(data stored in SCRATCH zone)

EMBL: AP010806

ID   AP010806; SV 1; circular; genomic DNA; STD; PRO; 31776 BP.
XX
AC   AP010806;
XX
PR   Project:PRJDA19949;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Sphingobium japonicum UT26S plasmid pUT1 DNA, complete genome.
XX
KW   .
XX
OS   Sphingobium japonicum UT26S
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Sphingobium.
OG   Plasmid pUT1
XX
RN   [1]
RP   1-31776
RA   Nagata Y., Ohtsubo Y., Oguchi A., Ankai A., Yashiro I., Fukui S.,
RA   Kamata S., Takahashi M., Ichikawa N., Tanikawa S., Tsuda M., Fujita N.;
RT   ;
RL   Submitted (04-JUL-2008) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institure of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RX   DOI; 10.1128/JB.00961-10.
RX   PUBMED; 20817768.
RA   Nagata Y., Ohtsubo Y., Endo R., Ichikawa N., Ankai A., Oguchi A., Fukui S.,
RA   Fujita N., Tsuda M.;
RT   "Complete Genome Sequence of the Representative
RT   gamma-Hexachlorocyclohexane-Degrading Bacterium Sphingobium japonicum
RT   UT26";
RL   J. Bacteriol. 192(21):5852-5853(2010).
XX
DR   MD5; 5011db30954796e361122472b890bdf9.
DR   BioSample; SAMD00060927.
DR   EuropePMC; PMC2953701; 20817768.
DR   EuropePMC; PMC4289293; 25418849.
DR   StrainInfo; 715801; 0.
XX
CC   "Nagata, Y., Ohtsubo, Y. and Tsuda, M. are at Department of
CC   Environmental Life Sciences Graduate School of Life Science,
CC   Tohoku University. The other authors are at NITE Genome Analysis
CC   Center (NGAC).
CC   Please visit our web site. URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE. The database
CC   contains genome sequence data, physical maps and the genomic and
CC   proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for the
CC   sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..31776
FT                   /organism="Sphingobium japonicum UT26S"
FT                   /plasmid="pUT1"
FT                   /strain="UT26S"
FT                   /mol_type="genomic DNA"
FT                   /note="strain coidentity: NBRC 101211"
FT                   /db_xref="taxon:452662"
FT                   /culture_collection="NBRC:101211"
FT   CDS_pept        1..1104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="SJA_P2-00010"
FT                   /product="plasmid replication initiator protein RepA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99177"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z995"
FT                   /protein_id="BAI99177.1"
FT                   /translation="MKPRIEPDRQRNPELPLAVNETPNGAEGRPPLLPVRYPDPDLFIC
FT                   DVLDAIPKDDMASMEHPIFSLATKPDRRVFRYEHNGNKLEIVPSVKGLATIHDKDILIY
FT                   CISQLIGKMNQGERPSRTLHLTARDLLVWTNRQTDGDGYDRLRSAFERLSGTRITTNIK
FT                   ADGEEITEGFGLINEWRIVRQTRSGQMSEIKVTLSDWLFKMVEGRSVLTLHRDYFRLRK
FT                   PLERRIYELARKHCGAQEKWSISVETLQKKTGASSHLRVFRSMLRDLVAHDHLPDYAVE
FT                   MNGDTVTFRNREALDTVEAIEAEPERPYIDPEGFHDAKSVAPGYDVYALYDQWVSWWID
FT                   SGRPELKSPRAAFIGFCRNKHKTAPLR"
FT   CDS_pept        complement(1133..1417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99178"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z996"
FT                   /protein_id="BAI99178.1"
FT                   /translation="MAKGGNSLQAVLNRAKADGDAAPAPAPAIEPVDVSRKAPPSGRQG
FT                   TKLIGGHFPPEVSTQLRIIAAEEGTTVQSLLGEALDDLFVKKGRGRITS"
FT   CDS_pept        complement(1417..2052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SJA_P2-00030"
FT                   /product="partitioning protein ParA"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99179"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z997"
FT                   /protein_id="BAI99179.1"
FT                   /translation="MKVLAILSQKGGVGKTTLATCLAVAAEQAGKVAAIIDLDPQATAS
FT                   FWKDVRQLDTPAVASIQPVRLPAMLKACEDAGTDLVVIDGAAVARDVAYEAARQADFIL
FT                   IPTKTAVFDTMSMTHTLDVVRQLDRAFAVVLTFVPPQGQETGDAIQAVAELGATVCPVT
FT                   IGNRKAFFRAQAAGQAVQEFEPHGPAADEIHRLYEYTTIRLYNEAEAA"
FT   CDS_pept        complement(2174..2806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99180"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z998"
FT                   /protein_id="BAI99180.1"
FT                   /translation="MTHQTRESWLNAVAQGMAPLFEALDAPLPDRVRVAIGFTSRGAKA
FT                   KAIGECWDNRLSADGHFEIFIRPDLAHAPDAMPAQIAAILAHELVHAAVGIPAGHGKAF
FT                   KRAALGLGLVGPMRATTPGEAFLAAIAPILESVGPLPHARLDTDGESTAPKKQKTRMLK
FT                   CECATCGYTVRTARKWLELAGAPLCPIEDHGQMQHEPLDDDEAEPEE"
FT   misc_feature    2491..2498
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        complement(2821..3216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99181"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z999"
FT                   /protein_id="BAI99181.1"
FT                   /translation="MYQNGDINSSSFALGVRRLGFAPAAARHRGPTRCAPQARKRSWPK
FT                   VTTHMAGARSQADLASQGAGVRRRVVCLVGESRSRPSLPRNGIRRGRASLRCGRSTPIE
FT                   SRCPPLPPAFLGVRVPADGMAIAGQAI"
FT   CDS_pept        3225..3548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00060"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99182"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A0"
FT                   /protein_id="BAI99182.1"
FT                   /translation="MKPVEWLGSSKADVRAFPEDARTDAGWQLELVQRGDDPDDWKPMK
FT                   TVGQGVREIRIREASGAFRVIYLATLEDRVLVLHAFQKKTQATAKKDLELAAQRLKRWK
FT                   AEQ"
FT   CDS_pept        3545..3826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00070"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved small protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99183"
FT                   /db_xref="GOA:D4Z9A1"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A1"
FT                   /protein_id="BAI99183.1"
FT                   /translation="MTSEIYENVWDALADTEQEAANLKLRSSLLYEIRKVVQGWNVSQD
FT                   EAGKRLGLTRPRTNDLLRGKLAKFSLDALVNIAASAHLHVELTLKEAA"
FT   CDS_pept        3839..4075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99184"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A2"
FT                   /protein_id="BAI99184.1"
FT                   /translation="MAGHRPFRDLVADRMKDWSPERRAQYEARKAQFEAEMAATAELTG
FT                   QAATRAAIEELEAGKGARFPSVDALMTDLHDGD"
FT   CDS_pept        4065..4247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99185"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A3"
FT                   /protein_id="BAI99185.1"
FT                   /translation="MAIDRPRKGETAAEFFRRRSKGSTLDGLDRILAKVPDRPPEPGDE
FT                   LPEGWTPDRLRDNRL"
FT   CDS_pept        4244..4870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00100"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99186"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A4"
FT                   /protein_id="BAI99186.1"
FT                   /translation="MRAIFIRHGQSTGNAGVPCDDLGAIELTELGQEQAREVAASWTQA
FT                   PALIVTSPYTRTRQTAAPTIARFPGVPVEVWPIEEFTYLQPARWNGTRSAERMPHLERY
FT                   WSAADPDYCDGEGAESFATLLRRCEAALARLAAMPAASLVYVFGHGQFIQAARAIVADA
FT                   HLDERAKMRAFWRKGEPPAIANAQRVGFHWEGGRWSCAPALAGTA"
FT   CDS_pept        complement(4867..5352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99187"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A5"
FT                   /protein_id="BAI99187.1"
FT                   /translation="MHRGQHDAAVRSIARRLATTYILPALAVRATGGQANGSPLAIPFA
FT                   GGLLLGRFQAEPKIDNSGGHVTFNKYCMRNHTVFYPTPTNFVVRTYVNPKLLRPEQHEI
FT                   VREMEAWLAAHQAEAEAAVMQYHRLEDNDQGEFLDSASWATLQADFQALWPRLSAQF"
FT   CDS_pept        complement(5368..7770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="SJA_P2-00120"
FT                   /product="TnpA family transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99188"
FT                   /db_xref="GOA:D4Z9A6"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A6"
FT                   /protein_id="BAI99188.1"
FT                   /translation="MLKLHDFCNRAMLIDEKVHDRQSRLSWLREPEPRVASASLAEILE
FT                   KVAIIHRTGISSIPVDPLHEPRLTQFAREGVRYTAQAFQQMRVSRRRVILLATLREMEA
FT                   TLTDAAIAMFSALMGRAHLRARKRLEQRVAISGREGRDRLMRIATVLETVSQAARAGGD
FT                   IGAALRDIVPLDMLDADAAIIRRTAAPHRDDVLSEIAAEYRTFKRTGPLFLQALDFHGR
FT                   AGTAALRDAMAILSNLDGDWRKPLPADVPLGHVERRWHRHVVVAGKIDRTHWEMATYGA
FT                   LTNALASGDIWVPRSRLHRSLDVLLAPLSGAALQPPFSLGNPHAWLDQRAAQLDSALRD
FT                   VAHNLAGRDAALFAGERLRFPKELKDDDARHDEGRRLTLACYDMLPATRITDVLSQVER
FT                   WTGFTRHFGHVSTGLPPGDEQAFLATLIAEATNLGLSRMAEVCGAGSRRALLRMQTWHM
FT                   REETFRAALACLTDAIHAEPIAAWFGQGHRASADGQAFYLGGPGEAGGAVNAHYGRDPV
FT                   VKIYTTITDRYAPLHQTVIAGTAGEAIHALDGLLGHDSNADLTALHVDGGGVSDIVFAT
FT                   MHLLGLDFEPRIPRLSDRRLYAFEPSKRYGRLAPLFGHRLNRDLIVSHWPDIERVIGAI
FT                   RHRTVTPSLILKKLSAYRQQNSLAAALREIGRIERTLFTLRWFEDPALRRTVTAELNKG
FT                   EARNSLARAVAFHRLGRFRDRGLENQQTRAAALNLVTAAIILFNCRYLGRAVDEMRRRG
FT                   SPIDPAMLSRLSPLGWDRINLTGDYVWSDHLDLDANGLMPLLIKPLP"
FT   mobile_element  7738..8617
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   7738..7754
FT                   /rpt_type=INVERTED
FT   CDS_pept        7769..8563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P2-00130"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99189"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI99189.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   repeat_region   8601..8617
FT                   /rpt_type=INVERTED
FT   CDS_pept        8657..9931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00140"
FT                   /product="putative efflux pump"
FT                   /note="cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99190"
FT                   /db_xref="GOA:D4Z9A8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A8"
FT                   /protein_id="BAI99190.1"
FT                   /translation="MMFTMLKPWEERSGEENSSLALVGKAMGFFTSIKEAMVFALNPPA
FT                   IAELGIAGGFTFKLEDVGGNGAEALFNARNQLLAAASQSPILAGVRPEGQEDAPQLRVM
FT                   IDRIQARALGLSIGDVNGTLAIAFGSAYANDFNREGRILRVLLQAEASHRMTPQDVLDL
FT                   KVRNAAGEMVPFGSFTQVEWTSGAQQLQRYNGYPSMTISGNAAPGQSTGEAMAEMERLA
FT                   NALPEGFAYEWTGMSYEEQQAGGQVGMLLGLSILVVFLLLAALYESWSIPVSVLLVVPL
FT                   GVLGSVLFTVMRGLSADVYFNVGIITIIGLAAKNAILIVEFAIEQEAEGKTPLEATLEA
FT                   VKLRLRPIIMTSLAFIGGMIPLFIASGAGAASRIAVGTGVVGGMLAATVLGIFFIPLFY
FT                   LSIRRWLSKKRPAAPGQAQPEPNHA"
FT   CDS_pept        9924..11327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="SJA_P2-00150"
FT                   /product="RND-family efflux transporter"
FT                   /note="copper efflux system outer membrane protein CusC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99191"
FT                   /db_xref="GOA:D4Z9A9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9A9"
FT                   /protein_id="BAI99191.1"
FT                   /translation="MRRVFVLTLTSFLGACQLAPPHARPALPTTRDYPTSYAGDGVLGR
FT                   RAVEISWREFFADPQLETLIATALERNRDLAVAVAQIQEARGLYRIQGAERLPALGANG
FT                   DVTRSRTPGSAIGIPEVGAITDTRYSIGVGVTGFELDFWGRVRNLSDAARSQYLATVQA
FT                   ERAFRLALIRDVASTYFASREADERIALAEATVRSRQEGLRIAERRLEAGVTSALDFRQ
FT                   AESLLTQAETELASLRLAEAQSENFLAVLLGGPVPVGLTVPLTLADQKNGTVIAAGLPS
FT                   ELMVTRPDILAAEEKLRAARANIGAARAAFFPSISLTGSIGFASTDLGNLIGNEGLSWS
FT                   FGPSISLPIFDWGARKGNLSVAEAREDIAIAEYERTIQGAFREVADALAGRRWLAEQVA
FT                   AQVRATAAQRAIADLARTRYREGVANYLEVLDAERNLFIAEQTLIQLRRAELDALVSLY
FT                   VALGGGQQG"
FT   CDS_pept        11496..11744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00160"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99192"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B0"
FT                   /protein_id="BAI99192.1"
FT                   /translation="MSLNVKDPEAHRLAQAIAQATGQSMTRVVTEALRERFARIERQKS
FT                   KASVAELLTIADRAATHVKRPYVDHAELFYDDNGLPK"
FT   CDS_pept        11741..12130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00170"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99193"
FT                   /db_xref="GOA:D4Z9B1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B1"
FT                   /protein_id="BAI99193.1"
FT                   /translation="MILDTSALVAILYREPEAATFAQAIHDADACRISVASYVELSMVI
FT                   ERQLGPEGMRQTEAFFRRAGITIEPVTLDHGELARQAFLDFGKGRHKAGLNFGDCFSYA
FT                   LAKATDEPLLFKGNDFALTDIEAAA"
FT   CDS_pept        12130..12435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99194"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B2"
FT                   /protein_id="BAI99194.1"
FT                   /translation="MRAVHDKIEGPFAIEENIALYGMVAGDATLHRGIRFILHGTITGN
FT                   LTIETGARAIIHGTVAGRIYNEGGRVEIFGIADAVANGSRDAITIIDPAAHVRGRP"
FT   CDS_pept        12432..12830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99195"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B3"
FT                   /protein_id="BAI99195.1"
FT                   /translation="MTQIGGVPDMHDEDDYPYDNPVSRAQAESLREQARAGGLRFEAYL
FT                   PPALADWLLEPIERGMFADPSEAVFAIVGNFRDLEPHRDLRDALLRRLLQAAVDDPRPG
FT                   TPHEQVQAEMARRRVEPRAAPARWRREG"
FT   CDS_pept        12830..13792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00200"
FT                   /product="putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99196"
FT                   /db_xref="GOA:D4Z9B4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B4"
FT                   /protein_id="BAI99196.1"
FT                   /translation="MAQLAPLPSPTLALPALIASADDRARLRFLEFFAVTIRNAHTRRA
FT                   YARAAGDFLTWVAARGVTSLGAVQPLHVGAWIEALGGEMSAPSVKQQLAGVRRLFDWLV
FT                   IGQVMPVNPAASVRGPAHSQRRGKTPVLAPDEARRLLDTIDVGGPAGLRDRALIGLMVY
FT                   SFARIGAALSMRVEDVFMQNRRLWVRLHEKGGKQHEMPCHHNLEDYLTAYIDGCELRAQ
FT                   AKGPLFRTIARGTKRLSDTPLPQANAFAMVRRRAVAAEIGTAIGNHSFRATGITTYLKN
FT                   GGTLETAATMANHSSTRTTQLYDRRPDDVTLDEVERVLI"
FT   misc_feature    13782
FT                   /note="may be target duplication site"
FT   repeat_region   13783..14959
FT                   /note="insertion sequence:ISSj13"
FT   repeat_region   13783..13809
FT                   /rpt_type=INVERTED
FT   CDS_pept        13856..14953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00210"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99197"
FT                   /db_xref="GOA:D4Z9B5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B5"
FT                   /protein_id="BAI99197.1"
FT                   /translation="MAGRRADLVVLSGDDRRFLEAQVRRHKAPRSLSDRCRMVLLCAEG
FT                   LQSKEVAERLGVHEHTVGKWRRRFVQAGIEGLTDEYRAGRPRTVSDTQVAQVIERTLNT
FT                   TPKDATHWSIRSMAAKSGLSHTTIRRIWGAFGLQPHRSETFKLSTDPLFVDKVQDIVGL
FT                   YMSPPNRAIVLCVDEKSQIQALDREQPVLPMAPGVPERRTHTYVRNGTTSLFAALDIAT
FT                   GAVIGKCYKRHRATEFLDFLKRIDAAIPKGPDVHLVMDNYATHKTPKIKAWLARRPHWH
FT                   AHFTPTSASWINQVERWFAELTRKQLQRGVHRSTAELETDITAFIAAHNENPKPYKWVK
FT                   SADEILAAVKRFCQKTMSRTSDSGD"
FT   repeat_region   14933..14959
FT                   /rpt_type=INVERTED
FT   misc_feature    14960
FT                   /note="may be target duplication site"
FT   CDS_pept        complement(14999..15394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00220"
FT                   /product="putative transposase"
FT                   /note="remnant"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99198"
FT                   /db_xref="GOA:D4Z9B6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B6"
FT                   /protein_id="BAI99198.1"
FT                   /translation="MNPPRQSVLILIVADLSPRSSRYNYVSNLPADATLKMLAATIKAR
FT                   WICEQAHQQLKEELGLDHFEGRSWVGLHRHALMTMIAYAFLQARRLKAAGRKKKSRGAA
FT                   ATTEHASYPTGDLEHLHKASATSVPPL"
FT   CDS_pept        complement(15404..16267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00230"
FT                   /product="putative transposase-associated ATP-binding
FT                   protein"
FT                   /note="transposition helper protein / IstB-like ATP-binding
FT                   protein / DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99199"
FT                   /db_xref="GOA:D4Z9B7"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B7"
FT                   /protein_id="BAI99199.1"
FT                   /translation="MTKAHNVDAQRLSFILNELRLPAIKVIWPEFTERADKEGWPATRL
FT                   LAALTEHEMAERDRRRIERHLSDARLPPGKTLDSFAFDAVPMVSRAQVTAMTSGDGWLE
FT                   KGANLILFGPPGGGKSHLAAAIGLQLVQNGWRVLFTRTSELVQKLQLARRELALESAIA
FT                   KLDKYHLLILDDLAYVAKDQAETSVLFELISARYERRSMLITANQPFGEWNRVFPDPAM
FT                   TLAAVDRLVHHATIFEMNVESYRRRAALQRQTGAGRTPKYATIKSIEKMSISDNQSEES
FT                   PLPATI"
FT   CDS_pept        complement(16264..16749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00240"
FT                   /product="putative transposase"
FT                   /note="remnant"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99200"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B8"
FT                   /protein_id="BAI99200.1"
FT                   /translation="MIGHRLRVRLYDDRLDLFLGGSYLMTRPRGRPKSATEHGYVVDYR
FT                   HVIHSLRRKPMALLQLTYRDQLFPREAYRLMFERLLEAMSERDACRKMVELLSMAHERA
FT                   CEAELADLLAQDLDEGRLPDIAALRTRFSPDPAALPEVVVELGPLTDYDALLLGEAA"
FT   CDS_pept        complement(16813..18009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00250"
FT                   /product="putative transposase"
FT                   /note="transposase or inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99201"
FT                   /db_xref="GOA:D4Z9B9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9B9"
FT                   /protein_id="BAI99201.1"
FT                   /translation="MTRTEIKPAVSAVKELLAQEPDALREIVRSVMQAMLEAEMDEALG
FT                   AGKSERSDARLGYRSGHYPRTLVTRVGKLELRVPQDRAGRFSTELFERYQRSEQALVAT
FT                   LAEMYVQGVSTRKVKAITEELCGHAFSASTISAINKKLDGSLAAFAQRRLDEPFPYLIL
FT                   DARYEKVREGGVVGSQAVLIAIGIDWDGRRQILAVEMANRESATSWKDFLLRLRDRGLH
FT                   GTEFVVADDHAGLRAAIREVLTGAAYQRCYVHFLRNALDHLPRKADDDCLQELRWLYDR
FT                   RNLAEARADLAQWLARWSAKYPRLTDWAEETIEETFSFYRLPRRHHKHMKSTNMLERFN
FT                   EEIRRRTYVVRIFPNAPSCLRLVRALAVETHENWLEANRYLNMDELREQKKTELRKAA"
FT   mobile_element  18046..18925
FT                   /mobile_element_type="insertion sequence:IS6100"
FT   repeat_region   18046..18062
FT                   /rpt_type=INVERTED
FT   CDS_pept        complement(18100..18894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="SJA_P2-00260"
FT                   /product="transposase of IS6100"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99202"
FT                   /db_xref="GOA:D4YYG3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYG3"
FT                   /protein_id="BAI99202.1"
FT                   /translation="MLGGDWTDGTMTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEML
FT                   AERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAV
FT                   DKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREG
FT                   KLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQA
FT                   RPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA"
FT   CDS_pept        complement(18830..19291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00270"
FT                   /product="putative resolvase"
FT                   /note="invertase/recombinase like protein / site-specific
FT                   recombinase, DNA invertase Pin homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99203"
FT                   /db_xref="GOA:D4Z9C1"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C1"
FT                   /protein_id="BAI99203.1"
FT                   /translation="MRVGYARVSTSDQNPELQLDALRRAGCERVFTEKASGARDDRPEL
FT                   ARILEDVLRAGDTLVVWKLDRLARSLKKLIATAEDLEREKIGLVSLTESIDTTTPGGML
FT                   TFHVFGAIAQFERALIREGSVAKIVKLEHAWRRLDGRNDDGFQVAPFPG"
FT   repeat_region   18909..18925
FT                   /rpt_type=INVERTED
FT   CDS_pept        19457..20149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99204"
FT                   /db_xref="GOA:D4Z9C2"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C2"
FT                   /protein_id="BAI99204.1"
FT                   /translation="MQVLDTVGWVGDGDDTDFFLAIERTFDLRLRSNLPWTTFGEVRDH
FT                   VVAHVAAYSGGGTTCATQMTFYRLRRALGLGRHVGPDAPLAPLIGGKLRQAFSDLEADT
FT                   DLKMPATRAGWLGIVSGLCFAVAVAILAFTTLAPPLRIFAAGASAYAGLWLRHLDRRRL
FT                   PRRCDTIGDLARLVTEQNRGRLARDGARLTAPEIWRIIQQLAAEESGIDPDLIGSETTF
FT                   FRAKVRAA"
FT   CDS_pept        20196..20630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99205"
FT                   /db_xref="GOA:D4Z9C3"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C3"
FT                   /protein_id="BAI99205.1"
FT                   /translation="MRGVGLTALGAVVVAGSFVALGLRPDGIASYYRDTLTPAGFAIWF
FT                   CGFVAATLAPPAIAVLCWFGAMRFRYGWLLHILLVPATYAAVRGSIALMLAVASEPDSD
FT                   GPTRWATDPAVMLMVVCPIVYFLILGSTKLREHRASANDC"
FT   CDS_pept        complement(20743..21021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99206"
FT                   /db_xref="GOA:D4Z9C4"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C4"
FT                   /protein_id="BAI99206.1"
FT                   /translation="MELCGRGGKRVNSHLPVGRMAERLESLPREHAWFAILVAVTALSW
FT                   ANHAYPSAGLLPLYVPIICAAGWALGVGACNRSSFCSQTAPFPAQIT"
FT   CDS_pept        20980..21114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99207"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C5"
FT                   /protein_id="BAI99207.1"
FT                   /translation="MTVHALPTPTAKLHLHSPATVDRTADRTPPHRKRAAGSNRPLET"
FT   misc_feature    21317..21324
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        complement(21353..21586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00320"
FT                   /product="Xre-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99208"
FT                   /db_xref="GOA:D4Z9C6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C6"
FT                   /protein_id="BAI99208.1"
FT                   /translation="MNQPALAGVESFAMLVGRNCRERRVQLEMSQTELSERSGVTASYL
FT                   SRIENGRGNPTLELLDSIAGALGCHVVDLFRE"
FT   CDS_pept        complement(21583..22320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99209"
FT                   /db_xref="GOA:D4Z9C7"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C7"
FT                   /protein_id="BAI99209.1"
FT                   /translation="MREEDDSFGDADDPALAFARVEDRLASVHGEVALLRAAIEGLTAA
FT                   RENIEIPDYEPTLGRTEQVLGVLAQQIAAMRKSPALSMDPAHMAGEIASAATNARREDQ
FT                   RLITEARTALDQAAREIGNRLASARRGDEQNRWLYVIGACGVVLGLLLYALLAGPLARA
FT                   TPDSWRWPERMATRVLNEPGPWGAGQRLMQAADPESWALIVAASPLTDANRETVQKCRE
FT                   QAEKAAKPVRCTIEVKADSGQKP"
FT   CDS_pept        complement(22478..25603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="SJA_P2-00340"
FT                   /product="conjugal transfer protein TraA"
FT                   /note="Ti-type conjugative transfer relaxase/nickase TraA /
FT                   MobA/MobL protein / exodeoxyribonuclease V alpha subunit /
FT                   ATP-dependent exoDNAse (exonuclease V), alpha subunit -
FT                   helicase superfamily I member"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99210"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C8"
FT                   /protein_id="BAI99210.1"
FT                   /translation="MAIYHFSAKVIGRSSGSSAVASAAYRAAERLHDDRLGRDHDFSNK
FT                   AGVVHSEIMLPEGAPERLNDRATLWNEVEAGEKRKDAQLAREVEFSIPRELNQQQGVQL
FT                   AREFVEKQFVERGMVADLNVHWDMGKDGQPKPHAHVMLSMREISPDGFGKKVVEWNSTA
FT                   LLKEWREAWADHVNQRLAELDIDARIDHRTLAAQGIDLEPQHKIGPAASRMPEQGLEAE
FT                   RVEDHARIARENGEKIIARPEIALDAITRQQATFTRRDLAQFAFRHSDGKDQFDQVMSA
FT                   VRTSPELVALGKDGRGEDRFTSRDMIDTEQRLSQAGDRLADRAGHGLSAASQMGGRDTA
FT                   ESGSLALGSQQKDALAHITGKNDLAIVVGYAGTGKSTMLGVARDEWERAGYQVRGAALS
FT                   GIAAEGLEGGSGIQSRTIASMEYQWDQGRELLGPRDVLVIDEAGMIGTRQMERVLSEAE
FT                   RAGAKVVLVGDPEQLQAIEAGAAFRSLAERHGAAEISEVRRQHEDWQKDATRALATGRT
FT                   GEAIHAYAEHGMVHAAETREAARAELIDTWDAQRLADPEKTRIILTHTNAEVRDLNQAA
FT                   RDRLREAGELGQDVRISAERGAREFATGDRIMFLKNERGLGVKNGTLGKVERVSPDSMA
FT                   VRLDDGRQVAFDLKDYAHVDHGYAATIHKSQGVTVDQGHVLATPGMDRHAAYVALSRHR
FT                   EGVQLHYGRDDFADDRRLVRTLSRERAKDMASDYPMYRDRDAEAQSFADRRGLSGEIRL
FT                   PDAPERKGVELLGPRAGTMRQMGGDPRPREIGEGRGAGDAKAAAERQPRRGMFDGLKLS
FT                   AEPAKAAEPAQGAKEKAAPKRGMFDGLKLSSRTPTPAKEAPARAEQGLTHDFRRAVERA
FT                   SRSAEAVLQARASGGPVLEHQKVALERATEALDQIRAGASRDMASAFQREPGLLHEAAA
FT                   GRSGPMMDAMAQEAKVRADPNLRADRFVERWQQLSQDRDRLYRAGDMTGREKAGKEMAG
FT                   MAKSLERDPQVESILRGRERELGLEMGMGRGRDLSHQLTHELGIGRDRGLSR"
FT   misc_feature    25412..25419
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        25780..26085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99211"
FT                   /db_xref="GOA:D4Z9C9"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9C9"
FT                   /protein_id="BAI99211.1"
FT                   /translation="MRKTRDYDAELRALSDKAKSIKAKKIQQLGELVTGTGADALDLDT
FT                   LAGALLAAVESADAEEREAWRSRGAAFFQGRGRKAGRRAGGNGEGGNQAGAGEAQG"
FT   CDS_pept        26123..26359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="SJA_P2-00360"
FT                   /product="conjugal transfer protein TraD"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99212"
FT                   /db_xref="GOA:D4Z9D0"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D0"
FT                   /protein_id="BAI99212.1"
FT                   /translation="MQRRERTRHLIELGGLVQKAGLVELTDDDRATLYGAMLDLAARAQ
FT                   GDGNALALWKRRGKRAFDAEAEGQDNAEGNAHD"
FT   CDS_pept        26352..26627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99213"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D1"
FT                   /protein_id="BAI99213.1"
FT                   /translation="MTDTSRLSWQLLMVGPGIDRITPDIQDKLASLLDLLPATATINVQ
FT                   TDAGYVTVSRDWPSHRMETVDSLVDEIAAAPGITHIALPASEGQEP"
FT   CDS_pept        26624..26908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99214"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D2"
FT                   /protein_id="BAI99214.1"
FT                   /translation="MTRALDIGAIRAQVRALDYVRGTPAEVAMWREGDAEARANLAIEG
FT                   MDLDADEHALFDMLRAEAVPPPLATAIVLKLLDHPDADPALAITPATIG"
FT   CDS_pept        26905..27840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00390"
FT                   /product="putative nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99215"
FT                   /db_xref="GOA:D4Z9D3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D3"
FT                   /protein_id="BAI99215.1"
FT                   /translation="MTMRADLDHLPAAKRRELERVARVLFDEFEDAVKTKLSDKRKGGR
FT                   ILKLILFGSYARGDWVEDRASGYISDYDLLVVVNSETFTDLQTWWAVADDHLVRELTVT
FT                   RHLSTPVNFIVHSLMDVNDQLARGRPFFADIARDGIALYEAPGQGLAMPRQLDAQERHA
FT                   EALRHRDHWFPLAAHALKLAQDSIADGVPRDAAFMLHQAVERAYNAVLLVLTLYAPKSH
FT                   RLGILRSLAENLDPRLIEAWPRDTRAARRHFAQLQRAYVEARYSHAYEITPDELAWLVE
FT                   RVRHFHTIAAAICAEHLATIDTKNDPGGLP"
FT   CDS_pept        27837..28553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00400"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99216"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D4"
FT                   /protein_id="BAI99216.1"
FT                   /translation="MKPALFLTPLLGLAACTPAAPDPRGVDRDETVLTVTGTGRAEATP
FT                   DQALFTAGLSSIAADAQAASARNAETMNKITAALARLDIPARDIQTRNLSVNRIDYGAN
FT                   KGRYEASNSVAVRVRDNKRVSEALAAVTAAGANIVSGPNLSVADPEKANLGAYGTAYKA
FT                   ARAKADAYAAAANLRVTRVLAISDGGQGGYMPQMADMEARIAAPPTVVPQAAPPVMAGT
FT                   NMNIVTVRVDFALAAK"
FT   CDS_pept        28560..30221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /gene_synonym="virD4"
FT                   /locus_tag="SJA_P2-00410"
FT                   /product="conjugal transfer protein TraG"
FT                   /note="type IV secretory pathway, VirD4 component"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99217"
FT                   /db_xref="GOA:D4Z9D5"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D5"
FT                   /protein_id="BAI99217.1"
FT                   /translation="MEWFRQLGRAIRNLARLAREQPIWAITALTLSPLALIRHLFRTAI
FT                   LFLIVGIVLAGGMQFVLASLLGLARDSNLYQLGMMLTFLVIILVTLRALFQPLILRYGG
FT                   PAGDDTHGSARFATDRETRPLAQNGDGLLIGRDRKSGKPLRYAGPAHLLTIAPTRTGKG
FT                   VGTIIPNLLDYPGPVVCIDPKGENARITAHYRARFGPVHVLDPFGVTGMVGAAFNPLDR
FT                   IDPAGLDLADDCMTLADALVYDAPGEAGEAHWNEEAKALIAGLILHIVCQEPAGTRTLA
FT                   TLRDRLTLAPQAFAAQLEAMQAQGGLTARAANRHLGKSDREAAGVLSAAQRHTHFLDSP
FT                   RMTAVLGHSDFTFADVKAQPTSVYLVLPPDRLATYARWLRLMLAQGLTDLARAPASPAR
FT                   SVLFLLDEFAALGRLEPVERAMGLMAGYGIQLWPILQDVHQLRALYERRAGTFLSNAGV
FT                   LQIFGVNDHDSAKLVSDLLGQETVVFESMSRAIDAEETGISFGSQHVGRPLLTPDEVRT
FT                   LREDLQLLFLAGQRPIVAAKLRYFADREFAGKFDKV"
FT   misc_feature    30225..30232
FT                   /note="recognition site for restriction enzyme PmeI"
FT   CDS_pept        30259..30720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99218"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D6"
FT                   /protein_id="BAI99218.1"
FT                   /translation="MPNERFEEFADRFMKSIGEPGCDLQALVDELIELHAVERDEFNRV
FT                   RLISMHIALTNIAAEGLAKAQAPGSQIIGFLADNLSTYHLMLRQESLVDGQIDKAVLLR
FT                   VTEREITAGRMKGNDPLRAFAEGGEYIRDNPMEGLFHADPSADDKPVLN"
FT   CDS_pept        complement(30806..31069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99219"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D7"
FT                   /protein_id="BAI99219.1"
FT                   /translation="MPLYGLPRRPIFWKLDPRTIARDDTEVRFMDARAEKRQHRVRAAA
FT                   IGAASFKICAPDNDFANLARSSLRERAESYAKNRQGRARKVR"
FT   CDS_pept        31108..31413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_P2-00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_P2-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99220"
FT                   /db_xref="UniProtKB/TrEMBL:D4Z9D8"
FT                   /protein_id="BAI99220.1"
FT                   /translation="MTPSGPEIAPAATFPPPLPSRLDRCPIRLAFLESQLRRCRWRCGR
FT                   GRGAAFKRSLIQQKACRRSRLIMGDAGWEDRKAIRGGRRPRAGGGEAPKRRRFSSL"
FT   misc_feature    31257..31264
FT                   /note="recognition site for restriction enzyme PmeI"
XX
SQ   Sequence 31776 BP; 5685 A; 10340 C; 9898 G; 5853 T; 0 other;
     atgaaacccc gaatcgagcc tgaccgtcaa cgaaaccccg aacttccgct tgccgtcaac        60
     gaaaccccga acggcgcgga gggtcgccct cccctgttgc cggttcgcta tcccgatccc       120
     gatctgttca tttgcgatgt tctcgacgcc atccccaagg atgacatggc ctcgatggag       180
     catccgattt tctcgctcgc gaccaagccc gatcggcgcg tgttccgcta cgagcataac       240
     ggcaacaagc tcgaaatcgt ccccagcgtc aaagggctgg cgacgatcca cgacaaggat       300
     attctgatct actgcatctc ccagctcatc gggaagatga accagggcga gcggccgagc       360
     cgcaccttgc acctcacggc gcgcgatctg ctagtgtgga ccaaccggca aaccgatggc       420
     gacggctatg accgactgcg gagcgcgttc gagcgcctgt cggggacgcg gatcaccacg       480
     aacatcaagg ccgatggcga ggaaatcacc gaagggttcg gcctcatcaa cgaatggcgg       540
     atcgtgcggc aaacccgctc cggccaaatg tcggaaatca aggtcacgct ctccgattgg       600
     ctgttcaaga tggtcgaggg gcgcagtgtc ctgacgctgc accgcgacta tttccgtctc       660
     cgcaagccgc tcgaacggcg catctacgag ctggcgcgca agcattgcgg cgcgcaggaa       720
     aaatggtcga tctcggtcga aacgctacag aaaaagactg gcgcgagtag ccatctgcgc       780
     gtgttccgct cgatgctgcg cgatctcgtc gcgcacgatc atctgcccga ctatgccgtg       840
     gaaatgaacg gcgatacggt cacgttccgc aatcgcgagg cgctggatac ggtcgaggcg       900
     atcgaggcgg aacccgaacg gccctatatc gaccccgaag gcttccacga cgccaagagc       960
     gttgcgcctg gctatgacgt gtatgcgctc tatgaccaat gggtgtcatg gtggatcgac      1020
     agcggacggc cggaactgaa aagcccccgc gccgccttca tcggcttctg ccgcaacaag      1080
     cacaagaccg cccccttgcg ctagtatagg cgtatacagc tatacaccta tactagctgg      1140
     tgatgcgccc cctccccttc ttcacgaaca ggtcgtccag cgcctcgcct agcaggcttt      1200
     gaacggtcgt cccttcctcg gccgcgataa tacgaagctg tgtgctgacc tccgggggga      1260
     aatgcccgcc aatcaacttg gtcccctgtc ggccgctcgg cggggccttg cgggacacgt      1320
     ctaccggctc gatcgccggc gctggtgccg gggccgcgtc tccgtccgcc ttggcgcggt      1380
     tcagcaccgc ttgcagactg tttccgccct tcgccatcac gccgcctccg cttcattgta      1440
     taggcgtata gttgtatact cgtatagccg gtggatttcg tcggccgctg gtccgtgcgg      1500
     ctcgaactcc tgcacggcct ggcctgcggc ttgggcgcgg aaaaaggctt tgcggttgcc      1560
     gatcgtcacc gggcaaaccg tcgcgcccag ctccgccacg gcctgaatcg catcgccggt      1620
     ttcctgacct tgtgggggca cgaaggtaag gaccacggca aaggcgcggt cgagctggcg      1680
     cacaacgtcg agcgtgtgcg tcatgctcat ggtgtcgaat acggccgtct tggtcgggat      1740
     caggatgaaa tcggcttggc gcgctgcctc ataggccacg tcgcgcgcga ccgccgcccc      1800
     gtcgatcacg acaagatcgg tgccggcatc ctcgcaggct ttgagcatgg cgggcaggcg      1860
     caccggctga atcgacgcca cggcgggcgt gtcgagctgg cgcacgtctt tccagaacga      1920
     ggccgtcgcc tgcgggtcca ggtcgatgat cgcagcgacc ttgccggcct gctcggccgc      1980
     gaccgccaga caggtggcga gcgtcgtttt cccgacgccc cctttctgtg agagaatggc      2040
     gagaaccttc atgctacact cctacacgta tagtcctata cttgtatacg cggtgaaccg      2100
     agagggaaag ccctatcgtc gctgaaatga cgatagggcg gcgctgaatc tgaactgacg      2160
     aaagcgcggc gcatcattcc tccggctcgg cctcgtcatc gtccagcggc tcatgctgca      2220
     tctggccgtg atcctcgatc gggcaaagcg gcgctccggc cagctccaac catttgcgcg      2280
     cggtcctgac ggtatagccg cacgtcgcgc actcgcattt gagcatccgg gttttctgct      2340
     tcttgggcgc ggtcgactct ccatccgtat caaggcgggc atgggggagg gggccgacgc      2400
     tctccaagat cggcgcgatg gccgcaagga acgcctcgcc gggggtggtg gcgcgcatcg      2460
     gcccgactag gcccagccca agggcggccc gtttaaacgc cttcccatgc cctgccggga      2520
     tgccgactgc ggcatggacc agctcatgcg cgaggatggc cgcgatctgc gccggcatgg      2580
     cgtcgggcgc gtgcgccagg tcgggccgga tgaagatttc aaaatggccg tccgcgctca      2640
     agcgattatc ccagcactcg ccgatcgcct tggccttcgc gcctctgctg gtgaagccga      2700
     tcgccacgcg cacgcggtcg ggcagggggg cgtccagcgc ctcgaacagc ggagccatgc      2760
     cctgcgccac cgcattgagc cagctttcac gggtttggtg ggtcatcgtc cttactccct      2820
     tcaaatcgcc tgtccggcga tggccatgcc atcggccgga acacggacgc ccaagaacgc      2880
     cggcgggaga ggggggcagc gggattcgat gggggtggag cggccgcagc gcagcgaggc      2940
     acggccccgt ctaatcccgt tgcgggggag agaaggccgg gaccggcttt cccccacaag      3000
     gcagacgacg cgccggcgaa cgccggcacc ttggctagcg agatccgctt gcgatctcgc      3060
     ccccgccatg tgggtcgtca ccttgggcca agaccgcttg cgggcttggg gagcgcagcg      3120
     agtagggcca cggtgccgcg cagcggcagg cgcaaatccc agcctccgaa cgcccaaggc      3180
     gaaggagctt gaattaatgt ctccgttttg atacacccag cctcatgaag ccggtagagt      3240
     ggttgggaag tagcaaggcc gatgttcgcg ccttccccga agatgcgcga acagatgccg      3300
     gttggcagct tgagcttgtc caacgcggcg acgatcccga cgactggaag cccatgaaaa      3360
     ccgtggggca aggcgttcgg gaaattcgca tccgggaagc gtcgggcgcg ttccgggtga      3420
     tctatctggc gacgttggaa gaccgggttc tggtgcttca tgcgttccag aaaaagacgc      3480
     aggcaacggc aaagaaagac ctcgaactcg cggcgcaaag gttgaaacga tggaaggcgg      3540
     agcaatgaca tcggaaatct atgagaacgt gtgggacgcg ctcgctgata ccgagcagga      3600
     ggccgcgaac ctgaaactgc gctcgtcctt gctgtatgaa atccgcaagg tggtgcaggg      3660
     ctggaatgtc tcacaggacg aagcgggcaa gcggcttggg ctgacacggc cccggaccaa      3720
     tgatctgctg cgcggcaagc tggccaagtt ctccctggat gcgctcgtca acattgcagc      3780
     gtcggcccat ctgcacgtcg agttgacgct gaaagaagcg gcctgagcga cgggcaaaat      3840
     ggcaggccat cgcccgtttc gcgatcttgt ggctgatcgc atgaaggatt ggagtccaga      3900
     gcgccgcgcc cagtatgagg cgcgcaaggc gcagttcgag gccgaaatgg cggcgacggc      3960
     cgagctgacc ggccaagccg cgacgcgcgc ggcgatcgag gaactggaag cggggaaggg      4020
     ggcacgcttc cccagcgtcg atgcgcttat gacggatttg catgatggcg attgatcggc      4080
     cgcgcaaagg ggaaacggct gcggagtttt tcaggcggcg ttccaaaggc tccacattgg      4140
     atggtcttga ccgcatcttg gccaaggtgc ccgatcggcc tcccgaaccc ggcgacgaat      4200
     tgcccgaagg ctggacgccc gatcggctcc gggacaaccg gctatgaggg cgattttcat      4260
     ccgccacggc caaagcaccg gcaacgccgg cgtgccctgc gatgatctcg gcgcgatcga      4320
     gctgacggag ctgggccagg aacaggcgcg cgaagtcgcg gcgagctgga cgcaagcgcc      4380
     cgcgctcatc gtcacgtcgc cctatacgcg cacccggcag acggccgcgc cgacgatcgc      4440
     gcgctttccc ggcgtgccgg tcgaagtgtg gccgatcgaa gagttcacct atctgcaacc      4500
     ggcgcgctgg aacggcacgc gcagcgcgga gcggatgccg cacctcgaac gctattggag      4560
     cgcggccgat cctgattatt gcgacgggga aggggcggag agcttcgcca ccctgctacg      4620
     gcgctgcgag gccgcgctgg cgcggctcgc cgccatgccg gctgcatcgc tggtctatgt      4680
     gttcgggcat gggcagttca tccaggccgc gcgcgcgatc gtcgctgacg cccatctgga      4740
     cgaacgggcc aagatgcggg cgttctggcg caagggcgag ccgcccgcga tcgccaacgc      4800
     gcagcgggta ggatttcatt gggaaggtgg ccgctggtcc tgtgcgccgg cgctggccgg      4860
     cacggcctaa aactgcgcgg aaagccgggg ccacaaagcc tgaaaatctg cttgcagcgt      4920
     cgcccagctc gcggagtcca gaaactcgcc ctggtcgtta tcttcaagcc ggtgatattg      4980
     catgacggcc gcctcggctt cggcctggtg cgccgcaagc catgcctcca tctcgcgcac      5040
     gatctcatgc tgttccggcc tcaacagctt cggattgacg taggttcgca caacgaaatt      5100
     cgtcggggtg gggtaaaaga cggtgtgatt ccgcatacaa tatttgttga aggtcacatg      5160
     gccgcctgaa ttgtcgatct ttggttcggc ctggaagcga ccgagtagca ggccgccggc      5220
     gaacggtatg gcgagcggcg atccgttcgc ctgccccccg gtcgcgcgca cggccaaggc      5280
     cggcaggata taggttgtcg ccagtcgccg cgcgatcgag cgcaccgccg cgtcatgttg      5340
     gcccctgtgc attatcagga cacggattca cggtagcggt ttgatgagca gcggcatgag      5400
     gccgttggcg tcgagatcga ggtgatcgga ccagacataa tcgccggtga gattgatgcg      5460
     atcccaaccc aacggcgaga gccgggacag catagctgga tcgatggggc ttcctcgacg      5520
     acgcatttcg tcgacggcgc gccccagata gcgacagttg aacaggataa tcgctgcggt      5580
     gacgaggttg agcgcggccg ctcgggtctg ctggttctcc aggccacggt cgcgaaaacg      5640
     gccgagccga tggaaggcga ccgcccgggc aaggctgttg cgggcctcgc ccttgttcaa      5700
     ctcggcagtg acggtacggc gcagagccgg atcctcgaac cagcggagcg tgaacagcgt      5760
     gcgctcgatc cgcccgatct cccgcagcgc cgcagcgagg ctgttctgct ggcggtaggc      5820
     ggacagcttc ttcaggatca acgatggcgt gacggtgcgg tgacggatcg cgccaatgac      5880
     acgttcaata tcgggccagt ggctgacgat caggtcccgg ttgagcctgt gaccgaacag      5940
     tggcgcaagc ctgccatagc gcttcgaggg ttcgaaagcg tagaggcgcc ggtcggacag      6000
     gcgaggaatg cgcggctcga aatcgagccc gaggagatgc atcgtcgcga atacgatgtc      6060
     ggaaacgccg cctccatcga cgtgcagcgc ggtcagatcg gcgttgctgt catggccgag      6120
     gagcccatcg agcgcatgga tggcttctcc tgccgtgccg gcgatcaccg tctggtgcag      6180
     cggcgcgtag cggtcggtga tggtggtgta gatcttgacc actgggtcgc gaccataatg      6240
     ggcgttgacc gctccgccgg cttcgcccgg cccgcccagg tagaaggcct ggccatccgc      6300
     ggaagcccgg tgtccttgcc caaaccaggc ggcgatcggc tcggcgtgga tggcgtcggt      6360
     cagacaggcg agcgccgccc gaaaggtttc ctcgcgcatg tgccatgtct gcatgcgcag      6420
     cagcgcgcgg cgtgaccctg cgccgcatac ctcggccatg cgcgacagcc caagattggt      6480
     cgcttcggca atcagagtgg cgaggaaggc ctgctcatcg ccaggcggca acccggtcga      6540
     gacgtgcccg aagtgccggg tgaagccggt ccagcgttcg acttgcgaca acacgtcggt      6600
     gatacgcgtg gcaggcagca tgtcgtagca ggcaagcgtc aggcgccgtc cttcgtcgtg      6660
     cctggcatca tcgtccttca gttccttggg aaatcgcaat cgctcgccag cgaacagggc      6720
     agcatcgcgt ccggccagat tgtgggcgac gtcgcgcaag gcgctgtcga gctgcgcggc      6780
     gcgctgatcg agccatgcgt gtggattacc gagcgagaac ggcggttgca gcgctgcgcc      6840
     ggataacggc gcgagcagca cgtccagcga cctgtgcagc cttgacctcg gcacccagat      6900
     atcacccgag gccagtgcat tggtgagcgc gccgtaagtc gccatctccc agtgcgtccg      6960
     gtcgatcttg ccggcgacca cgacatggcg gtgccagcgc cgctcgacat gaccgagcgg      7020
     aacgtcggca gggaggggct tgcgccagtc gccatcaaga ttcgacagga tcgccatcgc      7080
     gtcgcgcaat gccgcggtgc cggcccgacc gtggaaatcg agcgcttgca ggaatagagg      7140
     ccctgttcgc ttgaaggtcc ggtattcggc tgcgatctcg ctcagcacat cgtccctgtg      7200
     aggtgccgcg gtacgacgga tgattgcggc atcagcatcg agcatgtcga gaggcacgat      7260
     atccctgagg gccgcaccga tatctccgcc ggcgcgtgct gcctggctaa ctgtttccag      7320
     cacagtggcg atccgcatca gccgatcgcg gccttcgcgt cccgaaatcg cgaccctctg      7380
     ctccaggcgt ttgcgagcac gaaggtgagc gcgtcccatc aaggcgctga acatggcgat      7440
     cgccgcgtcg gtaagcgtgg cctccatctc gcgcagcgtt gcaagcagga tgacccgcct      7500
     gcgggagacg cgcatctgtt ggaaagcctg ggctgtatat cgcacgcctt cgcgggcgaa      7560
     ctgcgtcagg cggggctcgt gcaggggatc gaccggaatg ctggaaatac cggtcctatg      7620
     gattatcgcg accttctcga ggatttcggc aagcgaggct gacgcgacgc ggggctctgg      7680
     ttcgcgcagc caggacaagc ggctctgccg gtcatgtacc ttctcatcga tcagcatggc      7740
     tctgttgcaa aaatcgtgaa gcttgagcat gcttggcgga gattggacgg acggaacgat      7800
     gacggatttc aagtggcgcc atttccaggg tgatgtgatc ctgtgggcgg tgcgctggta      7860
     ttgtcgctat ccgatcagct atcgcgacct tgaggaaatg ctggcggaac gcggcatttc      7920
     ggtcgaccat acgacgatct atcgctgggt ccagtgctac gccccggaga tggagaagcg      7980
     gctgcgctgg ttctggcggc gtggctttga tccgagctgg cgcctggatg aaacctacgt      8040
     caaggtgcgg ggcaagtgga cctacctgta ccgggcagtc gacaagcggg gcgacacgat      8100
     cgatttctac ctgtcgccga cccgcagcgc caaggcagcg aagcggttcc tgggcaaggc      8160
     cctgcgaggc ctgaagcact gggaaaagcc tgccacgctc aataccgaca aagcgccgag      8220
     ctatggtgca gcgatcaccg aattgaagcg cgaaggaaag ctggaccggg agacggccca      8280
     ccggcaggtg aagtatctca ataacgtgat cgaggccgat cacggaaagc tcaagatact      8340
     gatcaagccg gtgcgcggtt tcaaatcgat ccccacggcc tatgccacga tcaagggatt      8400
     cgaagtcatg cgagccctgc gcaaaggaca ggctcgcccc tggtgcctgc agcccggcat      8460
     caggggcgag gtgcgccttg tggagagagc ttttggcatt gggccctcgg cgctgacgga      8520
     ggccatgggc atgctcaacc accatttcgc agcagccgcc tgatcggcgc agagcgacag      8580
     cctacctctg actgccgcca atctttgcaa cagagcccga ggctttagct tcttcggcca      8640
     aggccaagcg aatggaatga tgttcacgat gctcaagccg tgggaggagc gctccggcga      8700
     ggagaatagc tcgctagcct tggtcggaaa ggcgatgggc ttcttcacat cgatcaagga      8760
     agccatggtc tttgccctca atccccccgc gatcgccgaa cttggcatcg ccggcggctt      8820
     taccttcaaa ttggaggatg tcggcggcaa cggtgctgaa gcgctcttca acgcgcgcaa      8880
     tcagctgctt gccgccgcga gccagagccc gatccttgcc ggtgttcgac cggagggcca      8940
     ggaagatgca cctcagctgc gggtcatgat cgacaggata caggctcgcg ccctcggcct      9000
     ctcgattggc gacgttaacg gaacgctcgc gatcgctttc ggcagcgcat atgccaatga      9060
     cttcaaccgt gaagggcgga tcctgcgggt gctcctgcaa gccgaagcat ctcaccgaat      9120
     gacgccacag gacgtgctcg acctcaaggt tcgaaatgca gccggcgaaa tggtgccctt      9180
     cggctcgttt acacaggttg aatggacatc gggcgcgcag cagctccagc gctataacgg      9240
     ctatccttcg atgaccattt ccgggaacgc tgccccgggc cagtcgactg gcgaggccat      9300
     ggcggagatg gaacggctcg ccaatgcact gccggagggc ttcgcatatg aatggacggg      9360
     aatgtcctat gaggagcagc aggccggcgg acaggtcggt atgctgctag gcttgtctat      9420
     acttgttgta ttcttgctgc tggccgctct ctacgagagc tggtccatcc ctgtttccgt      9480
     gcttttggtt gtaccgctcg gcgtacttgg ctccgtcctc tttacggtga tgaggggact      9540
     gtccgccgac gtctatttca acgttggcat catcacgatc atcggcttgg ccgccaagaa      9600
     cgcgatcctg atcgtcgagt ttgcgatcga gcaagaagcg gagggcaaga ccccgcttga      9660
     ggcgacactc gaagctgtga aactgcgcct gcgccccatt atcatgacgt cgctcgcctt      9720
     catcggtggc atgataccgc tcttcattgc ttccggtgcc ggtgcggcga gccgaatcgc      9780
     ggttgggacc ggtgttgtcg gcggaatgct ggctgccact gtgctcggaa ttttcttcat      9840
     tccgctcttc tatctgtcga tacgccgctg gctcagtaag aagcggcctg ctgctcccgg      9900
     tcaggcgcaa ccggagccca atcatgcgta gagtctttgt gctcactctg acatcgtttc      9960
     tgggcgcgtg ccagttagcc ccgcctcacg cgcggccagc gctgccgacc actcgggatt     10020
     accccacctc ctacgcgggc gacggggtgc tcggtcggcg ggcggtggaa atcagctggc     10080
     gggagttctt cgctgatcct caactggaga ccctcattgc caccgctctc gagcggaacc     10140
     gcgatctcgc cgttgccgta gcgcagatac aggaggcgcg tggtctttat cgaatccagg     10200
     gtgccgaacg gctgcctgcg ctcggcgcca acggcgatgt gactcgcagc cgcacgccag     10260
     gttcggcgat tggcattccc gaagtgggtg cgatcaccga tacccgctac tcgatcggcg     10320
     ttggcgtcac aggattcgag ctcgatttct ggggccgggt gcgcaacctt tctgacgcag     10380
     cgcgctcgca atatctagca accgtgcagg ctgaacgggc gttccgcctc gcgttgatcc     10440
     gggatgtggc ctcgacctat tttgcttccc gggaagccga cgagcggatc gcccttgccg     10500
     aagctacggt acgcagccgg caggaaggcc tccgcatagc cgagcgtcgc cttgaagccg     10560
     gggtgacttc agctcttgat tttcgacagg cggagtcgct actgactcaa gccgaaacgg     10620
     agttggccag cctgcgcttg gccgaggcgc agagtgagaa cttcctggcc gtactcttgg     10680
     gcggacccgt tcctgtcggg ctcacggtgc cgctgacgct ggctgaccag aaaaacggaa     10740
     cggtgattgc cgccggatta ccctccgagc tgatggtgac tcgaccggac atattggcgg     10800
     cagaagagaa actgcgggca gcgcgtgcca atatcggtgc tgctcgggca gccttctttc     10860
     catccatctc actaaccggt agtatcggtt tcgcttcaac tgatcttggg aatttgatcg     10920
     gaaacgaagg actgagctgg agctttggac cttcgatcag cctacccatc ttcgattggg     10980
     gtgcgaggaa gggcaatctg agcgtggctg aggcacgtga ggatattgcc atcgccgaat     11040
     acgaacgcac cattcaggga gctttccgcg aagttgcgga cgcccttgcc gggcgccgct     11100
     ggcttgctga acaggtcgcc gcgcaggttc gtgccactgc ggcacagcga gcgatcgccg     11160
     atcttgcccg cactcgctac cgcgagggcg tcgcaaatta ccttgaagtg ctcgatgccg     11220
     aacggaatct gttcatcgcg gaacagacac tgatacagct gcgtcgcgcc gagctggatg     11280
     ctctcgtctc tctgtatgtc gctctgggcg gcggccagca agggtaatgg tggtaatgtt     11340
     ccaccgacgg gccttggcta ttgatcatga caacctacag atcggtccgc cgataaattc     11400
     cctgacctat atatgataat gtcctttatc atacactctt ccccttaggc gcgctgcatg     11460
     gtagaaaggt ggctaatttt ctagaaaggc ggaccatgag cctcaatgtt aaagaccctg     11520
     aagcccatcg gcttgcgcag gccatcgccc aagcgaccgg ccagagcatg acccgcgtgg     11580
     tgacggaggc gctgcgcgag cgcttcgcca ggatcgagcg tcagaaaagc aaggcgagcg     11640
     tcgcggaact gctaacgatc gccgatcgcg ccgccacgca tgtgaagcgc ccctatgtcg     11700
     atcatgccga actgttttat gacgataatg gcctgccgaa atgatcctcg acacctcggc     11760
     cctggtcgcg atcctctatc gcgaacccga agcggcgacc ttcgcacaag ccatccatga     11820
     tgccgatgcc tgccgcatca gcgtcgccag ctatgtcgag ctgtcgatgg tcatcgaacg     11880
     ccagctcggt cccgaaggga tgcgccagac cgaagccttc tttcgccgcg ccggcatcac     11940
     gatcgaaccg gtgacgctcg atcatggcga actggcgcga caggcgtttc tcgatttcgg     12000
     caagggccgc cacaaagcgg gcctgaactt tggcgactgc ttttcctatg cgctggccaa     12060
     ggcgaccgac gagccgctgt tgttcaaggg caatgatttt gccctgacgg acatagaggc     12120
     ggcggcataa tgcgcgcggt gcacgacaag atcgaaggcc ccttcgccat cgaggagaat     12180
     atcgccctct atggcatggt cgctggcgat gcgacgctgc atcggggcat ccgtttcatc     12240
     ctccacggca caattacggg caacctgacg atcgagaccg gcgcgcgcgc aatcatccat     12300
     ggcacggtgg cgggacgcat ctacaacgaa ggcggtcgcg tcgagatctt cgggatcgcc     12360
     gatgccgtcg ccaacggctc gcgcgacgcc atcacgatca tcgatcccgc cgcccatgtc     12420
     cggggccggc catgacccag atcggcggtg tccccgacat gcacgacgag gatgattacc     12480
     cgtatgacaa tcccgtgtcc cgcgcccagg ccgagagctt gcgggagcag gcccgcgcgg     12540
     gcgggttgcg gtttgaggcc tatctgcccc cggcgctggc cgactggctg ttggaaccga     12600
     tcgagcgcgg catgttcgcc gatccttcgg aggcggtgtt cgcgatcgtc ggcaacttcc     12660
     gcgatctgga gccgcatcgt gatctgcgcg acgcgttgct gcgccggttg ttgcaggcgg     12720
     cggtcgatga tccgaggccg ggcactcccc atgaacaggt gcaagcggag atggcgcgcc     12780
     gtcgcgtcga accgcgcgcc gcgcccgcac gctggcggag agaggggtaa tggctcagct     12840
     cgcccccctt ccctcgccca cgctggcctt gccggcgctg atcgcgtcgg ccgacgaccg     12900
     cgcgcggttg cggttcctgg agtttttcgc cgtcaccatc cgcaacgcgc atacgcgccg     12960
     cgcctatgcg cgcgcggctg gcgacttcct gacctgggta gcggcgcgcg gggtcacgtc     13020
     ccttggggcc gtgcagccgc tccacgtcgg cgcgtggatc gaggcgctgg gaggcgagat     13080
     gagcgcgccc agcgtcaagc agcagctcgc cggcgtgcgt cggctgttcg actggctggt     13140
     gataggccag gtcatgccgg tgaaccccgc cgcatcggtg cgcgggccgg cgcatagtca     13200
     gcggcgcggc aagacgccgg tgctggcccc cgacgaggcg cggcggctgc ttgatacgat     13260
     cgacgtgggt gggccggcgg gtctgcgcga ccgcgcgcta atcgggctga tggtctattc     13320
     gttcgcgcgg atcggcgcgg cgctctccat gcgtgtcgag gacgttttca tgcagaaccg     13380
     ccgtctctgg gtgcggctgc acgaaaaggg cggcaagcag cacgaaatgc cctgccacca     13440
     taatcttgag gactatctga ccgcctatat cgacgggtgt gagctgcgcg cgcaagccaa     13500
     ggggccgttg ttccgcacga tcgcgcgcgg gaccaagcgg ctaagcgaca ctcccctgcc     13560
     ccaggccaat gcgttcgcga tggtgcgccg acgcgcggtg gcggccgaga tcggcacggc     13620
     gatcggcaac cattcgttcc gcgcgaccgg gattaccact tacctgaaga acggcggcac     13680
     gctggagacg gccgcgacga tggcgaacca tagctccacg cgcacgaccc agctctacga     13740
     tcggaggccc gatgacgtga cgctcgatga ggtggaacgg gtgttgatct agtcacctgg     13800
     aactgaagta agcttcattg tataagccct tgtagatcag acggaggtta atgtgatggc     13860
     gggcagacgg gcggatttgg ttgtcttgag cggagatgac cggcgttttc tcgaagctca     13920
     ggtccgccgc cacaaagcgc cgcgttcact ctctgatcga tgccggatgg tcctgctttg     13980
     tgcagaaggg ctgcagagca aggaagtcgc cgaacgcctg ggcgttcacg agcacacggt     14040
     tggcaaatgg cgccgccggt tcgtgcaggc tggcattgaa ggactgactg acgaatatcg     14100
     tgcgggtcgg ccacgaacag tatctgacac gcaagtagct caggtgatcg agcgtacgct     14160
     gaacacgacc cccaaggacg ccacgcattg gtcgatccgt tccatggccg ccaagtccgg     14220
     gctgtcacac accaccatcc gccggatctg gggcgcgttc ggcctgcagc cgcaccggtc     14280
     cgagacattc aagctgtcca ccgatccgct atttgtcgac aaggtgcagg acatagtcgg     14340
     gctctacatg tcgccgccga accgggcgat cgtgctgtgc gtggatgaaa aatcgcaaat     14400
     ccaggcgctg gatcgcgagc agccggtctt gcccatggcg ccgggggttc ctgagcggcg     14460
     cacccatacc tacgtccgca atggcacgac atccctgttc gccgcgctcg acattgccac     14520
     cggcgccgtg atcgggaaat gctacaagcg ccatcgggca accgagttcc tcgacttcct     14580
     caagcggatc gacgccgcga tccccaaggg gccagacgtc cacctcgtga tggacaacta     14640
     tgcgacccac aagacgccaa agatcaaggc ctggctcgca cgccgcccgc attggcatgc     14700
     tcacttcaca ccgacttcgg cgtcctggat caatcaggtc gaacgatggt ttgcagaact     14760
     gacccgcaag cagttgcagc gcggtgtcca ccgatcaacc gctgaacttg agaccgacat     14820
     caccgcattc atcgcggcgc acaacgaaaa ccccaagccc tacaaatggg tcaaatccgc     14880
     cgacgaaatc ctcgccgccg tcaaacgatt ctgccaaaaa acaatgagcc gaacttcaga     14940
     ttcaggtgac tagcactact ttggcagttt ttgttcaggc ctgtctacga ggagcttttc     15000
     acaatggggg caccgaagtg gcggaggcct tatgaagatg ttcaagatcg cctgtcggat     15060
     agctggcatg ctcggttgtg gcggcggccc cccgactctt ttttttccgc cccgctgctt     15120
     tgagacggcg ggcttgaagg aaagcgtatg cgatcattgt catcaatgca tgtcgatgta     15180
     atccaaccca ggagcggcct tcgaaatgat cgaggcccag ttcttccttg agctgctgat     15240
     gtgcttgctc gcagatccat ctcgccttga tcgtcgcggc gagcattttg agggtggcgt     15300
     cggcaggtaa atttgagacg tagttatagc gcgacgatct gggtgagagg tcagcgacta     15360
     tcaggatgag aacagattgt cgcggcgggt tcatggtgcc gggttagatt gtcgctggca     15420
     agggcgattc ttcgctctga ttgtcgctga tcgacatttt ctcgatggat ttgattgtcg     15480
     cgtattttgg ggtccttcca gcccctgtct gtcgctggag ggcggccctg cgacgatagc     15540
     tctcgacatt catctcgaag atggtggcgt gatgaacgag acggtcgacg gccgcgagcg     15600
     tcatggcggg atccgggaag acccggttcc attcgccgaa gggctggttg gccgtgatga     15660
     gcatggatcg gcgctcatag cgtgcgctga tcaactcgaa gagcacggag gtttcagcct     15720
     gatccttggc gacataggcg aggtcgtcca ggatgagcag gtggtatttg tcgagcttgg     15780
     cgatggcgga ttcgagcgcc agttcgcggc gcgcgagctg aagcttctgg accagctcgg     15840
     acgtgcgggt gaacagcacg cgccaaccat tctggacaag ttgcaggccg atggctgccg     15900
     ccaagtggct ctttcctccg cccggcgggc cgaacaggat gagattggcg cccttttcca     15960
     gccatccgtc gcccgaggtc atggccgtga cctgcgcccg cgagaccatc ggcacggcgt     16020
     cgaaggcgaa gctgtcgagc gttttgcccg gtggtaatcg tgcgtcgctc agatgacgtt     16080
     cgatcctacg ccggtcacgt tcggccattt catgctcggt aagtgcagcg agcagtcggg     16140
     tggcgggcca gccctccttg tcggcacgtt cggtaaactc gggccagatc accttgatgg     16200
     caggaagcct caactcgttg aggatgaagc tcaggcgctg ggcatcgacg ttatgggcct     16260
     tggtcatgcg gcctctccca gcagcagggc atcgtagtcg gtcagggggc caagctcgac     16320
     caccacctcg ggcagcgcgg ccggatcggg cgagaagcgc gttcgcaacg cggcgatgtc     16380
     aggcagccgg ccttcgtcaa ggtcctgggc gagaagatcg gcaagctcgg cctcgcaggc     16440
     ccgttcatgg gccatggaca gcaactcgac catcttgcgg caagcgtcac gctcggacat     16500
     ggcttcgagc agccgttcga acatgagcct gtacgcctcg cgcgggaaca actggtcgcg     16560
     ataggtcagc tgcagcaggg ccatcggctt acgcctgagg ctatggatca cgtgacggta     16620
     atccaccaca tagccatgtt cggtagcgct tttcgggcga ccgcgtggcc gggtcatgag     16680
     ataactgccg cccaggaaca gatcgagccg atcatcgtag aggcgcacac gcagtcgatg     16740
     cccgatcaac cgtgacggca ccttcgttgg ttgtgtgcgt caagttctgc aaattggcgg     16800
     tcatggtgct ggtcatgcgg ctttgcgtag ttcggttttc ttctgctcgc gcagttcgtc     16860
     catattgagg tagcggttgg cttcgagcca gttttcgtgg gtttcgacgg cgagtgcgcg     16920
     gaccaggcgc aggcagctgg gggcgttggg gaatatccgc acgacatagg ttcgccgccg     16980
     gatttcctca ttgaagcgtt cgagcatgtt ggtgcttttc atgtgcttgt gatgcctgcg     17040
     tggcagccgg tagaaggaga aggtctcctc gatcgtctcc tcggcccagt cggtgagcct     17100
     gggatatttg gcgctccatc gggcgagcca ctgggcgaga tcggcgcggg cctcggcgag     17160
     gttgcgccgg tcgtagagcc agcgcagttc ctgcaggcag tcgtcgtcgg ccttccttgg     17220
     caagtgatcg agcgcgttcc tcaggaagtg cacgtagcag cgctggtatg cggcgccggt     17280
     cagcacctcg cggatcgccg cgcgcaggcc ggcatgatcg tcggcgacga cgaactcggt     17340
     gccatgcagg ccccggtcac gcaggcgcag caggaagtcc ttccatgacg tggcgctctc     17400
     gcgattggcc atctccacgg ccagtatctg ccgcctgccg tcccagtcga tgccgatcgc     17460
     gatcagcacc gcctggcttc caaccacgcc gccttcgcgc actttctcgt agcgggcatc     17520
     aaggatcaga taagggaacg gctcgtcgag gcggcgctgg gcaaaggccg ccaggctgcc     17580
     atcgagcttc ttgttgatcg ccgagatcgt cgaggccgag aaggcatggc cgcacagctc     17640
     ttcggtgatc gccttgacct tgcgcgtcga aacgccctgg acatacatct cggccagcgt     17700
     cgccaccagc gcctgctccg accgctggta gcgctcgaac agctcggtcg agaagcgccc     17760
     ggcacggtcc tgcggcaccc gcagctccag cttgccgacc cgcgtcacca gcgtgcgcgg     17820
     gtaatgcccc gaacggtagc cgagccgcgc atcgctgcgc tcgctcttgc ccgcgcccag     17880
     cgcctcgtcc atctcggctt ccagcatcgc ctgcatcacg ctgcgcacaa tctcgcgaag     17940
     cgcatccggc tcctgcgcca gcaactcttt gacagcggat acagcaggct taatctcggt     18000
     cctggtcatg gcgggtctcc tcggtgacgt tgaacatcac cagccggctc tgttgcaaag     18060
     attggcggca gtcagaggta ggctgtcgct ctgcgccgat caggcggctg ctgcgaaatg     18120
     gtggttgagc atgcccatgg cctccgtcag cgccgagggc ccaatgccaa aagctctctc     18180
     cacaaggcgc acctcgcccc tgatgccggg ctgcaggcac caggggcgag cctgtccttt     18240
     gcgcagggct cgcatgactt cgaatccctt gatcgtggca taggccgtgg ggatcgattt     18300
     gaaaccgcgc accggcttga tcagtatctt gagctttccg tgatcggcct cgatcacgtt     18360
     attgagatac ttcacctgcc ggtgggccgt ctcccggtcc agctttcctt cgcgcttcaa     18420
     ttcggtgatc gctgcaccat agctcggcgc tttgtcggta ttgagcgtgg caggcttttc     18480
     ccagtgcttc aggcctcgca gggccttgcc caggaaccgc ttcgctgcct tggcgctgcg     18540
     ggtcggcgac aggtagaaat cgatcgtgtc gccccgcttg tcgactgccc ggtacaggta     18600
     ggtccacttg ccccgcacct tgacgtaggt ttcatccagg cgccagctcg gatcaaagcc     18660
     acgccgccag aaccagcgca gccgcttctc catctccggg gcgtagcact ggacccagcg     18720
     atagatcgtc gtatggtcga ccgaaatgcc gcgttccgcc agcatttcct caaggtcgcg     18780
     atagctgatc ggatagcgac aataccagcg caccgcccac aggatcacat caccctggaa     18840
     atggcgccac ttgaaatccg tcatcgttcc gtccgtccaa tctccgccaa gcatgctcaa     18900
     gcttcacgat ttttgcaaca gagccctcgc ggatcagggc acgctcgaac tgcgcgatgg     18960
     cgccgaacac gtgaaaggtg agcatgccac ccggcgttgt cgtgtcgatg ctctcggtca     19020
     gcgacaccag cccgatcttc tcgcgctcca gatcctcggc cgtggcgatc aacttcttga     19080
     gcgagcgggc gaggcggtcg agcttccaaa caaccagcgt gtcgcctgcg cgcagcacgt     19140
     cttccagaat gcgcgccagt tcgggccggt catcgcgcgc gcccgacgcc ttttcggtga     19200
     acacccgctc gcagccggcc cgccgcagcg catcgagctg gagctcgggg ttctggtcgc     19260
     tggtgctgac cctggcatag ccgacccgca tgagcgtctg atcttctcca aactcgtgcg     19320
     gggcataccg ttttgcgacg cgggtttcca gaacagtttt gacaaagtgc ggcccgcaga     19380
     tttacgttgc cggcccagca aggcgatcgg ctcgtcagaa acggtcgttt tgcagaaccg     19440
     ctgaggagcc gggttcatgc aggtgctcga tacggttggc tgggtcggtg atggcgacga     19500
     caccgacttc ttcctcgcaa tcgagcgcac cttcgatctg cgcctgcgct cgaacctgcc     19560
     ttggacaacg ttcggcgagg tgcgtgacca tgtcgtcgcg catgtcgcag cctacagcgg     19620
     gggcggcacg acatgcgcca cgcagatgac gttctacagg cttcgacgcg cgctcgggct     19680
     tggccggcac gtcgggccgg atgcgccgtt ggcgccgctg atcggtggga agctgcgcca     19740
     agcgttcagc gacctggaag ccgataccga cctcaagatg ccggcgacgc gagccggatg     19800
     gcttgggatt gtcagtggtc tctgcttcgc tgtcgcggtc gcgatcctcg ccttcacgac     19860
     gctggcacct ccccttcgca tcttcgctgc tggagcgagc gcctacgcgg ggctatggtt     19920
     acggcacctc gaccgccggc gattacctcg gaggtgcgac actatcggcg atctcgcccg     19980
     actggtcacg gagcagaacc gtggcaggct tgcccgcgac ggcgcgcgcc tcaccgcccc     20040
     cgagatttgg cggatcatcc agcaactggc cgccgaggag agcgggatcg accccgatct     20100
     gattgggtcg gaaacgacct tcttccgagc caaagtgcga gcagcctgat caatggctta     20160
     ctggattgca tagattgatg ccgagacacg ggacattgcg tggcgtcgga ctgacggctt     20220
     tgggtgccgt tgtcgtcgca ggctctttcg tcgctctcgg attgcgaccg gatgggatcg     20280
     ccagctacta tcgcgatacg ctgactccgg cagggtttgc catttggttc tgcggcttcg     20340
     tagccgccac actcgctcca cccgccatag ctgtactctg ctggtttggc gccatgcggt     20400
     tccgctacgg gtggcttctc cacatcctgc ttgttcctgc cacctacgcc gctgtgcgag     20460
     gatcaatcgc gctcatgctc gcggtagcaa gtgagccgga cagcgatggc ccaacgagat     20520
     gggctaccga tccagcagtg atgctgatgg tggtttgccc catcgtgtac tttctgatct     20580
     tgggttccac aaagctgcgt gagcatcgcg catcagcaaa tgactgctaa tctcgacttt     20640
     gtagttggca gataccatga gcggcccttt gccgtttgcg agcagacgcg gatgatggcg     20700
     agcacattgt cggatagcgt gagcagcata gtcggctcgt tgtcaggtaa tctgggcagg     20760
     aaaaggcgct gtttgcgagc agaagctgct acggttgcaa gcgcctacac ctagcgccca     20820
     tccagcggcg catatgatcg gaacgtaaag cggaagcaag ccagcgctgg gataggcgtg     20880
     gttcgcccat gaaagggcgg tgacggcaac gaggatcgcg aaccaggcat gttcgcgcgg     20940
     cagggattcc agacgttcgg ccattcggcc gacagggaga tgactgttca cgcgcttccc     21000
     acccctaccg caaagctcca tctgcactcg ccggcgacag tcgatcggac agccgaccgc     21060
     acgccgccac atcggaagcg tgcagccggc agcaaccggc cattggaaac ctgatgtaag     21120
     tcaggcgcga acacctttgg gccaagggcc ttggacatgc gtgttcgctg cccggtcgct     21180
     gaagctcgtc ttacattgag aggtttccac gcctctgccc ccctctcagc gggcgcgtgt     21240
     cgtttagagg aaaagcatta cgaattgcaa ataaagtgca gttccgcacg ttcgcggcgc     21300
     tgccctccgc taagtcgttt aaacgatctc aaccaacgca gaggcgcgat cgtcactcgc     21360
     gaaataggtc caccacatga cagcccagcg cgcccgcaat cgaatccaac agttccaacg     21420
     tggggttgcc gcgtccgttt tctatgcgcg atagatacga ggcagtaacg ccggatcgct     21480
     ccgataattc tgtttgggac atttcgagtt gcacgcggcg ctcgcggcag tttcggccga     21540
     caagcatcgc gaagctctct actccggcaa gagctggttg gttcatggtt tttgtccgct     21600
     atccgctttg acctcaatcg tgcagcgcac gggctttgcc gccttttccg cctgctcacg     21660
     gcatttctgc accgtctcgc gattggcatc cgtcagcggg gaagccgcga cgatcagcgc     21720
     ccagctctcc ggatcggccg cctgcatcaa ccgctgcccc gccccccacg ggccaggctc     21780
     attgagaacg cgggtcgcca tacgctcggg ccagcgccag ctatcggggg tcgcccgcgc     21840
     gagcgggccg gcaagtaggg cgtagagcaa cagccccagc accacgccgc aagcgccgat     21900
     gacatacagc cagcggtttt gctcgtcgcc gcgccgcgcc gatgcgagac ggttgccgat     21960
     ctcgcgcgcg gcctggtcca gcgccgtgcg cgcctcggtg ataaggcgct gatcctcgcg     22020
     gcgcgcgttc gtggcggcgc tggcgatctc acccgccata tgcgccgggt ccatcgacag     22080
     ggcggggctt ttccgcatgg cggcgatctg ctgggccagc acccccagca cttgctcggt     22140
     gcgccccagc gtcggctcgt aatcgggaat ctcgatattc tcgcgcgcgg cggtcagccc     22200
     ctcgatcgcg gcgcgcagca acgccacctc gccatgcacc gacgccaacc gatcctcgac     22260
     ccgcgcgaac gccagcgccg gatcgtcagc gtcgccaaaa ctatcatcct cttcccgcat     22320
     cgccgcctcc gtccgtctat atttgacaat ttttcacaac atccaacgaa atcaaatgat     22380
     aaggcggcgc gcgacccgaa agtctcaata gcgactctct tgagacttac tggcctgcca     22440
     gtcgtgggac tggcaggcca tttttccggt cggccaatta ccggctaagg ccacgatcgc     22500
     ggccaatccc aagttcgtgc gtcaactggt ggctaaggtc gcgcccgcgc cccatgccca     22560
     tctcaagccc cagctcgcgc tcacggccgc gcaggatcga ttccacctgg ggatcgcgct     22620
     caaggctttt cgccatgccc gccatttcct tgcccgcctt ctcgcggccc gtcatgtcgc     22680
     cggcgcgata aagccggtca cggtcctggg agagctgttg ccagcgttcc acgaaccgat     22740
     cggcgcgcaa gttcggatcg gcccgcacct tggcctcctg cgccatcgca tccatcatcg     22800
     ggccgctgcg ccccgccgcc gcctcatgga gcaagccggg ttcgcgctgg aacgccgatg     22860
     ccatatcgcg cgaagccccc gccctgatct ggtccagcgc ctcggtcgcg cgctcgagcg     22920
     cgaccttctg atgctccaat accggcccgc ccgatgcgcg ggcctgcaac accgcctcgg     22980
     ccgaacgcga ggcccgctcg accgcgcgcc ggaaatcatg ggtaaggccc tgctcggcac     23040
     gcgccggggc ttccttcgcc ggcgtcggcg tgcgcgacga cagtttcagc ccatcgaaca     23100
     tgccccgctt gggagccgct ttttccttcg cgccctgcgc tggctcggcc gccttcgccg     23160
     gctcggccga cagcttcaag ccgtcgaaca tgccgcgccg cggctgtcgc tcggccgcgg     23220
     ccttcgcatc ccctgcgccg cggccctcgc cgatctcgcg tgggcgtgga tctccgccca     23280
     tctggcgcat ggtgccagca cgcgggccaa gaagctccac acccttgcgc tcgggcgcat     23340
     ccggcaatcg gatctcgccc gacagaccgc gccgatcggc gaacgattgc gcctcggcgt     23400
     cgcggtcccg atacatggga taatccgacg ccatatcctt cgcccgctcg cgcgacagcg     23460
     tgcggacaag ccgccgatcg tcggcgaagt cgtcgcggcc atagtggagc tgcacgccct     23520
     cacggtgccg cgacagcgcc acataggccg catggcggtc catccccggc gtcgccagca     23580
     catgcccctg atcgaccgtc acgccctgcg atttgtggat ggtcgcggca tagccatgat     23640
     cgacatgggc atagtccttg aggtcgaacg ccacctgtcg gccatcatcg agccgcaccg     23700
     ccatgctgtc gggcgacacg cgctcgacct tccccagcgt gccgttcttc acgcctagcc     23760
     cgcgctcgtt tttcaggaac atgatgcggt cgccggtcgc gaactcgcgc gcgccccgct     23820
     cggccgaaat ccgcacgtcc tgccccagct cgccggcttc gcgcagccga tcgcgcgcgg     23880
     cctggttcaa atcacgaacc tcggcattgg tgtgggtgag gatgatccgc gtcttttcgg     23940
     gatcggcaag ccgctgcgcg tcccatgtgt cgatcagctc ggcccgcgca gcctcgcgcg     24000
     tctcggccgc gtggaccatg ccatgctcgg cataggcatg gatcgcctcg ccggtcctgc     24060
     ccgtcgccag cgcccgcgtg gcgtccttct gccagtcctc atgctgccgg cgaacctcgc     24120
     tgatctcggc cgcgccgtgg cgctcggcaa gggaccggaa cgccgccccg gcctcgatcg     24180
     cctgcaactg ctcgggatcg ccgacaagga ccaccttcgc gccggccctt tcggcctcgg     24240
     acaatacgcg ctccatctgg cgcgtgccga tcatgcccgc ctcgtcgatc accagcacgt     24300
     cgcgcgggcc tagcagctcg cggccctggt cccactgata ttccatgctc gcgatcgtgc     24360
     gggactggat gccggaaccg ccctcaagcc cctcggccgc gatgccggac aaggccgcgc     24420
     cgcgcacctg atagccggcg cgctcccatt cgtcgcgcgc cacgcccaac atggtcgatt     24480
     tgccggtgcc ggcatagccg acgacgattg ccaggtcgtt cttgccggtg atatgcgcca     24540
     gggcgtcctt ttgctggctt cccagcgcaa ggcttccact ctcggcggtg tctcgccccc     24600
     ccatttgaga cgccgccgag agaccatgcc ccgcccgatc cgcaagccga tcgccggcct     24660
     ggctcaaccg ctgctcggtg tcgatcatgt cgcgcgacgt gaaccgatcc tcgccgcgcc     24720
     cgtccttccc cagcgccacc agctcgggcg aggtccgcac cgcgctcatc acctggtcga     24780
     actgatcctt gccgtcgctg tgccggaacg cgaactgcgc caggtcgcgc cgcgtgaacg     24840
     tcgcctgctg gcgcgtgatc gcgtccagcg cgatctcggg ccgcgcaatg atcttctcgc     24900
     cattttcgcg cgcgatccgg gcatggtcct cgacccgctc ggcctcaagc ccttgttcgg     24960
     gcatccgcga tgcagccggc ccgatcttgt gttgcggctc aaggtcgatc ccctgcgccg     25020
     ccaacgtgcg atggtcgatc cgcgcgtcaa tatccagctc ggcaaggcgc tggttcacat     25080
     ggtcggccca cgcctcgcgc cactccttca ggagcgccgt gctgttccac tcgactacct     25140
     tcttgccgaa gccgtccggg ctgatttcac gcatcgacaa catgacatgc gcgtgcggct     25200
     tgggctggcc gtccttgccc atgtcccaat gcacattgag gtcggccacc atgccgcgtt     25260
     cgacgaactg cttttcgacg aactcgcggg cgagctggac gccctgctgc tggttcagct     25320
     cgcgcggaat cgagaactcg acttcgcggg caagttgcgc gtccttgcgc ttctcgccgg     25380
     cctccacctc gttccacaag gtcgcgcgat cgtttaaacg ctccggcgca ccttcgggca     25440
     gcatgatttc cgaatggacg acgccggcct tgttcgagaa atcatgatcg cgcccgagtc     25500
     ggtcatcgtg cagccgctcc gccgcacgat aggccgcgct cgcaacggcg ctcgatccac     25560
     tggatcggcc aatgactttc gcggagaaat ggtagattgc catgacgata cgaaacttac     25620
     ctttcttagc gcaggtcggc aacgacctat aagcgcgcac tcaccactca ctgccgttcg     25680
     cgtgattgac ttcaccgtat ttctgttcgg aaccgctgtc ctgccagcgc gatcatgcta     25740
     ctgtgcggct tctgttcgac gggcgcgagg gagagaatga tgcgaaagac gcgcgactat     25800
     gacgccgaat tgcgggcact gagcgacaag gccaagtcta tcaaggcgaa gaagatacag     25860
     caactcggcg agctggtgac ggggaccggg gccgatgcgc tcgatctgga cacgctcgcc     25920
     ggtgcgctgc tcgccgccgt ggaatcggcc gacgcggagg aaagggaggc gtggcgctcg     25980
     cggggcgcgg ccttctttca aggacgcggg cgcaaggctg ggcgacgcgc tggcggcaac     26040
     ggcgaaggcg gaaaccaagc tggcgcaggc gaggcacagg gttgaagccg ccaagcgccg     26100
     caccgatacg agaggatggg tcgtgcagcg tcgcgaacgc acccgccatc tcatagagct     26160
     gggcggcctc gtccagaaag ccgggctcgt cgaactgacc gacgacgatc gagcaacgct     26220
     ctatggcgcg atgctcgatc tggccgcccg cgcgcaaggc gatggcaacg ccctcgcgct     26280
     ctggaagcgg cgcggcaaac gggccttcga cgcggaagcg gaaggacagg acaacgcgga     26340
     aggaaacgcc catgactgac acgtcgcgcc tctcctggca gctcctgatg gtcggaccgg     26400
     gaatcgaccg gatcaccccc gacattcagg acaagctcgc ctcgctgctc gatctgcttc     26460
     ccgccaccgc gaccatcaat gtccagaccg atgccggcta tgtcaccgtc tcgcgcgact     26520
     ggcccagtca ccgcatggaa accgtcgata gcctggtgga cgaaatcgcc gccgctccgg     26580
     gcatcaccca tatcgcgctg ccggcaagcg aaggacagga accgtgacgc gcgccctcga     26640
     catcggggcg atccgcgccc aggtccgcgc gctcgattat gtgcgcggca cccccgccga     26700
     agtcgcgatg tggcgcgaag gcgatgccga agcccgcgcc aatctcgcga tcgaaggcat     26760
     ggacctcgac gccgacgaac acgccctgtt cgacatgctg cgcgcggaag ctgtcccccc     26820
     tcccctcgcc accgcgatcg tcctcaagct gctcgatcat cccgacgcgg acccggcgct     26880
     ggcgatcacg ccggcaacga tcggatgacg atgcgggccg atctcgatca tcttcccgcc     26940
     gccaagcgcc gcgaactgga acgggtcgcc cgcgtcctgt tcgatgaatt tgaggatgcc     27000
     gtcaaaacca agctctccga caaacgcaag ggcggccgca tcctcaagct gatcctgttc     27060
     ggctcctacg cgcgcggcga ttgggtcgag gatcgcgcca gcggctacat ctccgactat     27120
     gaccttctcg tcgtcgtcaa ctccgagacc ttcaccgatc tgcaaacatg gtgggcggtc     27180
     gccgacgatc atctggtgcg cgagctgacc gtcacccgcc atctctcaac gccggtcaat     27240
     ttcatcgtcc attccctgat ggacgtaaat gaccagctcg cgcgcggccg tcccttcttt     27300
     gccgacatag cccgcgatgg cattgccctc tacgaagcgc cgggacaggg cctcgccatg     27360
     ccgcgccagc tcgacgcgca ggaacgccac gccgaagccc tgcgccatcg cgaccattgg     27420
     ttcccgctcg ccgcgcacgc gctcaagctc gcccaggaca gcatcgccga cggcgtgccg     27480
     cgcgatgcgg cgttcatgct gcaccaggcc gtcgagcggg cttacaatgc cgtgctgctc     27540
     gtcctgacgc tctacgcgcc caaatcgcac cgtctcggca tcctgcgctc gctcgccgaa     27600
     aatctagacc cccggctgat cgaagcatgg ccgcgcgata ctcgcgcggc ccgccgccat     27660
     ttcgcacagt tgcagcgcgc ctatgtcgag gcccgctatt cccacgccta tgaaatcacc     27720
     cccgacgaac tggcctggct cgtcgagcgc gtgaggcatt tccacacgat cgccgccgcg     27780
     atctgcgccg aacatctcgc cacgatcgac accaaaaacg acccaggagg attgccatga     27840
     aaccagccct gttcctcacg cccctgctcg gcctcgccgc ctgcaccccc gctgcgcccg     27900
     accctcgcgg tgtcgatcgc gacgaaaccg tgctgaccgt caccggcacg gggcgcgccg     27960
     aagccacccc cgatcaggcg ttgttcactg ccggcctgtc gagcatcgcc gccgacgcgc     28020
     aggccgccag cgcccgcaac gcggaaacca tgaacaagat caccgccgcg ctcgccaggc     28080
     tcgacattcc ggcgcgggat attcagaccc gcaacctctc ggtcaaccgg atcgactatg     28140
     gcgcgaacaa gggccgctat gaggccagca acagcgtcgc cgtgcgggtc cgcgacaaca     28200
     aacgggtgag cgaagctctc gccgccgtca ccgctgccgg ggccaacatc gtctccggcc     28260
     ccaatctctc ggtcgccgat cccgaaaagg ccaacctcgg cgcttatggc accgcctaca     28320
     aggccgcgcg cgccaaggcc gatgcctatg ccgccgccgc caacctgcgc gttacgcgcg     28380
     tgctggcgat cagcgatggc ggccagggcg gctatatgcc gcaaatggcc gacatggagg     28440
     cccgcatcgc cgctcccccg acagtcgtgc cacaggcagc gcccccggtg atggcgggga     28500
     ccaacatgaa catcgtgacc gtgcgggtgg atttcgccct ggcggcgaag tgatccggca     28560
     tggaatggtt ccgccagctc ggccgcgcga tccgcaacct cgcccgcctc gcgcgcgagc     28620
     aaccgatttg ggcgatcacg gcgctgaccc ttagcccgct cgcgctcatc cgccatctgt     28680
     ttcgcaccgc gatcctgttc ctgatcgtcg gcatcgtcct ggccggcggg atgcaattcg     28740
     tcctcgcctc cctgctcggc ctggctcgcg attccaatct ctaccagctc ggcatgatgc     28800
     tgacgttcct cgtcatcatc ctggtcacgc tgcgcgccct cttccaaccg ctgatcctgc     28860
     gctatggtgg ccctgccggc gacgataccc acggctcggc ccgcttcgcc accgatcgcg     28920
     agacgcgccc cctcgcccaa aatggcgacg gcctgctgat cggccgcgac cgcaaatcgg     28980
     gcaagccgct gcgctatgcc ggccccgccc atctgctgac gatcgcgccg acgcgcaccg     29040
     gcaagggcgt gggcaccatc atccccaacc tgctcgacta tcccggcccg gtcgtctgca     29100
     tcgaccccaa gggcgagaac gcgcgtatca ccgcccacta tcgcgcacgc ttcggcccgg     29160
     tccatgtcct cgatcccttc ggcgtaacgg gcatggtcgg ggccgcgttc aatccattgg     29220
     atcgtatcga ccctgccggc ctcgatctcg ccgacgactg catgacgctg gccgacgcac     29280
     tggtctatga cgcccccggc gaagcgggcg aggcgcattg gaacgaggaa gccaaggcgt     29340
     tgatcgccgg cctgatcctg catatcgttt gccaggagcc ggcgggcaca cgaacccttg     29400
     ccacgctgcg cgaccggctc accctcgctc cgcaagcctt cgccgcccag ctcgaagcca     29460
     tgcaggcgca aggcggcctc accgcccgcg ccgccaatcg ccacctcggc aagtccgatc     29520
     gcgaagccgc tggcgtgctg tcggccgcgc agcgccatac ccattttctc gacagcccgc     29580
     gcatgacggc ggtgctgggg cactcggatt tcacgttcgc cgatgtgaag gcgcagccta     29640
     ccagcgtcta tctggtgctg ccgcccgatc ggctcgccac ctatgcgcgc tggctgcgcc     29700
     tgatgctcgc gcaagggctg accgatctcg cgcgcgcgcc ggcctcccct gcccgctccg     29760
     tcctgttcct gctcgatgag ttcgccgccc tcggccgcct cgaacccgtc gagcgcgcta     29820
     tgggcctcat ggccggctac ggcatccagc tctggccgat cctgcaagac gttcaccagc     29880
     tccgcgcgct ctacgagcgc cgcgccggca ccttcctgtc gaacgccggc gtcttgcaga     29940
     tattcggcgt caacgatcac gacagcgcca agctcgtctc cgatctgctc ggccaggaaa     30000
     cggtcgtgtt cgagagcatg agccgcgcga tcgacgcgga agagaccggc atatcgttcg     30060
     gatcgcagca tgtcggccgc cccttgctca cgcccgatga ggtccgcacg ctgcgcgagg     30120
     atttgcagct cctgttcctc gcggggcaac ggccgatcgt cgccgccaag ctacgctatt     30180
     tcgccgatcg cgagttcgcg gggaagttcg acaaggtgta gagcgtttaa accgtctcaa     30240
     acacaaggta tttcgaccat gcctaatgaa cgatttgagg aatttgccga tcgattcatg     30300
     aaaagcatcg gcgagccggg ctgtgaccta caagcattgg tcgatgagct gatagaactg     30360
     cacgctgtcg agcgcgacga atttaaccgt gtccgcctga taagtatgca cattgcgttg     30420
     accaacatcg ctgccgaagg cttggccaag gcacaagccc caggctctca gatcatcggc     30480
     tttctggccg ataacctttc gacttaccat ctcatgctcc gccaggagag tttggttgac     30540
     gggcagatcg acaaggccgt gcttttgcgc gtgaccgaac gcgaaatcac cgctggccgc     30600
     atgaagggca acgatcctct ccgggcattt gccgaaggcg gcgagtatat tcgcgacaat     30660
     ccgatggagg gccttttcca cgctgatcca tcggccgacg acaaacccgt cctgaattga     30720
     agcgatagca ccacgcgcca cagggcgcga atgtataggc gtatacaaat atacaagttc     30780
     gccgtctgtt cggcctgggc gttgtttagc ggactttccg cgccctcccc tgccggttct     30840
     tagcgtagga ttccgccctc tcccgcaacg atgatcgggc caggttcgcg aaatcgttgt     30900
     ctggcgcaca aatcttgaag ctcgccgcgc cgatcgcggc cgctcggacc cgatgttgcc     30960
     gtttttcagc cctagcgtcc ataaaacgca cttccgtgtc gtcgcgcgcg atcgtgcgag     31020
     gatctagctt ccaaaaaatc ggccgcctag gaagcccgta gagcggcatc gggcgctcga     31080
     cctctccaac cctgccgaac gctcagaatg acgcccagcg gcccggaaat cgcccctgcc     31140
     gcgacgtttc cgcctcccct gccctctcgg cttgatcgct gccctatccg cctggctttt     31200
     ctggaaagcc aattgcgacg gtgccgctgg cgctgtggtc gcggcagggg cgcagcgttt     31260
     aaacgatccc taatccaaca aaaagcgtgc cggcgaagcc ggctcatcat gggggatgcc     31320
     gggtgggagg atcgcaaagc gatccggggc ggccgcaggc cgcgagccgg cgggggcgaa     31380
     gcccccaaga ggcggcgctt ttcttccctc tgaccgtgct tcaagcactg cgccagtgag     31440
     tcgcgctgcc tctgtcccga tttccgggac aggttgtccg atctggcggg atgctggtgg     31500
     gtgaaaccac gtcgcggcaa aagttatcca cagggcggcc tagtgttaat atatgggtta     31560
     aagagtcgtg ttacgggatt ttggcgtctc cgtaagatac tgaatataat agtgaaatcg     31620
     gccatttttt ggccttgggc gtcaacggaa ccccgaatcc ggtgactcca gaaccccgaa     31680
     tctgcgtcaa cgaaaccccg aatcgtcggc gagcgtcaat gaaaccccga actttttcgt     31740
     tgcgtcaatg aaaccccgaa tctacggtgg ccgtca                               31776
//

If you have problems or comments...

PBIL Back to PBIL home page