcgtcc ggttctcccc tgcaatatgc    178020
     tttgcgcccg ccacggaaaa cggacttcgt cccggccacg gttcgaagga caggcgcgca    178080
     gtcggcagat gatgctgcaa ctcgtgcagg tcaaagacga tccgcagcag cgctgccgct    178140
     gcaactgggc gcagcccggc taggcgcaag gctccggcgt agcgatcgac cagagcctga    178200
     tcgacccggg cgagatcgaa acgccccagc tgagccttga cgaagtcgaa aaagcgcaag    178260
     gtccggttgg cctcgccgcg caccccggcc ggctcaagcc gcgaacggtg accggggaga    178320
     tcgacattga gccgcgcatg gagaatctgg cgcagggcat cagcaatgga tgggtctttg    178380
     ataccgccga aatgtaccgt gacatggcag cgccgcgcgt tgtcgcgaaa tacgccggga    178440
     gccagatccc acactggatc gccgtatcgt gaaatatgcg cgcgatcgca gccggggcgc    178500
     aaaggcgcgg acataagcac agggagggca tcgcgctcat cgtcgctctc cgccagaagc    178560
     tggacaacgg tcatgcccgt gcctctggcg gcagatagac cgtgggaggg tcgttcgcga    178620
     cttgcgcacg ggcccttgtc acgacgtctt cggcgaaggc aggcagaatc tgctgaacga    178680
     tgcgatcatg ggcatgacca aacttggcgg tccaatcagc agcactcagg ccgatccgct    178740
     gagcgtcgac gaaggagaga aaggtgagaa tggcaggcag cttgcgcgcg gtaatgaccg    178800
     cgttgcggca atcgaggcag gcccagaacg gtgtagggca tggcgtgccg gcggatgcga    178860
     agggactgga atagaagttg ccacagcttg caagccagac gtcttgttcg ccattgagca    178920
     gtgcggttga aatgccccca tcatcgggat cagggcttgc caactcgccg cgcagccggt    178980
     cctcgtcttg aggaggcagg atcattggac cagcgagcac ctcttcgagg gcatctgcca    179040
     cggtttgctc gtgcagcggt ctgagggagg gaatatcggc gtagtgccgt gccgcgatat    179100
     cgacggtatg acctacggcg aagcgggcca tgtggccttc ggtcttgaga taccacaagg    179160
     ccttgtgcgt cttgcgcaga tacgaaagac acaggtggag cggtttaccc tgatcatcgg    179220
     taatacaatg gcgctgcgtc caggcactga ccttcaagcg cagttgacga atacctgcgg    179280
     tgatctcgcc cggctgaaaa tagacccaaa ggttatcgct ggagttatgg accctggcct    179340
     tggacgatag ggcgatgatg cgtcggatca gaccgccagc ggtggatgag ccgcgatcac    179400
     gcacccggat tgtcttgtgc tcggcaccgt gtgcccgcag cttggtgtag gcgatatcga    179460
     cggtaccccc tgcggcattg cgcagacaat cgagggtgag cgacttgcag cactccagct    179520
     caagccctgt ctcgattaag agcagaacaa gaagcgggac gatatcgtcg gcagtaagat    179580
     agtgggctgc gtggaggctc aggttaagcc tgtcactggt gagatcgcgc tttttgcgca    179640
     gcttgtacag gctctgaaac gtgggatcac ggtagcccag aacaccgtat gtctcgatgg    179700
     cagcatgggc tttgcaatat gcgccatcga tctgcggcac ctcatcgaac tgcggccccg    179760
     accgcaagcg cgcctcgatc gcagcgatat ccgcgcgtgc cgcatcgcgc agctggcggg    179820
     ctacatacgg actgtaggca tcgcgtggac gggaacgaac gtgtgcgtgt gagctgacgt    179880
     agcgcagtcg ttcccgcaag ccgcaatcga caagctcggg gctgtcgtcc gcgatgcgac    179940
     gaaggacgga aacgaccttg gcgacatagg ttggtccatg cacgcaagac ttgccctgcg    180000
     cgctgagcca tgtctcaaat ccatcaatgt gatgggcacg aaggtcagca gggccgttga    180060
     tcccgtcgcc tgtcccggcc aggtaggaaa agaagcttgg cagctggttg gcgtatgtct    180120
     tgagcgacga acgtaccatg atggggccgc gcggagcagc cagcatgaac aggctccggg    180180
     caaatgcgag cgccaggccg cgtggccgca agcccgtgaa atcgacgagc agctcgccgc    180240
     catataaggg atgaatcatg aagcgcagcg tgctgatctg cgaccatgga tcggcttggg    180300
     gcgcagccgt atctgccgcg aagctgacct tgcgtccttt gcgtggagca gcggtcatga    180360
     tcgaagatag cctggtacga gtgccagcag ttcttcgact gccgcatcaa cggtatcggc    180420
     acgcgtggcg aggtgatcga gataaataga ggtcgtcgcg aggctcgaat ggccaagcaa    180480
     tcgctggacc tgttgaagcg gatcgccgac cagctggcga taaccttcca tggcgcccac    180540
     tggtgccgct gcgtcggcga ggcggcgctg gatcagcatg gcaagcatgt ggactgcaaa    180600
     ggaatgccgg agttgatggg ggctaagccg gaccgggatg ccggcgtccg tgcagcggcg    180660
     gctcgcccgt gcgaagatcg cttcccacga gttgggcaac acaggatggc ccacctcggt    180720
     cagccagagg accgcggctt cgcgcggcgt tccatcgtca gcgcaaataa caagccttgc    180780
     gcgttcatcc ggtgtgacga cctctatgtc catcgtgcca ccgccaacga gatgcaatgc    180840
     acgctgcccg aatgaggggc tgtggatgaa gatcgggcgg tcgatggctt cccagccacg    180900
     gcgctgtgcg aacttggcga cggctgcggc tcgctcaacg gcgatgtagg cgtcaaacac    180960
     cggcaacaag cggcgcggca gcagcatgct tcgccccctg tcacccttgg tgagtgccgc    181020
     cggaagctcg acccgccgct gacgttccga gcgggcgtcg caaaccggaa tctcagctgc    181080
     gagcaagtgg gatgcctctt ccaggcgcag gccggtggtg accagcagat cggcgaacag    181140
     cgcgttgcgc gcgccattgc ggtcacgcgc tccaggacgc tcggtccctt caacggtcag    181200
     gccgcgcaaa ccaacttccc ggaaggcgcg gtaatcggtg agatcgatga aacggacgtc    181260
     ggaacgacgg gctgcgcgct cataggcgtt attgcggccc gtgaccgccg cacggcgccc    181320
     atcgtgcgat cgtcgccaga cctgacgatg cgtaaaaggt gtacgctcga tcagcccctc    181380
     ccgttcggcc catcgataaa gcttgtcgag cgaggcaatc gcccggttcc acgtcgatgc    181440
     agaaatccgg aactcagcat cgctgcgccg ccgggcacga tgataggcac cgacatcatc    181500
     ggcatcggct tgccagacag acttgccgcg ggccgaagcg agaaagcgaa cccagaccag    181560
     aacatcataa ccatgggcgc gcaacgagtg tcgcgaacgc gaaccgttca gcggcaaatc    181620
     gaggaagtag cgctcaaggt ggagatcata gatcgcacca tcacgcagaa ttaccgggat    181680
     gtaggagtcc aggccatccg ccgtccggcg ctcctgaatg acgatcgacg cacctgaatt    181740
     atccacagct tgtcagtccc tcccccggac cccctcccga ctccagatcg cacacgttgc    181800
     gcgcctgcgg gacggtggtc atcaggccgg attacgccag cttatggata gcgcttcatc    181860
     cggcctgatg cccccctgcg tcgcgccaaa gcataccgtt caatggtgcg tcaggcacgg    181920
     tgcagactgt ccagataagg cgaccaactc ctcgaacgca tatgcctgat cgccgaagcg    181980
     cttcccgaac gatcgggcaa gccgggctgg atggcctgtc cagtggccgg cctcatgcgc    182040
     aatggtggct gcccaggcgg cgcgcgtgtc gaattgctcg accggcggca tggtgatgac    182100
     gtccgcgcgc agatcataat aagcacgatc gccgccgcat cgcagccgcg cgggcagccg    182160
     atcgacgaag cgctccgccc gcggaccgag ccggtcgccc ggcgggacga gggagagggc    182220
     ttcgggatag aaatcgcccg gcagtgtatc gatctgatcg gcattgaaga ccgcatagga    182280
     ccgcatgacc cggcgctgct catcgacgag ctcacccgga cgttcgtagg aatcgacctt    182340
     cttcgaatag gctttgtaga agatcgcaaa ttgcgactgc tcaccggcac ggacctgccc    182400
     gccgaggctt tgtgcttgcc gataggtcat ccagtagcgg gaccgatagc cgcactgctc    182460
     ggcggccagc catagccaaa aggtgttcat gccgcgatag ggctcgccat tggcgcgcag    182520
     cgggcgccct tgcgcggcgc atgatcgcca gggccgtacc cagggacgca caccggcctc    182580
     gagccggtcg atgatggcgc gcgtgatggt ctcggccggc gagggccggc ccgatgattg    182640
     ggtcatggtg gatactccgc gaaagagcgg ctgtctcagc gccgccgatg aagggcggcg    182700
     ggcgacacga aagcgccgcc cgccgttagg cgttcgcctc aggcggcctg ttcgaagtcg    182760
     ccagcatcgc catcgggggc gatctcccct gccccgccgt cgctgtcgtc ttcatcgctg    182820
     aggaaagcgg aatagctccg gaagctttcg ggcttttcga tcgcgccgaa ccgcatctcg    182880
     tcgggcagcc aggagagcgc cttttcccgg acttcggcct cgacgatgcc ctgccccgaa    182940
     cagagcgcag cgcaggcatt ggcaaggtca cccttcttgg cgtccttgta tcggccgcgc    183000
     agcaccggcc cgccgatctc gtcgagcgct tcgagcatga cgtccttctt cacccgcccg    183060
     aaaaagttct gggcatcggg ccgccaccat tgcgcgacat caatgtcgag cagccgtccg    183120
     agatgatcgt ggaagccgtt gcggcgcccg ccatcgtcga cgttgagtgt cggctccagc    183180
     gtctgcgcca tgacatgggc gagccaatcg gcgcgcgcct gttcatccag ttgccggaag    183240
     gcatcgaagc gggacgacag cgtgttcccg cctgcccagc tcacatcgag cgcctggcgc    183300
     tgttcggtca ggacattgct cgccgcgcta ccttcatcgc ggaagctgac gatcgggaag    183360
     ctcgcggcgg cggcctgcaa cgtcgcgtgg tcccggacat agctgctggc gaacaccgtc    183420
     cggtgcgcca tcaggaatat cgtgagatcg agcgcgaacc cggcatccga ggcgacatgg    183480
     gctgccagga tctgccggcg ctgggtcgcg agttcgtcaa ccagcgtcgc gctgagccgg    183540
     gaggccgcga ccttgccgga cggtgcttcg ggttctgcat cctcgcccgc ctgccggatg    183600
     gcgcgctcgc tgaacatgcg gctgtgcacc cgcggactgc catcgggcgc cagatagatg    183660
     aaggtgccca gctggtcctt gatcgcatca tcgaccatcg tgcgcgacgc ctcgatcgta    183720
     tcgagttccc gctcgatgtc ggcgagacgc gccgaagccg cctcggcctc gggcgtgccg    183780
     tcctcgagtt cggtctcaag ttcgcggatg agcgcgtcgc cctcatccga gagactatcg    183840
     acgcgctcct gctcgtcccc gctcaattcg cgcagcggcg gatgatattc gtggagctgg    183900
     cactccgtat catagggcac atgcgtcgcg agaaccggcg tcacgaacgc cagcttctgt    183960
     tcggcagcga gcgcttccgc ggccgcttca agcttctggg cggccagctg ctcgatgagc    184020
     tccacgtcga tccagctctc gtccacatct tcaccgaaca ggtcgcgctc gatccggccg    184080
     cccgcgccga cataggcctc gcggccgacg aaccgtgcct tggcgtcggt cgccttgacc    184140
     gttccgttga ggagcgcacg gcggatattg tcgggattgt cgccataata ggaccggctc    184200
     atgctctcga acacgcgcgc ctggcgatcg acgtcgggcg tgacggcata agcctgggcg    184260
     acccccagcg tgatctcgcc cgccgccagc gccgcgaata cgagaggagc cagttcggca    184320
     agccgtaccc gctgctcaac gaagcgggtc gtgacgccga aacgtttcgc cacatcctcg    184380
     gcactcgcgc ccttgtcgag gaagtgcttg aaagccgagc actcatccgc cgggttcatc    184440
     gcgacgcggt ggaaattctc ggcaaggctc gcttcggccg atccagcatc atcctcgagc    184500
     accagcacct gaacctcatg gtccccggca agccgacctg aatcgatcag ccgctggagc    184560
     gcccgcaagc ggcggccacc cgccttgacg gtgaaatgtc ctgccttctt gagcggcgtg    184620
     accacgagat tctgcaacag gccatgcgcg gcgatattgt cggcgaggct gtcgaggtcg    184680
     gcatcgcgat tggatttgcg gacattgtcc ttcgagagcg agaggttctt gaccttcacg    184740
     gactggatca tcggttgtct ccttcgaggg ttgcgccgac ctcgtcggcc ggcttgagcc    184800
     actcaggccc acccggccga aggccccctc ccctctcttc ggtcgcttgg cgcggccgcg    184860
     ggtcagtccg tgatcctggc gaggatctcg agggcgcggc tcgggggaac gaacagccgc    184920
     gtgcggtgct ggatgatctc ggtgaagcag cccgccgcct tgagatgcgg cagcgcctcg    184980
     ggcttccagt ccagcaattc gaggcgttga tcgccggcga ccaaggcgcg cttcagccgc    185040
     agcgctccga tcggcatgat ctcgcccgag gtgcggacgt gctcgacccg cgcgccgagg    185100
     tcgatctcga catgggccgc gatgccgaat gcgctggcaa tccgctcaac cagcggcgcc    185160
     ggaataagac gcccgagaag cgactggccg tcatcgctcg tcagccgcca gacctggaca    185220
     tgatcgtcgg gcagcttgcc ccacaccgga agcagcaggc cagtgaccag atagatgatc    185280
     tgcgtgcgcg tctgcgccgc cattgcgtcg cattcggcct gccaggcttc gtcgaagctc    185340
     gcccggtcca cgtcggtcca atgggtttcg gcgaagaggt cctgccggtg ccgttcggtg    185400
     cgcgtcggcc gcaccagctc atagcggcgc acggtccgcc cctcttcgtc cgtcagcgag    185460
     aaggtcggcc ggcaaatggc ggccttgccg gaacgcgggt tgatcaaccc gcgcgcttcc    185520
     gggtcggcca gaagccaatg cgctcgctcc agggtcagcg gccgatatcg ctcctcggtt    185580
     tcgatacgca ggatctcggt ttcggcgccg ctcacgggat cgcgccggat caccgtccgg    185640
     tcgaggatcg aaatacggtc ggccgcgatc gtttcgacgc caagatcgag ggtgccggcc    185700
     tcgcgtgcct tttccacccg tgcttcgatc aagccgagat attcgtcgaa gatcgcgttc    185760
     tgcaggtcga tgcgcagcgc caggatgcgg ttcaaccacc gctggatcgt gggcaaggtc    185820
     tcggtgagcc ccccgccctc cccggccagg ttcaaaccgg tgagcgcctg gaactgatcg    185880
     aagtggaccg attggagttt tgcctggaac agcaggcgaa accactggtc gagcgattcc    185940
     cgcgcgaagt cggactccag attgtcgcgg gggtcgaaaa gtccctgccc gccggtctgg    186000
     cgttggccac gggtcagcgc gcccaggctg tcgaggcgcc gggcgatggt cgagatgaac    186060
     cgccgttcgc cacggcaatc ggtggaaacg ggccgaaaca agggcgggca ggcttggtgg    186120
     gtgcggtgcg tgcggcccag cccctggatc gccgcgtccg cgcgccaacc gggctcgagg    186180
     agatagtgaa tgcggcggct ctgattgggc gcgtcgaggc tggcgtggta actccgcccc    186240
     gtgccgccgg cgtcggagaa gatcaggatg cgcttttcgc cgcgcatgaa gatgtcggtc    186300
     tccgcgaggt tcgtgcgcgc gctgcgccgt tcgatccgct gacggccgtc ggcatcgacg    186360
     acgatccgcc ggctgcggcc cgtcacctcg gccacagcct ccgtcccgaa atgcccgatt    186420
     atgtgatcga gcgccgagcc gacgaccggc agcgcacaga gttgctcgag gagctggtcg    186480
     cgcatggcca tcgcttcccg gcacagcacg ggctgcccgg cctcgtcgat catcggttcc    186540
     gagcgcaccg tgccgctatc gtcggtatag gtgcgcatct ggcgcacggg aaaggccgcg    186600
     gtcagataat cgaccaggaa ttcgcgcggg gacagctcga tatcgagcca ggcgcgctcc    186660
     tcgggggaca ggtcggcaag ggcacgatcg agcatcgctt ccgaggtcga cacgagctgg    186720
     acgacggcgc agtcgccgcg cgcgagatcg gcggcgatcg ccgggatcag cgagggcagc    186780
     ttcatcgaca gcaggatctg gccgaagaag cgttgcttgg tcgattcgaa gatcgacaat    186840
     gccgcggcct tcgcgccgct attataggtg gcaccgctga agccgtcggt gacgcgcgtg    186900
     gcggcgagcg cggcctgcag attgttgtga atgatcgccc aggcatcggc ataggcattg    186960
     tagacggcga tctgttcttc gctgagccga tgctcgagga tgtcatattc gacgccggcg    187020
     aagctgagcg cccgcgcggc atagaggccc tgcgctttga ggtcgcgggc gatcaactcc    187080
     atcgccgcga tgccgcctcg gcgcagggat tccacgaagg cccgccggtc ggcgaaggcc    187140
     gtctgcggtc cccacaatcc gaggcgtgtc gcataggcaa gattgttgac atccgaggcg    187200
     cccgtcgccg aggcgtagag aatccgggcg cgcggagcga gattttgcag gcggacgccg    187260
     gcaatgccct gctcggaccc tttcgtggcg ccgaaccggc cctcgccgcc ggccaccccg    187320
     gccatttcat gcgcctcgtc gaaaacgatg acgccgctga aatcctcacc catccattcg    187380
     atcagctggc gcagccgcgt gcccctgtcg ccgcggttgg agcgcagggt ggcataggtc    187440
     aggaagagga tcccatcgcc cagcgcgatc ggggtgccga gcttccactg gttgagatgc    187500
     tggatgtcga gcggcaagcc gccaagcgcc gaccagtccc ggcgagcgtc ttcgaccagc    187560
     gtctcgctct tggatatcca gaggtggcgg cggttgccac gcaaccactg gtcgaggatg    187620
     acgcctgcca cctgccgccc cttgccggcg cccgtgccat cgccaaggaa aaagccggtc    187680
     cgataggcgt taccggcctc tgccggcgac agcgaaagac cctcctcgct ggatatgaac    187740
     cgcccgggaa gatcgcgctc gaacgccgcg ccagcgtaga tcagcgtttc gagctgcgcg    187800
     tccgagagca ggccgtcgtc caggatcctg gccggcagca cgggttcata agcgaccggg    187860
     ggtgcggcaa tcgatcccat tgcctgcgat tcgaccagcg cgcttgggtg ctcacgagca    187920
     tcggcaatca gcagacggct cggccgatag ggcaggtaaa tcccttgcgg ttcgcccgcg    187980
     ggtgcgggcg cgtcgagacg gtgataggcg accgcgcggg tcgtgggcag ggtcaccgcc    188040
     gcacgcgagc agacggggcg ggtccgccgc gtgaggcccc ggaacaatcc gctggggcgg    188100
     gagatcggct gcggctgcgg cgcgcatggg gtcgccatcg catcgatggc cgcaagcgca    188160
     gcgccgagcg tcgtgcaggt ctggcgcggg accgagcccc ctgccccgtc cttttcgagg    188220
     agtatgagct ggactgcctg gccggtgccg tgcttggcat aggcatcggg cggcaggtcg    188280
     agatgcagcc gggcatgcgc acccgcagtg gcgtgcagcc aatccgcgtc ctccgtctcg    188340
     atgcggtcgg ggagaataac ggcgcagcgc ccgcctggag caagccgcaa cagcgcggag    188400
     cgcaaatggc gaagcgcggc atggcgatcg cgcgcgcgcc cctggcttcg cgagaagggc    188460
     ggattgagga gcacgacgct cggcaccagt tgcggatcga gcatatcgtc gatcagttcg    188520
     ccatcatgcg tgctcagcct gccttcggga aaggcgtgac gcagcaaacg cgtgcgccag    188580
     gcatcgatat cattgagaag gaggcgcgcg ccggcgagat gggcgtgtac ggccaggagg    188640
     ccggtcccgg ccgagggctc gagcacgata tcgtgtgccg tgatcgcggc tgccttggcg    188700
     gcaaggaagc cgatcggcgc cggtgtcgag aattgctgga acgcgatctg cgtttcgcta    188760
     cgcacgcttt gcgtgggaag cgccgccgtc atagcgatca gctgggcgag ccgcgcattc    188820
     gcatctgccg ggagcgtcgc gttcttcaga tggaggacct gcgcgagttc gagcacatcg    188880
     taggcgtcgc gcaatgacca caggccatcg gcgctcgagc caccgaaagc ggaggtcatt    188940
     tcggcaagga ggtcgttacg tgcaaccgga catccttcgg acagccggtc ggctatgcct    189000
     tgagcagcgg tacgggcggg atcatcgagc ggcagcgtga gcgcgagggg gtgtgtggcc    189060
     atggggcatc tccaggtctg acacctggca tcagcgccag gtcatcagcc ggaaggctcc    189120
     ctcccctttc aggccgcctc ggcggcccgg cggacacgcc aagcatcatt ccagtccgcg    189180
     tgccgttccg gcagccggag caccagttcg cgtccattgg ctgtgagatg ggggcgggct    189240
     tttttgagca tggcggcagc ggcggcaccg cgatcgccat agacgatgat acgcttgacc    189300
     cgttcgggga tggcgacaag cccaaggcgt tcgaccccgc ccagcgccca ggtgggcgtt    189360
     ccgaaccagg ccattgctga aagggcgtcc tcgatgcctt cggcaaggcc aagctcctcg    189420
     ccggccggcg ccagacgaat ggccgcgtcg ccgagaaggc caagggcaat cttcggcttt    189480
     ggcatgggtt tgtgcaggat gtcggcgaga tcgaggcagg tccgctggac ggcgacaacc    189540
     cccagatcat tctcgaccgc ggcgatcatc gccggaaaga accggcggcg ctcaccggcc    189600
     ccgacgatgg tgcgcgggtt gtagcgcagg caacgcggat agggaggcgg cagaccgcgc    189660
     gccgccagat aatcggccgc tggagatccg gcgatgggct ggctcgcctt ccataggcga    189720
     agtgcaagag cgcgatggtc cgcggccgcc ttcgggcgcg gcattgtgag cggctccgca    189780
     tcgtgaagtt tgcgccggcg caaagcagcc agaacatcgc gcgtgtcgca gccggcaaag    189840
     cagtggaaca ggatcgcccg ctcgcccagg cgtaccgaca ggctgggacc atgatcgtta    189900
     tgtgccgggc accggcattc gccgcgcgta ccgcgccaga tcccacccag ggcttcgaca    189960
     atggctttgg cgcgatgggg agcagctatg ggcatcgact aatcctcgga agtggtggag    190020
     cgccgctgct gattgcgccc tcccctcccc gatatttcac cccggcatgc ctttggctgc    190080
     caggatcccg aattcctcga cgatgcgatc ggttgtgtag tgcgtcgcgc cgtcgcgttc    190140
     ataggagttg tccttgagcc gtccggctat gcgcacgaga tccccgactt gagcccggtc    190200
     ggcgatatgt tttcgctggc cttcgctgaa gacgctcacg cggttccagt ggctgtcttc    190260
     ctgccattcg ttatcgtcac ccttgcggcg ataattcgcg cagaccgaca gcagggtgac    190320
     tttcggccgc gcgtcgattt ccccgatccg gccgatgatc tcgaacttgg cgaagttgat    190380
     catgcaccct ccatgcgcaa ggtcatttgg ccggcagcct atcgtaggcg gctaacttcg    190440
     cgtatccctc caggcggggg gattgaacga ttgcatcagg cgcgacgccg atctctttct    190500
     caaaataaaa agaatcaaaa cgccgctgct cgcagcggaa gcttttccga ttcaaaagga    190560
     ttcagattca ggaggccgaa agcacagcat ttctgcgggt ttgagcaagc ttatcctgac    190620
     cggacggggg attttgcctg cccttccggg ggcgcttccc tgaccgatcg ggggatgcaa    190680
     cctgacctgc tggggccttc ctgaccgtat gggggacagc ttcctgctgg agtgattcgc    190740
     tcgccatagc gttcgtcagg gactttcttc ggcgtccgcg ctgccgtttg cgcgggtccg    190800
     ggcgcttgga aacgcgactc gccgcacttc ctcatggttt gctgcttcgg agcgaagttc    190860
     catcctgacc tcttgggggc cgaatccggt gtctatcctg ccctgacttg acgcgtaagg    190920
     acaggtcagg cagattttct cccacgctgg acgaatcggc gcagacttca tggc          190974
//

If you have problems or comments...

PBIL Back to PBIL home page