(data stored in ACNUC30630 zone)

EMBL: AP010890

ID   AP010890; SV 1; circular; genomic DNA; STD; PRO; 2400312 BP.
XX
AC   AP010890;
XX
PR   Project:PRJDA32051;
XX
DT   31-JAN-2011 (Rel. 107, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
DE   Bifidobacterium longum subsp. infantis 157F DNA, complete genome.
XX
KW   .
XX
OS   Bifidobacterium longum subsp. infantis 157F
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-2400312
RA   Hattori M., Toh H., Oshima K., Itoh K., Ohno H.;
RT   ;
RL   Submitted (02-OCT-2008) to the INSDC.
RL   Contact:Masahira Hattori University of Tokyo, Graduate School of Frontier
RL   Sciences; 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8562, Japan URL
RL   :http://www.cb.k.u-tokyo.ac.jp/hattorilab/
XX
RN   [2]
RX   DOI; 10.1038/nature09646.
RX   PUBMED; 21270894.
RA   Fukuda S., Toh H., Hase K., Oshima K., Nakanishi Y., Yoshimura K., Tobe T.,
RA   Clarke J.M., Topping D.L., Suzuki T., Taylor T.D., Itoh K., Kikuchi J.,
RA   Morita H., Hattori M., Ohno H.;
RT   "Bifidobacteria can protect from enteropathogenic infection through
RT   production of acetate";
RL   Nature 469(7331):543-547(2011).
XX
DR   MD5; a5957f9aacd859346025aa70e958133d.
DR   BioSample; SAMD00060953.
DR   EnsemblGenomes-Gn; BLIF_16SrRNA01.
DR   EnsemblGenomes-Gn; BLIF_16SrRNA02.
DR   EnsemblGenomes-Gn; BLIF_16SrRNA03.
DR   EnsemblGenomes-Gn; BLIF_16SrRNA04.
DR   EnsemblGenomes-Gn; BLIF_23SrRNA01.
DR   EnsemblGenomes-Gn; BLIF_23SrRNA02.
DR   EnsemblGenomes-Gn; BLIF_23SrRNA03.
DR   EnsemblGenomes-Gn; BLIF_23SrRNA04.
DR   EnsemblGenomes-Gn; BLIF_5SrRNA01.
DR   EnsemblGenomes-Gn; BLIF_5SrRNA02.
DR   EnsemblGenomes-Gn; BLIF_5SrRNA03.
DR   EnsemblGenomes-Gn; BLIF_5SrRNA04.
DR   EnsemblGenomes-Gn; BLIF_tRNA01.
DR   EnsemblGenomes-Gn; BLIF_tRNA02.
DR   EnsemblGenomes-Gn; BLIF_tRNA03.
DR   EnsemblGenomes-Gn; BLIF_tRNA04.
DR   EnsemblGenomes-Gn; BLIF_tRNA05.
DR   EnsemblGenomes-Gn; BLIF_tRNA06.
DR   EnsemblGenomes-Gn; BLIF_tRNA07.
DR   EnsemblGenomes-Gn; BLIF_tRNA08.
DR   EnsemblGenomes-Gn; BLIF_tRNA09.
DR   EnsemblGenomes-Gn; BLIF_tRNA10.
DR   EnsemblGenomes-Gn; BLIF_tRNA11.
DR   EnsemblGenomes-Gn; BLIF_tRNA12.
DR   EnsemblGenomes-Gn; BLIF_tRNA13.
DR   EnsemblGenomes-Gn; BLIF_tRNA14.
DR   EnsemblGenomes-Gn; BLIF_tRNA15.
DR   EnsemblGenomes-Gn; BLIF_tRNA16.
DR   EnsemblGenomes-Gn; BLIF_tRNA17.
DR   EnsemblGenomes-Gn; BLIF_tRNA18.
DR   EnsemblGenomes-Gn; BLIF_tRNA19.
DR   EnsemblGenomes-Gn; BLIF_tRNA20.
DR   EnsemblGenomes-Gn; BLIF_tRNA21.
DR   EnsemblGenomes-Gn; BLIF_tRNA22.
DR   EnsemblGenomes-Gn; BLIF_tRNA23.
DR   EnsemblGenomes-Gn; BLIF_tRNA24.
DR   EnsemblGenomes-Gn; BLIF_tRNA25.
DR   EnsemblGenomes-Gn; BLIF_tRNA26.
DR   EnsemblGenomes-Gn; BLIF_tRNA27.
DR   EnsemblGenomes-Gn; BLIF_tRNA28.
DR   EnsemblGenomes-Gn; BLIF_tRNA29.
DR   EnsemblGenomes-Gn; BLIF_tRNA30.
DR   EnsemblGenomes-Gn; BLIF_tRNA31.
DR   EnsemblGenomes-Gn; BLIF_tRNA32.
DR   EnsemblGenomes-Gn; BLIF_tRNA33.
DR   EnsemblGenomes-Gn; BLIF_tRNA34.
DR   EnsemblGenomes-Gn; BLIF_tRNA35.
DR   EnsemblGenomes-Gn; BLIF_tRNA36.
DR   EnsemblGenomes-Gn; BLIF_tRNA37.
DR   EnsemblGenomes-Gn; BLIF_tRNA38.
DR   EnsemblGenomes-Gn; BLIF_tRNA39.
DR   EnsemblGenomes-Gn; BLIF_tRNA40.
DR   EnsemblGenomes-Gn; BLIF_tRNA41.
DR   EnsemblGenomes-Gn; BLIF_tRNA42.
DR   EnsemblGenomes-Gn; BLIF_tRNA43.
DR   EnsemblGenomes-Gn; BLIF_tRNA44.
DR   EnsemblGenomes-Gn; BLIF_tRNA45.
DR   EnsemblGenomes-Gn; BLIF_tRNA46.
DR   EnsemblGenomes-Gn; BLIF_tRNA47.
DR   EnsemblGenomes-Gn; BLIF_tRNA48.
DR   EnsemblGenomes-Gn; BLIF_tRNA49.
DR   EnsemblGenomes-Gn; BLIF_tRNA50.
DR   EnsemblGenomes-Gn; BLIF_tRNA51.
DR   EnsemblGenomes-Gn; BLIF_tRNA52.
DR   EnsemblGenomes-Gn; BLIF_tRNA53.
DR   EnsemblGenomes-Gn; BLIF_tRNA54.
DR   EnsemblGenomes-Gn; BLIF_tRNA55.
DR   EnsemblGenomes-Gn; BLIF_tRNA56.
DR   EnsemblGenomes-Gn; BLIF_tRNA57.
DR   EnsemblGenomes-Gn; BLIF_tRNA58.
DR   EnsemblGenomes-Gn; BLIF_tRNA59.
DR   EnsemblGenomes-Gn; EBG00001272491.
DR   EnsemblGenomes-Gn; EBG00001272492.
DR   EnsemblGenomes-Gn; EBG00001272493.
DR   EnsemblGenomes-Gn; EBG00001272494.
DR   EnsemblGenomes-Gn; EBG00001272495.
DR   EnsemblGenomes-Gn; EBG00001272496.
DR   EnsemblGenomes-Gn; EBG00001272497.
DR   EnsemblGenomes-Gn; EBG00001272498.
DR   EnsemblGenomes-Gn; EBG00001272499.
DR   EnsemblGenomes-Gn; EBG00001272500.
DR   EnsemblGenomes-Gn; EBG00001272501.
DR   EnsemblGenomes-Gn; EBG00001272502.
DR   EnsemblGenomes-Gn; EBG00001272503.
DR   EnsemblGenomes-Gn; EBG00001272504.
DR   EnsemblGenomes-Gn; EBG00001272505.
DR   EnsemblGenomes-Gn; EBG00001272506.
DR   EnsemblGenomes-Gn; EBG00001272507.
DR   EnsemblGenomes-Gn; EBG00001272508.
DR   EnsemblGenomes-Gn; EBG00001272509.
DR   EnsemblGenomes-Gn; EBG00001272510.
DR   EnsemblGenomes-Gn; EBG00001272511.
DR   EnsemblGenomes-Gn; EBG00001272512.
DR   EnsemblGenomes-Gn; EBG00001272513.
DR   EnsemblGenomes-Gn; EBG00001272514.
DR   EnsemblGenomes-Gn; EBG00001272515.
DR   EnsemblGenomes-Gn; EBG00001272516.
DR   EnsemblGenomes-Gn; EBG00001272517.
DR   EnsemblGenomes-Gn; EBG00001272518.
DR   EnsemblGenomes-Gn; EBG00001272519.
DR   EnsemblGenomes-Gn; EBG00001272520.
DR   EnsemblGenomes-Gn; EBG00001272521.
DR   EnsemblGenomes-Gn; EBG00001272522.
DR   EnsemblGenomes-Gn; EBG00001272523.
DR   EnsemblGenomes-Gn; EBG00001272524.
DR   EnsemblGenomes-Gn; EBG00001272525.
DR   EnsemblGenomes-Gn; EBG00001272526.
DR   EnsemblGenomes-Gn; EBG00001272527.
DR   EnsemblGenomes-Gn; EBG00001272528.
DR   EnsemblGenomes-Gn; EBG00001272529.
DR   EnsemblGenomes-Gn; EBG00001272530.
DR   EnsemblGenomes-Gn; EBG00001272531.
DR   EnsemblGenomes-Gn; EBG00001272532.
DR   EnsemblGenomes-Gn; EBG00001272533.
DR   EnsemblGenomes-Gn; EBG00001272534.
DR   EnsemblGenomes-Gn; EBG00001272535.
DR   EnsemblGenomes-Gn; EBG00001272536.
DR   EnsemblGenomes-Gn; EBG00001272537.
DR   EnsemblGenomes-Gn; EBG00001272538.
DR   EnsemblGenomes-Gn; EBG00001272539.
DR   EnsemblGenomes-Gn; EBG00001272540.
DR   EnsemblGenomes-Gn; EBG00001272541.
DR   EnsemblGenomes-Gn; EBG00001272542.
DR   EnsemblGenomes-Gn; EBG00001272543.
DR   EnsemblGenomes-Gn; EBG00001272544.
DR   EnsemblGenomes-Gn; EBG00001272545.
DR   EnsemblGenomes-Gn; EBG00001272546.
DR   EnsemblGenomes-Gn; EBG00001272547.
DR   EnsemblGenomes-Gn; EBG00001272548.
DR   EnsemblGenomes-Gn; EBG00001272549.
DR   EnsemblGenomes-Gn; EBG00001272550.
DR   EnsemblGenomes-Gn; EBG00001272551.
DR   EnsemblGenomes-Gn; EBG00001272552.
DR   EnsemblGenomes-Gn; EBG00001272553.
DR   EnsemblGenomes-Gn; EBG00001272554.
DR   EnsemblGenomes-Gn; EBG00001272555.
DR   EnsemblGenomes-Gn; EBG00001272556.
DR   EnsemblGenomes-Gn; EBG00001272557.
DR   EnsemblGenomes-Gn; EBG00001272558.
DR   EnsemblGenomes-Gn; EBG00001272559.
DR   EnsemblGenomes-Gn; EBG00001272560.
DR   EnsemblGenomes-Gn; EBG00001272561.
DR   EnsemblGenomes-Gn; EBG00001272562.
DR   EnsemblGenomes-Gn; EBG00001272563.
DR   EnsemblGenomes-Gn; EBG00001272564.
DR   EnsemblGenomes-Gn; EBG00001272565.
DR   EnsemblGenomes-Gn; EBG00001272566.
DR   EnsemblGenomes-Gn; EBG00001272567.
DR   EnsemblGenomes-Gn; EBG00001272568.
DR   EnsemblGenomes-Gn; EBG00001272569.
DR   EnsemblGenomes-Gn; EBG00001272570.
DR   EnsemblGenomes-Tr; BLIF_16SrRNA01-1.
DR   EnsemblGenomes-Tr; BLIF_16SrRNA02-1.
DR   EnsemblGenomes-Tr; BLIF_16SrRNA03-1.
DR   EnsemblGenomes-Tr; BLIF_16SrRNA04-1.
DR   EnsemblGenomes-Tr; BLIF_23SrRNA01-1.
DR   EnsemblGenomes-Tr; BLIF_23SrRNA02-1.
DR   EnsemblGenomes-Tr; BLIF_23SrRNA03-1.
DR   EnsemblGenomes-Tr; BLIF_23SrRNA04-1.
DR   EnsemblGenomes-Tr; BLIF_5SrRNA01-1.
DR   EnsemblGenomes-Tr; BLIF_5SrRNA02-1.
DR   EnsemblGenomes-Tr; BLIF_5SrRNA03-1.
DR   EnsemblGenomes-Tr; BLIF_5SrRNA04-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA01-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA02-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA03-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA04-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA05-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA06-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA07-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA08-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA09-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA10-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA11-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA12-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA13-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA14-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA15-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA16-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA17-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA18-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA19-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA20-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA21-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA22-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA23-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA24-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA25-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA26-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA27-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA28-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA29-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA30-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA31-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA32-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA33-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA34-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA35-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA36-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA37-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA38-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA39-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA40-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA41-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA42-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA43-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA44-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA45-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA46-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA47-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA48-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA49-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA50-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA51-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA52-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA53-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA54-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA55-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA56-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA57-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA58-1.
DR   EnsemblGenomes-Tr; BLIF_tRNA59-1.
DR   EnsemblGenomes-Tr; EBT00001804715.
DR   EnsemblGenomes-Tr; EBT00001804716.
DR   EnsemblGenomes-Tr; EBT00001804717.
DR   EnsemblGenomes-Tr; EBT00001804718.
DR   EnsemblGenomes-Tr; EBT00001804719.
DR   EnsemblGenomes-Tr; EBT00001804720.
DR   EnsemblGenomes-Tr; EBT00001804721.
DR   EnsemblGenomes-Tr; EBT00001804722.
DR   EnsemblGenomes-Tr; EBT00001804723.
DR   EnsemblGenomes-Tr; EBT00001804724.
DR   EnsemblGenomes-Tr; EBT00001804725.
DR   EnsemblGenomes-Tr; EBT00001804726.
DR   EnsemblGenomes-Tr; EBT00001804727.
DR   EnsemblGenomes-Tr; EBT00001804728.
DR   EnsemblGenomes-Tr; EBT00001804729.
DR   EnsemblGenomes-Tr; EBT00001804730.
DR   EnsemblGenomes-Tr; EBT00001804731.
DR   EnsemblGenomes-Tr; EBT00001804732.
DR   EnsemblGenomes-Tr; EBT00001804733.
DR   EnsemblGenomes-Tr; EBT00001804734.
DR   EnsemblGenomes-Tr; EBT00001804735.
DR   EnsemblGenomes-Tr; EBT00001804736.
DR   EnsemblGenomes-Tr; EBT00001804737.
DR   EnsemblGenomes-Tr; EBT00001804738.
DR   EnsemblGenomes-Tr; EBT00001804739.
DR   EnsemblGenomes-Tr; EBT00001804740.
DR   EnsemblGenomes-Tr; EBT00001804741.
DR   EnsemblGenomes-Tr; EBT00001804742.
DR   EnsemblGenomes-Tr; EBT00001804743.
DR   EnsemblGenomes-Tr; EBT00001804744.
DR   EnsemblGenomes-Tr; EBT00001804745.
DR   EnsemblGenomes-Tr; EBT00001804746.
DR   EnsemblGenomes-Tr; EBT00001804747.
DR   EnsemblGenomes-Tr; EBT00001804748.
DR   EnsemblGenomes-Tr; EBT00001804749.
DR   EnsemblGenomes-Tr; EBT00001804750.
DR   EnsemblGenomes-Tr; EBT00001804751.
DR   EnsemblGenomes-Tr; EBT00001804752.
DR   EnsemblGenomes-Tr; EBT00001804753.
DR   EnsemblGenomes-Tr; EBT00001804754.
DR   EnsemblGenomes-Tr; EBT00001804755.
DR   EnsemblGenomes-Tr; EBT00001804756.
DR   EnsemblGenomes-Tr; EBT00001804757.
DR   EnsemblGenomes-Tr; EBT00001804758.
DR   EnsemblGenomes-Tr; EBT00001804759.
DR   EnsemblGenomes-Tr; EBT00001804760.
DR   EnsemblGenomes-Tr; EBT00001804761.
DR   EnsemblGenomes-Tr; EBT00001804762.
DR   EnsemblGenomes-Tr; EBT00001804763.
DR   EnsemblGenomes-Tr; EBT00001804764.
DR   EnsemblGenomes-Tr; EBT00001804765.
DR   EnsemblGenomes-Tr; EBT00001804766.
DR   EnsemblGenomes-Tr; EBT00001804767.
DR   EnsemblGenomes-Tr; EBT00001804768.
DR   EnsemblGenomes-Tr; EBT00001804769.
DR   EnsemblGenomes-Tr; EBT00001804770.
DR   EnsemblGenomes-Tr; EBT00001804771.
DR   EnsemblGenomes-Tr; EBT00001804772.
DR   EnsemblGenomes-Tr; EBT00001804773.
DR   EnsemblGenomes-Tr; EBT00001804774.
DR   EnsemblGenomes-Tr; EBT00001804775.
DR   EnsemblGenomes-Tr; EBT00001804776.
DR   EnsemblGenomes-Tr; EBT00001804777.
DR   EnsemblGenomes-Tr; EBT00001804778.
DR   EnsemblGenomes-Tr; EBT00001804779.
DR   EnsemblGenomes-Tr; EBT00001804780.
DR   EnsemblGenomes-Tr; EBT00001804781.
DR   EnsemblGenomes-Tr; EBT00001804782.
DR   EnsemblGenomes-Tr; EBT00001804783.
DR   EnsemblGenomes-Tr; EBT00001804784.
DR   EnsemblGenomes-Tr; EBT00001804785.
DR   EnsemblGenomes-Tr; EBT00001804786.
DR   EnsemblGenomes-Tr; EBT00001804787.
DR   EnsemblGenomes-Tr; EBT00001804788.
DR   EnsemblGenomes-Tr; EBT00001804789.
DR   EnsemblGenomes-Tr; EBT00001804790.
DR   EnsemblGenomes-Tr; EBT00001804791.
DR   EnsemblGenomes-Tr; EBT00001804792.
DR   EnsemblGenomes-Tr; EBT00001804793.
DR   EnsemblGenomes-Tr; EBT00001804794.
DR   EuropePMC; PMC3273023; 22179250.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC4908950; 27379055.
DR   EuropePMC; PMC6109161; 30143740.
DR   EuropePMC; PMC6339635; 30661116.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP010890.
DR   SILVA-SSU; AP010890.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2400312
FT                   /organism="Bifidobacterium longum subsp. infantis 157F"
FT                   /sub_species="infantis"
FT                   /strain="157F"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:565040"
FT   CDS_pept        1..1503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70148"
FT                   /db_xref="GOA:E8MWJ5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ5"
FT                   /protein_id="BAJ70148.1"
FT                   /translation="MVNASGDPVIEAAHIWSDTLTVLKHSASLSPREKGWLEGVVPEGV
FT                   FGSTIVLCVDNNDTLQAIQGDLNDSLLQALRTVTGENMFPAFKVVPKTEPEPLSEAKPA
FT                   QPYPSEISPTVAEFGKESYGAKPAAAPREPMPATEPQFPVGQQKMNRDPETHLNKNFTF
FT                   DSFVPGDSNRFARTVALAVAEGSGQDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPGLK
FT                   VRYVTSEEFTNEFIDALQNPNQSQGQIAEFNRRYRQVDVLLIDDIQFLGGKEATLDQFF
FT                   HTFNALHQANKRIVIASDVAPKNLKGFEARLISRFESGLTVDVKPPDLETRIAILRMIA
FT                   SMNGSKIPSDVLDLIAERFTENIRELEGALTRVTAVASLSNQPVTRALAEQTLQDFFTT
FT                   DVEIKPTDIISQVAKYFHLTFEDLVGKSRTKNVAVPRQIAMYLAREMTSMSLMDIGQVF
FT                   GGRDHTTVMHACTRISDRMQQKQEIYNYVMELTVRLKQSNTN"
FT   CDS_pept        2239..3363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0002"
FT                   /product="DNA polymerase III beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70149"
FT                   /db_xref="GOA:E8MWJ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ6"
FT                   /protein_id="BAJ70149.1"
FT                   /translation="MKVEIDTAALADAVAWTSRVIDARPSNPILAGVKLEAIDGTLQFS
FT                   AFNYEISARHHIEAGVDEAGSVLVQGKLLADITKSLRSEKTYLVTDGSTLTITSGKSKF
FT                   TLQLMPDTEYPDLPVVPAMLGQVDAPTFVQAVNQACVAVSREENRPVLTGVRMQFQGDK
FT                   VVMTSTDRFRLARATFTWTPQNPDVDTTTLVRGSLLKDVARALDEHQNIRLDFDADSPT
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLFADEYPIQAVVNKQDLLDAISRVALVAERNAPI
FT                   RMTFTGQEVALSAGSVDEAQANETLDIDMDGDDITVAFNPSYLKEGLSAVTEPFVRIKM
FT                   TTPVKPVEFNGQQEADSDESMDYRYLLVPMRFNN"
FT   CDS_pept        3391..4629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0003"
FT                   /product="recombination protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70150"
FT                   /db_xref="GOA:E8MWJ7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ7"
FT                   /protein_id="BAJ70150.1"
FT                   /translation="MHISRLALDHYRSWSQVVVDFVPGVNILFGKNGLGKTNLVEAVEV
FT                   LSTGSSHRTSSTLPLIERGQTTATIRANVADDAGQTTTYEASIHARGANRARINSGSSL
FT                   YLRDIIGKIPSVSFTPEDQRLVSGDPGARRTMMNQAAALLEPGYMQTLQQFTRIAKQRA
FT                   TLLKQLNANVNNGQPMDAVLSGLEIWTGQFIEAGVALTRMRAHVIGLLAEPFAAIYADL
FT                   AGAGEQVTLTYAPSFDEVLMFDDPHPQISEHFQRIYPGEVARGVNLIGPQRDDMNLELG
FT                   GIPAREFASNGEMWTMALALKMALFEIVRDRLGLQPIVILDDVFAQLDDSRRTQILDFA
FT                   RKQDQVLITVAAEGDVPDYESAHRIDVAALDEPASVILPTLGNLSNSRENESLGGYDEK
FT                   TAVDSASVERKVS"
FT   CDS_pept        4626..5096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70151"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ8"
FT                   /protein_id="BAJ70151.1"
FT                   /translation="MNPPIARQLNLDETKLPAEIFERLSRRGATLKDYRRRREEAIENF
FT                   GKPGRDPAELGSVMTTIAGNGVWTANMKLAQLRNHWDQVVGQAIASHSAVADFTDGVLT
FT                   IRAESTVWATQLTYLIPQLTDTIRRNLKGLTIAEIRVTGPAAGYTRKWARRR"
FT   CDS_pept        5277..7367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70152"
FT                   /db_xref="GOA:E8MWJ9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWJ9"
FT                   /protein_id="BAJ70152.1"
FT                   /translation="MADETSKEEQLKAAAERINNAELTEGELDESMAPEHYEASDLRVL
FT                   EGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIEITILPDNGIRVVD
FT                   DGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVVNALSTRVDI
FT                   EVRRQGFHWTQTYIDQHPTAPLKQGEPMTEGESTGTSVTFWADPKIFETTIYDFETLRS
FT                   RFQQMAFLNKGLKISLTDERENDQAGDEVAGDAADEPGAKHQTVTYQYLNGIKDYVDYL
FT                   VKVRKATPVEEDVISFEAEDLKLGISAELAMQWTTAYSEAVHTFANTISTTEGGTHEEG
FT                   FRAALTSLVNRYARDKGILKDKDENLSGDDVREGLTAVISVKLTNPQFEGQTKTKLGNS
FT                   EAKTFVQRVMTDKLGDWFDAHPAEAKNIIQKAIEASRARLAAKKARENTRRKSIFESAG
FT                   MPDKLKDCQSSNPEECELFIVEGDSAGGSAIQGRNPITQAILPLRGKILNTERASLDRM
FT                   MKSDTIESLITAVGGGYGEDFDISKVRYHKVIIMADADVDGAHIATLNLTLFFRYMRPM
FT                   INAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQLPKGEGIQRYKGLG
FT                   EMSYQELWETTMDPEHRILKQVHIEDAAAADETFSMLMGDEVEPRRLFIQRNAKNVRWI
FT                   DA"
FT   CDS_pept        7435..10086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70153"
FT                   /db_xref="GOA:E8MWK0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK0"
FT                   /protein_id="BAJ70153.1"
FT                   /translation="MADENNTGDEQFTPDGSMEPLSPQEADTTDYGLMDTGERIQRKDL
FT                   QQEMRESYLAYALSVIVERALPDVRDGMKPVHRRVIYAMYDGGYRPDRGYNKCSRVVGD
FT                   VMGKYHPHGDSAIYDTLVRMAQSWSMRNMLVDGQGNFGSPGDDPAAAMRYTECRMAPLA
FT                   MEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSAGIAVGMATNIPPHNMREV
FT                   ADGVHWALDHPDASREELLENLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAV
FT                   VNTEEINGRMCLVVTELPYQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVL
FT                   VLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHWVNHQLDVIAR
FT                   RTAYLKREAEERDHILQGYLKALDMLDEVIALIRASEDTDTARTGLMGLLDIDQVQADA
FT                   ILAMQLRTLTRMNRDKIVAEHEELQRKIADYIDILAKPERQRKIIGDELDEIVAKYGDD
FT                   RRTKILPFSGEMNVEDLIAEENVVVTVTHSGFIKRTKADEYRSQHRGGKGIKGTKLRED
FT                   DVVDHFFLTSTHNWLLFFTNKGRVYRIKAYELPEGSRDSKGQHVANLLQFAPDESIQTV
FT                   LSIPNYEVAKYLVLATRSGKVKKTPLAEYDSPRQGGLIAVRLMADENGENADELIGAAL
FT                   CNAEDDIILVSKLGMSLKFQADDEQLRPMGRQTAGVQGMKFRNDDSLLAMDVVPGDSDK
FT                   DLFVVTNEGFAKRTAISEYRLQGRNGLGIKAVQLVEGRGALVGALVVSEDDQVMAIMKS
FT                   GKVIRSNVDEVKRTGRNTQGVTFAKPDKGDTILSIARNEEKDEPEDGGDAAANGTAETA
FT                   QSGENVNNADEA"
FT   CDS_pept        10156..10722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0007"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70154"
FT                   /db_xref="GOA:E8MWK1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK1"
FT                   /protein_id="BAJ70154.1"
FT                   /translation="MSENLEDNEPRIIPPAVGNTQNEHVEPLIGTEHAPRVARSVSSDP
FT                   EESALPSSGAATPVRPAPRRSAPRARRMSLSLTRVDAWSVAKVTFMLSIAVAIIQVVAS
FT                   AIVWVLLDVVGVFSQITQIVSSTGLDAGGFDLKNVLSLTTVVSGVTIFSIVEVVIFTLL
FT                   ATIAALIYNVVSSLVGGVHVTLGDD"
FT   CDS_pept        11406..12119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70155"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK2"
FT                   /protein_id="BAJ70155.1"
FT                   /translation="MKNTIIRAAGVLLAASMIFGGAAATASAAEATSPSTGTTSSTQAA
FT                   ESINREWVLNPANNTELAALGTIQGGSQTFDGLTIDATANGAKFAPRANDTQINAGTII
FT                   SIPVPAHTNTATITLALSGGTTTITADAGEVSSDNTVIALPAAESARTVNVTFTAQTYL
FT                   NGIALAEQQPEPEFPGTPTVAAKDTNWDFTETGIDRPAVQGLPTTTKASPSTLGRKAPS
FT                   STRVLPRQAAAAILR"
FT   CDS_pept        12116..13702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0009"
FT                   /product="putative pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70156"
FT                   /db_xref="GOA:E8MWK3"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK3"
FT                   /protein_id="BAJ70156.1"
FT                   /translation="MNAGTILYIPVAQAEGGATVTVKGQLYGPTLKLDGTDITTGTAVT
FT                   IATDSTRYVPLSVEGRGSLYLTGIAIDYAAGSPAATSHTVTVGPNGQYRTIQAALDAND
FT                   SSETDRLVLKITPGDYREKITVTKPGVTFANADVTAKRAVTIRASYYSSNTFDADGKFV
FT                   PQDEFDLGTNKCATVTIGAGATGFSAYGITFQNDYNVVDHTAAGEQTPAVALNTQADKV
FT                   YLKNSRIIGRQDTLYVQGAGNRVYVDGGYIEGTVDFVFGDANAYFAGTELHMAAFAGKN
FT                   NGYFTAANTKKSGVGLVFDRCNLTVAAAYDDDAKLSLGRPWQTFAQYTQVRKGDGSSYV
FT                   TGVDLGTKNSAYTDTSSAVTYLDSTMSSKITKNRWNVWTSKNQSGKSVDVTFHDDVRFA
FT                   EYASHDETGALLDPADYKNVVLGSMTALDEAQVQAKRAELLAALGFGSAAGQWVVPDGA
FT                   WPFAYDPNYSTGTDVQPTQPGGNASPNADSAAKADTMPETGSAIIAVVVVAVPLLVAGL
FT                   ALVAVRRNRQQ"
FT   CDS_pept        complement(14100..15446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0010"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70157"
FT                   /db_xref="GOA:E8MWK4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK4"
FT                   /protein_id="BAJ70157.1"
FT                   /translation="MLTDEYIKRVYDQVVARDGDQPEFLQAVREVFETLQPVVEKHPEY
FT                   EKAGVLERIVEPERTIKFRVAWVDDEGKVQVNRGYRIQFNSAIGPYKGGLRFHPTVTES
FT                   VVKFLGFEQILKNSLTTLPMGGGKGGSDFNPKGKSDAEVMRFCQAFMTELSRHIGQFTD
FT                   VPAGDINVGGREIGYLFGQYKRIRDEYSGVLTGKGLEFGGSLARTEATGYGVCYYTQEA
FT                   LRVLRNDSFEGKTVVISGSGNVATYAAQKAEQLGAKVVTVSDSNGYIYDPNGINVEVVK
FT                   QIKEVERGRIKEYAERVPGSEYHEGSKGVWTVKGDIALPCATQNEVDGESAQKLVDNGV
FT                   TVVVEGANMPSTPEAIEVYQKNGVLYGPAKAANAGGVAVSGLEMSQNSYRLSWTFEEVD
FT                   AKLKSIMEEIVANSLAAAKEYGHEGDLMLGANAAGFVKVANAMVAQGVL"
FT   CDS_pept        complement(15765..16199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0011"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70158"
FT                   /db_xref="GOA:E8MWK5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK5"
FT                   /protein_id="BAJ70158.1"
FT                   /translation="MTAIDETDQRILTMLEADGRATLAQLAQATGLSVSAAQSRVQKLE
FT                   KRGIIKGYKAIIDQEQRGLPISAFVNVTPLDYSAESSIPDKLNNIDGIVSCYSVAGAPS
FT                   FVLVVRVASPTALEELLNLIHRTVPVSTETTMILQTYFAH"
FT   CDS_pept        16405..17739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0012"
FT                   /product="putative aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70159"
FT                   /db_xref="GOA:E8MWK6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK6"
FT                   /protein_id="BAJ70159.1"
FT                   /translation="MQKFSNMPLSEVASAAVPAARRVAVPTAKPASLSAEALNIPRSGI
FT                   RDVFDRVERVPDAISLTVGEPSATAAPHIVAAACEAAQAGRTRYTNVLGVPEYRKAVAD
FT                   YSARVKGLTYDPETEIQAVDGATIGLFLALKAVVGTGDEVIIPSPFFTSYDAEVMLCGG
FT                   RPVTVALRPEHGMRVNAADIEAAITPRTRAVIINSPGNPTGAVTSAAELARIAEVCKQH
FT                   NIWAISDEVYHPFVFGETFGETLGGEAAVAPSIAAVPGMKDRTIVVESLSKTYAMTGWR
FT                   IGYLLAPEAVIEQTGKIAELMHSSVNSLAQYAGVAALAGPQDHVAAMREEYRAKRQIVL
FT                   DGLAGCPVLRLIEPQGAFYAFVDVRLTGLDSGEFADRLLDEEHVAVVPGEAFGEEGRGF
FT                   VRLSYAGDAGELREGVARLRAFAERVWNPITGHHTATYHPMEVLA"
FT   CDS_pept        complement(17754..18746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0013"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70160"
FT                   /db_xref="GOA:E8MWK7"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK7"
FT                   /protein_id="BAJ70160.1"
FT                   /translation="MLFQVYGDNAIYQWIGWILVFCCLIGANELARRTKTGGVIAFLVI
FT                   PAVLTVYFITIYTAAAMGADWALNNPTYVHMTSWFHYAKLYAATIGCIGFMALKYKWGS
FT                   IGKSHWFKCFPFVIVAINILIAVVSDFESAIRGWGTTWISTEGVTLYGGWHNVFNGVAG
FT                   LLNIFCMTGWFGIYASKKKDDMLWPDMTWVFIVAYDLWNFCYTYNCLPTHAWYCGLALL
FT                   LAPTVANFFWNKGGWIQNRANTLAIWCMFAQVFPMFQDYSMFSTQSVNNPNVNLAVSLI
FT                   ALAANVLALGYILLRAKKQGINPWTKEVFKGTKDYEQAIARADESELAA"
FT   CDS_pept        19268..19603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70161"
FT                   /db_xref="GOA:E8MWK8"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK8"
FT                   /protein_id="BAJ70161.1"
FT                   /translation="MPIPAPAAYQATDATAVLAPPRKSSKKLIAVLCALLATILVAALA
FT                   FIVPNFTAVKAMLGFQPTNPLVVTFDAINSLSTLRSTKYELRTHSSTDDSLDARMSGMY
FT                   SLGQNHQ"
FT   CDS_pept        19617..20465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70162"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWK9"
FT                   /protein_id="BAJ70162.1"
FT                   /translation="MTIKTDEQATTLAWHKGAFAGKNVWYDDDPYYIYYPADQYEDDLR
FT                   NGVGSDVADLILNVKDALVKNGAWDITGAERTFYDQLDKMNDDGYSNDIDRAKGTKTSA
FT                   EVKAEASKFIQQYLGVELEDKNVRSQLFPNTSSAKSAGNTQLSYQIDVKALTQHFVNYW
FT                   ISHEAQYPHLKSWVIQQIEDTGVGDAEGEYRQALDNVRNWDFGTDEEPDMPTITVDLNY
FT                   GRKRLMSSIAVSVSGKDEYGDSYKGSLSLTLSQQNAVSVDDPDLTDTVSKAKDNNGLDL
FT                   S"
FT   tRNA            complement(21322..21394)
FT                   /locus_tag="BLIF_tRNA01"
FT                   /product="tRNA-Ala"
FT   tRNA            complement(21437..21510)
FT                   /locus_tag="BLIF_tRNA02"
FT                   /product="tRNA-Ile"
FT   CDS_pept        21742..21876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70163"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL0"
FT                   /protein_id="BAJ70163.1"
FT                   /translation="MWWAYVESAAAEHDEGDGIVRVVEAVGHADGDLDPVVGRLEPGV"
FT   CDS_pept        complement(22402..23706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0017"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70164"
FT                   /db_xref="GOA:E8MRS3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS3"
FT                   /protein_id="BAJ70164.1"
FT                   /translation="MQHLTYRKEGQVTRSHRNEDRGGEHRWTFNGVEYPTRKLMCEARR
FT                   AEYVRLLDEEGMNFTQAAHAVGVSKRTGKAWRNGRTRATGRNEKPLVDWYRSTMDKPKT
FT                   LHPRYLSQEERIQIADRLRLGDSIRAIARLLGRDPGTVSREVERNRNPESGGYEPYRAQ
FT                   QKAAGRLKRPKPRKAAEGTRLWDEIAAGLRRHWSPEQIANRLRLDFPDNGDMHASVETI
FT                   YQAIYLQARGELKQELKRAMRQGRTARRPQGGQGRKPRFREPMAMISERPPEIEDRAVP
FT                   GHWEGDLITGSRNKSAIGTLVERTTRFTILLHLPDGHDAEHVQQAIIDKMQHLPKLLRN
FT                   SLTWDQGAELALHKRIGASLDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYP
FT                   EDYLDAVAEELNDRPRKTLGFMKPSEKIIELLDAA"
FT   CDS_pept        complement(23785..24804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70165"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL2"
FT                   /protein_id="BAJ70165.1"
FT                   /translation="MLLDEVQYAISDEEMRGEEPPRLYGVLNGLLRMRNVDVYVTGSNS
FT                   KMLSTNVMTEFRGRGDEVRVRPLSFAEFMQAYDGDVQHGWAEYVMFGGMPLTLSMRSDE
FT                   QKSLYLKNLFEETYLKDIVSRNGLRRSQELDDLVDVLASSIGALTNPPKIKATFASVLH
FT                   SGISTNTIMQYIGHLEDAFVIEEARRFDVKGRKYIGSPKKYYFEDMGLRNARLGFCQIE
FT                   QTHIMENIVYNELRTRGYNVDVGVVDRRGTSEGVPYRKRLEVDFVANLGNRRCYIQSAY
FT                   QLPTPEKVAQEKASLLEIDDSFQKIVLVRDVVKPVRDEHGILTMSVYDFLLNPDSLTM"
FT   CDS_pept        24948..25754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70166"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL3"
FT                   /protein_id="BAJ70166.1"
FT                   /translation="MPYRRRQSTAPKSGAPKSVRSAAAGQSLDIDGIHLHLTRKPIKNL
FT                   YLRIKPPSGRVEISAPMRMSESRIADFVKERHSWILAQQQRMAEAQRRSIMALNEGAGF
FT                   ENGGRGVAGASGHDGGVAGRPKTGDISRPGIGDAGPGQAGTNVQPYFDRSQIWTDERKR
FT                   QAAAAINAALPQLLAKWGPVVGRQPTHITLRVMTSRWGSCTPRTGRIRLNLQLGLMEPQ
FT                   FLEYVLVHEMTHLWESGHGAGFQRRMTAYLPGWKTLRRDLNRRVVL"
FT   CDS_pept        25841..26206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0020"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70167"
FT                   /db_xref="GOA:E8MWL4"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL4"
FT                   /protein_id="BAJ70167.1"
FT                   /translation="MAAGHPLTDEDRWPWLDTIAAWIDERVAAGEPAVVTCSALKKIYR
FT                   DKLRRQGVVFVYMQGTFDEVMERLSHRQGHFMKPSMLQSQSDILEEPGDDEIHVNVHIG
FT                   QADPGHEAMAVAGALGL"
FT   CDS_pept        complement(26465..27778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70168"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL5"
FT                   /protein_id="BAJ70168.1"
FT                   /translation="MLRRKIETQLEAWRSAPKRTALLVTGARQIGKTYIIRHFAQQHYD
FT                   HIAELNFIENPDLVALFDRPRDAKNLLMRLELAVNTPLVPGKTLIFFDEVQRCKEMVTA
FT                   IKFLVDDGRFDYALSGSLLGVELEDIRSVPVGYLTELDMYPLDFQEFCWSQHIGNDVFD
FT                   MLAECFAKHQEVDEFIHQRLMELYSKYLVIGGMPAAVDSFVANGSVADVRTIQENIKRE
FT                   YRRDISQYARKEDRLHIRAIYDLVPSELNNPNKRFTFAKIEKNMRFQSVASDFDWLVNA
FT                   DVAVAAYNVDEPCTPLEMSKERNLFKLFYNDVGLLTGSFLKKTALDVLDGNPDINYGSI
FT                   YENAVAQELRAHGFDLYYYNSKKLGELDFLIQDRNDHVLPIEVKSGKSYKRHRAMDNVL
FT                   AHPEYHLNTGYVLGPCNVSVEGNVTYLPVYMAGMFHNE"
FT   CDS_pept        complement(28013..28492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70169"
FT                   /db_xref="GOA:E8MWL6"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL6"
FT                   /protein_id="BAJ70169.1"
FT                   /translation="MTLAFVVPGLDEAASEKAIAILQNRLSQEQEAALVLKHAHWNVTG
FT                   PNFIAVHEMLDPEVEAVLAQADETAERIATLGGTPDGRADAIVRNRTWKSFDAEGRVGT
FT                   EEYLKALIEYYDAFIADDRKAIAELDELDVISSNIIQDHVQELEKFQWFMRSHLA"
FT   CDS_pept        complement(28589..29932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70170"
FT                   /db_xref="GOA:E8MWL7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL7"
FT                   /protein_id="BAJ70170.1"
FT                   /translation="MSLGLNILLIFVFLVIGSVFSGTELALVSLRGSQIEQMEQEDARG
FT                   AKVAKIARDPNTFLSTVQIGVTLSGFLSASFGASSIAPYLIPAVESWGVHPGIAGGLVN
FT                   IILTLIISYCSIVISEMVPKRIAMQRTEQIARAVVPAIDAFAAVCRPIIWLIGKNTNGI
FT                   VRLLGFDPQQTESEVSDDELRVLVSSNTNLSKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFIEGDQPLAEAAAFVRDQPYSRYPVTGKDFDDVIGFVHVRDLLDVRDPNAKIVRDVVR
FT                   EGISLPGTSKLLPSLELLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   SEKGGERTTRTAFVNGVATIEASMTIEDFADLTGIELEDGPYETVAGYFLSKTGKMGAV
FT                   GDVLHSDDGYNMVITKVDGRRIETIEVRKAGAPDHAPLPAESQSDDAN"
FT   CDS_pept        complement(30191..30874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0024"
FT                   /product="putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70171"
FT                   /db_xref="GOA:E8MWL8"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL8"
FT                   /protein_id="BAJ70171.1"
FT                   /translation="MAQSDFEQESTANATWSRMLQGNRRFAEGKPDHPWQDKETRQTLL
FT                   DGQNPDAAVLSCSDSRVPPEIIFDQGLGDLFTVRTAGQLIDSAVIASLEYAVKKLHVSL
FT                   ICVLGHEHCGAIEAAEQELDDLMHTITSEADGSLEAADAMDDLDEHIAAAESIILRQAG
FT                   MSVWQAREAELDAHEDIERVHVAHIIETLVEQSPVIQQALAADKLMIVGARYQLDSGKV
FT                   EVLSF"
FT   CDS_pept        31080..31643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0025"
FT                   /product="alkyl hydroperoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70172"
FT                   /db_xref="GOA:E8MWL9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWL9"
FT                   /protein_id="BAJ70172.1"
FT                   /translation="MTLLQHELTDFKVNAFQNNEFHEVTKDDVLGHWSLFFFYPADFTF
FT                   VCPTELEDLAKNYAKFKEIGCEIYSVSCDTHFVHKAWHDANEKIAKIEYPMLADPTALL
FT                   AKDLDTYNEADGMAERGDFIVSPEGKVVAYEVISSNVGRNAEELLRRVQASQFVYEHGD
FT                   QVCPANWTPGEETIEPSLDLVGQL"
FT   CDS_pept        31812..33743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0026"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70173"
FT                   /db_xref="GOA:E8MWM0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017561"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM0"
FT                   /protein_id="BAJ70173.1"
FT                   /translation="MTQTNNLYDVVVIGGGPAGLTAGLYLARARYRVLILEKDDFGGQI
FT                   TITNEVVNYPGVGRTTGRALTQTMRQQAQDFGAEFLSAEATGLDVDGDIKTVHTSRGDL
FT                   KTFGILIATGASPRKLGFEGEAEYAGRGVAYCATCDGEFFTGKEVLVVGGGFAAAEESV
FT                   FLTKYASKVTVLVREPDFTCDAAVAAEAKNNPKIDVRYQVELKGVTAGQGGLREASILN
FT                   LATGQTETWKPADAGTFGVFVFAGYVPATDLVRGVVELDDHGYVVTHDYLRTSVPGVYA
FT                   AGDLRVKNLRQVVTATADGAIAAVELERYAKQMSEKTGLVPPRPTASAYEESEAKAASA
FT                   ASAAGTTPAPAPAKRSADAAAAASAAKKPGELFSAAVKQQLGVVFGRMTRPVTLALELD
FT                   GTPLSAELQGFIGEMVALSGGKLNSVAVDAAGLITAVDGASVPTSLVVGEPLSVTLPDG
FT                   TELPTYGSLDDSGRATFDVAGVLPLARPTVRICVPAEGDGKAGKDGNGSLVFTGLVFTG
FT                   LAFHGVPSGHEFNSFVLGLYNAAGPGQPLGDDLIERAKSITDPLNIMILVSLTCTMCPE
FT                   TVLASQRIASLSPAVRAEAYDVSHFPELKDQYGAMSVPCIVITHADGTQQVEFGKKSIP
FT                   QMLELVGA"
FT   CDS_pept        complement(33860..35146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0027"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70174"
FT                   /db_xref="GOA:E8MWM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM1"
FT                   /protein_id="BAJ70174.1"
FT                   /translation="MARFTENRWTSAIIPALLIHIPIGTVYCWSVFKQLIADRLHASPA
FT                   SVEWGFSLAIFFLGMSAAFAGPMVEKNIKKSALVSMVCFVVGFAGTGVSIALNFLPGVF
FT                   ICYGAIMGIGLGVGYLTPVKNLMLWFADNKGLATGIAVAGFGLAKAIASPLMEYLIGTV
FT                   GLVSMFFILAAVYAVMMFVGFLLIKRPAGWVYDPATSHVSRKTILKKPVFWGIWIAFYI
FT                   NITCGLALISQEKDILHDVLRAFPQYANLSPAKFAAAISGIIGLVLAVDSVFNTAGRVG
FT                   FSTLSDHLKRRETVYQVIFIMSIAVCLLQIFTNSIGNALLWAVLAMLFLVNAGYGGGFS
FT                   TLPVLLDQHFGTKTVSTTHGLTLSAWAFAGLSGNQLASFVVAHAPDQAHRYAALIPVLT
FT                   GLFVVALISISLVKYLGDRNVTKAVEDRG"
FT   CDS_pept        35320..35466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70175"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM2"
FT                   /protein_id="BAJ70175.1"
FT                   /translation="MCISSALLALVDADKQNYNAVMGLLWLISVVGSYELSHIENSYMT
FT                   VSA"
FT   CDS_pept        35702..36700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0029"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70176"
FT                   /db_xref="GOA:E8MWM3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM3"
FT                   /protein_id="BAJ70176.1"
FT                   /translation="MVTLKDVGELAGVTATTASAALRGKDYVKPETTQRVCDAARKLGY
FT                   KINLSGRSLRSGRSDTITFLTSGLEGDYFSHLAMCVAEEVHKRDSHMLIELSRYLTDDN
FT                   DLSYTFSDGIIAINAPRAVDILKRHPAVMLENYDTSLPIDTVNAPSDAGSRAAIEHLIA
FT                   RGCARIGIVGDNHDPNNPNIIPGSRDIRMRAAKETILAAGLPFDERRDYIKSSWSIDGG
FT                   IEAGRGLAKKGKCKYDGLYCLNDGIALGILRGLADDGVSVPGDVRVIGFDGLSQGAYSV
FT                   PMLTTVATDFKGMADTALTLLMRRIENPDDEFFPQTVNVGYKLIERESTAA"
FT   CDS_pept        complement(36924..39677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0030"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70177"
FT                   /db_xref="GOA:E8MWM4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM4"
FT                   /protein_id="BAJ70177.1"
FT                   /translation="MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEIL
FT                   RNVLGEYNPELLSTFDTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQ
FT                   LLARAFATYFHLANLSEENYRVSVLHERENNVPVDQAVDPINELTVAYHQLINETGPAK
FT                   AKELLNQLEFHPVFTAHPTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEI
FT                   DALFRTSPIALKKPTPVEEADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACP
FT                   AFFHPGSWIGSDRDGNPNVTAKVSRAVARKFSDHVIAALEEATRTVGRNLTMEAETTPP
FT                   SAELKSLWSHQKEMSERLTDKAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDD
FT                   FLADLKVVQRSLAAAGAKRSAYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIR
FT                   EHGLHGERGELQPMTHEVLDTFRALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNR
FT                   LAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSD
FT                   SSKDAGPASATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVG
FT                   SVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKRNTEMTEKYADMA
FT                   AQLDEAAHNRFLDLLNTDGFAPWFSIVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIP
FT                   WIFSWAQARINLAAWYGLGTACEKFGDLETMRKAYEEWPLFSTFIDNIEMSIAKTDERI
FT                   AKMYLALGDREDLNKKVLEEMELTRKWVLAIVGDKWPLQHRHVLGQAIRIRSPYVDALS
FT                   VTQVLALKSLRKKVDKEELSQSQQAGFIYLILCTVSGVAAGLQNTG"
FT   CDS_pept        39963..41843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70178"
FT                   /db_xref="GOA:E8MWM5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM5"
FT                   /protein_id="BAJ70178.1"
FT                   /translation="MKDVSEQKKKSAPEAKGATAVRKFHTHSIPLDMEDIARDWEKPVV
FT                   DAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTDIEATCTDG
FT                   RNRITEVVDLPSTGVNTERIWLLEHFADWFSVNLGKGSMYHVDSQLSDGVVKHLDERDA
FT                   SQYSADLAKRLRERAKVEAEAANGSVDEALDLASKTKVLVTSVAKSLDDDNEEAHRLLA
FT                   DSAEVTPVEDKAAEEKAYDDAEVFTGDSNESVESANAANGATAESPAASSTKRKNRVPK
FT                   EYAEHFNERSDEEKAKGGITVRQAHERLDLIERRKPLYKPWFSGLASALACAAFVFLLG
FT                   GGPYDMIGAFVGAGLGQWMRRRLFAYHLNQFFVTFVCVAAAALACTGTLRLIGIFDPVA
FT                   LSHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGIQRVAYVLCIILMATLAGWAVAVM
FT                   VHLHPEGFEPLGLDPWVNGLLRFVAAFVGVWGFSVLFNSPQRMCLTAALIGAITDTLRL
FT                   ELQDFNVAPEMATFIGAFLAGILASVWRSSVRRGWLPPHLGYPRICLTVPSIVIMVPGL
FT                   YMYRAMWYLGSFQTMNALDWAFRAFMVIICLPIGLAMARVVTDKSWRYDI"
FT   CDS_pept        42068..43729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0032"
FT                   /product="putative sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70179"
FT                   /db_xref="GOA:E8MWM6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM6"
FT                   /protein_id="BAJ70179.1"
FT                   /translation="MIGEVSQLANDFWILLAMVIYFAAMLSIGFIYSKRSNSSSKEYFA
FT                   GGRGVGPWLTALSAEASDMSGWLLMGLPGLAYFTGAADPMWTAVGLALGTYLNWKLVAR
FT                   RLRRYSVVTDDAITIPDFFAKRFHDKKGVISTIAAVIILVFFSVYVGSCFVTVGKLFAT
FT                   LFGFDYHVMMIIGAVVVFVYTVVGGYLSVVMTDFIQGMLMFFALAVVFIGTVASAGGVD
FT                   NTVEFLRAIPGYLSGTQVAAPKLDPATGQQLVEAGKAVFGAPSDYGIITIISMLAWGLG
FT                   YFGMPQVLVRFLSIRSVEEVRKSRIIATSWCVISLGCAVCIGLVGRAMMPTELLTSTDA
FT                   ETIFIVLAQTLLPSFMCGVVVSGIFAASMSSSSSYLIIGASAMGENIFRGLLHRKATDK
FT                   QVMIVARVTLVVMFLFGILVAYDQNSSIFQVVSYAWAGLGASFGPLMLCSLYWRRANKA
FT                   GAVAGMLSGTAAVLIWHNLVKPLGGVFAIYELLPAFIISLLFIVVVSLLTAKPNKRMLY
FT                   EFDHYMDDPLPGTLPSGTVLVDEPMEAMESEVRSGK"
FT   CDS_pept        complement(44059..44730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70180"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM7"
FT                   /protein_id="BAJ70180.1"
FT                   /translation="MFSTYLELEELIVLADSMMRRDRRLCRTTIDALSLYLDEAEAQVR
FT                   ADKENGTNSYLFRGYNKCRRALLLARAGTDSSMETRTRLVLLKYGLNCPQVNYPIFVGN
FT                   NTRPIYLDLAYPEFKICIEYEGSHHAGQWLNDARRRQMIEDAGWKYIQVTKLDIGDEAG
FT                   EEALARRVAERIQEVTGKTVQLTMRQTTQQISDVRKLRRIPLYKRLKFEPLLPIIPTAQ
FT                   E"
FT   CDS_pept        45299..46918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70181"
FT                   /db_xref="GOA:E8MWM8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM8"
FT                   /protein_id="BAJ70181.1"
FT                   /translation="MAGMSSLVRIVNAGVPGSQDRVDVVLRDGVVASVGPAGTVSASDS
FT                   TMQTKAHTTSLEYATNAIASGSVSIPTSAAAPADETTIDADGLWVIPGLWDCHTHFTQW
FT                   AKTLGRLDLINARSAAEAMDMLRRHLDERRAADTLDPDAFVVGMRFRHSLWADDEQPTL
FT                   AAIDAVTGEQPVALSSADMHCGWVNSAAARRLGVPVDESGLVGELEWFNAYTAFDKAPG
FT                   AAEETDRLLREAEQDAASKGVVGIRDYEMAENIDTWINRFAAGINGLRVDAGVYPERLR
FT                   AAIDAGWHTGKELPGSAGLGHVGAMKLISDGSLNTRSAYCSTPYSGIEPLTYGTLSYTP
FT                   QQIEDYMRLATEHGFDIACHAIGDEANTIALNAVAATHAHGSIEHAQMLKPVDIPRFAE
FT                   LGLTASIQPQHAMDDRDVITRFWANPAGIPYPFRALHDAGTTLRMGSDAPVAPLDPWLA
FT                   ISAAVLGTESSDREPFQPEQCLDVHTSLAASTATGRDRLASGDPADVVLLDADPYAADT
FT                   PEAMRAMPQHVVMTLLCGERTY"
FT   CDS_pept        complement(47096..48187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0035"
FT                   /product="tryptophanyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70182"
FT                   /db_xref="GOA:E8MWM9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM9"
FT                   /protein_id="BAJ70182.1"
FT                   /translation="MTDEQQLTAAGNEMSASFLAAKKRSDETLAKLEAKPSSFTMLTGD
FT                   RPTGRLHLGHYFGSIRERVAMQERGVNTNIIIADYQVITDRDTTEHIQDNVLNLVLDYM
FT                   AAGIDPNKTMMFTHSAVPAENQLLLPFLSLVTEAELHRNPTVKSEMEASGHALTGLLLT
FT                   YPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKNPVFPEPAAILSEAP
FT                   EIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERRITFDPVARPQVSALLTTA
FT                   GLVTGRDPKDIAEEIGDSGAGALKAYVIESVNEFLAPHRERRAELAKDMDSIRDILHDG
FT                   NKRANAIAEETLDQVREAMGMKY"
FT   CDS_pept        48321..48710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70183"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN0"
FT                   /protein_id="BAJ70183.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYLTTDTDYDELAKELSEQEPGMGSPDP
FT                   FADIDDQYADKDVDSAADDHASGAAEAAPATQEDDLDEYAKWAAEAAAKATSGEFPASA
FT                   PAAPKPAPRKPIPMPMPSALKPKKS"
FT   CDS_pept        complement(48816..49235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70184"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN1"
FT                   /protein_id="BAJ70184.1"
FT                   /translation="MMGYMAVILEKDLKRGHDALVQWRAAARELADNTPHRLTVSPVLP
FT                   RPVWAMAVRYSLFLLERRAPGPGVEVRVAPWGAVKILDGPESDPHNLTPPDVIELDPEV
FT                   WLRLACGITTWAEEKDAGHISAVGERDDLSDLLPL"
FT   CDS_pept        49443..51893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0038"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70185"
FT                   /db_xref="GOA:E8MWN2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN2"
FT                   /protein_id="BAJ70185.1"
FT                   /translation="MTEITAPKSPVTAEQFADEIREQLKYTQNVTTEQATPADVYVAAS
FT                   KAVRNHLADSWFKTQADTVNGNTKAVGYLSAEFLMGKQLRNALLNAGLTEQFDKAVEAL
FT                   GFKVQDVVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFKQEFDKDG
FT                   KQVETPDYWLANEEPWGHIDYNRDQKVSFGGKVVENADGTKTWQPAWSVRAVPVDYLVP
FT                   GYKSGRVNTLRLWSAKSYDEFDLLAFNRSEYMEAVTPQVKAENISKILYPEDSTKVGKE
FT                   LRLEQQYFFVSASLHDAIRVFYPGQDKPDLTTFPNKIVFQLNDTHPVIGIPELMRILID
FT                   EYGYDWDTAWSITTKTFNYTCHTLLPEALEVWPASLIGELLPRHLEIIEKINAQFEDEL
FT                   KSKGVDKNTIKDMAIYTGDAVRMAYLATYGGSHVNGVAELHSQLLKDVTLKNFSDVYPD
FT                   KFTNVTNGVTPRRFVKLANPRLSDLITEGLGTDKWLSDLEMLKGLEPLAKDDEFVKKFA
FT                   AVKKANKVDFAAYAKREYGFELDPNTMFNTMVKRLHEYKRQSLKILSVISTYADIKSGK
FT                   VKAEDVTPRTVFFGAKAAPGYYLAKMTIQLINNVSRVVNNDPDVKGKLAVYFPWNYNVR
FT                   LAQHLIPATDLDEQISQAGKEASGTGNMKFALNGAMTVGTLDGANVEIRERVGAENFFL
FT                   FGMTVDEVEKKYAEGYNPASYYEADPRLKHAIDMVADGTFSNGDRNAYSPLVADWLTKD
FT                   WFMTLADFSAYMDIQSEIEALYADELEWNRKALLNVANSGYFSSDRSMEDYLERIWHTA
FT                   PLAD"
FT   CDS_pept        complement(52246..52461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70186"
FT                   /db_xref="GOA:E8MWN3"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN3"
FT                   /protein_id="BAJ70186.1"
FT                   /translation="MENKSSNGWKFFALLFGGLLAALVGLYIYKQQNPDYDPWEEPWEN
FT                   SSSPVDLGLNKAEDEDKPAAEAPAEA"
FT   CDS_pept        52566..53411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70187"
FT                   /db_xref="GOA:E8MWN4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN4"
FT                   /protein_id="BAJ70187.1"
FT                   /translation="MGDSSAPVCPWPARHLRGAWNASETFDTVGCMHIPTQREIRYQWE
FT                   RGGPVMTWALIVACVAVWLLEVLLGFIAPGLRAWLMYLGMAAPVRLVAEPWTLITSMFL
FT                   HAPNSLLHILFNMIALYSVGPVLERMIGHWRFLGLYVISGLGGSLGLMVWAAVAPGGIG
FT                   WQMAAYGASGALFGLFASLLVVYRRIGADIRSMLIWMAVNFALPFVVGGVAWQAHVGGF
FT                   VVGGILTWLLVGGVPAWRGKSLKWRMQVYGWAMVVLVIALILLCNMANPYGWMSFGSLH
FT                   "
FT   CDS_pept        53466..53612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70188"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN5"
FT                   /protein_id="BAJ70188.1"
FT                   /translation="MPGIAEHAVPGINVCAESDDVDISDVDIVVRRVGVCRMKISTVMR
FT                   CAQ"
FT   CDS_pept        complement(54079..54555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70189"
FT                   /db_xref="GOA:E8MWN6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN6"
FT                   /protein_id="BAJ70189.1"
FT                   /translation="MLMADEELHETDSNNQKDWQSETSSSTVADETASKDTEQNAENAS
FT                   AEEGAAYGVNMEQVQAVLNATADKATLTPQMQRMMNRQAENTKRVEETIKGTKSNPRWF
FT                   VPLFCAFMIIGLIWCVVYYLSPSGSWPIPNIGAWNLGIGFALIMIGFLMTMGWR"
FT   CDS_pept        54639..55439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70190"
FT                   /db_xref="GOA:E8MWN7"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN7"
FT                   /protein_id="BAJ70190.1"
FT                   /translation="MARHVGKHGARHSLWGGVAVFVVIALTGFLLSTNVRVNRTVAATN
FT                   DTADLVEQGVDEANQLQQDVSDLTKQVANLTDALKADGTDGTDSTQNQGKDSSNVDSSL
FT                   MLPALSGSGVTVTLDDSPLWENAVNNNGTTANINDYVIHQQDVESVVNALWAGGADALM
FT                   IMDQRVLFNSAVICSGNVLSLHGKKYSPPFTISAIGDPQRLRAALNDSEAITILKQYVT
FT                   AFGIGYKVENAEDLQFPATAALLQQLKYATVDTSKTTDEEQTQQ"
FT   CDS_pept        55532..56674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0044"
FT                   /product="putative sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70191"
FT                   /db_xref="GOA:E8MWN8"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN8"
FT                   /protein_id="BAJ70191.1"
FT                   /translation="MAADPANASRARSRRAAVRGASSPQRSPVWQALGICAELLITAAV
FT                   ICALYIVWQMWWTGVEAERAQNETTQSVDWSDPSNNGGTVTIAKAQEGDAPVQPKDAKY
FT                   GDLIAQIYIPRFGSQWHRNIVEGTTLEQLNRHGLGHYDTTQMPGQVGNFAVAGHRNGYG
FT                   QPLGDVDKLQEGDPIIVRTKDYWYVYHYTRYEIVLPTDVHVIAPNPEDSTANPTKRMIT
FT                   LTTCEPKYSTPTHRWISYGELAYWAKVSDGVPKELATTDSSGAVMFSTTETPSIASRIG
FT                   SLDKVVFGALVVWLVLFIAAAVAWRWPVLREIRAGERRRPDASIYGGLLRLQPGVAPIR
FT                   WLLLALLLFAAAAALFQWGFPWAAANIPFLQQMSNFVAAS"
FT   CDS_pept        56725..57369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0045"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70192"
FT                   /db_xref="GOA:E8MWN9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN9"
FT                   /protein_id="BAJ70192.1"
FT                   /translation="MTDSAHILVVDNYDSFVYTIVGYLQTLGATVDVVRNDAIDPAAPG
FT                   VLDGYDGVLISPGPGAPAESGASEDMIRLCAASGVPMFGVCLGLQALAEVYGCTVDHAP
FT                   TIMHGKTSLVEHIDDEIFEGVANPMTATRYHSLAVEPDSVPDTLVVTAWTQGDHIIQGV
FT                   RVKGKPMYAVQFHPESVMTQDGYRLLANWLKVCGQDNAVAKSAGLQPKVTK"
FT   CDS_pept        complement(57593..59653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0046"
FT                   /product="putative serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70193"
FT                   /db_xref="GOA:E8MWP0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP0"
FT                   /protein_id="BAJ70193.1"
FT                   /translation="MPTALAGGRYQLGQLIGRGGMAEVHVALDTRLGRTVAVKIMRADL
FT                   ANDDIFLARFRREAHAVAQMNNPNIVNIYDSGEELVSSESGDAERLPYIVMEYVKGQTL
FT                   RDIIKVNGALSQRDCEQVMLGVLNALDYSHRMGIIHRDIKPGNIMISEQGVVKVMDFGI
FT                   ARALDDSAATMTQSQGVVGTAQYLSPEQARGETVDMRSDLYSAGCVLYEMLTGRPPFTG
FT                   DSAVAIAYQHVSEVATPPSAVVPGLPKMWDSICAKAMAKDRQNRYATASEFKTDILTYM
FT                   NGGVPVAAAFNPLTDLSNMKARKEAERDLPTTPVEPHQQPTQAFNPVTGQFEQIPPANG
FT                   ANSAALQSRAQQRAAAAKAKKRKKIIIGSVIAAIVAVLVIVGIVFAMNGSGNKSSEDTV
FT                   TIPEVCNASTSKDSIELKLKASGLKMTEKQDTDSTEPEGTCTKMSPDAGSKVAKGSAVK
FT                   VWFSAGPQSTQVPDVKERSQEEARSILESAGFKVNAAVKTEDSADIAKDMVTKTDPAAG
FT                   QSVPKGTTITIYVSSGMTTVPSNLVGQSKDSVLQQYEGKFSFTVEQESSDTVEAGLITR
FT                   VSPDSGSSIAQGGFITIWVSTGKEKVAVPNITAGTDYVTAELMLKAVGLKAQVNGPTGS
FT                   TAVVVSINPGAGSQVDAGSTVTITTKAGSTGGGTGTGDGGNGTGNGGGTGE"
FT   CDS_pept        complement(59662..60612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0047"
FT                   /product="putative serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70194"
FT                   /db_xref="GOA:E8MWP1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP1"
FT                   /protein_id="BAJ70194.1"
FT                   /translation="MKLIEGQLIHRRYRLDSRLAQGGMGEVWKGYDIQLGREVAIKALR
FT                   SDVTNAEAKLRRLRAEAHNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLFHS
FT                   KGAMDPIELLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDTGEVKITDFGVSYSTGQ
FT                   GQITQDGMVVGTAQYISPEQAQGQQATPQSDIYSLGVVAYEGLAGHRPFTGTTPVDIAA
FT                   AHVNNPVPPLPDSVDVQLREFVMSMLAKDPLDRPKDALVVSRTLARIERRLLDQQTEMA
FT                   DTAMATSGNRLPRRVTSTPRIVLEAPASRLGGNKQ"
FT   CDS_pept        complement(60609..62075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0048"
FT                   /product="putative penicillin binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70195"
FT                   /db_xref="GOA:E8MWP2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP2"
FT                   /protein_id="BAJ70195.1"
FT                   /translation="MNKYLRQLFTAVVALFVILGLSSTIIMAVRANALNNDPRNARSLY
FT                   HQLGAYRGAILASDGTVMAKSEPVNDAFKYLRTYSNGPLYAPVTGFFSINQTADRGLEA
FT                   SRSMLLNGEADSLIWQRAKAMLTGTTNQGASIETSIDPKLQQVAYDQLGTRDGAAVAIE
FT                   VNTGRILAMVSTPSYDPNKLATHDTKAASQAYNELSAGQNSPLINRATSQLYPPGSTFK
FT                   TIVASAALETGDYQTDTKIPAGSSYTLPGTATQLPNDEAQADGVNGQISLQEAVAWSSN
FT                   TAFAQLGVKLGASKVSDMATKLGFGSTITIDGTESTGTPMTATASTFPSDPTDDKLALA
FT                   SIGQGDTTATPLQMAMVAQAIANNGKLMQPTLVDRVRAADLTVLSQTKPQTMANAFSED
FT                   SADKLTTMMESVVTEANPQLAIDGIKVAAKTGTAQIGTDNSAIDGWVIGFAPADDPQIA
FT                   VAVLVHNTDVYGSLAAGPIMRAMMQEALQQ"
FT   CDS_pept        complement(62072..63733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0049"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70196"
FT                   /db_xref="GOA:E8MWP3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP3"
FT                   /protein_id="BAJ70196.1"
FT                   /translation="MIVTRLRQISLLLIAMAISALAFIQMFQRTAGEFPMQYAGMLALA
FT                   VVLFLVLWGLIVRFQPYASQSILPCVLLLTATGVTMIARIDQSEGWAVAQRQLIWLCIA
FT                   IVLSALLIIFLKDYRVLRRFSYVSMVVGLVLLLAPMLPFVGQEVNGARIWIRIPGLGQF
FT                   QPGEFAKLFLAFFFAAYLFDHRDQLAVGGKKMLGLQLPRIKDLGPIIVVWIASMGVLIM
FT                   QHDLGTSLMFFAMFVAMLYTATGRKSWIIIGLIAFAAGAVLAAGMFSHVGQRVDAWLHP
FT                   FSNEQYNKTPGGSWQLVTGIFGLASGGMLGTGLGQGHPSLVTFANSDFIYASLGEELGL
FT                   MGVLAILMLYLLIIASGFITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTLPYMAAGGSSLIANYILATLLIIISNSANAPEPELTSDTFQYEALAVLRNKELEARA
FT                   RATEPIVQPRSASATASQSESESFDDPIVDITKHAPDTLEAPEVPAIVTSAGSAAAPIA
FT                   EPIVDATTPAYAGADEPYTPTGTIPPLPPVNGGTRV"
FT   CDS_pept        complement(63730..65424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0050"
FT                   /product="putative phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70197"
FT                   /db_xref="GOA:E8MWP4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP4"
FT                   /protein_id="BAJ70197.1"
FT                   /translation="MPKSAASQPLFLYSTTVSDVGTVRANNQDSSFAGEHLIAMCDGMG
FT                   GHAGGDTASSIAIRSLAHIEQDDTGGNVETISRMMETSVMAAHDAIVGKAKRERKLAGM
FT                   GTTVTAVALVAGYWVIAHIGDSRAYLLRDGHLSRITCDHSYVQHLINTGRITPSEAKNH
FT                   PQRNVVMRVLGDFDIDPRPDISIRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLSDQG
FT                   ECAQRLVQMALRAGSTDNVTAVIADATLALDADAFDLPHQTPLVGGAASRNLEPIADIV
FT                   NEPVATAPALREDDSPAQRAAALIQPASAHEAETAQTTAKPSSTRVVQPSTVREETGER
FT                   ANPDTGEIPVVQKPDGRLSADPNDPDVAKAIRDEQVEQKKATRTKKRRNKLAVIITCIL
FT                   AVLALAGAGWGAYTWSQTHYYVGDSNGTVAIYRGVPTNLFGLELSHEVQTTNIATADLP
FT                   QTWRDQLSQGITVGSLDEAQSHVGIIRTEMRKLAKQQEADAAKKAEASNSPDSSKDSSQ
FT                   SDSKDSTEDSSSQSGSSSDKSGSSSSSDSSDKSGIGAADNAATGDSQ"
FT   CDS_pept        complement(65429..65959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70198"
FT                   /db_xref="GOA:E8MWP5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP5"
FT                   /protein_id="BAJ70198.1"
FT                   /translation="MTELTFALLKYGFLILLWIFIWLAVRSLRKDIETFSPRPSRARRR
FT                   REREVHKAKAETPQAAAPRPHRQPSASASSAASAQPTLLVIIDGPLAGSSVPLAEADIT
FT                   LGRAASNTVVLDDEFVSSHHARVYRDTRSGQWAIEDLNSTNGTVVNQQRINRPTILPAR
FT                   IPVRIGATTFELR"
FT   CDS_pept        complement(65989..66690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70199"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP6"
FT                   /protein_id="BAJ70199.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIEAWGSETLANELADNLTEYAKSQHYAFVGPVIVI
FT                   FEEDLDLSKGNFNLTSESVQGNAVPVTTDAQTEDSPVLEVNGNQYLLTKDKTVIGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASAQAQE"
FT   CDS_pept        complement(66875..69319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0053"
FT                   /product="putative dipeptidyl peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70200"
FT                   /db_xref="GOA:E8MWP7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP7"
FT                   /protein_id="BAJ70200.1"
FT                   /translation="MSETNDVNDAIKHFPRLRARTLRFGCGAPRSAQTVGDGSRALFLR
FT                   SDGPEDLVTALWLSWFDESGEHHETKLADPRELLGATADSEDVPAEEKARRERAREGGT
FT                   GIVGYSADDDGNRIVFTINGRLFLTDIDWNDETGAPEPHTRELAGEWLDEDPAMYTPVL
FT                   NPRIAPDGEHVLYTTGSYLMLVDIGGELGDRITAVYGVSVEDEDGNPAENTWKIGLAEF
FT                   VAGEEMDRYDGFWWAPDSQHVLFESFDTADEPTWHISDPADPEKPDAGRRYPRALTRNA
FT                   DVYLTVITLAFDENDRYAGITGNADVDWDREAYEYVAAVNWRRGHDPLVLVQNRRQTRD
FT                   QVLEVAVEADGAALGATRVLEEHANEQWIDLVHGTPAYTPDGRLVCSLNDMATDTNRLT
FT                   MDGRPFTPAGWNVRTVLAVTDEDVLAVVQRAPEIAPEVPDAWADAAATESVFGDHDARS
FT                   FDVVSIDYNGTITPVTTDSGQWTASRGERGIVVSGRDMRSARAQMRHILGEQSATIAST
FT                   AAEPGFTPNVTFTRLGEHQLYTAIIAPSPESPYAHAEKLPVLMKPYGGPGFQQAIASQS
FT                   FYWEGQWWADQGFLVVTADGRGTTGRGPAWDREIFEDMKDVTLADQVEAVNALPEAVAR
FT                   LNADVESRAAQPAAGDQADAENHPPALRATSRQREAIPMPDLDKVCMIGWSYGGFLSAL
FT                   AVLDAPNVFKAACAGAPPTDWTLYDTHYTERYLGLDPDVYYRNGIVQDAPKLERPLMLI
FT                   HGFADDNVTIAHSLRLSQALMAAGRPHTFLPLTGITHMTNDETVAENLLTLQRDFLRDA
FT                   LA"
FT   CDS_pept        69429..70529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70201"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP8"
FT                   /protein_id="BAJ70201.1"
FT                   /translation="MGAMQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAG
FT                   IEPLSGIMDTGGRSGQLHYLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDEL
FT                   VWYFLLAGYSVCVLEHRGHGKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGM
FT                   PLNLFCHSMGGGIGAAVLERYPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFG
FT                   KKRVFGQSGFTPEFSMEGNEGASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRA
FT                   ILNPSACAEVETPVLLFQSGRDIWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSM
FT                   PNSTYKPYLEKILGFYDDPMIACAAY"
FT   CDS_pept        70664..71752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0055"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70202"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWP9"
FT                   /protein_id="BAJ70202.1"
FT                   /translation="MLALTGCTAFNNSDDGTADGNGTSATTQTFQPSGGKPTATLSIAS
FT                   GSENKEVAVAIQKAADQSNVAVTMHYMGSLEIMNALKAGGQDHDAVWPASSMWISMGDT
FT                   KHIVKDAASTSTTPIVFGIAKSKAVKLGWADDTGAAKPVSTADILAAVSDGKLTFSMTS
FT                   ATVIDSALNVYQTALRKPSWTIWVVDYSGSMSGEGKNGVVKGLNAALDPDQAKKSYIEP
FT                   ASGDVNILIPFETEAHRPVKATGTSTSDLLHEADATDASGGTDIYEGLLSALDELPSES
FT                   EASQYTTAIVLMTDGRSNSDHQDEFESAYKSRGRDLPIFSIMFGDADPSQLKSLATLSN
FT                   AKVFDGRSGDLAAVFRQVKGFN"
FT   CDS_pept        71752..72072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70203"
FT                   /db_xref="GOA:E8MWQ0"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ0"
FT                   /protein_id="BAJ70203.1"
FT                   /translation="MLQVICGFVVGLLLAGLGFGLVGGGVPGLIVAVVLAALGYIAAST
FT                   LTEPERRIGKMLVSALPNGQKTADTIDAANAQLNSIAMLTKQVRDPAVKAEANDFIAAT
FT                   KD"
FT   CDS_pept        72082..72471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70204"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ1"
FT                   /protein_id="BAJ70204.1"
FT                   /translation="MTRDTSAYPTLLHYITVYGEQTEKLLRSYVDVESSGARDQIATVR
FT                   IETIEALQVLEQTAAGELSRAVSAKTLGITADSDAIQRLARMNGYDDVAPSPVPSSAAD
FT                   EGRHAPSQTPSGGPAHQSDQKTDAQ"
FT   CDS_pept        72468..73247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70205"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ2"
FT                   /protein_id="BAJ70205.1"
FT                   /translation="MKLSKSKIIGLIALLAVVGVVCGTLVWRQSQPAPAEPTEQVSITG
FT                   YLGGEKIGLFDDAKFKALAAKQGIAIDYRKAGSLAMMDADRKGMDYLFPSSRAAVEYGN
FT                   AKGVKPPPQKRHRLQLTDCAIHAQGRGGRARERRTCDQGRFWRVPHGYGQSRGRDGRQH
FT                   NLGRRRIHGRLRAVPHRLDRSGEVELRQRIRGASCHGAQRRAAGHGRFGGARRQDHRLH
FT                   LRQIRLDGDLFRGFVQPVPDLGRGLQADDGGLRIAAA"
FT   CDS_pept        73397..74251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70206"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ3"
FT                   /protein_id="BAJ70206.1"
FT                   /translation="MQKLAWERHGFRAANFAGTDSISRFGVAGTLDQIPAVSELPNNDA
FT                   MQHLITTLQSAQAKLVADISMYDTMYTQNAQQYRELKMTVLAGKKALADFNANQLPALE
FT                   AEAAASGDAMQAQVLKNFKSKLDRFAKRLDDLDRISVVTLQTAPQIKIIQNADQTIVDK
FT                   IDTTISTTIPVWKSQMVIALGLSNQRKVLDLQNKADDVTNKLLARNAAALYKGAVDAEK
FT                   ANQRSVVEIDTLEKINAELIATLKETVQIQKEGEANREAAQVKMRQIESDLKNALLENA
FT                   QQM"
FT   CDS_pept        74632..75135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0060"
FT                   /product="putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70207"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ4"
FT                   /protein_id="BAJ70207.1"
FT                   /translation="MAMFPALMNDTMFSDLFDDPFFEGWRNTDNTMSAVMPANMMTTDV
FT                   RETDKGYDVDIDMPGFKKEDINLELNNGYLTVSASRCSEHEDKAPAAEDEASDSKCACA
FT                   SDSGKWLRRERYMGSCSRSFYVGEDVKESDIHASYRNGTLCIQVPKMQAQPQVESKHQI
FT                   AIEG"
FT   CDS_pept        75462..76418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70208"
FT                   /db_xref="GOA:E8MWQ5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ5"
FT                   /protein_id="BAJ70208.1"
FT                   /translation="MANGAQNASGTPAPAASHSGGHVVSARATTIGLMAILLWSFMAGT
FT                   VRIVSENFGATLGSALIYTVGGILLLMFRRPAPIREFPKKYLIIGGLLFVFYESSISLS
FT                   LGLASTDASSVEVSLVNYLWPTMMVLLSAGVSHRKHAVVKVLPGAIVATAGVVLAVGGN
FT                   SGLDWHAAVQHIAANPLPYALAFVGALAWSVYAVFTPAMSHGVDGTSLFFPCVAVALWI
FT                   IHFASGQGWPAEPPSLVAWLFVLIAAAAIGGGYACWGYGILHGSMERLAIASYATPVLS
FT                   TGASAVLLGLALSLPFWCGALLVAVGSVLNYLVSARK"
FT   CDS_pept        complement(76586..76819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70209"
FT                   /db_xref="GOA:E8MWQ6"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ6"
FT                   /protein_id="BAJ70209.1"
FT                   /translation="MTIIVTVVVVVAIVLGLGFFVNWGLAALLVIIMIPGAISLAVLAK
FT                   HPESTGGRSMFGISDPNTLLDPIRRPSERRGE"
FT   CDS_pept        77303..78658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70210"
FT                   /db_xref="GOA:E8MWQ7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ7"
FT                   /protein_id="BAJ70210.1"
FT                   /translation="MELSLVRGIVPRTVFGLTAIAAIILVIGLALSKSNKRGRLHPLIV
FT                   SLIAAVLAGAAGMLVAWLVSDVFMVFGVSLGWPVIFTIAGGIAGVGFVIAAAVTMRGAR
FT                   RVLAIVLVPLVLLSTALGVDSIYGEYQTIGTLVGYTPYASLGSIEVHKAAMSVSDWRSK
FT                   AQKGSLPSMPSQGKVLTVDIPNAKSNFTARKAMIYLPPAALSDRPPALPVMELLAGQPG
FT                   SPSRLIDAGNIAATMNAYAAKHDGLAPIVLVPDQNGEATHNSLCADTTQGNAETYLTTD
FT                   VVNWAKKMLPVAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELKPTNGSVA
FT                   KMVQEYFAGDRKAYDEQVPVNAIAATGTPEQALFTGAGERDKESISNMRTIADAARKAG
FT                   MEVTELIVPGTGHDWHAVQAVWRPGLDWFGERTGLGEMTKSLKEYPQVEVLQ"
FT   CDS_pept        78655..81228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0064"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70211"
FT                   /db_xref="GOA:E8MWQ8"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ8"
FT                   /protein_id="BAJ70211.1"
FT                   /translation="MSEESRKHNSHAAESWRELAGDVRQWADGHRLAITATVALVVLNL
FT                   VVWLVVAMAGFAFPLRLDTSMAEFDFGKLFCTLFLARGVIQLILDAALWLVMLSIAEPW
FT                   LGRARTVGTALACALGGVIVGLTLCAAAGWLFQDSQFVSRMQFALSPLVLPVGALMAAS
FT                   AFCSHLLRRRIRLIGYVAILVALLYSGNPGDYCILAAALIGHAVGRVMAGSPAHAETGW
FT                   HWLRSTSFEARRMFAAIAVVLALGPVIAITSHNHAGPLSTVGLLMSPVSVDDGTLARCL
FT                   AGATHSGCFLQFDLMRASMPGAVLRSLLPTAVTLVLAWGLYRGRRFAATCAVAINLFTA
FT                   GVAIAYYLVVPLSFAPDGMTSLLQHGAITACVTNTLPPLIFAIALAAAMKHFPIRVGWR
FT                   RLIGGVGAIVLVLLACAAVYLMYGIAQPDAFSPRATASSLLAELPGRFLPIGFLSHMKL
FT                   SFVPRTPMASIVYQGVGLVFWIVVLVVVIRWMSDVSESNERAQARAERLVETGGESMSF
FT                   MTTWEGNSYWLSPTGKSAVAYRVLNGIALTCTGPFGELSEWMDDLTGFTQYCVERSLSP
FT                   VFYSVHREQRDALLEAGWSSIEVGSEMVVDPRGWKTTGKKWQDVRTAINKAKRDGVTDV
FT                   QSTFLEASLDVREQIEDISEEWAQLKALPEMKFTLGGVEELRDPRVRLLYAIDADGRVL
FT                   GVTSWLPTWRDGRIVGWTLDFMRHRTDSPNGIMEFLIARMAERLRDEGLADPEHAVEFM
FT                   SLSAAPLAGMNPERDNAREGGVAAGEGTQVLQHALQIVADWMEPAYGFHSLFNFKRKFQ
FT                   PAEAPVYVCYPDPAALPQIGLAVVRAYVPSVTPAEVAGMLSTLRS"
FT   CDS_pept        81765..82781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0065"
FT                   /product="methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70212"
FT                   /db_xref="GOA:E8MWQ9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ9"
FT                   /protein_id="BAJ70212.1"
FT                   /translation="MSERNEHNDGNTQTAYFAGGCFWGLERYFQNVDGVTDTTVGYAQS
FT                   TVESPAYEQVCAGGTDAAETVKVEFNPAQVSLRTLTLLFLEVIDPFSVDQQGEDRGRQY
FT                   RTGMFYTDETQRAVYVAALEQLVDRQPQRPAVLVEPLRNFYPAEAHHQDYLVNNPGGYC
FT                   HVPIAAIANVKRRQKYVERIWDLTLEQFAVTQNAATERPFVNEYDEEFEPGIYVDIVSG
FT                   EPLFSSRDKFDSGCGWPAFSRPIAGDLLTEHEDHRIPGRDRIEVRTSDTQIHLGHVFTD
FT                   GPADRGGLRYCMNSAALRFVPRSRMAEEGYGDWIAVVDGMIRHEHGEYCGRSQARQA"
FT   CDS_pept        82864..83022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0066"
FT                   /product="truncated conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70213"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR0"
FT                   /protein_id="BAJ70213.1"
FT                   /translation="MLPGHVIIRRAAWERCGGYDESMRGDATASQAFMAHPTYGDGGMA
FT                   AAVRLRS"
FT   CDS_pept        complement(83026..86232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0067"
FT                   /product="putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70214"
FT                   /db_xref="GOA:E8MWR1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR1"
FT                   /protein_id="BAJ70214.1"
FT                   /translation="MSINLASTSSSPANTQHSDPGPTPSILEDVISGLIEPRSDAPGEY
FT                   KPTLIANRPGGLTMREEIGNSLATSDSFDISVAFVSAEAVLSLFEDFRSHHETATRAGT
FT                   LITSTKNHFNDPRAFWELLHLQNTTGVDVRVWEGSRNASVAAMAQGQPFHPKGYIFSRR
FT                   MKDGTPYYDLYVGSSNLTGAALTTQREWNLKVSSLADGELVGQFQDEIDSQVADSVPLT
FT                   EEWIKQYEEDFKKYAPPRHEILQSFEGHDIQPNAMQQEALANLKKLREQGEHRAIIVSA
FT                   TGTGKTYLSAFDVRECQPKRMLYIAQQQMILQTAMNSYQKVLGCDESELGLYSGTSKQQ
FT                   DRRYVFATVQTMRQPEVLAQFKSDEFDYVLVDEVHHAGAEGYQRVINHFKDADFMLGMT
FT                   ATPERTDGINIFELFGHNIAYEIRLQKALDENMLCPFHYYGVAEYLGSDDDPNGIAHRL
FT                   DVSKGLDAKDSKQLKYEIEQLATEKRVRYIIDKLQEYGQFNIPVTGLVFCSRQEEAHKL
FT                   SQLFNQQWNQQDERPYRTAAVTSTDDDGRPVSQAQRDEYVRKLTEGELDYLFTVDMFNE
FT                   GVDIPAVNQIVMLRSTESSIIFTQQLGRGLRKFPHKESVVVIDFIGNYNNNYLIPVALY
FT                   GNTGDRDRARKNLQRKSIGLSSISFDPIAKERILKSLDTADWSDMKKLSEQYRQVRYEL
FT                   GRIPMLTDIYNYDPSLPYTIASKRSNYLDFVRSREKSLGKGKHHEATFEDQLEPVTDVE
FT                   DAILKMAAELLLPGLRPHELVILAQLCHFVSERLDDDVPQHWSAGSSIGRSELLDAIRT
FT                   EFPLADGSDAQFDSAISVLDYSYFTGPNCNRFGNQPLVETLNSTGTGSDTAYRLSSRFA
FT                   DILATNRTFRIFFADTLRTGMANCRDMFREAAARQQVFDHMFLYERKYSMADVMRLCGW
FT                   KKENTPQNVGGYLLDKETNTMPIFVKYAASQYEDEFLSTQEMKYFSKNGRTPQSPEFRW
FT                   ALSGIGPNWDHTHFVPLFVMRKAEEADGKYYYVGHVAAFENPQLTTKPDATGQGSVKVT
FT                   LSVLRLARPIDPELYRHLAG"
FT   CDS_pept        complement(86305..86718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0068"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70215"
FT                   /db_xref="GOA:E8MWR2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR2"
FT                   /protein_id="BAJ70215.1"
FT                   /translation="MDPERKIINVVGAAIVTNGTVLCAQRGPGKSLAGYWEFPGGKIEP
FT                   HETARQALHREIEEELLCEVEVAEEVCTSEYAYDFGTVRLTTFVCHLIAGTPHLTEHTD
FT                   IRWLNPADMPTLNWAPVDREAVAIIASKQLTLR"
FT   CDS_pept        86860..88113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70216"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR3"
FT                   /protein_id="BAJ70216.1"
FT                   /translation="MVNERQTDTCADVMYRRERQRGCGEAGLDFAPFIPSQDEVDQQMS
FT                   ALDDKLVSKAQEQYANREIYPLDECYQLDGSTFISAEAFEEILGDEQTHYMAWKNGCID
FT                   KLSIDYWEMPDVMAYLVERSIAEGDGGECCYTDAQPIDYAEDCAYSPSEMLECLGANWQ
FT                   EQGVADDGLSYALYGHPNINVENVSGSMMVVSTEQPGLSVMVDYRSGIWVVQPFAHDES
FT                   FGSAIQFGERLAPVEAGLLRPNVYQHFLEAKHAFDYAIAWIEDVGEGALDYCGSQEKRS
FT                   VSEVRFGSDPTLGSDSSTQTSQRSLAMILVTTTPSVDGYTITNYQGIVFGEVVSGVNMF
FT                   KDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAEAMGAHAVVGVDIDYEVLGADN
FT                   GMLMVTASGTAVQIARTA"
FT   CDS_pept        88201..88722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70217"
FT                   /db_xref="GOA:E8MWR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR4"
FT                   /protein_id="BAJ70217.1"
FT                   /translation="MTIRIEAYDRLPAAARAIREQVFIRERDWRPEFDEWDAASVHLLV
FT                   FDSDNDAPNRPGSSAQLASRSQPIQPSQNHPVATCRFYADPDHPDQPGRYIIARLAVLP
FT                   EAQGRHIGSRLLADAERRIAQAGGTMTAVHSENDHYKFYEQCGYRLTDEVYEGGRHGWL
FT                   IKDLILGSEN"
FT   CDS_pept        complement(88803..89660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70218"
FT                   /db_xref="GOA:E8MWR5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR5"
FT                   /protein_id="BAJ70218.1"
FT                   /translation="MSVSISTPSGRTMASAATVAPSATASQKSSANANPTALDRASARY
FT                   RAAQSRYRQAKVALKAIKRQIVPVDAFGNRKPRLRGWLHLATLPLCIAASIVLICIAPA
FT                   GSVKAACAVYGASAMLLFGNSALLHVVPWRSAKVTRVLCGIDYSNIFLIIAGTNTPVLF
FT                   ALSPAIRRPYLTVIWVTAAIGTILHIVWLRTPNWVFTTVYVVLGLAPVTLIPQLWTAPA
FT                   VGPAATILIACGGAAYIAGAVCFALRKPNPVPGWFEFHEVFHLGTVIGYACHVVAIYLI
FT                   VCAL"
FT   CDS_pept        complement(89764..90000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70219"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR6"
FT                   /protein_id="BAJ70219.1"
FT                   /translation="MNRDETNEVSGVTDDQLGRTAEPYESGNWRGGVGSIIRSNPKSGT
FT                   DTSRTQQTRIIRVHRLGDVFRNRTTEYHTTEEL"
FT   tRNA            complement(90518..90603)
FT                   /locus_tag="BLIF_tRNA03"
FT                   /product="tRNA-Leu"
FT   CDS_pept        complement(90776..92089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0073"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70220"
FT                   /db_xref="GOA:E8MWR7"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR7"
FT                   /protein_id="BAJ70220.1"
FT                   /translation="MTISLLEHPLGAQPGQPGDRSAFHFETITRLPSTASGLGRDGARY
FT                   GRTGIIHTPHGDIRTPAFVPVGTQAAMKAVLPEQMKDLGAQCLLANAFHLFERPGEDVL
FT                   DAAGGLARFMNWDGPTFTDSGGFQVMSLGVGFKKTLAMDVTGMKSDDIIAKGKERMAWV
FT                   DEDGVTFKSPLNGDAHRFSAEISMGIQHKIGADIMFAFDELTTLMNTRSYQEDSVERTF
FT                   RWARRCVDEHQRLTAERLGRPYQALYGVVQGANYEDLRRRAASQIASLDFDGVGIGGAI
FT                   EKRIIGDTCAWICDAMPESRPRHVLGIASVDDIFACVENGGDTFDCVAPARCARNGAIY
FT                   TRAGRYNIKRAQHKFDFGPLEEGCDCYTCQHYSRAYVDHLLRAREFNGFTLATIHNEHF
FT                   FVKLLDDIRASIDGGYFDEFRDEALAHFYGNGERRPGL"
FT   CDS_pept        92506..94548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0074"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70221"
FT                   /db_xref="GOA:E8MWR8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR8"
FT                   /protein_id="BAJ70221.1"
FT                   /translation="MADEFNPQGVDQTPRNNENPNSTADTGNAEPKNPFVGGDSVDAGN
FT                   ASDSSEQQAPVSSAALAADQQPTQAATDTAATEPIPDYASAKGESTVVSSSPASPAAPA
FT                   AGQTSATTPLYRPAPEYGAYGPTPTQAQGQQGGQAGSNAQPTQQFPFGQPAQQTPQGQQ
FT                   GNRNPYYTNNPQPQGNGNPFNPPTQPQQNNGNPFASQSGQNGRNGQQPQQGGLFGFGTP
FT                   GTGTPNGQGPAQPGQPGQPGQPGPAKQGMSKTASNILIAVVAAVLAAALCLGLGYGALT
FT                   SGLITLPTSNSLSNVSSNKSGSGSATAKSGEAPDWQTVASDVSGSVVSIQTALSNGTAK
FT                   GSGAIIDTEGHIITNNHVISGAQQIQVTLANGNMYSATLVGTDTTTDLAVIKLDNPPSD
FT                   LKAVKFADSDKLAVGENVMAIGNPLGYDDTATTGIVSALNRPVTVTDDNNNEIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTATSSDSAGSIGIGFAIPSNLVKRVADEI
FT                   IKDGKVKHVALGVVIKSDTVEADGVTRGGATITKSSATGSAVVSGGPADKAGLKEGDTI
FT                   VAFNGNAVNNNYSLLGYVRAAALGDKVTLTIVRDGKTMDVDVTLDQEESSVNGSSSSDS
FT                   NGNSQNKQNNQNGNGQNGYGNGNGNGNSDGGTGDGGGFSDPFGLW"
FT   CDS_pept        94959..97118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0075"
FT                   /product="putative cation-transporting ATPase V"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70222"
FT                   /db_xref="GOA:E8MWR9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWR9"
FT                   /protein_id="BAJ70222.1"
FT                   /translation="MGALIRFFTKILDICKLVPMLPVVVIAAIPLALLGDWRPWGNAMA
FT                   IPVLGNPGFGQWLVIALVLIIVIDTVRGMIDDLRHGQVGVDVLAVVAILSTVAVAEYWA
FT                   SWAVTLMITSGEAIEEYAQAKAERSLTALMEAAPQTAHVVNLPGVGRGFAADKGDSSDG
FT                   FRRVGLASAAAAAHRFDTVPVEQVQLGDVLMVLPGETVPVDGELLSGTATLDLSNINGE
FT                   PVPREVFAGARVMSGAVNGSTALTMRATQVAADSQYQRILELVASAQESRPAVVKTADR
FT                   LAVPFTVLSLMIAGIAWAMSGVPTRFAQVLVLATPCPLLIAAPVAYIAGTGRLAAAGVL
FT                   IKAQDVLENLGRVTQVFFDKTGTLTVKQPQVVRVEMLPGAATRLNEDHVLMMAGAVESY
FT                   SVHILSKGIAKAGAEALARLRQRFEDGQRLCPEPEASWPGHGREYPVVKNINEDAGKGV
FT                   SGEVNGHAVRVGRLSFAAAGEDGFLAVGEAAPLSPRSGQLPLRGGAQQKDDLRTRFGLL
FT                   QPDEMASYVSVDGRLIARIVLRDVPRANAKAVLAKLHELGVTELAMLTGDKRASANIIA
FT                   SEVGIDEVHAELFPEDKVAAVRAATGAGKTVTMMVGDGVNDAPVLAVADIGVAMTDGTS
FT                   TAASESAQVVIMNDNIAAVPRAIAIARRTKRVMLQAVIAGLVLATIGMIAAAFNLIPVV
FT                   VGAFLQEAIDVVSILWALTALIDRD"
FT   CDS_pept        97537..98643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0076"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70223"
FT                   /db_xref="GOA:E8MWS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS0"
FT                   /protein_id="BAJ70223.1"
FT                   /translation="MGQQYSHLSSEERILIEKLHCEQHLSIRRTAEEIGRDKSTVSREL
FT                   RRGLWFASNENGSYRPYRPKRLKTGAWTSGPFYSALAAQRKADLRRRGSRKPRRMDSDR
FT                   LRAWVLDSLRRGWSPELIEGRLKAQYAGDPSMRISHECLCQWIYAKPQRALDLRQYLAR
FT                   GRKRRTRKKGRKAKGPRIPMRVPIADRPEAVGSRKGFGHFESDTVVGAAPSRRCMNTQV
FT                   ERRSRRLFARLVDDKSASATARAEYEIFKDIPPAARVDRTWDNGTEASLHMLVDEALGM
FT                   LTYFADPYSSWQRGSNENRNGRIRRYLPKGTGFEDLAQEDLDAIVGEINDTPMKLLGYK
FT                   TPNEVWDEEIAKLQSKAASPNTSVALTN"
FT   CDS_pept        complement(98698..99498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70224"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS1"
FT                   /protein_id="BAJ70224.1"
FT                   /translation="MVKLLPFSFQEACKADQALTPDTFMLQGGYPRIYDTRMPLNLFFS
FT                   NYIDTYIERDVSEYLDVRNLADFRRFLTLCALSSGALINYTNIANELGVSPRTVKAWMS
FT                   ILESSYIAFHLIPFYTNARKQVVKTPKLYFYDTGLLCHLLGIRTVEALVAHPKFGDIFE
FT                   NLIIAETMKQHLNANQEPQLFFYRDASKVEVDLLDFTDPNNRMLIEIKSGQTYHDRFAR
FT                   HLTLIGNVLGIPCEQQYVTSRVEHSYVSQGIRVTSALDWLEGRR"
FT   CDS_pept        99629..101080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0078"
FT                   /product="putative ferredoxin/ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70225"
FT                   /db_xref="GOA:E8MWS2"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS2"
FT                   /protein_id="BAJ70225.1"
FT                   /translation="MTESVNTELRIAVIGAGPAGVYSSDIFLRQLKKLGEELGLGTEAR
FT                   IDLFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPNIHLYCDVEFGKDVTLDDLL
FT                   ARYDAVLFATGAVKDKPLNLPGADLEGVYGAAKFVEWYDGYPTGAREWPLTAENVAVIG
FT                   GGNVAMDVARELMRNADDLKVKTDIPDNVYEGIGQNKAKVLHLFIRRGVAQAKFSVQEL
FT                   REMEKLPGVQLIINEDDFDLDDETIEVAGKDKLTRQMVEELFAIREMAEDMEDDGDVDF
FT                   EGNPADRKYYVHFNSAPTEILGEDGKVKAIRVERTETGADGKMHRTGEFTDYPVEAVYH
FT                   AIGYKPAEAPGIAYDEHGAHLANANGDGRITTEADGGEVRDRLYATGWAKRGPVGLIGS
FT                   TKSDALAIVTNMLEDLAKAAEGGRVAADRDPESIDRLLAERGIRPIDFAGWKKVDAFER
FT                   AEGAKEGREHKKVIEPDQMRELAHA"
FT   CDS_pept        101255..102193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0079"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70226"
FT                   /db_xref="GOA:E8MWS3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS3"
FT                   /protein_id="BAJ70226.1"
FT                   /translation="MDAKVRVHGHFNGLKTTLLFALMWAIIMLIWWATGGSRQTLSIYI
FT                   VIGLITTFGTYWFSDKLAIASMGAREVSEQEAPEIYQIVRELSAKAGKPMPRIYIAPTM
FT                   SPNAFATGRNERHAAVCCTQGILQILNARELRGVLGHELMHVYNHDILTSAIASAMATV
FT                   ISYLGYSLMYFGGGSRDDRDSSGGLGLIGALLSVILAPIAASLIQMAISRTREYDADED
FT                   GSLLTGDPEALASALNKISYGAQTTPMRKTAGTQSVSAMMIANPFSAVGFSRLFSTHPP
FT                   TDERIARLMQMANEMNGTPIAPPTYSTRVGR"
FT   tRNA            102268..102341
FT                   /locus_tag="BLIF_tRNA04"
FT                   /product="tRNA-Gly"
FT   CDS_pept        complement(102404..103471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0080"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70227"
FT                   /db_xref="GOA:E8MWS4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS4"
FT                   /protein_id="BAJ70227.1"
FT                   /translation="MTIATPERYAEMLEAARRGGYAYPAINVTSSQTLNAALKGFADAE
FT                   SDGIIQISVGGAAYVSGRGVNDRVTGSLALAAFAHEVAAKYPNITIALHTDHCAKQYLD
FT                   EWVRPLLAHEADQVARGQEPTFQSHMWDGSTVPLKENLDIAEELLDKSQKAHTVLEIEI
FT                   GAVGGEEDGHSAEINEKLYSTPEDGLEVARRLGLGERGRYMAAFTFGNVHGAYKPGVVK
FT                   LRPSLLGDIQARVARAVAEGELPSAAGIVDFPNGKPFELVFHGGSGSRPEEIAEAVSYG
FT                   VIKMNIDTDTQYAFTRPIADHVFENYDKVLKIDGEVGEKKFYDPRSWGRKAEDSMSARV
FT                   VEACRQLGSAGKALK"
FT   CDS_pept        103687..104973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0081"
FT                   /product="adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70228"
FT                   /db_xref="GOA:E8MWS5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS5"
FT                   /protein_id="BAJ70228.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHSVVV
FT                   GDESYALHLLPSGIINPNLTPVIGNGVVVDPEVLFEEIDGLESRGIDCSHLKVSEAAHI
FT                   IAPYHRTLDKVTERFLGKHKIGTTGRGIGPAYADKINRVGIRVHDLFNADHLHDKVEAS
FT                   LHQKNQMLVKLYNRRPIDVDQTTEELLKLGERLKPYVANTGLILNKALDEGKTVLFEGA
FT                   QATMLDVDHGTYPFVTSSNPTAGGACTGTGVGPTKITRVIGVSKAYVTRVGEGPFPTEL
FT                   LDESGEWLRQQGHEFGVTTGRPRRCGWFDAVVNRYASQVNGLTDIVLTKLDVLTGLKEI
FT                   PICVAYDVDGERHDDMPTDQAAFAAAKPIYETMPGWDEDISDCHSFDELPATCQAYVKR
FT                   LEELSGCRISAIGTGPQRDHVIQINSLVD"
FT   CDS_pept        104997..106580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0082"
FT                   /product="putative voltage gated channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70229"
FT                   /db_xref="GOA:E8MWS6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS6"
FT                   /protein_id="BAJ70229.1"
FT                   /translation="MTGNDAAHDIRRLIPRFDHLKWKMAAAGIVIGLVSGLLVVVYRLG
FT                   IEYGTDASRWIYARIRETPWLIAPWAVAAVAAALAIAWMVGKEPMAGGSGIPQTNGVVI
FT                   CGLKMRWQTILPVRFVGGLLGALFGLSLGREGPSIQIGASGAQCVSHRLRGRRREDMQE
FT                   HYLVTAGAAAGLSAAFSAPLSGMMFALEGVHRSFSPAILMGATAASLTADFVSKYCFGL
FT                   RPVLDFGDIGQLSLEEYVWLIPLGLVAGLVGSLMNRSLLGFQTLYGKLPAWSRPMIAIA
FT                   IALPVGIWLPDVLGGGSNLIDTAEHARVGLGMLCLLFVAKMLFTSTSFGSGAPGGIFMP
FT                   ILAVGSLAGGICGEVLHRFGDLPSDAVAVFAVCVMTGTLAASVKTPITSILLAVEMSGT
FT                   LTHMLPVAAVAFVALLVSDLLRTKPIYGELLERYVRAQGMQMAIASHVGSGIMELPLEM
FT                   GAIADGKRVCDVRWPSGCLIIGLRRGESEIVPRGDTRLRAGDYLVVLFSGEEEREVRPA
FT                   MRRLCDARLD"
FT   CDS_pept        106608..107837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70230"
FT                   /db_xref="GOA:E8MWS7"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS7"
FT                   /protein_id="BAJ70230.1"
FT                   /translation="MYESAESDIQGAYVGAPCKLICVRKAATAAQLVVARPMGGTTLSA
FT                   EGQYRGSAMESQEQSPGDVVTAGEDSHPITQAIDTVEVMHAGATAPAANTMDPPTIPLA
FT                   PMKRMQARFNPLADGLMYVVVFVGGFVGVGCRHALDMLLPSVSGTPFVVGTFVSNMVAC
FT                   FLFAMLTEFMATASWLRRRVRQVVSRGVGLGLLGGLSTMSGVMLETMEGLHERHIASAL
FT                   GYLAGNFAGGLLTAAAGVVLMQALLSRSTRKRVRGAFSAVSVSDSAESDTQGVRHVKVA
FT                   DVARSAAQAAMEAAQTAQQIAQTGQVPRVETPTVPPTASQPMQTGRVPQIPPLAVPQLT
FT                   QPAHPLLREPDTPDLGQLPEIQQSQPIQQPQQQSQPIQQPANPLPPSFEPKPITAEISL
FT                   VADPTTGEVR"
FT   CDS_pept        107837..108232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70231"
FT                   /db_xref="GOA:E8MWS8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS8"
FT                   /protein_id="BAJ70231.1"
FT                   /translation="MMWMICLFGGLGAMARYVLDVSIQQGWNRENRRTNRNFPLSTLVI
FT                   NGVASLCAGIAMMSYYSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLAL
FT                   GYGIATVAVPLICVAAGFGIALLANPA"
FT   CDS_pept        108507..109592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0085"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70232"
FT                   /db_xref="GOA:E8MWS9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWS9"
FT                   /protein_id="BAJ70232.1"
FT                   /translation="MVGMRDVAKKAGVSLSTVSLVVNGNGYVSDDMRERVRKAMQALNY
FT                   VPNELARNLYHDRTNLVGVIVPTIRHPFFATFTAHLQHALAAQGLRTMLCSTADEADGE
FT                   IQYVDMLRRHMMDGIVMCAHTSHPGDYWTSIHRPIVAFDRVLGDGISSIGSDHEQGGRL
FT                   IAQMLIRNGTKHVVMIGGPRDQFFDLAARGEVEEGPFDLGKTTFPTVRYYLTLEQELTS
FT                   AGVKYEYVEAGEVMDFAGYHRAVSNALDKVTIDGVDAVVSSDIGASFCVREALGRGISI
FT                   PDELQIVAYDGTYLTDLAGMKLTAVAQDFSAIAQSAADHIVQAIANEEVAAANASRKNI
FT                   PKPFEPNVLIPMTLVPGDTTR"
FT   CDS_pept        109801..111585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0086"
FT                   /product="potassium transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70233"
FT                   /db_xref="GOA:E8MWT0"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT0"
FT                   /protein_id="BAJ70233.1"
FT                   /translation="MDVRFCRIIFALYSLIRKYGAWLVIPAMLGGAAFLADSVLTPAVS
FT                   ISSAVEGLKTLPALEHLFTENKDLTMMITAVIIVILFAVQSRGTESIGKVFGSVVMVWF
FT                   AFLAIVGVVAIGNDWSVLAALNPYYGIKFLFSPNNATGLALMGTVFLSTTGAEALYSDM
FT                   GHVGRGNIYFTWPFIKVALVLNYFGQGAWMLRNQNNPELADAEGINPFFQMMDPNVRYV
FT                   AVVLSVTAGIIASQALITGAFTMVSEATGLNWMPHLQVCYPARTRGQLYIPVVNVVLCV
FT                   ATLAVLLLFRDSEHISAAYGLALTITMITTTILLGIYLWHRSNKFGAVVFTIVFLAIQV
FT                   LFFAASMAKFLHGGWFTLLLTLAILMIMYTWNEGTKLERSQRRHMMPKDFLPALDKLRG
FT                   DSRIHRFADNIVYLTSDPDLKRLDTDIFFSIFADHPKRARAWWAVAVETTDEPFTREYS
FT                   VESFGTDYLFRVRIRLGFKVSQSIPAYLHQLMHDLEKTGELPNQQSIYPKLDADPGIGT
FT                   IRYVVIHKALMPESKVSGRGALSLQIKYAIRRVAGSPVKWFGLAPYNPLVEVQPLFVST
FT                   RRPPRLTRVASQAPKREG"
FT   CDS_pept        112002..113549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0087"
FT                   /product="alpha-L-arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70234"
FT                   /db_xref="GOA:E8MWT1"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT1"
FT                   /protein_id="BAJ70234.1"
FT                   /translation="MPQQDHLTARLVVDDDFEVAPVNNRLFGSFVEHLGRCVYTGICEP
FT                   DHPTADEHGFRKDVIDLVKELGATTIRYPGGNFVSGYRWEDGIGPKQERPRRLDLAWHS
FT                   SETNEFGLHEMAEWLEATGGNELMEAVNLGTRGLQEALDLLEYANVPGGTELSERRRAN
FT                   GADKPFDIRMWCLGNEMDGPWQLGHKSAEDYGMLAASVAAGMRQIDPDVELVVCGSSAH
FT                   GMPTFGKWEQTVLEKTYENVNFVSCHAYYQPFFKEDGTRDMASFLASGVDMDGFIKDVA
FT                   ATIDATKAHLKSAHDVYISFDEWNVWYQGEEPSKTPEGIGNWPVAPRLLEDIYTAADAV
FT                   VFGDLMITLLKNADRVRAASLAQLVNVIAPIMTEPGGPAWRQTTFHPFSVTARLAKGGT
FT                   VLEPKLSAGTVDTPRYGEVDGVNAVAVRCADGSLAVFAVNRSLEATAEFEIRLQDGAQP
FT                   ASVEAQTLHDDDLFAANTLYDQNRVTPHANGSAMYDAESGVVRVSLPPVSWTALHIK"
FT   CDS_pept        113733..114755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0088"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70235"
FT                   /db_xref="GOA:E8MWT2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT2"
FT                   /protein_id="BAJ70235.1"
FT                   /translation="MTITDVARETGVSIKTVSNVLNNTGSMRPETRQRVQDAIERLGYR
FT                   VNVSARAMKTGGTKLIGLAITDFCQPFMPYLADSIVAAARSRGYAVITDTYNSAGGLAQ
FT                   AIPETKKLAADGWIFFMGSPITDRTILHQPYPLVIVGDYDTQGLADWVTMPNVEAVRTA
FT                   VGALLDSGCRRIALIGGTAENACPDADRESRPETTSTMRTRGYVLAHEERGLQVDWRLV
FT                   RNADWVQSGGRDAVAGLLDDPDAPRPDAVMCLNDALAIGVIHELQRRGVRVPQDMQVIG
FT                   FDNVPDAEYCMPGLTTIDPHVDDYARHAVDMLIARIEGSADPFRTYVTSYDLVRRASTC
FT                   "
FT   CDS_pept        complement(114841..115752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0089"
FT                   /product="alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70236"
FT                   /db_xref="GOA:E8MWT3"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT3"
FT                   /protein_id="BAJ70236.1"
FT                   /translation="MYWGSPDIDAAYHVPDEYMFGTELLAAPITEPMDKSSRRGKADVW
FT                   LPQGDWFDFFTGRRYSASSPNGRRMTVWRPLDGIPVFAKAGGIVPMQPLSEGDSINSVD
FT                   NPQHLEIIVFPGADGDFTLMEDSGHYSRQITPATTAITYRWRKDGATSALTVSPAQGDV
FT                   HALPARRTWDFLFRGITDSDISVQADGASVDSDRRYDAETLTLQVTVADVSTRSEIRVT
FT                   IGDTTMAADPRMEDVFDILRHAEMRYLTKEQAYAAIAENGIDALATMDSLEHVSGPDME
FT                   DCSDSHMPSAVRQALTEVLLRS"
FT   CDS_pept        115822..115989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70237"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT4"
FT                   /protein_id="BAJ70237.1"
FT                   /translation="MAQAERIVHDRTEGVRMFFWTVRRPVQDFCGIARGSSSPARCLNE
FT                   SATPVRLEIA"
FT   CDS_pept        116018..117094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0091"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70238"
FT                   /db_xref="GOA:E8MWT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT5"
FT                   /protein_id="BAJ70238.1"
FT                   /translation="MGEVYSHLSEEERQVIQIEVGNGASIRGIGAMLGRSPSSISREIK
FT                   RNTWFPSNENESYRPYRPKRLKAGPWTGRYYIAGPAQRKADRRRSKPRKPYRLSHDRLW
FT                   AQVAEWLGRGWSPLLISGRLRVLWPDDALMRVCPETIYRWVYSSRPLRERWARCLPRGH
FT                   RRRRRHGGRRTSRFPIPGRVPISERPPEADGRSAFGHWEADSVIGVGCNLHTEVERRTR
FT                   FLMARVVPDKTAGESVGAQLDMFSPLPAGARVSVTHDNGTEFAHHERLRDGLGMATYFA
FT                   DPYSSWQRGSNENRNGMIRRYLPKRCEIRMDMAKEVREIVDEINNRPMRVLGYRTPAEA
FT                   FADELLELQDQQGCCTSK"
FT   CDS_pept        117510..118712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0092"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70239"
FT                   /db_xref="GOA:E8MRY8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY8"
FT                   /protein_id="BAJ70239.1"
FT                   /translation="MGETTVGHVAGEVVRALYGAGYMESTIGQYRKSIRALERYAGGPD
FT                   AVYTRGLGAGFAASTFSERTGGFSRQRWFDYGRLARLCDSYLRSGSVDLGKWRRSRLAE
FT                   PVVPGLAVVMERWEAYLAGSGLASATVGHYRRMAGLFLTWLESHGVVSLDGSDGSHVLG
FT                   FLAGLRSRWSESSMRHAASDLRPLFRWLGRDDLADAIGLAGIRRTHAIAGTLPDDEHRR
FT                   LLEACASRSVPSRDAAITLLSLTCGLRACDVIGLRIADVDWDSMSIGLVQRKTGNPLTV
FT                   PMTGPLAARLASWLLDERPATDDDRVFVRYKAPHVALRGHSSVYEAISRVMRHAGLGRR
FT                   GGSRLLRRNAATRMLEAATPLPTISAVLGHADPDSTRVYMATHRGGMLACVLPVPEGGS
FT                   S"
FT   CDS_pept        118964..119674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0093"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70240"
FT                   /db_xref="GOA:E8MWT7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT7"
FT                   /protein_id="BAJ70240.1"
FT                   /translation="MRLAHDPDAYVLSDQWKAGSPRPTPYLLTDREAALFLRAAGTLES
FT                   PSPWAWQSRAFFMLMACCGLRTREVRRLAVGHVDHKARSIDVVDSKAGRSRRLPVGDEV
FT                   AAELLECDQRSRERFGDDRPAFFVTSTGNPVSPGMPGVVFRRVWTRAGLEWPQAGKRPR
FT                   PYDFRHRFAFANIERWTRDGVDVMAMLPYLAAYMGHAGIDSTLYYVHASPDFMDGYADL
FT                   VADAERVVPETEEP"
FT   CDS_pept        119671..120732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0094"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70241"
FT                   /db_xref="GOA:E8MWT8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT8"
FT                   /protein_id="BAJ70241.1"
FT                   /translation="MSKARKTAASSGEPDFWRVARDWLHHWLPKVRGSSPKTVEAYRIG
FT                   LESYVRWLETTEGTQRSHIGFGHFDRARLGRWVEWMRTERGYSDRTIMLRMTTMRVFLD
FT                   HAGLEHPALTALGNDAAGIRVKPPARKPVDHLGEEHTKALLTAWGTGDAKSRRNRMLLI
FT                   LMYDTAARIGELAALTIADVGMDKPARVTLTGKRGKSRVVPLGERTRTHLAAYLEEFHP
FT                   GPSMRDGDRPLFHSTRNGAIQPLSVDRIDEILKTAAARARRGTCPSMPERVHCHLIRRT
FT                   RAMDLYQQGVPLPLIMQLLGHESMSTTSAFYAFATLDMMRKAVDAANPGPDPDPSKETW
FT                   LSEQRLRQLHTLK"
FT   CDS_pept        complement(120819..121868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0095"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70242"
FT                   /db_xref="GOA:E8MWT9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWT9"
FT                   /protein_id="BAJ70242.1"
FT                   /translation="MPNQILQVDENMLETKLDRLVSEKVEQLLNAMLDAEADEITGACR
FT                   RSYTLECKTNAARRALEGEPLARVARDAGCTPTSVYQWMRRYRSEGILGLMDRRNAPMP
FT                   AEPMPAAGDDVEELRRQVEVLRLENAVMRETIDVLKADDPRLDPSMLTNRERTRVVDAI
FT                   RGEFGLAACLKAVGLKRSTYYYERGAIAAGDRYAVLRARVAGLFEQGGRAWGYRTIHRM
FT                   LRLDESDPIVVSEKVVRRIMREGAMRPVYLKRPKRWSSYAGEIGEAPANLVERDFHADA
FT                   PNMLWVTDVTQFTMDGYKCWLSPVVDCFDGMVVSWTLSRSPNADMANRMLLDAVATLRD
FT                   GEHPIIHSD"
FT   CDS_pept        122203..123729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0096"
FT                   /product="sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70243"
FT                   /db_xref="GOA:E8MWU0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU0"
FT                   /protein_id="BAJ70243.1"
FT                   /translation="MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLEKGE
FT                   ESEYYPMFLTMSSVFPNGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDI
FT                   DTDSDKGWEYLMSIFDQMAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEG
FT                   VKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYLAARAVQFFLPGVPQVYYVGALAGRNDMELLRRTNNGR
FT                   DINRHYYSTAEIDENLERPVVKALNALAKFRNELSAFDGEFSYEVDGDTSITFRWTAAD
FT                   GASTAALTFEPGRGLGTDNATPVASLAWSDAAGDHETHDLLANPPIADID"
FT   CDS_pept        123947..125584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0097"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70244"
FT                   /db_xref="GOA:E8MWU1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU1"
FT                   /protein_id="BAJ70244.1"
FT                   /translation="MLEPYVRPGIDDRPDLDKVLSPEDKAAVARLAIKNRRRPPEASAD
FT                   QPEAQAVRLASAGSSAAAAAAASVDTPAPDMSSAYLDMRDPMVAVNGQRPTAGQVSRLN
FT                   WGFFAASILVGAPWVALNTIAMPNAIARTFGYDTAVAGHIAINPATGRPLPVATELAMP
FT                   LAVLVIVGVVASMFAMPLISVLSDHTRTPLGRRTPWMVGGGLLCALITLILGQNIGIIV
FT                   LCIFWVFLQFAYAMLSVPLTSAISERVPDKFRPRIERWHGIGVMLGQALGVCMGALGVM
FT                   FNSFAPFSYTAVLFAVSGIATVLILPKEPSSAEQPNQLFDRSQVLDQLRPPAHAPEFSR
FT                   VFAARTCMMAGVGLTGVFLWYLVRFWVYGKAVVLTSAPLTIPAGFLIAGMAVATLIGAA
FT                   LASWAAGPISERIEEKNIPVARVVAGACLLYAAGLALAWGLGVWSTGTARENGMLLFAL
FT                   ISGFAFGVYDSLGLELVMDSLPDPRRAGHDLGIYALANSAGLALAAIIGALLVNAFEHS
FT                   FGYYLLFPSAIVMVLLAGIVTLTTKSAE"
FT   CDS_pept        125648..126691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0098"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70245"
FT                   /db_xref="GOA:E8MWU2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU2"
FT                   /protein_id="BAJ70245.1"
FT                   /translation="MVGMRDVAKAAGVSLSTVSLVVNNTGYVSADMRAKVESAMRQLNY
FT                   IPNELARNLYRNRTNTIGVIMPTIAHPFFSTLTAHLQREFAARDLKTLLCSTADTDKGE
FT                   SEYIDMLQRHMMDGIIMAAHTEHPADYWTSIHRPIVAFDRTLGEGVPVVRSDHEQGGRL
FT                   IARQLIDSGARHVVLVGGPRSQFAEGTTFPTIRYHLTVERLLAEAGIACDYVEAGAVAD
FT                   IAAHEATACAIFEQYPDVDAIVGSDVVASVALQEASRRGIEVPADLQVIAYDGTLMAET
FT                   AGKRLTAIRQDFPAIAAALAVRMDSQIAADGGPASPSKNDSASDVDTQPTPEEVIPVAL
FT                   IPGETTR"
FT   CDS_pept        127319..128686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0099"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70246"
FT                   /db_xref="GOA:E8MWU3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU3"
FT                   /protein_id="BAJ70246.1"
FT                   /translation="MTAAVEETGLGQAAGKAATLVRDSVKTVIAASMVGTAIEFYDFYA
FT                   YGTAAANYFPHIFFSAKDNPTVALLMSLLTFAVAFIARPLGSLIFGHFGDRMGRKTTLV
FT                   VSLMTMGVGTFLIGCLPTYNQVGVGAVAILCLLRFIQGIGLGGEWSGAALVATENAPED
FT                   KRALYGSFPELGAPIGFFLSNGTYFVLESFNNQDAMLAWGWRVPFLLSAILVIVGLVVR
FT                   VHMEETPIFRMAQEQKKVVKSPLTEVFRKSWRQVLQATFLVAVTYTLFYTLATWSLAWG
FT                   TKEQGEGGGNLGFTNQEYLLMLMISICVFALFIVLSCLYADKIGRRRVLTFSSCALVVF
FT                   AVLFPFLLDGGLVGQKNFFANMVFLCVGFALMGIAFGPIGAFLPELFDANVRYSGSGIG
FT                   YNLAAIVGAAFVPTIATWLSSHWGVHSVGLYLAVMAVCCLVSVLTCKETKDVDFTK"
FT   CDS_pept        128883..129935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0100"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70247"
FT                   /db_xref="GOA:E8MWU4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU4"
FT                   /protein_id="BAJ70247.1"
FT                   /translation="MAATIWYEKDADLSVFDGKKVAILGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVEFAKEQGLEVKPVGEAVAEADVVMILLPDQYQAAVYKKDVEPNLKPGAA
FT                   LAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPDGKTW
FT                   PLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGINHLCDLGFDVLTEAGYQP
FT                   EIAYFEVFHELKMLVDLANEGGLNKARWSCSDTAQYGDYTSTVITEETKKRMQYQLKRI
FT                   QDGSFAKEFMDDQAAGAPKFKKLQEEYSHPHLETVGPKLRAMFSWNNAEAKDKDETESF
FT                   NGKIARTQVQ"
FT   CDS_pept        130364..131416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0101"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70248"
FT                   /db_xref="GOA:E8MWU5"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU5"
FT                   /protein_id="BAJ70248.1"
FT                   /translation="MAAQIWYENDGDLSVLEGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVDFAKEQGLEVKSVAEASAEADVIMILAPDQYQRTIWANDIEPNIKPGAA
FT                   VAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPRGDGW
FT                   ALTLAYAKALGALRAGAIKTTFKEETETDLFGEQNVLMGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMLVDLMNEGGLNKARWSCSDTAQYGDYVNTVINEDCRKRMEYHLQRI
FT                   QDGSFAKEFIDDQDAGAPHFKELQEKYSNERIETVGPKLRAMFSWNKDGVKDADEANSF
FT                   TGKIARAQVQ"
FT   CDS_pept        complement(131565..133379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0102"
FT                   /product="putative alpha-1,4-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70249"
FT                   /db_xref="GOA:E8MWU6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU6"
FT                   /protein_id="BAJ70249.1"
FT                   /translation="MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEKMDYL
FT                   KNLGVDAIWLSPFYPSDLADGGYDVIDYRNVDPRLGTMDDFDAMAEAAHEAGIKVIVDI
FT                   VPNHTADKHVFFQEALAAEPGSPARDRYIFRDGRGEHGELPPNDWQSFFGGPAWARVAD
FT                   GQWYLHLFDKAQPDVNWKNPDIHEEFKKTLRFWSDHGTDGFRIDVAHGLAKDLESKPLE
FT                   ELGREYSVVGVLNHDFSHPLFDRREVHDIYREWRKVFNEYNPPRFAVAEAWVVPEHQHL
FT                   YASMDELGQSFNFDFAQANWYADEFRKAIAAGLKAAAETGGSTTTWVMNNHDVPRSPSR
FT                   YGLPQVKGAPYHQLPHDWLLRNGTTYPEDRELGTRRARAAALMELGLPGAAYIYQGEEL
FT                   GLFEVADIPWDRLEDPTAFHTAQATMDKGRDGCRVPLPWTASDEPALADFSRPAPADDG
FT                   TGENHVPLCAAGQFGTGASFGFSPAVRADGVTPAADPHLPQPLWFKDYAVDVEQADPDS
FT                   MYTLYHAALAIRQESLTATRDTTAEQVDMGADVVAYRRAAVEGRTFTSVTNFGTAPVSL
FT                   PEGSVVLASGPLTPDGQLPTDTSAWVIK"
FT   CDS_pept        complement(133539..134573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0103"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70250"
FT                   /db_xref="GOA:E8MWU7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU7"
FT                   /protein_id="BAJ70250.1"
FT                   /translation="MTKANIQAVAREAGVSVSTVSRTFAKPDLVLPETRDRVMTAAEKL
FT                   DYSVSRSAAALKSGQSFRIALLASETITTWFNANIFAGLDSALRPSGYDTVPYPMRNAA
FT                   ERHDFFADLPVRRNADAVIVSSFDIEPAEVERLKHMHVPIVGINIPSTDGFDAGVSIDD
FT                   YAATRSAIEHLIALGHRHIAFVGSAPTETNMRYSAEARLQGVIDAAAAHPGIELTPLSI
FT                   QRGLGESNAALNAVLNASPSITAFCFEDDEMAAPVLYRLRQYGRRVPQDISIIGFDDST
FT                   LSAAVGLTTLHQDPFAMGVAAGHMVLDAIAGKSIEPAFVRPDTPLILRETTAPPAATAA
FT                   SAQA"
FT   CDS_pept        complement(134884..137121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0104"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70251"
FT                   /db_xref="GOA:E8MWU8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU8"
FT                   /protein_id="BAJ70251.1"
FT                   /translation="MTDAYGNDAATSTGTIADTTNNAASGAPQRAESTERLARPLIKLA
FT                   KACGLATSFIDQLGTYTEISDAALVAVLKALDVDASSDEAIARSMTQLEVENSKRLLPS
FT                   TIVATTGKPTGITLNCSSDADITASIELEDGTAFGHFALLPNLNSGKPDLTIAPDLPMG
FT                   YHTLTVTVDGREGKAAIIAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDL
FT                   KRLLADAAEKSKADFMLINPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATL
FT                   PADVRAQVDALHDSVAARNDESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKT
FT                   TAGPDLDSFATWCLCFEVWGAPWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWI
FT                   AAEQVNAAQQEALDHGMTLGLMQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQ
FT                   QGQDWGQPPFNPRYLEATGYQVYREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGARN
FT                   GAYVTYNHEAMLGVLAIEATRAGGMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVD
FT                   DSPNAGDPYRAPKDYRKQALASVTTHDLPPTAGYLNFAHVKLREELHLLSEPVEAFAAS
FT                   AMAERTAMMNRLVENGYISQTVADDVEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGE
FT                   CRSQNQPGTSREYSNWRVPLADSSGHVVHTDEVFDLPRVQSLAAVMRREKR"
FT   CDS_pept        complement(137382..137663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70252"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWU9"
FT                   /protein_id="BAJ70252.1"
FT                   /translation="MQAGFDMDLYLDWRRDGHPNGYNLLLRNTDTPMEHEGDSSYFNAD
FT                   SGASIASFLTEYLPDELSSDADVLLSLGEPAVSGGQLTLSPQSFVVFG"
FT   CDS_pept        137708..138364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70253"
FT                   /db_xref="GOA:E8MWV0"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV0"
FT                   /protein_id="BAJ70253.1"
FT                   /translation="MDSDKAAVWVTNWDTERNGSSLTTRDGTSYLLANAFMLAYDYGQP
FT                   HIFSGYYYAGVDDGAPGATRTSVPDMTCPTGGIETAGTWHCAQRWTAIRGMIGFRNAVA
FT                   GTFTATVAKGSAVALYAGATPANWAGTRKYDPSDPAWFTGETPHKGDDTAAKSADSAAS
FT                   AKSGDAKSGKATSDAIRRAATLAAILLPVIVGVTFMAIARRNGKAQSDNSGPNND"
FT   CDS_pept        complement(138376..139386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0107"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70254"
FT                   /db_xref="GOA:E8MWV1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV1"
FT                   /protein_id="BAJ70254.1"
FT                   /translation="MKASIEDVARQAGVSTATVSRAFSRPDMVSAKTRAKVMEAAQQLD
FT                   FSVSRMAGILKSGRSHRVALLVGSSKLDWFTSRIIEGLNEVLRSAGYDLVIQPIGDAGA
FT                   REEFFDELPVRGNADAVIVSSFAITPAEIRRLNTTRIPLIGINTASQGFTASVGIDDKA
FT                   GIRLIVRHLTTLGHRNLLYLYETFDATMGFSSHNRVTGFLEACSELDGVTGQTMDMQAG
FT                   DDPVDAALTALLARDDAPTALCFHQDSLAIPLFFRLRQCGMAIPTDLSVTGFDNSTFSG
FT                   EVGLTTVRQKPYDMAVAAARKALDLIEGRTLDQPHEIFPVQLLVRDSTAAPRVRG"
FT   CDS_pept        139656..140372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0108"
FT                   /product="putative ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70255"
FT                   /db_xref="GOA:E8MWV2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV2"
FT                   /protein_id="BAJ70255.1"
FT                   /translation="MKIKKSLAALTATVSIMALATGCSSSGSSGVVDTQADKGLAVMGD
FT                   TITYDPNHLVNDGQPIELGYWSWGDESTDPVISMLHEYEKIHPNVTFKISQVAWSDYWV
FT                   KTPLSLKGNKNAPVLFNVHNSEDALLRPHAVRLDGASDWRIFHQVVLPMSRNSIAALAI
FT                   FTFLWNWEDYLWPFLMITDDDKQLLSVGLKMFSGQYGTDYGGLFAATSVTIIPVVIVYL
FT                   VFQKQFIAGIATGSGK"
FT   CDS_pept        140484..143021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0109"
FT                   /product="glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70256"
FT                   /db_xref="GOA:E8MWV3"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV3"
FT                   /protein_id="BAJ70256.1"
FT                   /translation="MAQSPQLKQSSPTSPDPQDFRLDTTPAMRADNVVSGEHWRIGLIT
FT                   DSLVRFEWSDSGVFENRPTQTVLNRDFGSPVERRVTERDGRVIIDTAALTIVYDQQPFS
FT                   KEGLSVVVKGVADTQFNTWHYGDAQRGNLKGTARTLDEADGAIELDNGVISRDGWAVID
FT                   DSAANIIIETDTVNGKANPFGTWVSPRATAETDLYFFGYGHRYIEAVRDFYRLTGPTPL
FT                   LPRFAMGNWWSRYYRYTQDGYLALMDRFKREGIPFTTSVIDMDWHRVDDVDPKYGSGWT
FT                   GYSWNRELFPDPPAFLADLHRRGLRTTLNVHPRDGVRAFEDAYPEVAKRVGIDPATEEN
FT                   VEFDLTNPDFVDAYFDMHHRMEGEGVDFWWLDWQQGGVTRQKGLDPLWMLNHMHYLDSG
FT                   RGGNWPLTFSRYAGPGSHRYPVGFSGDTIVTWESLAFQPQFTATASNIGYGWWSHDIGG
FT                   HMFGYRNEELEARWYQLGAFSPINRLHSSNSPFSGKEPWNFNRDVSAAMVDALRLRHAM
FT                   MPYLYTMNYRAAEAGRPLVEPMYWQNPDTPDAYEVPDEFRFGTELVVAPIVSPDDAAAC
FT                   RGRADAWLPQGKWFDFFDGRRYVSSDAAGRRLEVWRSLDRTPVFAKAGAIVPLQDVAES
FT                   GEAINSIANPQALRVLVFPGADGSFVMREDRGTWGAPSADTAIAFTWGGADASPSAFTV
FT                   APVTGDTSAVPELRDWTVVFRGVAPVDAASGVRAWSGEAPVEATVAYDEATMSLTVSVT
FT                   GISSAASLRIEIPGGLRIADNPVESDAMDLLLHAQMLYRTKELALQAVHKLGIGAIGAL
FT                   RTMNRGPRYANDFWITDMPDAVAGALEEILLRS"
FT   CDS_pept        144004..145884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0110"
FT                   /product="chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70257"
FT                   /db_xref="GOA:E8MWV4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV4"
FT                   /protein_id="BAJ70257.1"
FT                   /translation="MARAVGIDLGTTNSCIATLEGGEPTVIVNAEGARTTPSVVAFSKS
FT                   GEILVGEVAKRQAVTNVDRTISSVKRHMGSDWTVDIDGKKWTPQEISAQILMKLKRDAE
FT                   AYLGEPVTDAVITCPAYFNDAQRQATKDAGKIAGLNVLRIINEPTAAALAYGLEKGKED
FT                   ERILVFDLGGGTFDVSLLEIGKDDDGFSTIQVQATNGDNHLGGDDWDQKIIDWLVSEVK
FT                   NKYGVDLSKDKIALQRLKEAAEQAKKELSSSTSTSISMQYLAMTPDGTPVHLDETLTRA
FT                   HFEEMTSDLLGRCRTPFNNVLHDAGISVSDIDHVVLVGGSTRMPAVKELVKELTGGKEA
FT                   NQSVNPDEVVAVGAAVQSGVIKGDRKDVLLIDVTPLSLGIETKGGIMTKLIDRNTAIPT
FT                   KRSEVFSTAEDNQPSVLIQVYQGEREFARDNKPLGTFELTGIAPAPRGVPQIEVTFDID
FT                   ANGIVHVSAKDKGTGKEQSMTITGGSGLPKDEIDRMVKEAEAHEAEDKKRKEDAETRNQ
FT                   AEAFAYSTEKLVNDNKDKLSDDIVKEVTDKVNALKEALKGDDTEKVKTAQTELMTAAQK
FT                   IGQVLYAQQGAEGAAAGADGAGASAGSASGSDDDTVEAEVVDDDDDKDNK"
FT   CDS_pept        145884..146540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0111"
FT                   /product="chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70258"
FT                   /db_xref="GOA:E8MWV5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV5"
FT                   /protein_id="BAJ70258.1"
FT                   /translation="MSEFNKDDYLNDLPDPSDAEAAAQASSGADASAESGSAQDSAAQA
FT                   PSNEGADAAPAAAEGEKTGEGQSDSADTLTPLGKAKKEAADYLEALQRERAEFINYRNR
FT                   TQKEQERFRQHGIIDVLTALLPALDDIDRIREHSEMDDSFKAVATKIDKAFEKFGVEKF
FT                   GEKGEDFDPTKHDAILHKPDADAEKETVDTVVEAGYRIGDRVIRAARVVVASPQN"
FT   CDS_pept        146772..147791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0112"
FT                   /product="chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70259"
FT                   /db_xref="GOA:E8MWV6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV6"
FT                   /protein_id="BAJ70259.1"
FT                   /translation="MAENEWLSKDFYKVLGVSKDASDDDIKKAYRKLARKYHPDVNKTK
FT                   EAEEKFKDISEAYDVLSKKEDRQKYDAIRQFGMGGARFAGGSGGFDASGFSDIFGSMFG
FT                   QGAGGNGSRIRFSTSGGGPNNINDIFSMFGGAAGQGGQPYGGYGQSPYGNAGGYGYEEA
FT                   PRPENGEDRNSKISLTLRQAVKGATVSLSVDGKKFKAHVPAGVKDGQKIKLAGKGKLGI
FT                   NGGKAGDLYLHVTVKPDATFSMRGHDIVMDLPVTVGQAVAGGKVEAKDIDGNPVTFKVP
FT                   AGSSSGAEVKLTGLGVQRSNQPGDLIGRVQIMVPAKPGLAVKHAAKEFDEKAGDYLSL"
FT   CDS_pept        147806..148393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0113"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70260"
FT                   /db_xref="GOA:E8MWV7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV7"
FT                   /protein_id="BAJ70260.1"
FT                   /translation="MARLANQMKQLYAMCATALVMGRADLDGADDVGFDIELPIFTVGQ
FT                   TAELANIHPQTLRQYDRLGLVRPQRTDGGARRYCLRDIARLTRAQRLSQDEGINLSGIA
FT                   RILVLEEENRQLRREVKRMQTGDQESVFAAGRDGNIVEIQRSNRARLWRNAIRRETREL
FT                   PGRDTAADIAAGATGDSNYTPADSKSMVLWGW"
FT   CDS_pept        148666..150018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0114"
FT                   /product="xanthine/uracil transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70261"
FT                   /db_xref="GOA:E8MWV8"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV8"
FT                   /protein_id="BAJ70261.1"
FT                   /translation="MSIRKELTAQNVLLGFQHVLVSNVWLDPVFVAGAIGLPIALSSNM
FT                   INAIFIVSGLVTLVQATRLVRLPVVQGPSAAFDALMIAAGTAGMLGAASSSILIASLVF
FT                   LLLCLTGVIERMRFLFSPMISGVVIFMVGVSLSGFTLSEFLGGAPGDKTFADPHILTVS
FT                   ILTTAIVLVLSLLGKGLLKSFSFLIALVVGTVVAAAFGMVDFSPVASKGWLGLPTFLPY
FT                   GPFTFDWKIFIPFFIAYMVAVMEALGVYQAASEIQGTSLERKQVRYGLAGEAAGSAISS
FT                   LIGGFTTTAYPQNVGLLNLTGEGKLRTRTPVIIAAVLLLILGFVPKAGALLSVIPSAVV
FT                   GGIFLPAAASLIVTGLRALRKVADDERRQTVIGMSLLLGIALPKALSGLTGGASVFFGN
FT                   NIMVGVFSAIILNALFVALPDLVAKHRAPASVDVPAADPADGTGAAAYDER"
FT   CDS_pept        150055..151176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0115"
FT                   /product="putative acyl protein synthase/acyl-CoA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70262"
FT                   /db_xref="GOA:E8MWV9"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR016671"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWV9"
FT                   /protein_id="BAJ70262.1"
FT                   /translation="MTDVMDDARRIKRGILDFIHTYGCEQAPEEAFGALARDVFIYQYT
FT                   YDLPYRRYCAAKRVTPATLKDWREIPPMPVDGFKHLDLSTIPTEQCEAVFMTSGTTHGG
FT                   KMRGRNFHPDLEVWDESMIVPFRHFIMPDRERIRIAVISPAWDMNQNSSLSRYLTKAVE
FT                   CCGSEGSGVFFDEHGLKFDEIIAFLNRAVSDGEPVMLMGVSSSYLYLFDYLHEHDLTFA
FT                   LAPDSRLFDTGGFKSTKRDITEDQMLDELEQTLGVPRHHCVNMYGMTELSSQIYDQNIL
FT                   SWYTDGTSNYLKANPAWVRTVFLDPETLTPVKDGETGVIAHYDLANWNSCIGILTEDLG
FT                   HRTPDGFLLQGRAKGAEARGCSIAVDEVISANR"
FT   CDS_pept        151163..152662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0116"
FT                   /product="putative acyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70263"
FT                   /db_xref="GOA:E8MWW0"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW0"
FT                   /protein_id="BAJ70263.1"
FT                   /translation="MPTVDESVSQAIDVFHLPSGVDVSDYEIYEVATSDGVKRLRYPRL
FT                   DGSKVTSLAKQLVDVRNRTLAAMSVNDILDIVADAAQLWADPDFELRRQAELLIPAITG
FT                   YEPDMVRIELKRYMRQFRRRELLRFLDSEIGQPSMLDEFRPNKAGGYSKYVGPALTYQV
FT                   FSSNVPGIPVWSMAMTLLVKGAILGKSSFSEPVMPAFFARSIAMVNSDLADAIAVVPWK
FT                   GGSQQLEDSAIDAADAVIVYGSSQTTKLIAGKVAGSKPCLGYGAKVGLAFIGREALRPD
FT                   TYADTVHRVAVDIATYDQQSCLAPQTVFVETDGALTPREVAQLLGGELENQQRKYPRSV
FT                   LSDAENVAIQRARTDAEMRALMGGKAAVFASGHSTAWSVLYRELDGSGADEDVASLMSP
FT                   LNRTVNVVAVPDLLDAARRLTSCRGWLQSCGVAVDSTRLFGLADTLAEVGVNRICPLGE
FT                   MDRAKSGWHHDGGFNLIDLLRAVDVERGSDAYSDSFDMDME"
FT   CDS_pept        152749..153519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0117"
FT                   /product="3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70264"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW1"
FT                   /protein_id="BAJ70264.1"
FT                   /translation="MVNLDGRTAIITGSGKGIGAAVAKCLASHGAAVVINYVHDAASAQ
FT                   RTVEDIHSLGGLAIAVQADVCDESQSSKLVGTAVDSFGGVDILVNNAFGRFSFDPRRRS
FT                   TFAGGDWDEFSAQIEGCLHGAYLMCSHVVPLMRAQTSGRIINISSNLVDSPIVPYHSYI
FT                   TAKGGLVGMTRSLAQELGGFGITVNAIAAGLTAGTASSAATTEDVRERIIAMTPLGRLA
FT                   RPDDIAGGVALLASDMAGFITGQCLHVDGGLTMR"
FT   CDS_pept        153632..154303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70265"
FT                   /db_xref="GOA:E8MWW2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW2"
FT                   /protein_id="BAJ70265.1"
FT                   /translation="MLLKAVFWDLDGTLIDSEPLWHDGEIEIAHNNGGEWNEDLGWECS
FT                   GTPVPHVAEVMIAHGCTLSVPEIDKQLKDYVFKAEVERLPWIPGVQDVLHSLKEADIPS
FT                   MLVTTSPRRMAENIMKQADGLLAGYVCGDDPYEHKPSPAPYLAAAERLGIAPEDMVKCV
FT                   VMEDSSSGLRSGAASGATLIAQTGWIRTDTSGLGQFASIDSYEGIDAAALDAFVRQRLG
FT                   E"
FT   CDS_pept        154454..155179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70266"
FT                   /db_xref="GOA:E8MWW3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW3"
FT                   /protein_id="BAJ70266.1"
FT                   /translation="MGFVNFIIELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGVFAAPDAATGKAALPLFWLLPVVWCAPIIGDQCNYFIGHFFGRRI
FT                   IQSGKVKALTPERLAKTEGMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPF
FT                   SVLGGLCWSTLFTLLGYFFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPA
FT                   KVTDAQLDVMEDGIKNLDK"
FT   CDS_pept        156149..156352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70267"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW4"
FT                   /protein_id="BAJ70267.1"
FT                   /translation="MGIGEAQDYLTATVLGPVKPSVNLCGDVLEGLGIRSVTKGSRKAV
FT                   SLLADLVEQAIRPVSGASCKDR"
FT   CDS_pept        156359..157426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0121"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70268"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW5"
FT                   /protein_id="BAJ70268.1"
FT                   /translation="MAAVITRADEPGAVPRTVFFGLLNDVASDPQVTDLAVTCDGRVWA
FT                   DRGNGMRETVLRVPFRSPQVVREYAVQLCAQLGRRLDDACPIADAASPDGIRVHAVIAP
FT                   LVPQGAAISIRFPDRTMASLRHLSQLGVFPAAWLPMFVGLVRRHATVLITGGTGVGKTT
FT                   LLKALLAQCDVNERIVTVEEVRELGELGRGDHVSLVTREANVEGVGAISLTDLVKATLR
FT                   MRPDRVVLGECRGAEIVDLLRAFNSGHHGGMTTVHADGVNRVPSRLISLGLLAGVSPQA
FT                   LAMLAAGAFDAVVHLERVNGQRRITQIGELRVAHGELAGTPLAVWNGCHPPRYAAEWGH
FT                   FIERWGIVPGPSGGG"
FT   CDS_pept        157390..158082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70269"
FT                   /db_xref="GOA:E8MWW6"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW6"
FT                   /protein_id="BAJ70269.1"
FT                   /translation="MGHRSRAEWWWVMMWCAVLVALAVLIWPGNKSGRLYRLAYRGRAV
FT                   DSAAINEPRYAGSPRVGVAQVITSAIARLRGGGTLVEAFEEQSSRRFATQRITVERLIT
FT                   VFEQRRLPDESPAQVLEAARGVTAAAVLSDELGCQAVPCLEAVLTAYRQMRLMQNLRSQ
FT                   ACAVPKATVGLLSALPAVTVALGELLGARPLAFLLGSPRGVVCLVLGGCCYAAGLAWMR
FT                   ALLKGSGL"
FT   CDS_pept        158385..158681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70270"
FT                   /db_xref="GOA:E8MWW7"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW7"
FT                   /protein_id="BAJ70270.1"
FT                   /translation="MAVQHEGAPADSSSGKRTSRTQRDLGLLQSALESSWTHGDMPGVR
FT                   LESAIEQLDRDERAAIERNAAKLSVKLLMPTGLCFLPAFVLVGVIPAIASFMM"
FT   CDS_pept        158966..159253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70271"
FT                   /db_xref="GOA:E8MWW8"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW8"
FT                   /protein_id="BAJ70271.1"
FT                   /translation="MNTPIPVIVDGQAGIFAHSKARVATLNAKAKERLCLMDARIRTLM
FT                   AEPEEGAATAEYAVVLVAATGFAAVLVAILKSDAIKTLLTNIIKQALKVG"
FT   CDS_pept        159259..159636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70272"
FT                   /db_xref="GOA:E8MWW9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWW9"
FT                   /protein_id="BAJ70272.1"
FT                   /translation="MKTMTCRWRLARLPPDLCTGSATAEFAIVLPSVIAIAGLILAIGR
FT                   VVIVSMDCQSAAAAAAREFVVTGDESSSRSIAADVAGGEPRVIIAHDGQSTSVMVECSV
FT                   LPGPLDVTPTRVTGNATAISQ"
FT   CDS_pept        159678..160064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70273"
FT                   /db_xref="GOA:E8MWX0"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX0"
FT                   /protein_id="BAJ70273.1"
FT                   /translation="MQGMRYEEGSGTMAGAMLVMVVGIALAVAASVGNLMICQNRARSL
FT                   ADLIAFDAAYALWHADIGDPCALAANMAEANGVVLGSCSVRDEDVLVTIKVETMVLVAS
FT                   SVERMARAGPVSCTEGDNYHNNGP"
FT   CDS_pept        160113..161243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70274"
FT                   /db_xref="GOA:E8MWX1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX1"
FT                   /protein_id="BAJ70274.1"
FT                   /translation="MSESERNERRRVVAMVGNPTSDKGRGAKVDAQVLGLLEEAGRAHN
FT                   FDVIDITGTSFDDSLNQARERAHEYDYLVVVGGDGMIALGANAVGCSGKPLGIVATGSG
FT                   NDFARGLKLPVNRIETAVEGIVGAIVRGSHIDVDMGRVTSLDGGYAVDPSTGEEYEYQE
FT                   SKSAEHPIDRYYAGMLSCGLDASINDRANHSHLPTGTMRYFAAVLVELTHMKRYGYHIK
FT                   ATLADGTTDERDIITPLLTIANSRHIGGGIEVSPYSCFSDGLLDLVWMDHVPNFGECAV
FT                   AISNAYNGKLLASKVFGWKRIREIEVTRAAEGDEPPVLMADGEYIGHLPFRVVAEDCAL
FT                   RVLVPPAVAAREVDSRQEVLDVIARDGRDPVTGQFA"
FT   CDS_pept        complement(161441..162040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0128"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70275"
FT                   /db_xref="GOA:E8MWX2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX2"
FT                   /protein_id="BAJ70275.1"
FT                   /translation="MSDILDEKRPTRGDARRDAIVQAARKVCLEKGFSKITVSDIASEV
FT                   GMTRSLFYHYFEDKEAVADAVLDNVIDEILTTLKQWNQARETGNVNKALDDIVHVLRSL
FT                   IADESPFSNRMIQDGNAELYIKFIDRAADRIADYIAQTTVRDFEQMHGLPITNVHETFF
FT                   TLIVGLISLIRSHPNISDRTIKEVMAQTLHIESYVV"
FT   CDS_pept        162236..165148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0129"
FT                   /product="DNA polymerase III gamma and tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70276"
FT                   /db_xref="GOA:E8MWX3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX3"
FT                   /protein_id="BAJ70276.1"
FT                   /translation="MALALYRRYRPDTFEGVIGQDQVTVPLMRALDEGKLTHAYLFSGP
FT                   RGCGKTSSARILARCVNCAKGPTSHPCGECESCKDLATGGPGSIDVVEIDAASHNGVDD
FT                   ARELRERAGFAPARDRYKIFILDEAHMVTQQGFNALLKIVEEPPEHVMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPQEVMGPYLETICDKEGIKPEPGVLKLAMRAGGGSMRDTLSVL
FT                   DQLMVGSVEGVITHDAAVALLGFTPEALIGEAVDAVIDHNGEALYGVIQKVVVGGFDPR
FT                   RFVEDLLARVRDLLVLALAGDRAESVLSDTAEAEDMDDLHRQAKALGLGALTAMADIIN
FT                   TTLGAMTGAISPRMRLELLAARLLAGSESGFATAAPAPASSGMPPAAASSTSTTSAASG
FT                   TGASGFAGASRGGFAGASHGGFSGAARNQQAAAPQSTASHESVGGNGPVNGPVSDRPAG
FT                   SLSVQPAVATAAAGAAPAANAGWGAPAASPAVPAQPVTSPAASDNRSIDEKWDAAVAAL
FT                   PETIREYVSRDKVPTVKFGPNRKGLPCLSMTFDKSLSQHAFALAVDNSGKKAAAVVMDA
FT                   VRNEFGANAVIAPSAVAANGERVESVKRMSPEQLAKVKQQIAMAKAGLAASSLGASLGI
FT                   HMGSETKAPKPTATGQAEDADDSHRAGQSSASTAAKNWSDDDPWAKPAVSNASPQSADG
FT                   FAPNEPAATPAPEEHHKKHVAVPDISDGVDPWAAPAAPVAPTASVASAGPTGQSTGQPA
FT                   TASSVTAVAGASDDPWNQTQSQAAVSPASQPAEADPWNQPYQQSPHDDPWNQPQGNHAQ
FT                   AAPQPGDDPWNQPQSQTPASSVPQTVSGNMSGDDPWNQPQSVPQPAAGDDPWNQPQAVP
FT                   QSAPQATPHGDPWNQPQPAQPTPNADPWNSQPQPQPKPQPQVAAEDDEYSMSDQSLGEA
FT                   TAMNLDDLKKLFEVKKVEQFAADDPKNPKNIQPAKKHSDE"
FT   CDS_pept        165174..165776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0130"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70277"
FT                   /db_xref="GOA:E8MWX4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX4"
FT                   /protein_id="BAJ70277.1"
FT                   /translation="MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDL
FT                   AEAIEEVKAKIRFCDICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYHG
FT                   LYHVLGGAINPMANVGPADLRIPGLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLR
FT                   PVGVKVTRLASGLPVGSDLEYADEITLGRALAGRREA"
FT   CDS_pept        complement(165773..166906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0131"
FT                   /product="putative sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70278"
FT                   /db_xref="GOA:E8MWX5"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX5"
FT                   /protein_id="BAJ70278.1"
FT                   /translation="MALLHRRSTSKRASQKMWENNAAMPDDASANDNVSSARPEPAAFV
FT                   PTPFDEVIDISDLVAERRRLQRNLWAMRIITIVLLIAAIAVACFPLALQFESDRNLAAT
FT                   TATTAKEVAGWPYPQAEDKLTAARAYNKKLAESGQPILGEAVDPFAAAQGGSQASGEDS
FT                   ASKKDKEYQSLLNTGNGVMGTIKVPKQSINLPFYHGTSEEALASGAGHLYGTSLPVGGK
FT                   STHSVITGHRGLVEALMFTRLDEVKEGDFFYIEVMGETLGYKVDRISVILPDDTSKLKI
FT                   VPGEDRVTLMTCTPYGVNTHRLLISGHRVAIPMPAPEPNDVLDARNIALGVGLGILAAG
FT                   LFIIWLARRHKAARIIRHGAFWPWMRRKGESANDTLA"
FT   CDS_pept        167796..169079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70279"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX6"
FT                   /protein_id="BAJ70279.1"
FT                   /translation="MAGESSEIQRGEYLPRVADGLLTQALQSSGAVQIKGPKWCGKTAT
FT                   AERQSASQVFMQDPDRSATLLALADTKPSLILRGEEPRLIDEWQMAPQLWDAVRFAIDR
FT                   GRGRGRFILTGSATPQQEPAHSGVGRIARLTMRTMSLFESQESTGVVSLGELFDGNHDV
FT                   SGFSDFDIENTAFALCRGGWPEAVVESRVNVALRMAADYVEELLDSDINRMDGIKRNKT
FT                   WMRLIMRSYARNISSQASQSTIAADMQGEPPSEGTLSDYLDALSRACVTEDLPAWNPRL
FT                   RSKTAVRTSPTRHFSDPSIACAVLHATPEKLLNDFETFGLLFESMCIRDLRVYADALGG
FT                   DVFHYRDKTGLESDAVIGLHDGRWALIEVKLGEKQVDIAAAHLKKLADRIDQDHEGRPS
FT                   FLMVLTATAAAYRRDDGVLVVPLATLAP"
FT   CDS_pept        169440..170204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0133"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70280"
FT                   /db_xref="GOA:E8MWX7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX7"
FT                   /protein_id="BAJ70280.1"
FT                   /translation="MALIVQKYGGSSVADTESIKRVAKRVVETEKKGNKVAVVVSAMGD
FT                   TTDDLIDQALSIDSNPPEREMDMLMTAGERISMSLLAMAIHAEGSRAHSFTGQQAGFFT
FT                   DARYGAAHIKAVRPDRVKNALSLGDIAIVAGFQGINAKGDATTLGRGGSDTSAVALAVA
FT                   LGADICEIYTDVDGIFTADPRIVPSARRIPSIDYESILEMASCGSKVLALRCVEYAQRF
FT                   NMPLHVRSSFSRRPGTLVVPDGIDPRTLPNLD"
FT   CDS_pept        170260..170826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0134"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70281"
FT                   /db_xref="GOA:E8MWX8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX8"
FT                   /protein_id="BAJ70281.1"
FT                   /translation="MTEEEAKSMGDLFPDLGPEAPVISGIAHDRSEALATVRGVPNEPG
FT                   MAAKVFTELATAGVNVDMIVQAGASVGTADISFTVPESAVKQVQNTLLDKQEVLGYHSF
FT                   DVDTNVGKVAVVGVGMKTHAGLAAKFFQALSDEGINVLMISTSEIRIAALVPLDQLNDA
FT                   VKALHTAYGLDADQIEAVVYGGTGR"
FT   CDS_pept        complement(170908..172002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0135"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70282"
FT                   /db_xref="GOA:E8MWX9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWX9"
FT                   /protein_id="BAJ70282.1"
FT                   /translation="MSEKLKVGILGATGMVGQRFITLLENHPWFEVVTLAASAHSAGKT
FT                   YAEAVGDRWKMETPMPEYVKNMVVVDGDDAESVASGVDFMFSAVNMPKDQIRAIEERYA
FT                   KTETPVVSNNSAHRWTPDVPMVVPEINPEHFEVIEHQRKRLGTTRGFIAVKPNCSIQAY
FT                   TPALAAWKEFEPREVVVSTYQAISGAGKTFKDWPEMVGNIIPFISGEEAKSEKEPLKVF
FT                   GHVDAAKGEIVPFDGDLKITSQCIRVPVLNGHTATVFLNFGKKATKEELIDRLVNYTSK
FT                   ASELELPHAPKHFIQYLTEDDRPQVKLDVDYEGGMGVSIGRLREDSIFDWKFVGLAHNT
FT                   LRGAAGGALECAEMLKALGYITKK"
FT   CDS_pept        172170..172790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70283"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY0"
FT                   /protein_id="BAJ70283.1"
FT                   /translation="MSIASVEAQKQLDRIVALGYPDVADISAAAFRSLARPLIGALEHS
FT                   DLGSNILLVPTRELVSPESLIARTSINRMAGFTTMPPRDIASFLPQDGFMPPEGPFYLV
FT                   VNPHTGTCYINREPDVARKLIDSDERLPLTLEEGLAIATQHPEWLLEKNGFNLLGSRSA
FT                   DGRVPSIWMSQNAPRLGAVWPNSRHTWLGNAYCTARRGVSLFK"
FT   CDS_pept        complement(172793..174373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0137"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70284"
FT                   /db_xref="GOA:E8MWY1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY1"
FT                   /protein_id="BAJ70284.1"
FT                   /translation="MTSLRFREDGSFRVLQMADVQDGPDVLPDTIRLIREAIREADPDL
FT                   VVFTGDQIRGYDPAYIDTFLRRRGEEPGARVRAVTEIEAKIRGIKRHPVIRKTSDRVAD
FT                   RLTEAGKPVPAALLDPDTVTNAVAAAGADSTDVITTSEVGDSVETSPTPETVSTLVYST
FT                   QSGKASPAHETPATLDELMIETREKVRRTFSGFLGPVVEAGVPFAATYGNHDFQCGILA
FT                   DEQDDIYREYPGCLNPDDSLEPGTFALPVESSDGSGRVAMSVMMVNSGDYAGKPEENDA
FT                   QYPAYVVNPRGLDLADADGYGTPTPKAIEWLGSVQTELGERNGDGKPVPAIAFQHIPPQ
FT                   EFYDCLKEVPAWTPNAVEGARTHAGRCYVLNHEVCRPGSRLGEAIGCADENVGEVDALR
FT                   EAGGYFALFCGHDHKNSFVGHVHDIDLGYAPTCGFECYGPKSRYRGIRLFEFHESNPAG
FT                   YVTRMLTWGNLVGRYSSNELRVWFEDHCVTGAVSARNELRRPQVFAVVAGAMSLGFIAI
FT                   IRSLIKAAR"
FT   CDS_pept        175062..176978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0138"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70285"
FT                   /db_xref="GOA:E8MWY2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY2"
FT                   /protein_id="BAJ70285.1"
FT                   /translation="MGQDQSSVFDLAAVAAASNGGNNDPLLPPARFIGDPQKPSRMPYN
FT                   KYAAYDKQIPFDYPERTWPGKRLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVS
FT                   MGFKEIEVGFPSASETDFDFIRMLIERELIPDDVTIVVLTQCREHLIRRTYEALKGAKR
FT                   AIVHFYNSVSVLQREVVFRKNKEEIKKLATDAAELCKDLENEAKGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIGVIKPTPEHPMIINLPATVEMTTPNVFADEVEYVSTHLDDRDSVV
FT                   LSLHPHNDEGMGVAATELAVLAGADRVEGCLLGNGERTGNVDLVTLGLNWLTQGIDPQL
FT                   DLSNVPEIRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEARQVAAERAGA
FT                   DLDSFVWLVPYLPIDPKDIGRTYEAIIRVNSQSGKGGMAYLLKTNHNLDLPKRLQIEFD
FT                   KIVQNYADTTKKEVKDEDIWRLFKDEYLPVEQSGMTAAGVVVGDTHDASLVPWGRLKLL
FT                   KVAVSSGEDGSDTVLKARLLDRGVNVGVDAPVEREVSGIGNGPIAAFLNAISNFGVDAS
FT                   IMDYVEHTMSVGTDAMAASYVECQVGEADDAQIVWGVGIDSSITTSALKSIISAINRFQ
FT                   RKR"
FT   CDS_pept        complement(177050..179233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0139"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70286"
FT                   /db_xref="GOA:E8MWY3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY3"
FT                   /protein_id="BAJ70286.1"
FT                   /translation="MLGIFFSLIGLGLLAGIAVFAYLYTTTEVPQPEKFALAEKTTVYY
FT                   ADGTTAIGSYAEQNREIISCEGLPDYIGNAIVASENRTFYTDKGLDLKGIARAFINNVT
FT                   KGTRQGGSTITQQYAERYYMGETTSYVGKAREAIMAIKIAQTESKDEVLCNYMNTIYLG
FT                   RNSYGIQAAAKAYFNKDAKDLTLSEAAMIAGIIPSPSTWDPADNADMAKSRFKRVLNIM
FT                   QEDGYITAKQHTDAKFPQTAAVAQQNEHAGPNGYLLDMVRRELVQSKAFTKEDLDTGGY
FT                   KIITTIDKSKQDLMQSIGDTRLDDMPESLQIGGIALDPKTGEVLSVYAGSDYLSKQLNN
FT                   ADQAVFEPGSTMKPFALLGAAQSGVSFDTLFNGNSHQHFTGLDQEVNNALENNWGNINL
FT                   YQATANSVNTVFMNVNEHLTPKRTAAIAHEAGIQGDIDENSMYNVLGINALTVWDLAQG
FT                   HSTIANNGVKNTLHMVSKVLDSNNKDMYNAPSNGTKVFDANDCALVQKAMQGTTTYGTA
FT                   AGTSSMLGRPVAGKSGTANDEMASSFVGYTPSMMNVWAIWNPDDKGNPQVVPAFSGYGV
FT                   SSTGYPAHLFQEFMAQALQGTEAEQFPTAKDNGKIGGSDDTWGLGKGQSSGLSNNTNKQ
FT                   STEDAQKQAEQDAQQKAAEEEAKKQQQAQEFAQQCLANPSYSTECPNYPGTTTGGDGNA
FT                   GNNTGGDNGNNTGNDNGNSGGTGGNTGTNGVTQ"
FT   CDS_pept        179832..180983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0140"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70287"
FT                   /db_xref="GOA:E8MWY4"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY4"
FT                   /protein_id="BAJ70287.1"
FT                   /translation="MNDAQTPRIRDPHAAVNLVGSGAAQPDSSSNVVDPLAALGPVSGS
FT                   DASASTSGSLRDFRPLDMDDADGASDIDRGLARLDPLTVRPRISSRVLCVVFGLLLIAI
FT                   GFGVWWGCVFTENGQSYDELVWKNLHNDVPSWATGVMNAVAQSWLVIAVSCTIAAIGII
FT                   TALIRRRWWLAGQIAVFAVVCLAVTRIKGLLPRPFIINTESPAANSAPSGHTMLAAACA
FT                   VILLLTVPRAVRALAGVIGVVWAVTVGVSVIYGQWHRPSDVAMSILLVAGLALLALAVT
FT                   RKSGMDEPGRRVSSVSVQIVGSVLITGGLLLLAYSGYVIWQVVPGLNVSASWAVQGANV
FT                   SAVVGIAGVAMLAFGLLLALRQITAAPLSRLGLIGAPPAPPKR"
FT   CDS_pept        181107..184193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0141"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70288"
FT                   /db_xref="GOA:E8MWY5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY5"
FT                   /protein_id="BAJ70288.1"
FT                   /translation="MATKLVIVESPTKAHKIGDYLGKGYTVMASVGHIRDLAQPSQVPA
FT                   ADKAKFGKFGVDVNDGFKPYYIVDGDKKRTVSELKSALKNADELYLATDEDREGEAIAW
FT                   HLVQTLKPEVPVKRMVFHEITKNAINASLNNTRDVDGNMVDAQETRRILDRLYGYELSP
FT                   VLWRKVGPGLSAGRVQSVATRLIVERERERMAFKRAPYWDIVATLSAPDALGERAEFSA
FT                   RMIALGGKRLAGSKDFGADGQLTPDGFAANVRQLDEAGATAVASALKTADFTVMSMETK
FT                   PYRRRPQPPFTTSTLQQTAGNRLGMGARAVMRAAQSLYENGYITYMRTDSVTLSQEGIT
FT                   AARNAVSYHFGDKFLSAEPKQYATKTAGAQEAHECIRPAGSRFHDPDELASKLPGDQLR
FT                   LYTLIWQRTLACQMADATGSTATVRLSAPAGPTEGEAVFQASGTVIEFPGFMKATGEGR
FT                   KPKAAAPGAGAGSDQAAAAGKTDAKAVRGDASESNTSLPPMSVGQQVEASDIEPDGHET
FT                   QPPARYTEATLVKTLEAKEIGRPSTYASIISTIMDRGYVYERGRALIPSWLAFSVTKLL
FT                   ETNFPKLVDYQFTAEMENGLDRIAHGEESGRDWLTHFYFGSGEGAARNADEAHEGLQQQ
FT                   VAQLGEIDARAINTIDIGDGLHVRVGRYGPYLEDMEHLDAEGNPKRASLPDTIAPDELT
FT                   VAVARDLIDNHSGGPRELGVDPVSGGTVEVRNGRFGPYVALVPPAEASAGAAGDTAGAS
FT                   AAKKGSKKAAAAAASRPKMASLFKTMSPESLSLEDALKLLSLPREVGTYEETNAETGEV
FT                   SECTVAANNGRYGPYLTKTGADGKSETRSLASEDEIFTVDIDKAKELFSQPKYGRGRGR
FT                   GAAKPPLRDLGKDPNTGKNVTIKDGRFGAYITDGETNRTVPRQYTPESITPDDAFRLLA
FT                   EKRAAGPSTRGRRGAGRAGGAKAVAGKGKKGGTSAAVSAQEAKRAERRAEVKKLANKGW
FT                   SNQRIAEKLGSTPATVKKDVDWLTANEGYERPAVIPKRG"
FT   CDS_pept        184471..185091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0142"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70289"
FT                   /db_xref="GOA:E8MWY6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY6"
FT                   /protein_id="BAJ70289.1"
FT                   /translation="MNGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTAL
FT                   GKAIRQLLLHGVDGGAVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSS
FT                   LAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDPALSHHRLEHAEDRMESAGDDF
FT                   QSRTRQAFLDLAAAEPNRFRVIDASQSIEAVWAAIESDIKELA"
FT   CDS_pept        185088..186239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0143"
FT                   /product="DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70290"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY7"
FT                   /protein_id="BAJ70290.1"
FT                   /translation="MSVWDSLVGQKPVIDMLSRIAQGDPSQITQSWLICGPPGSGRSNM
FT                   ARAFAAALESPDHGMSAEPTRVTQQVLAGTHPDVTVLATNKVTIGIDQVREIITASEQM
FT                   PATAPWRIIIIEDVDRMLERTTNVLLKEIEEPAEHCIWLLCAPSAQDVLPTIRSRTRIV
FT                   NLAVPSTQAVAGFLTSTTNVEPKVAQRAARLAEGHIGIAKLYATDERVMSDRDELVVGV
FT                   LNLARASDAVLLAGNLIDNAKAQAEADANRITAGQEAEFRRINGLAPSDRIPPKLRGAF
FT                   NQIAKKDDVKRLVTRRTRDVLDRALNSIASIYRDVAVLQNNAEDSVGLINLENRSSITE
FT                   LSVRLNRAGAVTRLDEVAHARKRLAGNGNPLLVFESLFCALIS"
FT   CDS_pept        186358..186912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70291"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY8"
FT                   /protein_id="BAJ70291.1"
FT                   /translation="MKISADFTVIPDDFAKAAAPEYFNGGVPVVSFPFYIDDVDPEARY
FT                   LHWEFVDPDSIPVCGFEWIHWSVANLPIDALMYDFNDSHALAIPPDFSRQLPAMIPETV
FT                   QGCNSSASKFLGRSTDPAVIMRYNGPQPPDKDHEYYLQVWATKKPLSGLNQGFWLNELL
FT                   HALRNSGEVPDTDGIFLTGKA"
FT   CDS_pept        187055..188656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0145"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70292"
FT                   /db_xref="GOA:E8MWY9"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWY9"
FT                   /protein_id="BAJ70292.1"
FT                   /translation="MACTTILVGKDASYDGSTIIARNEDSANGEFNPKRFIVVKPEEQP
FT                   REYKSVISHLTITLPDDPLQYTAVPNADLKEGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPFVEYTPAKGDEPEVPGGIGEEDFLTIVLPYVKTAREGVQRLGALLEEFGTYEMNG
FT                   VAFSDSNEIWWLETVGGHHWIAKRVPDEAYVTMPNQLGIDEFDLEDALGDQEAHMCSED
FT                   LAEFIETNHLDLAVENTTPFNPRDAFGSHSDSDHVYNTPRAWYMQRFLNPYDEVWDGPD
FT                   ADHKPTSDDIPWARQPERKVTIEDIKYVLSSHYQGTPFDPYGQLGDERTRHMYRTIGIN
FT                   RQSQLAVMQIRPYRPQASRAIQWMAYGSNPFNTLVPFFPNVDTTPAYLEDTTTRVTSEN
FT                   FYWANRIIAALCDGAFRSTSNAVERYQEKTGAMGHRLVAATDEQIARLGLTAAEEAAQS
FT                   AAEEEFEADNVDGDVQPMTPDETIAALRNPEVREILAAANQTMADQLKEETEKLLDSVL
FT                   YTRSMEMKNGFHMSDF"
FT   CDS_pept        188816..190333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0146"
FT                   /product="formate-tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70293"
FT                   /db_xref="GOA:E8MWZ0"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ0"
FT                   /protein_id="BAJ70293.1"
FT                   /translation="MTTIEDFTSQYGLVQKIDAFGYMKYLAENPDAPRKHGKVVLVTAD
FT                   TPLKASRGEGKTTTTIALIDALNKRGIDATAVLRQPSMGITAAGSKGGASGGGKASLTH
FT                   PELIDWGLCGEMGAIEAAQNLLVSFAEKAIDDGKLDTILVPRVSEVPSRSLRSTAVDYG
FT                   KGNVPEKVVLTPTCELMQIVVLSRSMDEISERVSKMIAGTKDGKAVTFGEFVDLWRITG
FT                   ILADAVKPAKTETVNGSPVYVHGGPFANVSIGIPTLVSVEMACALHDVVIVEAGYGTDA
FT                   GAQKWLDIACREYGAQWPSAAIVVTRASTWRDDPELAWRYPFHVQRLENLDIPTFPLIN
FT                   LWEGEDDQVPSLKATADELGFRTPIIGNLFRDGGEALAPQLDGFVDALQNGSMPAEPHS
FT                   HKGMALTENAKWVAENAYGVPAERVIYKPGFTESVSEAMELCQSAGISLDDLAFVAVKS
FT                   PATMTDNDRAPEEERTVTLKKVEVHAGAGLVHVNLTTSLTTPMPKIV"
FT   CDS_pept        complement(190730..191077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70294"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ1"
FT                   /protein_id="BAJ70294.1"
FT                   /translation="MPVIHTHVSVSTTPEQREALKAAYGKAITAVPGKSEGWLMCPFED
FT                   NMPIYFGGSDDQPAAYVEVNVFGRSVPGSAWEKLTESIMAALNSTLGIPEDRTYIRYTA
FT                   TTDWGWNGGNF"
FT   CDS_pept        191278..191814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0148"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70295"
FT                   /db_xref="GOA:E8MWZ2"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ2"
FT                   /protein_id="BAJ70295.1"
FT                   /translation="MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNY
FT                   LASMKFVFKHRDDMARWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLL
FT                   RTNIGKLVATAVVMIWNFLIRKWLLDDTHTNAMNRLKSAENRLNAEELEAKWQNSFSHK
FT                   LGIWSLEHTPKGWPK"
FT   CDS_pept        complement(191862..193313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0149"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70296"
FT                   /db_xref="GOA:E8MWZ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ3"
FT                   /protein_id="BAJ70296.1"
FT                   /translation="MSNNSSNSNSGAILAGIKEVGHKVFGGYAELLRIPHTARYSIGSV
FT                   IACMPFPMVGMTITISVQHYYGNYSLAGMLTAIQAIALAVATPLLGKLTDKFGQRQVSI
FT                   PTILVWIVAAVALTTSITNRAPEWVLYCLTPFLAAIPPWGAMSRARWTKILKGDQERTN
FT                   RALSLCGVLDECMWVIGNPLASTLAVISGLLAFSFTGMCVVVGALMFLTELTTEPPSQT
FT                   QLARAEGISRKEYREREAARAEALKVETAAEETRRRLEREGVTDEATINAAIEQAVADA
FT                   RSGKKASIWGPGLIAVCVTWFGLGAFQSATGISIIAFATESNMKQYTGFVFACFSISSL
FT                   MGALVYGAKNWSIALWKRFYFCLAVVNIGISTFLFAKHLWVIMIIYLIIGVCQAPTWIN
FT                   GNQLMLHLVPPSRLTEGMAWMGAMNSIGSSAGSAIAGQFIDRMGSHGGFMVVTTLALVS
FT                   LVIALIGFKQIKGSTEQPTLTEVSV"
FT   CDS_pept        193555..194214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70297"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ4"
FT                   /protein_id="BAJ70297.1"
FT                   /translation="MSATTIHFVRHGKVYNPDHLLYERLPDFHLSDLGRRMAQATATYL
FT                   AKNPQTNTIAAVYSSPLDRTRETAGAILDALNPVREARGEAPLTLTTDERVIEAGNEFR
FT                   GKRIGHGEGALWKNGNWKLVTNLYKPSWGESYQHIAARMDDFAREKVAQHPGEQIVVVS
FT                   HESPIFSYRHYLETGHPEHWMFLRHTALASVTSVTYDNETGRVMSITYVDPAANVK"
FT   CDS_pept        194430..195383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70298"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ5"
FT                   /protein_id="BAJ70298.1"
FT                   /translation="MTIELNREAIAQVTALPAVTEAAEAGSALISLWPLTEAMQMDNDA
FT                   KYAENLQVRVTRAFARILTGQDVTMPDAEFVYEGADEIPGRPQSIVDTLLAANDAYDTM
FT                   AGYSESGDVQLIFDAAEALGVDWDSHVEAAVRETVVSVEAQVEADAEAGGRLAASGEPA
FT                   DVAVRFATALAVCDALLNVVSGHAETVGLVGPAVADAADVADEARATAIVTLPILLYVN
FT                   ELREQCSIPRICLTDQQILDLIDTRANAGDTLTATAEYIAPLAGAEWTKHRDDVLWNPD
FT                   EAKKKAKEEDEKRNKEALAAKFAHIKDDPGKETVEL"
FT   CDS_pept        195462..196379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70299"
FT                   /db_xref="GOA:E8MWZ6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ6"
FT                   /protein_id="BAJ70299.1"
FT                   /translation="MVKNIAYATEEETLMGNGVNLRTLTNDGGSAVISDYGAHLLRWAP
FT                   AGQPDVIWTPRTWHFEAGQPVGGGVPVCFPWFGPGFVHGGQTAKRPIHGFARLRQWALD
FT                   EGAFTGARVRYVLDSERLTTGEVPWIEDEPNVRFHAAYEVCASDTLTMTLTVTNTGGEP
FT                   MSYEAALHSYLHVGDVLGARLVGLRGATYLDATEAGFPPKLQEQPSVMFGDQPVDRVYY
FT                   SDAALELQDHVLGRVIRIGKTGSPQTVVWNPGEQGGNAIAHAKTGEWRGFVAVEAAACR
FT                   DRIVALSPGESYMLSQSIAVMPLG"
FT   CDS_pept        complement(196497..197678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70300"
FT                   /db_xref="GOA:E8MWZ7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ7"
FT                   /protein_id="BAJ70300.1"
FT                   /translation="MSDPNNVPLPQQPEANGTPTPNPVPQYGAPAPAQPSQPAQPAYGQ
FT                   PAYGQPAPTANSYGQAVPTYGQPAPDANTYGQSAPAYGTPAPDGNPYGPVPPSYGQYAA
FT                   PTATVPLDKPYYGCSFQEAFLRFWKKYTVFRGRASRSEFWWWVLAAFGINIVLDILNTA
FT                   TDEKLGFLATIWGLATLIPTLALSVRRLHDTNKPGWWVAIFYIAMVIGLIIMIIGGGAA
FT                   LYGGFRSLGSYDYGYGSMAAGGLGAAVIGALITLAGCVVYIVFMALPSKPEGARFDDGA
FT                   AATPMPQGAYGAPYSTPVPPNFAAPNAPAPGFNQPALAYVQPAMPTPDYGQPAAPAPDY
FT                   GQVPAPQYGQPEAPAPQYGQVPPMPQNAGDESATPSEHTAPAGDNAQKPWQGQ"
FT   CDS_pept        197876..198052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0154"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70301"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ8"
FT                   /protein_id="BAJ70301.1"
FT                   /translation="MRGRNWKADEAFGATHKATYRDVGNAMNHEYTDAAVEQRESHEDE
FT                   SQDWDLLFVGLAC"
FT   CDS_pept        198235..199755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0155"
FT                   /product="glutamyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70302"
FT                   /db_xref="GOA:E8MWZ9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWZ9"
FT                   /protein_id="BAJ70302.1"
FT                   /translation="MTDAENTKPELPKNVRVRFCPSPTGTPHVGMIRTALFNWAEARAT
FT                   GGTLIFRIEDTDAVRDSEESYNQILESLRWLGIDWDEGIDVGGPHGPYRQSERTAIYKD
FT                   VAAKLLEAGYAYESFSTPEEIKERNLAAGRPAEFGYDGYDRNLTDEQKAAFRAEGRKPA
FT                   LRIKMPDEDIAFDDLIRGTIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMEVNVVLR
FT                   GEDLLSSTPRQIVLYRYLMELGIAKEMPLFGHMPYVMGQGNKKLSKRDPESNLFNHRDN
FT                   GFIREGLLNYLALLGWSIAPDRDVFSMDEMTEKFDVRDVKANPARFDIDKAISINAEHI
FT                   RMLEPEDFLRRSVPYLHRDGVVSADNWDALTDREREVLTAAAPLVQPRVRLLGEVAGMV
FT                   GSLLSTEGYLEPADDAKKQLKDSAGEVLDKAIAALEAVDEADWKTDNLHETLNKALVEE
FT                   GGYKPRLAFGPVRVAMSGRRVSPPLFESMEIVGKPVSLARLKGLREHL"
FT   tRNA            200357..200432
FT                   /locus_tag="BLIF_tRNA05"
FT                   /product="tRNA-Glu"
FT   tRNA            200469..200543
FT                   /locus_tag="BLIF_tRNA06"
FT                   /product="tRNA-Gln"
FT   CDS_pept        200685..201173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70303"
FT                   /db_xref="GOA:E8MX00"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX00"
FT                   /protein_id="BAJ70303.1"
FT                   /translation="MSAGQQAVPANNANNASNEGAQKKHMSKAAVAIIAVVVVAIIVVA
FT                   GVFGFRAYSDAQYNNAVAACAAASENVRNATNDYNNLVNGDASEAAALTKKDVKDASTL
FT                   DALNKELSVELPVYEGCVADDTAGFKSATAKLNEQADWYKAYTQSLQKAVDAVNASKK"
FT   CDS_pept        201570..207467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0157"
FT                   /product="endo-alpha-N-acetylgalactosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70304"
FT                   /db_xref="GOA:E8MX01"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="InterPro:IPR035364"
FT                   /db_xref="InterPro:IPR040502"
FT                   /db_xref="InterPro:IPR040575"
FT                   /db_xref="InterPro:IPR040633"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX01"
FT                   /protein_id="BAJ70304.1"
FT                   /translation="MKKKKTISAALATALALTCMGSGGGTAFAVPLSDADLQTLASQIQ
FT                   QINDTSDSATASETPSAQADAVEGWTIDSNIAQGDEILEMANGWLHLKSTASNGNAAAN
FT                   PSSSNNWPAVAVWGTDYDFSKAGSFHATIKSPQEGSANRFGFYLGYNDPGSGLFIGYDS
FT                   DGWFWQTYTGGGSGSWYSGARIAAPSANEEHDIQVSWTDAKVATLTVDGQKAFDVDYSA
FT                   MTNLSNKLAIKAGSWKGLNQVTDVYIKDFPEVVEAAKHAVSGKVVDAGGAAIEGATVRL
FT                   DKTKVKTGADGTFSFADIEEGEHTLSIAKEGYEDVSQQVAVSGADLAIDPITLNKTVQV
FT                   ASETLKTKKMEVQIKKNFPSVLQYTMTDGKVMYGQTKDVRTVEINGTNIELTDDDVTFK
FT                   KVSDTEATYTLKVKDEAKKIDAVITVQITVKANQLHLNVTKIKNNLSEGIPEGNGVEEN
FT                   AIQTLSFPNQSLVSVRSSQENAQFTGARMSSNTQKPGDTNFAVTEDTNVTDSDYTYGFI
FT                   SGAGLSAGLWSNSEHDGTYVAAPVRGGSQNTRVYATTQQTGDATSLGLASAPWYYHRTV
FT                   TDSKGKKYTVAETALPQMAVAIAGDENEDGAVNWQDGAIAYRDIMNNPYKSEEVPELVA
FT                   WRIAMNFGSQAQNPFLTTLDNVKKVALNTDGLGQSVLLKGYGNEGHDSGHPDYGDIGQR
FT                   LGGADDMNTMMEEGSKYGARFGVHVNASEMYPEAKAFSEDMVRRNSAGGLRYGWNWLDQ
FT                   GVGIDGIYDLASGSRVSRFADLSKEVGDNMDFIYLDVWGNLTSSGSEDSWETRKMSKMI
FT                   NDNGWRMTTEWGSGNEYDSTFQHWAADLTYGGYTSKGENSEVMRFLRNHQKDSWVGDYP
FT                   QYGGAANAPLLGGYNMKDFEGWQGRNDYAAYIKNLYTHDVSTKFIQHFKVTRWVNNPLL
FT                   TADNGNAAAVSDPNANNGNEQITLKDSNGNVVVVSRGSNDTSSAAYRQRTITFNGVKVA
FT                   SGVVSAGDGSATGDESYLLPWMWDSFTGKLVKDSEQKLYHWNTKGGTTTWTLPDSWKNL
FT                   SSVKVYQLTDQGKTNEQTVAVSGGKVTLTADAETPYVVYKGEAKQIQVNWSEGMHVVDA
FT                   GFNGGSNTLTDNWTVAGTGKAEVEGDNNAMLRLTGKVDVSQRLTDLKAGQKYALYVGVD
FT                   NRSTGDASVTVTSGGKVLATNSTGKSIAKNYIKAYGHNTNSNTENGSSYFQNMYVFFTA
FT                   PENGDATVTLSHKSTDGAHTYFDDVRIVENQYSGITYEKDGTLKSLTNGFENNAQGIWP
FT                   FVVSGSEGVEDNRIHLSELHAPFTQAGWDVKKMDDVLDGTWSVKVNGLTQKGTLVYQTI
FT                   PQNVKFEAGAKYKVSFDYQSGSDDIYAIAVGQGEYSAGSVKLTNLKKALGETGKAEFEL
FT                   TGGVNGDSWFGIYSTATAPDLQGSTGNAQDFGGYKDFVLDNLKIERIESQTRTKAEAQD
FT                   KVKEIRGKYDSKRAELSDAAWQQYQDTLVKARVLINKNGATAEDFTKAYDILVALDEYM
FT                   KTAPGNESSDKYDVAADGSDELGGYTVATGSEEPTAGLPSEGPADLAQDGNDSTHWHTS
FT                   WSENAVGNGTAWYQFNLNEPTTINGLRYLPRSGGMNANGKIKGYKITLTLADGTTKDVV
FT                   TDAEFSTTMWQKASFDAVENVTAVRLTVLSSAGQSDSQANKFASAAELRLTTDREVEEE
FT                   TVAPDKTDLNDTIAKANGLKESDYTAESWTALVKAREAAQAVADNDKATAYDVALALTN
FT                   LESAIAGLEKTGEEPGPGPVEVNKTDLQTAVNKASKLEKADYTTNSWEAFAEALKAAQQ
FT                   VLDNKNATQQDVDTALSALQDAISKLEAATEPKPNPEPGVVDKAALNATINKAAAINLG
FT                   LYTDDSANALRAALKKAREVSDNSNATQKQVDAAREALEKAIAGLVKRTAAKGDGNVVS
FT                   NTGANVVTIAVAGLLLAGAGAAIAYRRNREQM"
FT   CDS_pept        complement(207566..208450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70305"
FT                   /db_xref="GOA:E8MX02"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX02"
FT                   /protein_id="BAJ70305.1"
FT                   /translation="MCKAARQLLNTAKQQRKASPTMTSHLAEAGRTLIPRKDDRYGLLS
FT                   PALVILTFVAGLVDALSYLALGHVFVANVTGNIVFLGFAFAHAQGFVWWTSALTLATFM
FT                   IGAFIGGRIIHYFGANRARHLLVSTSIQLAFVAAALVGIYLLNQFAPEPSMGGTDASAI
FT                   ARTAQPSLNFPTARHIDLHIILLIVLLAPAMGIQNSTARKLSVPDLPTTVLTMTLTGII
FT                   ADTSAHGHEQSKLGRRAIVMLALALGALTGATLQTRGHEDVILMVMIVCLIAVIVMMIP
FT                   HVHSDARWVTGKH"
FT   CDS_pept        208614..208727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70306"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX03"
FT                   /protein_id="BAJ70306.1"
FT                   /translation="MIMQSDNSHHEAHQNDLNYSSEYQYDMYMYAEYGIEW"
FT   tRNA            complement(208733..208804)
FT                   /locus_tag="BLIF_tRNA07"
FT                   /product="tRNA-Thr"
FT   tRNA            complement(209165..209252)
FT                   /locus_tag="BLIF_tRNA08"
FT                   /product="tRNA-Ser"
FT   CDS_pept        209831..211624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70307"
FT                   /db_xref="GOA:E8MX04"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX04"
FT                   /protein_id="BAJ70307.1"
FT                   /translation="MVRRAQAALRSVEHTSVRQLRVLAAIVFLFAMVIATVAPAVTAPM
FT                   AFADSSTSSSSVDYATWAEVSKAMDKQLNSGLKTYKDGNTAGATSDFMGAYNKIYVASN
FT                   FTAVVHDTIGADKQLAQQQAFQSVQNLSYTPSNDDQLAQQIDALTADLDATAQQLDANA
FT                   DLAKPKAYAEALQAQLAKERKELDAKKKKNPGKGNRSWTDVANEMTPILDNAYKAYEKG
FT                   DGAKGATLVNNAYYQYYEKLGFEKNVMNAISGNRVSQVEYQFKMCRKSMNAGASLKDTK
FT                   KLIDDLKAMLIKDAGILDGGAADKEDGFTKLVTSSSGQAFLVLIREGLEALLVVAAIVA
FT                   YLVKSDNKRFVKWIYLGVLVGLLGAGLVAVIFVFAFGGSGPIQEIMEGTCALIAMGMLL
FT                   WTSNWMLNKSSVEAWNRYIRKKTEAAVADAEAAASADNVTLKTVVSLAMLSFLAVFREG
FT                   AETVIFYESIYTMSRDTRGMWIGGLTAAVVLVGIFLLFRFTSVKIPIGPFFLVTSILMS
FT                   VLVVVFAGGGVHSLIEGDLLPAFYLNGVPTNDWLGLYPYVECLVAQAIAAVAVIALFVV
FT                   GFIKQRKLKAQAAAEAPAVKA"
FT   CDS_pept        211798..212481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70308"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX05"
FT                   /protein_id="BAJ70308.1"
FT                   /translation="MMKNKKLAALLGLLLAGSMTVSMAACGSTNSASDTKTDSSSQSSD
FT                   SSSSDSSSDSGAGFEEVPVGPSGTAEEQDQDAGPLTVGAVYFQPIDMEPSSMGLKAADA
FT                   SFHLEADIHANQKGTELGYGKGDFVPDLTVNYTIIDKSTGKEVEGGTATSGTFMQMNAS
FT                   DGPHYGANVKLDKAGTYQLKLSIESPASKGWMLHVDPETGVKGHFWTEPIEVTFDNWDY
FT                   TPRQW"
FT   CDS_pept        212631..213908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0162"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70309"
FT                   /db_xref="GOA:E8MX06"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX06"
FT                   /protein_id="BAJ70309.1"
FT                   /translation="MLEQFVAVMPGTLAPALLVMSLSVMLTVGEGRDKPISSHWRLIGL
FT                   IVGLIAAIVFAGLRASAVINQRTFVNYPVLWCAIIADILTIVVVVFARRITTNWQQHKV
FT                   FMHIANAVAAIDIALTLFYALPDVILQLAIWVEPGETAFTSAMLLRALGFLLGVAMSII
FT                   VAAIFRTMRTTAVRWAFTVAVAAMMVILLIQHFTGLAQILQARGFPMNHTMFVALAWSI
FT                   NQNSTMIMAQALVFLIPAVASIVAGFRMKTHDVPGANEATLRRHKTFRRRAIAAAVWSL
FT                   VAAIGVTATLTVGVAATHQTITLSPPEAYSLKDGVATIPFSQVEDGHLHRFEYKAKDGT
FT                   VMRFIIIRKNGGAYGIGLDACENCGDAGYYEKDGKIICKKCEVAINLATIGFKGGCNPI
FT                   PFPYKTGHGKITIQTTDLDALSAHFQ"
FT   CDS_pept        213930..215234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0163"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70310"
FT                   /db_xref="GOA:E8MX07"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX07"
FT                   /protein_id="BAJ70310.1"
FT                   /translation="MFFLRMITRSFTRQLRRRLLIALTVCLSATVSVSMLGVVFDVGDK
FT                   LNAELSTYGSNITVQPKADAVVSDLYNTESGGATSTSDPTAFLKESDAAKIKTIFWSFN
FT                   ITSFAPQLNIHATVNGTNVPVVGTWFNKNLKISTGETTVVGVEGMRSWWQLDGKWPKDD
FT                   SDQGVIGKTLASELGVTTGDTITLNKTTASGKKNEQKIKLTGVYDSGDEDNGSLYIASS
FT                   TAQVLADLPDSVDKIEVKALTTPENDLARKAAANPAALSQEEWETWYCTAYPSSIAYQI
FT                   EEVIPGAVAKQVRQVAALQGNVLQKTQAVMILMTVLSLIAAAVAVANLMVASIGERSGE
FT                   LALLKALGATDAAVSRLMLAETAAISLLGAIVGALLGSGVAQLIGRVVFGSGITMRPMV
FT                   FVLVFVLLAVTVLLASASSIRSILNLKPAEVLHGR"
FT   CDS_pept        215268..216491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0164"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70311"
FT                   /db_xref="GOA:E8MX08"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX08"
FT                   /protein_id="BAJ70311.1"
FT                   /translation="MTNTGMFFRMLFSAVFRRRSRAVMAVVASLVGAATLFCLAMICLA
FT                   VPQQMNEEMRAYGANLIVTPTESTNADGKAGIDKAMVQHTTEMVKAKGSAKYATYRYEN
FT                   VRVNASPYVMAGVNAAQVKNLNHHWVVDGSWPTDGKVLVGRDIADAIGLRIGSAITIGY
FT                   RASDNASTNGTSSNSSIDQQTKDGRVSSDIMDTSGTEFRVAGIVDTGGSEDSIIYATNA
FT                   DVNKLTGITRGVDVIEYSAGASDLAGLVSSINDMTSMHVKAQQVTKITASDTRIITMLQ
FT                   TLFWIVSLVVLVLTLVGVGTTISSIVSQRRNEIGLRKALGASSRAIGTEFYIESSLYGL
FT                   IGGLIGTAIGYGLASWLCVAVFERSIVFNWWLALISVLFSALVAIVASIPPVHRATRID
FT                   PAVVLREE"
FT   CDS_pept        216507..217304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0165"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70312"
FT                   /db_xref="GOA:E8MX09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX09"
FT                   /protein_id="BAJ70312.1"
FT                   /translation="MLLELDHISKIYGDLRAVDDLNLTVPEGEWLAIVGSSGSGKTTLM
FT                   NMIGCMDTPSKGSVKLEGRKLEDLNATQLADVRKNLIGLVFQKFYLVPHLTAVENVMVA
FT                   QYYHSVVDEKQAMEALEKVGLKDRAHHLPGQLSGGEQQRVCVARALINDPKLILADEPT
FT                   GNLDEKNEKIVLDLFRKLHEQGTTIIVVTHDALVASCAQREIMLNHGVLVGEKWNDEDA
FT                   RKAYEAAGGKPASTGAQVEGAQNGETAIGFTDPTKAAKTGGEE"
FT   CDS_pept        217420..217983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0166"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70313"
FT                   /db_xref="GOA:E8MX10"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX10"
FT                   /protein_id="BAJ70313.1"
FT                   /translation="MTEKSTLKKSATLAAAGLVVAGALLAGCGESKAAPMDDAYAGNSG
FT                   ETEKSQEEQSQSQSNGSDSSDGSDSSSSHNDPSTTTSDKKDTGNYKDGNYSINGQYGPV
FT                   GEDSIDVHLTIKDGNVETVNIIGHPFTTISKNHQDDFAKAINGVVDGKPLKGLKVDKVA
FT                   GASWTSDAFNKALEVARQEASIQE"
FT   CDS_pept        complement(217989..218516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0167"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70314"
FT                   /db_xref="GOA:E8MX11"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX11"
FT                   /protein_id="BAJ70314.1"
FT                   /translation="MRATLQIAVDRGISGVTIEEVARRSGVAKTTIYRRYHNADELLHE
FT                   ISAMYLAIPDSDPVPSPTREHFTQLLQRLVDWVRDNDIDVKRVGIVLSSEAEFFQHIVD
FT                   QVVTPWLERVGAFLKQGVAQGVFREDVDEKLLLSTIIGSLVAYEAIEGKAMDDDTAWAS
FT                   RMADLLWPALLK"
FT   CDS_pept        complement(218703..220865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70315"
FT                   /db_xref="GOA:E8MX12"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX12"
FT                   /protein_id="BAJ70315.1"
FT                   /translation="MNTMWKLFTGDIKRLTSNVVSIIIVIGLVMIPGLFTWFNVAACWD
FT                   PFSNMKNLKFAVANVDEGYRSDLIPVKVTVGDQVVNALRANSQLDWTITSKADAVEGAR
FT                   SGKYYAAIVIPKSFSKDMMTFFSDDVQHAELTYYRNEKKNALAPNLLNEGTDEVAAEIN
FT                   TTFAKTITSAGLEIASSLADQLSKPEAKEQLNTFNANIANFATQLDDTADLLGTYSALT
FT                   DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQEVTDVAGALGTTADAMSSALDASASS
FT                   FGAVSDSIDKLYSDANDGATTVADELDRQATAIGKQTEKYTEIRNTLAGILGNDSSIIT
FT                   AIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKNLADQAQNSIANIKSDFSATV
FT                   KPQIDSLSSTVADASGILSSGATQLDSTLGDLKGTSDDASDMLSDARTTLDKVSGKLRS
FT                   AGAELASFNSTLSDALNSGDMGMVKEVLGNDPETLASTLAAPVQLRRKAVFPVANFGSS
FT                   MAPFYTLLPLWVGALLMVVTLKTTVSRRTRKALGDPRPHRLFLGHYGVFALIALLQSTV
FT                   SLGGDLLFLRVQAVHPLLFMLSGWLASLVFSFFTYTMVVSFGNVGKAIGVLMLIVQISG
FT                   ANAAYPVQMLPDFIAKVSPLLPLTHAVTMMRAAIAGIYDMDYWRAAGMLLAFVPPLLLL
FT                   GLLLRKPLVRFNQWYVAQVESTKVLS"
FT   CDS_pept        complement(220862..223492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70316"
FT                   /db_xref="GOA:E8MX13"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX13"
FT                   /protein_id="BAJ70316.1"
FT                   /translation="MGNIFKVLRRDFLRLFKVPAAWVILFGMVFIPPLYSWYNIVGFWD
FT                   PYGNTKGITVAIANNDDGTDNALIGKQNLGDQIVKQMRSNDQLGWTFVTEAEAMDQVES
FT                   GKAYAAIIIPKDFSDDLAGVVTGGKSRPTLEYYVNEKASAIAPKVTDVGASTVDRTVNS
FT                   TFVSTVSEVLTEVINTVDGKAISTEDTTKAKALTALAKASDDVQHTRSTIAKLTTKLTD
FT                   TPEQTRTARQALDDARTLGIDTAEGLAGVSTLIGTTQTSLNGFVTSTSEALDQGSSLLS
FT                   QAAAQANQSVGTVTGTISAANQQVGGLINTAEDINQANADIIDQLKGLPNANREPLQSA
FT                   IATLESRNSELAGALGNLDSLNTTIGNASTDTAGLAQHLNTATQTTVREANTARGTITS
FT                   GAIPQLNTGLNALSSTASTLSTGITSQGSLIDQSKHTLDQLDKAASTTVTALRDTDKAL
FT                   AGVQTKLDTLVTDIKALSISSSLSSLIGTDGKLDAATIADFMLSPTVISEQAVYPVASY
FT                   GSGMAPLFTTLSLWVGAFVLVVIPKLETDDEGIDDLTPTQGYLGRFLLLATLAAVQGLV
FT                   TAIGDLVIGIQCASAPVFLLTCVITSLVYMSVIFALSTTFMHVGKGVCVALVILQVPGA
FT                   SGLYPIEMMPAFFRAIYPLLPFTYSIDAMRETIGGFYDGLWFAYIGKLLVFVVLAFALG
FT                   LGARPKLANLNRLFAREIKESDMIIGEPVHLPGSEYRVTQAIAALADHDEYRHAIERRA
FT                   AKFAYRYPRLLLGALIAGFVVPAALIIVFALTTSEKIVVMGTWLAWVLIIMGFLMVVEF
FT                   MRDSIRRQTELGSLSDESIRAMLYGHKAKRRDTSAERHEEADPSAAVTAIIPTIPPTKE
FT                   GRHAR"
FT   CDS_pept        223847..225133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70317"
FT                   /db_xref="GOA:E8MX14"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX14"
FT                   /protein_id="BAJ70317.1"
FT                   /translation="MVEFKDDGTATTPGKPRENRDAESAVVADLVAVELDDAGLNLNAK
FT                   RLPILARIYGAVVLLDGLATLPIMVISILYAVREILDGHVHVDAMSLTFILSAIHAVVL
FT                   VVSAACLIVLGVMLLRNHRRYAARWTYVLMPLTLADGMLSLALTGLGFNLLLPLIQMII
FT                   LVVISVTADPSLSEERRLQRALRRMDDRDDYESAVAAGMLGRDQSGKGYIALDFFNIFW
FT                   LFTIASVGGLIVETIYHMALYNGELQDRAGLLWGPFSPIYGCGAVLVTVCLNRLWKANP
FT                   FLILCASAVIGGAFEYCTSWFMEAAFGITAWDYTGRWLSIDGRTSGQFMFFWGLIGVVW
FT                   VKWLLPRLLALINRIPWKVRYSLTAVCTVLMVIDIAFTLMALDCWYGRMAGQPQDSPVA
FT                   MWFSERYSDAYMANRFQTMHIDPSKAGRM"
FT   CDS_pept        225237..226766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0171"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70318"
FT                   /db_xref="GOA:E8MX15"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX15"
FT                   /protein_id="BAJ70318.1"
FT                   /translation="MIPSADALFCDARDDDGTIKRKARHMAEATANIGVIGLATMGSNL
FT                   ARNLAHHGNTVALFNRHYSRTEKLMNEHGTEGNFVPAETLEEFAASLKRPRTAIIMVKA
FT                   GAPTDATIAQLEEVFEPGDIIVDGGNSFFKDTIKREKEVRAKGFHFVGCGVSGGEEGAL
FT                   NGPSLMPGGTAESWKTLGPILQSIAAKVNGEPCVTHIGTDGAGHFVKMVHNGIEYADMQ
FT                   VIGEAYDILRRGLGMDAEEIGDVFAEWNKGDLDSYLIEITAEILHHKDAETGKPFVDVV
FT                   VDHAGMKGTGTWTVQTGLECGSPVAAIGEAVFARALSSHGELREDAQKEGLAGPNKTID
FT                   LAGEDKAAFVEDVRKALFASKVVAYAQGLNEIQDGAKEYGWDINLSEVARIWRGGCIIR
FT                   AQFLLDRITEAFRGDNPPASLLFDPYFEKIIGESQDAWRRVIVRAVEAGIPTPVFSSSL
FT                   AYYDGLRSKRLPTALTQSQRDFFGAHTYGRVDKPGVFHTLWAEEGKPEIEA"
FT   CDS_pept        complement(226914..227756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0172"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70319"
FT                   /db_xref="GOA:E8MX16"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX16"
FT                   /protein_id="BAJ70319.1"
FT                   /translation="MATRKLIVYPNKDLMIQAGAQRFVLALLDLLAERLPDGTHRTRVD
FT                   VALSGGSAAQPLGLVLNDPLADAIDWSRVHFWWSDERFVPAYDTDRNALEARRLLLDQL
FT                   VADGKLPESNIHEMAADTRSADDIADVMDQADSDDASVRAAADAANDALLDDVASDYER
FT                   ELVNELGPEPVIDLMILGMGPDGHYASLFPGHDEVKVTDRLTVGVNHSPKMPPLRVSLT
FT                   APLIARSRHTWFFAAGAGKAESLAHVFEQPNKPDYPSSYANGVDEFIWFSTEETVTEL"
FT   CDS_pept        complement(227983..229008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70320"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX17"
FT                   /protein_id="BAJ70320.1"
FT                   /translation="MIIDMPNTRTREIAHKIEQLHEERGESATGRVLTLLIATEDADLE
FT                   HALEIANSASREHPCRVIAVVPDTNPADQSGEGEPNAAEVAAEVSASRDNPAVDLTDGP
FT                   NDPNDSNLNAQVRFGADAGAGEIIILRPRGGLINHPDTLVIPLLVPDAPVVAWWPTTPP
FT                   SNPAKDLMGAMARSRITDALHSNNPEATIERLRRNWTPEDIDLSWTRLTVWRAMLASML
FT                   DQPPHLPITAVKVTGKADFLPLEMLCAWLRLKLGVPVETEFVPDAQAVTGVYLTREDGV
FT                   ISLERPYEDQALISLPGQTPQEVSVPMRTIEDCLTEELRRIDPDEIYAEVINEGWDLIR
FT                   H"
FT   CDS_pept        complement(229005..230543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0174"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70321"
FT                   /db_xref="GOA:E8MX18"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX18"
FT                   /protein_id="BAJ70321.1"
FT                   /translation="MSESPNWSNPLRDSRDLRLPRIAGPCSLVIFGVTGDLAQKKLLPA
FT                   VYDLANRGLLPPSFGLTGFARRDWTQERFIEFVKAAVQAHCRTPFKESTWRNLAAGIRF
FT                   VQGTFDDPEAFERLSATVQELDRDRGTQGNHAFYMSVPPRAFPQVAKQLAASGLSRSSE
FT                   GAWRRVIIEKPFGHDLASAKELDSVVSEVFDPSSVFRIDHYLGKETVQNLLALRFANAM
FT                   YEPIWNANYVDHVQITMAEDIGIGGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPVSF
FT                   TAKDLTAEKTKVLSAVRLPKDLAANTARGQYAKGWQGSHEVVGYLEEKGIDPKSTTETY
FT                   AAIRLDIDTRRWAGVPFYLRCGKRLGKRVTEIAVVFKRAPHLPFEQTAVRELGKNAIVI
FT                   RVQPDEGVTMRFGAKVPGGSTMEVRDVNMDFSYGRSFTENSPEAYERLILDVLLGDPPL
FT                   FPTTEEVNLSWEILDPIEQFWSTLGQPQAYRAGTWGPAQADEMLARDGRHWRMP"
FT   tRNA            230719..230794
FT                   /locus_tag="BLIF_tRNA09"
FT                   /product="tRNA-Lys"
FT   CDS_pept        230866..232500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0175"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70322"
FT                   /db_xref="GOA:E8MX19"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX19"
FT                   /protein_id="BAJ70322.1"
FT                   /translation="MSCTTILVGKNASYDGSTIIARDDDSGSGRYDPKRFVAVAPDDQP
FT                   RHYRSVLSHVEIELPDNPCRYTIAPNVLNNRGILAEAGANEHNVAMSATETIAVNERVL
FT                   GADPMVELRPAVGEPDSTDYQAEQPGGIGEEDIITLVLPYVTTAREGVARLGELLETYG
FT                   TYESNGVIISDVDEIWYVETIGGHHWIARRVPDDCYATIPNQLGIDDFDLADAFGEQRE
FT                   YLCSADLREFMATHHLDRTMGTPVSSNGRHAHSAGFGTTVALPTRFNPRKAFGTATPKD
FT                   HIYNTPRAWYMQRRLNPSEDWDSPAARYTPESDDIPWCRVPEDKVSLEDVDFLLSSHFE
FT                   GTPYDPYGTTGTAESRHRYRPIGVNRTGHMVAIQVRPYVPAANRTVMWVSFGSGPFTAA
FT                   APFYANVNDTPAYLRDTTPEVSTGNLYWTNRLIAVVADAHWYETNRFIEGYAEGVRAFG
FT                   HRLIERTDEQLLARSDAESTGTNAWPLDGGHGDEKDVQGVADVLEAANDEMADYLREHT
FT                   TKLLNDVLYTSSNLMHNSFAMSDRWAE"
FT   CDS_pept        complement(232574..233608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0176"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70323"
FT                   /db_xref="GOA:E8MX20"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX20"
FT                   /protein_id="BAJ70323.1"
FT                   /translation="MASTAKTLTFVIPAYNMESYLDRCVNSLLSASDISDLEVLIVDDG
FT                   SKDGTLEYARKLERTNPGAVRAIHQENKGHGGAVNTGIAAATGMYVKVVDADDWVDPQA
FT                   IDTVLATLRAQHDTDEPIDMLVTNYVYDKVAKRHKTVVNFRRVMEAGRVLGWDDLGRFG
FT                   LAQYIIMHALTFRTQVVRDSGLKLPEHTFYVDFYYSYQPFPWVKRIQYLDVPFYHYFIG
FT                   REGQSVQTDVMIKRVDQLRLVNRLMTEATPERGTVPEGLYRYMIHFLAIESCVTSTFLI
FT                   LSRDPANYVKKTELWDAIDAYSPAIGKDVRSQLMSRALNLPGKTGRWIVRNGYLIAERI
FT                   VGFN"
FT   CDS_pept        complement(233632..234453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0177"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70324"
FT                   /db_xref="GOA:E8MX21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX21"
FT                   /protein_id="BAJ70324.1"
FT                   /translation="MTSLQRREQLIEVGRSLFAAKGFEAVSVEEIAAHAKVSKPIVYEH
FT                   FGGKEGLYAVIVDREMRALTGTLTAALDDPTVHPRQIVERTALALLTYIEENAEGFQVL
FT                   VRDSPSTDPSGSFSSLMGDIAVRVEDILSETFKRQKLSAKGVPYYAQMLVGMTVFTGQY
FT                   WADRPKVSKEQLAAYIVDLAWHGLSRLDSKPQLFFEGAKARKEAERRAKRESDSGSPDS
FT                   DQTSSAQSDPEHATGEDSGLQNMRSGAQVTQHSAESGGEVLRFEQETEHND"
FT   CDS_pept        234576..235838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0178"
FT                   /product="signal recognition particle-docking protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70325"
FT                   /db_xref="GOA:E8MX22"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX22"
FT                   /protein_id="BAJ70325.1"
FT                   /translation="MLAVLGVIVAAVIVIALSIWLGKSRKRDLDRAMGKVAPDNKKTRD
FT                   AKAAADARLAAEAEEAKAATAAEPAKSAESAKAEPAPAAQAEPEPAAAPKPESQPASKP
FT                   TPAKPETPESVGSRLTRLKAKLAKSGNPFGKALFDILAKDNLSEADWEDVEDTLLLADV
FT                   GADASAQLVDDLRTDARITGKADPAEVRATLKEKLLDLVGRDTDRRLNAEKPGAAKPSV
FT                   IIMVGVNGTGKTTTAGKLARLFVAENKQVMMGAADTFRAAAADQLETWGARVNVPVVRS
FT                   DKDGADPASVAFEASAKAKEANADVLIIDTAGRLQNKSNLMDELGKIRRVTEKNLPVDE
FT                   VLLVLDATTGQNGMAQAKVFAEAIGITGVVLSKLDGSAKGGIVVSVQKELGVPVKLVGL
FT                   GEGPDDLAPFDPEGFVDGILA"
FT   CDS_pept        236206..237501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0179"
FT                   /product="putative ammonium ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70326"
FT                   /db_xref="GOA:E8MX23"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX23"
FT                   /protein_id="BAJ70326.1"
FT                   /translation="MGAIDSGNTAWILTSASLVFLMTPGVAFFYGGMVRAKAVLNMLML
FT                   EAAALSVTMIIWTLWGWSIAYAGSDIGGIFGDPASGFLLKDSMVAQDGVFTATGLNGNN
FT                   YPVSVDVAFQVAFAMITVGLICGAIAERVKYSTWMIFVALWVTFDYAPMAHMVWNGGLL
FT                   SADGAISKAIGAAAHDFAGGTVVHINAAVAALIIVLIIGKRKGFGTQPFRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAANGTAGYAWVSTSAATAAAMLSWGFTEKIRSGHYTAMGAA
FT                   SGMVAGLVAITPAADVVSPLWAIVMGAIAGVLTCLACGLKFKFGYDDSLDVVGVHGVGG
FT                   FTGTILIGFFGEGTGLLAGGDWRQLVVQLVIALVAILYSAVITAIIAFALEKTIGWRVT
FT                   EAQEVGGIDLADQGERAYDFAGTASSVLKEVK"
FT   CDS_pept        237503..237841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0180"
FT                   /product="nitrogen regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70327"
FT                   /db_xref="GOA:E8MX24"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX24"
FT                   /protein_id="BAJ70327.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALAAAGVHGLTVSEANGYGRQRGHTEV
FT                   YRGAEYTVDLIPKIRVEVLSDDADAETLVGVIIKSAGTGTIGDGKVWVAPLDSVARVRT
FT                   GETGSAAI"
FT   CDS_pept        237950..239776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0181"
FT                   /product="uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70328"
FT                   /db_xref="GOA:E8MX25"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX25"
FT                   /protein_id="BAJ70328.1"
FT                   /translation="MTSAVDGLKQRFMDMSQPDDDGVYRNGATKRKARTELAMQCLTEL
FT                   WNAACKDVSFPVPDSGIGFAAVGSLARGQLGPSSDLDLVIIYEPRTLNDQQLNELANKL
FT                   WYPLWDSGLDLDHSIRTRAQCEEVTDHDLPAAMGWLDVKPIAGDTALITTTATSILERW
FT                   RKAARKRLPELLDSAKARLDEFGRLQYVNQPDIKEARGGLRDSVLVSALAASWLADRPH
FT                   GIYDEAVERLLDVRDCIHLVAGKDTNLMLTPYQAKVAAMLGLADPTWPENERAAYSIDD
FT                   LQTLLARIGRRISFSLDSTASRAEHSLTHEKPRFAFFQMFSQRSGGKREAPQFDVVAPG
FT                   VAKHEGELVLAPGAEPAKDAKLALRMAVAAGEFGLPINPSTLVNLKRCPIHDNQWDDES
FT                   RELFIRLLACGSNLMEVWESIDFVDIPGRWMPEWLGVRNRPSASAAHRYTIDRHMVEVT
FT                   SRLGRETPSGGRYDDDHFEALLLAGITHDIGKRAFVADHAAEGARHVPVIFKRMGYAPD
FT                   IVDWATVLVREHLTLSEFATGKDPYDPAVAEELADRLHHDKMLLDMLFDLTRADGSSLG
FT                   ATAGETITKQYGWSKWREQIVRGMYSAARAAM"
FT   CDS_pept        complement(239810..241255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0182"
FT                   /product="putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70329"
FT                   /db_xref="GOA:E8MX26"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX26"
FT                   /protein_id="BAJ70329.1"
FT                   /translation="MRVSVPIDSSDAKATSSGDTTRRDGFGTPHAGANTNVSNGPTDAR
FT                   STNRRIMALALPTFGQLIAEPTFILIDTAIVGHIGDAALAGLSIGSTIILTAVGLCIFL
FT                   AYSTTAQVAHLLGAGRRRAGLQAGIDGLWLALSIGTVLGLGLFAAAEPLCRALGGQGEV
FT                   LEQAVTYTRAIVLGAPGMLMVYAANGIFRGLQKVRITLIAAVGGAVVNTVLDVLFVIVL
FT                   NWGIAGSGVATLVAQWFMGLFLVIPAILWSRADGASLRPRLAGIAAAGGDGLPLFIRTL
FT                   AIRAAMVTTVACAARMGTAVLAGFQAVNSSWNFAMNMLDSVGIAGQTLVATALGAGSVQ
FT                   QARRLTRATGRAGLVTGAVIGTAFAVVGLFAGHFFSPTPHIQTLIAVGMVTMGIFFPLQ
FT                   GWMMAIDGILIGARDYRYLAVTCTLTAVVYVTLILILANMVTPALTSDLMRTAVLWAAF
FT                   NVVLMGGRGLSNGLRVRSDAWMK"
FT   CDS_pept        241461..242990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0183"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70330"
FT                   /db_xref="GOA:E8MX27"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX27"
FT                   /protein_id="BAJ70330.1"
FT                   /translation="MRATVSFPYDIVHLPRHILYLEAMPEGSEHSYQNGFGGGLDRGDR
FT                   GDRAGRGGTQTSAAAGDPIFDRVPPHDDDAEMAVLGGMLMSKDAIGEVSQTIDVTDFYQ
FT                   PKHQTIYNAIIDLFSASQPVDVVLVANQLLADGNLDKVGGADYLHSLVASVPTAANAMY
FT                   YAEIVHQRAILRNVIAAGTKIAQLGYSAEGSQAEDVVNLAQSEIYEMSMGKVRQDYAAI
FT                   GPVVHDALDQLDKLQQGLVNKGVPTGFRDIDDVTQGLQPGQMVVVAGRPAMGKSTLGID
FT                   FARAAALHHNMTSVVFSLEMSKVELAQRIISAETNIPMAALRRADDITPERWNTLNQFW
FT                   TKMQNAPLFIDDSPNMSLMEIRAKCRRLKQTNDLKLVVIDYLQLMTSGKAVESRQQEVS
FT                   EFSRALKLLAKELEVPVVALSQLNRGPEMRNDKKPQLSDLRESGSIEQDADVVFLVHRP
FT                   DFYDKEDRPGEADIIMAKHRNGPTETFHLAFLGATSKFKDMPQDYNANQGV"
FT   CDS_pept        242990..244462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70331"
FT                   /db_xref="GOA:E8MX28"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX28"
FT                   /protein_id="BAJ70331.1"
FT                   /translation="MMASNVSRDVSQDQSSVVQTCKPWYAFATVAAGRFVRFASRVTKH
FT                   GGSALPGKVVEKIDPGFLTRTLGQLPLGVVLVSGTNGKTTTTRMVASMLSDLGLKVFTN
FT                   PTGSNFVRGVVSALLTEVTLGGKLDADIAVLELDEAYAVHFVKQVKPRYALLLNVMRDQ
FT                   LDRFGEIDTTAKLLSHVAAATTGTVVLNREDPRIAALAAKAPAGTTVRYFGLADDLRRY
FT                   FPSDDDMATTVSVEGVAGPLPSARTPLSPRSELRGASTGTAELPADVTLTAVGDHKATF
FT                   QMDGQGYATDVKLEGVYNLYNAAAALAVVRAVMQDNAAASKATAAANACAVSADELIAA
FT                   VSRVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLSLASFDPANADTMIAINDEYADGRD
FT                   MSWLWDVDFTSLRASGVAMVSGVRAWDMALRLGYDQVPVADTNTDLEQAVTAFVNANPG
FT                   TRKHIYCTYTAMLKTRAVLGRITEVRDAGVGK"
FT   CDS_pept        244563..245315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0185"
FT                   /product="cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70332"
FT                   /db_xref="GOA:E8MX29"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX29"
FT                   /protein_id="BAJ70332.1"
FT                   /translation="MARTIDVVSLYPKDMNIYGDSGNVLTIRRRLELYGYEPVVHQYNQ
FT                   GDDWPDQVDLILGGGGQDTGQKKIIDDFYHRADLLRSLAADGTPMLMICGLYQLFGEYF
FT                   ETVDGTRLDGIGVIGAYTVGQNVRMIGNLVEHSDQFGDVMGYENHSGQTFLREGVQPLG
FT                   TVDQDSRGNNGEDHTEGARVHNVIGTYMHGSLLPKNPAISDFLIETAVTRRYGTFDTSD
FT                   QTPEQAKELARIDQVATNARKAAAERPR"
FT   CDS_pept        245464..245751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70333"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX30"
FT                   /protein_id="BAJ70333.1"
FT                   /translation="MADFDLLGDGLRKVLLAGIGALATGYEKSSELVDELVKKGEITVE
FT                   QGKALNTELKRKVSETVDDVKKAAAEAGDKAAAAADTSAADKPADEGKAE"
FT   CDS_pept        245826..247568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70334"
FT                   /db_xref="GOA:E8MX31"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX31"
FT                   /protein_id="BAJ70334.1"
FT                   /translation="MKAEREAAANRSVDTSDTLKQTVTKATPSVSDETLALFGRRNDFA
FT                   TRYHLTRRGKIKRLGQITRIVEQFDVLHGLTPVKMRLMFEALGPTFVKVGQILSMRSEI
FT                   LPQSFCDELAKLRADADPMPYSTVLDVLAAEYGRPADEVFAHIDPKPLGSASLAQVHRA
FT                   TLKTGEDVAIKVQRPGVRETMAQDVSIMRSIAKAATKVIRTSQIVDLKGVVEELWDTFE
FT                   SETDFLIEARNLAEFKRFAARFKYMDCPTAYTELCTEHVVVMEYIDGISVSHPGRLVDA
FT                   GYDLKEIGTKLVDNYATQILDDGFFHADPHPGNIIIRGGQIVLIDLGMTGRLDQRTRAV
FT                   LKEMIFAVAKQDSPALAEGLLRFAGTEADPEDYPALLADLDVIVKEFGTVDLAELDIAA
FT                   FLTALTQMAGRHNIEVPSTVTTVGRALVTLEGLLDEFIPDVNMIEIISDHIATSKSLKN
FT                   ATKDEIKSLGVEGHQALHATLGTMTELKTVARMLTRGQLRVNMELVGSEEPFQLLSDMV
FT                   NRLTMALIVVGLFVGSSIVYYAGMKPIIFGIPVIGFMGYVVAFALGVWIVIDIYLKGRK
FT                   TKKR"
FT   CDS_pept        complement(247583..248605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0188"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70335"
FT                   /db_xref="GOA:E8MX32"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX32"
FT                   /protein_id="BAJ70335.1"
FT                   /translation="MMTQPATGRAARLEDVAALAGVSTATASKALHNKPRISEETKQRV
FT                   LDAAKQLNYSPNKLAQSLARGTTGTIGLVTSDLQGRFSTPILIGAENELRAQSTSVLLA
FT                   NARGDAALERQHVEKLLSLKVDGLLIVQCETNPRPTLGHDWGVPLVYVYGPSTDPKDCS
FT                   VTCDNVDAGRMAINHLISCGRRHIAIIGGDETYTAATDRTKGALEALSELGIEPAGPIR
FT                   YGKWDEGWGRAATRLLLDQGVKFDAVVCQNDQLARGCIDVLKQQGLRIPDDVAVIGHDN
FT                   WSVLTSSSRPALTSIDNETETIGRRAARYLVDAIDGNPHHGVDYVPCHLIQRESTLPLD
FT                   "
FT   CDS_pept        249091..250416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0189"
FT                   /product="ABC transporter substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70336"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX33"
FT                   /protein_id="BAJ70336.1"
FT                   /translation="MVSFNKLTRTLAGIAAAALIVPLAACGGSGNGGTATAEGIPAKGT
FT                   DDGTEITLWARSPLERQAKNVVEAYNKSHKNQVKLEIIPNDDMEGKVGGASQTDSLPDI
FT                   LAGDVVRIPYWASEGIFTDITKQIDGLDNKADLQQGHIEAGTVDGAEYTLPFITDVSVM
FT                   VWNKNLYKEAGLDPEQGPKSIDQFVEQAKKVAALNKDGVAGSYLAGQSGGALVFDLFPS
FT                   VWADGESVMNKDGSEATLDNDSMKGVLDAYKELANTTNGLGAGSKEETGATWTAPFANG
FT                   KIGVMPYPNTSTTALFDAEKDGGFEVGVAPIPGTKEGKTSTFLGGDAMGISKDSKHVAQ
FT                   AWNFLYWLMQSDAQKEVFADQGDTASNIQTLKTAYKDADPRIQTINSVIIDGNGQTPKS
FT                   PAFNEAFNAAGSPWQLLVQNAVWGSGDLKADNKAVTDVLSAQ"
FT   CDS_pept        250704..251630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0190"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70337"
FT                   /db_xref="GOA:E8MX34"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX34"
FT                   /protein_id="BAJ70337.1"
FT                   /translation="MSSVSKSAGAVPVHKSKAKAAQTRRGLLYALPDWLMIIVLFFVPI
FT                   VLLVVMACSRWSLLGGNRGVNFPDNFVKVFENKLFWPSIWFTLEYTVIVTIFLLVLGLG
FT                   MAMIVQESSKWNNVLRTCFLLPSATGLASASLLFYALYSPQVGPVTKILSSLGLMQEGG
FT                   SVLATGQSALWATIIVIVWRFSGYYMLLMMIGLQAIPGDLYEAARMDGAGSWRIFRSIT
FT                   LPLMKPTIVMCLVYCVTGSILAFDQFFILTKGGPNNSTMTVVQLIYNFAFDSKKDLGMA
FT                   AALSLIVLVALVIINSIQMRGMRDNTK"
FT   CDS_pept        251651..252469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0191"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70338"
FT                   /db_xref="GOA:E8MX35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX35"
FT                   /protein_id="BAJ70338.1"
FT                   /translation="MTTPLWKRIIARILEALLAIIFISPLVWVIICSFSPQAGSAQSKG
FT                   WGVANYLTLFGYQEGLPKYLFNSVIVTLVAVVFSVVVCTLAGYSFSRFDYPGRNLGFMV
FT                   TLSILMVPYASLLIPLMVWYKQIGLNDSLLGVGLVITLFQLPMSTFIMRNAFDAIPKDM
FT                   EEAAMVDGCNSLQALFKILVPVVKPSMVTVGLLAFLEAWNNFMIPLYLSSSSKSTLPLA
FT                   MVNMRQQTMGVIDYGATEAGVVILLIPCAILFLALQKYYVKGFMAGAVKG"
FT   CDS_pept        252630..254606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70339"
FT                   /db_xref="GOA:E8MX36"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX36"
FT                   /protein_id="BAJ70339.1"
FT                   /translation="MNVTITSPFWKRRRDQIVESVIPYQWGVMNDEIDTTVPDDPAGNQ
FT                   LADNKSHAVANLKVAAGELDDEFHGMVFQDSDVYKWLEEAAYALAYHPDPELKALCDRT
FT                   VDLIARAQQSDGYLDTPYQIKSGVWADRPRFSLIQQSHEMYVMGHYIEAAVAYHQVTGN
FT                   EQALEVAKKMADCLDANFGPEEGKIHGADGHPEIELALAKLYEETGEKRYLTLSQYLID
FT                   VRGQDPQFYAKQLKAMNGDNIFHDLGFYKPTYFQAAEPVRDQQTADGHAVRVGYLCTGV
FT                   AHVGRLLGDQGLIDTAKRFWKNIVTRRMYVTGAIGSTHVGESFTYDYDLPNDTMYGETC
FT                   ASVAMSMFAQQMLDLEPKGEYADVLEKELFNGSIAGISLDGKQYYYVNALETTPDGLDN
FT                   PDRHHVLSHRVDWFGCACCPANIARLIASVDRYIYTERDGGKIVLSHQFIANKADFASG
FT                   LTVEQRSDFPWDSHVEYTVSLPASAADSSVRFGLRIPGWSLGSYTLTVNGKPAVGSLED
FT                   GFVYLVVNAGDTLEIALELDMSVKFVRANSRVRSDAGQVAVMRGPLVYCAEQVDNPGDL
FT                   WNYRLADGVTGADAAVAFQADLLGGVDTVDLPAVREHADEDDAPLYVDADEPRAGEPAT
FT                   LRLVPYYSWANREIGEMRVFQRR"
FT   CDS_pept        255305..261124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0193"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70340"
FT                   /db_xref="GOA:E8MX37"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX37"
FT                   /protein_id="BAJ70340.1"
FT                   /translation="MHQSTRKRWLASIGAVAAVATLATGGAVTAQAADTPVIKNADVAY
FT                   PSFKGSDDPMKTAANNTTYNPAASYLQETFDNDVKNLAGTDTDHDFWIDKILTRTGAQP
FT                   TGKGTNDKGAYSYEGSDGNNYLFTRGRAAYMYTHTPNRLGFVGNTAYWDETNRDGFTVT
FT                   VNADGANQTLNEDASQRKQTPSYFTSLFQTGGKSLKIKEVKYITYNNVMVANLTVESTQ
FT                   DRDVTLTTASPFAAEGADGATELTGRVNVKNNLTTIYPRFSANNQDGSNWIVSGGKLTS
FT                   TLSLKANEPQTVKIQLGLIANELPDSTKEYEARYTGDLKDAAASYKDSVTTYNKWWVDN
FT                   APYVDTPEDNIDKTVVYRWWLSRFNMLDANIPGNTFQYPTSIEGVLGYNNQIVLTSGMF
FT                   MMDTKWFRNPEYSYGTWLSAGDTAKKSKAGYYYYHDNPGDPANWNHSYTQYITRAGWDS
FT                   YKVHGGPSTVAEKLADQGAEDVQGLLASKSEPDNNDNQNNNDNSLIDWSWWSMTGNDAD
FT                   AVSFSEPGRSGQRMDRADGSANMWANANAAAQAYKAAGDTANAEKMQAIADKIQKEVTT
FT                   ELWDKSDNLLKHRWLNDGAFAKYKEINNYYPYSEGLMPTGNEDYNKALRLFEDSNEFPI
FT                   FPFFTANQADKAALNFPGSNNFSIINAQPLLQVYSAGIRNYDAAKNGYITNEQFKKLLY
FT                   WVAFAHYQGGDNNYPDQNEFWNEDNNNVGDVNGDGVINNLDKNLDAAQNGGKITYRSWI
FT                   HHTQLGTTNWTMVEDVAGMVPREDNKIELNPIEIPGWNYFTVNNLRYHDQNVSIVWDKD
FT                   GSHYGGPAGYSLYVGGKLAFTSDKLAHLIYDPAAGTVEVKDDSSAQVTVGAEAVKNVKA
FT                   ANQVTFNADQRVTDLFAKSGTNVDSASKSTTNVAKDADVTGTTYAEKDTNYPAKNAVDG
FT                   KTVMESFWGTKGSENKTDTLNIKFKDGKQKIDDIRLYFYQSSSSQTISGYAEPANYKLE
FT                   YQKDDGTWAPIADQVRTPNYAGANYNRIQFTPVETTTIRVTFTPQAGMAVGVKEIEAYN
FT                   TGIKADGTSENQTPQVDAYVSSSTSSGAKLVGTVKDDGLPAEGDVTTTWSQVSGPEGGT
FT                   AKFVDASAASTTVTFNKEGDYVLKLTASDGEKEGSKEITVHGIPSDGTVNVAPQSSASA
FT                   SYTNGYQPKDNAKKVIDGQVVYANTPNETWNNWGDSTGVEPWLQLKWAGKVPLKKAKVF
FT                   FWTDGGGVPMVSSWKLQYADADGNWQDVKLADGQSYTVNRNEGNEVKFADAVETDKLRV
FT                   VFPKGAIVGASEFEAYAIEPVSVDEVNRLVQTGSKADDLKLPSTVSAVYTDGSRRDLAV
FT                   TWGKVTDAQLAADAVFDVKGTVAGALNGTVAHIAARSDTASQTVGNAQPVEQTVYQNAK
FT                   SIDLPATVPVKFPNGYNDDRKVTWKDADIKAIDLTKVGDYEVAGTVDDGSSSAAAKLTV
FT                   HVVADPNGSSTPEPEPEPEPLVGWIEGKATRTTISPDSEATWSPAEGKLNDGVVVDDTW
FT                   PTTDDQNVNDKVWGSWGKAKDGMYAQYDFGQSVTIDQSRAQFWANFAETDDSKGGLEVP
FT                   DAWKIQYLAEDGSWKDVEPTEDYTVVRNSPASRADTDAKGWSAVTFKPVTTKSLRLVLT
FT                   PYTGSSTFGAAVAEWGVHGIDGTEPEPTPVDKTALKSALDTANGLDANRYTAASWAEFQ
FT                   QIIDAAQAVYDDANATAEQVAEQVTKLEDGQKALVALATDVEKSTLQAAIDTAKAEAAS
FT                   GKYTDKSVEALNKAIEAAEGVLKVGEVTQAAVQEASASLNKAVKALEEKPAAETVKKES
FT                   LEASIEQAKKADKSKYTEEAWQALQSQIAAAQKVYDDKDAKQADVDAAQDALDKAFWAT
FT                   KPEQKPGSQQPGVTDGKQNDNKGSLTNTGVAVLGVGILAVLFAAAGVTILKRRQSGDHG
FT                   SARHSA"
FT   CDS_pept        261229..264945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0194"
FT                   /product="putative xylanase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70341"
FT                   /db_xref="GOA:E8MX38"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX38"
FT                   /protein_id="BAJ70341.1"
FT                   /translation="MSFHVSAQSVRAVAGGLVAAATLLSGLALAPTAMAADSATADNAP
FT                   SVAGHAYNELPYNNPDVTVTQIDNSALPSYMRNPIGQNEGIDTPNDLSQNYYSADASAL
FT                   SYDGKLFVFTGHDEASPDYGSFNMKDWGVYVTDEDGLNQGKWTHYKTIAKADLFSWATG
FT                   DGAYAGQVVADDNGTPSDTSDDWFYYYVPVKDKASEAAGQDPFAIGVAKSKSPLGPWKD
FT                   AIGKPLLTTSQTQIETIDPAFFVDEDGTGYLHFGTFGTQLAIKMKKDATTGRTSYTEVE
FT                   TKADGTTPNLHTMKDADSNANGPKGFFEAAWVFRKGDTYYNVYDGGKPGSGTATCVESN
FT                   YQACIQYSTSDSPLGPWKYQGVIVPSGSATTMHPSVLQFGDKWYVTYHTGDKEGGTDFR
FT                   RAVCIDEVDWTADGQMVSTAHPTKAEKTQPSTNVAPYAKVSATFTETPAWKGSVNDGRV
FT                   LQTAVVPPNHWTNYRSIPQSQSGDSLVYQWDGTVRVNSSKVWFDVDSNALRAPTSWKIQ
FT                   YLDADGTWKDVTNPSAYTTTTGKANPNAVTFDAVTTTALKLDMTGQAVDGGYASVAVAE
FT                   WEVGSDSSESPAITAPKSVTTATGTAPTLPATVDVKYGNPTVASPVIWRPVDASSYAKV
FT                   GSFTAYGVVAGVPGEASEQGNVSVNVTVQDGYQPAADTTKPTVTVAVTANAGNSEWLTT
FT                   APFATVQATDDTAPIAKLEISADQGKSWTTIAANANAAIATLSQQGDVEVWARATDQAG
FT                   NVSDVAKAGGKVDSAAPTVTAAADKEERTLTLTADDGTGSGVASIEYRIGTDGQWATYS
FT                   KPIAAPSVSRATVYYRATDKAGNVSASAKTDIPSDTSVPLTGYIEGDATATDVDGKASG
FT                   WVKGAAALNDGKIIPDITIANEDVWGTWPNTGEMRLDYEWDREVTIDSSRVQFTSDDGG
FT                   LGIPASWELQYWDALANNGAGNFVDISDATYTVTANSPSAGWATGDAKGWSDGTWNTPV
FT                   KTTKLRMVITSGSASPAVAEWQVHAIDDSTPEPPEPTPIDKTELKQALADSPKADDASK
FT                   YTETSWAEYAAVLDSAQQVYKAEDATEAAVVDAATQLKQAAKKLVLVATVQDRAALSAQ
FT                   LDAAAAVDRTKWTDESLAVLDSAVATANALTSDGQAAQSDVQAATEAISDAIAGLVEKS
FT                   TTKPGQGGDKPGSGTDKPNQGNDSNQNKGDADSGKHKKIPDTGAAVLGVGILAVVLAVA
FT                   GVIILKRRKSGTC"
FT   CDS_pept        265088..265909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70342"
FT                   /db_xref="GOA:E8MX39"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX39"
FT                   /protein_id="BAJ70342.1"
FT                   /translation="MDHKDLANEVIDQARAQEITGGVHRVLDRIASAESAAGRAAGSVQ
FT                   LLAATKTRDVGEILAAIDAGIRVIGENRPQEITVKADGLAKRLGERGYSLGVIDAAEAD
FT                   TANAAAATHIPFHLIGQLQANKIGKVLPVVDTIESVDSIELAEKIARRATMRGITVGVL
FT                   LEVNESGEESKSGCAPSHAIDLAQRIGAMGGLRLQGLMTIGAHVDDERTIRAGFAHLRR
FT                   TRDQILASGAEGTADCTELSMGMTHDMTYAIEEGSTIVRVGTAIFGERAFI"
FT   CDS_pept        complement(265982..266995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0196"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70343"
FT                   /db_xref="GOA:E8MX40"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX40"
FT                   /protein_id="BAJ70343.1"
FT                   /translation="MSAILEGTPDKRLVLVTGRAYPELAEKVAECLGTEILETTSYDFA
FT                   NGEMYVRFTEPVRGADVFVLQCHSGDINKWIMEQLIMIDALKRASAKSITVVAPFLGYS
FT                   RQDKKHRGREPITARLIFDLFHAAGADRIMTVDLHAAQEQGFFDGPVDHLTAMPVLLDY
FT                   VRSTLDLGNTTIVSPDAGRIKVSEQWAAKLGNLPLAFIHKQRDITRPNHAEAHGIIGDV
FT                   DGRDCVVIDDMVDTAGTICEAVRTLNESGAKSVTLVATHGLLSGPAVERLANCGAHEIV
FT                   FMDTVPIPEEKRLPNMTVLSCAPLLAAGIRSVFEEGSVAILLDGLPEDMRPRNIYA"
FT   CDS_pept        complement(267117..267599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70344"
FT                   /db_xref="GOA:E8MX41"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX41"
FT                   /protein_id="BAJ70344.1"
FT                   /translation="MPTVLAKPTQPAAPITPGAAPVAAPGATSTTMNEQQKKIFIIVGA
FT                   VAGFLVLFGIVYGVLSSAVFSAKSVANSYVAAISSGNYDKANTIADPHVNTNQRALLTS
FT                   KASSGENTRITNARISQTSNNADGTVSAQLTYTLEGKEVNGNFTIKDNKVSVEFSE"
FT   CDS_pept        267764..268054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0198"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70345"
FT                   /db_xref="GOA:E8MX42"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX42"
FT                   /protein_id="BAJ70345.1"
FT                   /translation="MSAHKYELMFIADPELDERGLKKLTEQYLELVTKEGGSFDEPDYW
FT                   GRRKLAYEIAGKTEGNYVVVKYTAEPATSDELDRVLNLNESVIRTKILRKG"
FT   CDS_pept        268111..268767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0199"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70346"
FT                   /db_xref="GOA:E8MX43"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX43"
FT                   /protein_id="BAJ70346.1"
FT                   /translation="MAGETVITIVGNLTADPELRTIGSGATVASFTIASTPRTWNRQTN
FT                   QFEDGQALFMRCSAWRDLADHCAQSLKKGMRVIATGRLQQRSYQAQDGSQRTVVEMQLD
FT                   EIGPSLRYATAQVTRQSSGQGGFQGRSGGFQGGQQSNQGYGNQGGQGGYAGGQGGYNGG
FT                   YQGGGAGYSQQSAAPANPSAPAVDPWSNAGASDAGSFSTFGASSDFGGDDSDPEF"
FT   CDS_pept        268828..269076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0200"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70347"
FT                   /db_xref="GOA:E8MX44"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX44"
FT                   /protein_id="BAJ70347.1"
FT                   /translation="MSRKRPQPPVKPFKKKPNPLKAAKVTEIDYKDVALLRKFISDRGK
FT                   IRSRRITGVTVQEQRELSKAIKNAREMALLPYATSGR"
FT   CDS_pept        269096..269542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0201"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70348"
FT                   /db_xref="GOA:E8MX45"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX45"
FT                   /protein_id="BAJ70348.1"
FT                   /translation="MAETKVILTKTVSNLGHSGDVVDVKSGYARNYLFPQGLAFAWTKG
FT                   AEAQIVAMKRARLAKAVATREDAVAAKAAIEGTTVEIAAKVSESGKLFGGISNEAIAVA
FT                   LSDKAAVNPKAIEVETIKTTGDFPAKVALHPEITASFFVKVVAE"
FT   tRNA            269742..269815
FT                   /locus_tag="BLIF_tRNA10"
FT                   /product="tRNA-Lys"
FT   CDS_pept        269929..270189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0202"
FT                   /product="putative phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70349"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX46"
FT                   /protein_id="BAJ70349.1"
FT                   /translation="MPQIFTFTVSDPEGMHARPAGRLVAKAQEYESSITVAYGGKSVDA
FT                   KRIFGVMGLDVQQGDEVTVRVQGNDEAVAAAEFERFLKEHL"
FT   CDS_pept        270189..271868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0203"
FT                   /product="putative PTS system enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70350"
FT                   /db_xref="GOA:E8MX47"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX47"
FT                   /protein_id="BAJ70350.1"
FT                   /translation="MRTIQGVSVSAGIAIGTVRVLAAVDYAVERRLIDDPQAEMDRFRA
FT                   ARDTAVAQLKQLRDNVAAEFGENKAELFDAHRLMLQDPDYAECVEGLIAQDKVNAEFAV
FT                   KSAAEQFAAMFAAMDSSTMQARAADVKDVSRRVMNVLQGKRDSTAQDGSVQGDAVQNGI
FT                   VQNGIAQNGESHIIFAEDLAPSDTAQLDRAKVLGLVTAKGSANSHTAILARTMGLPAIA
FT                   GIGDAFDPADDGHVAVIDGTSGAVFVDPDEATLTEYRRRKAEAEEHLSLLRKLKGKPTE
FT                   TKSGQRVHLYANISRPSDAAAVLANDAEGIGLFRSEFLYLEREDWPTEEFQFDAYGQVA
FT                   QEMGDRPVIIRTLDIGADKQVDYFNLSHEDNPALGYRAIRICLTRPEIFKVQLRALLRA
FT                   SAYGNIAIMLPMITSVQEVRDAKRILEEAKSELRGERIDFNESIQIGVMIETPASVIMA
FT                   DELAAEVDFFSIGTNDLTQYTLACDRQNPSLERFADPHSPAVLRMIQMTIEAAHRHGIW
FT                   CGICGELGADLSLTDTFLRLGIDELSVSPTSVLPLRNVIRNH"
FT   CDS_pept        272102..272836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0204"
FT                   /product="glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70351"
FT                   /db_xref="GOA:E8MX48"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX48"
FT                   /protein_id="BAJ70351.1"
FT                   /translation="MDYPLFTKLAAEFFGTAILMIFGNGSVANVELKNTKGHHAGWLNI
FT                   AMGYGFGVMFPVLMFGSVSGAHINPAMTIAQAVNGLFPWSDVLPYIVAQLLGALLGQLI
FT                   VYITYYPHYKETEDAEAILGTFCTTDADNQKVNYFLNEMFGTLVLVFGALCCLSLAWGK
FT                   QDYAAASIVIGFIVWGLVTSMGGPTGPGLNPARDLMPRLLHAILPIPHKGSSRWGEAWI
FT                   PVVAPIVGAIIGAWLFVFFFAS"
FT   CDS_pept        complement(272920..275628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0205"
FT                   /product="copper-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70352"
FT                   /db_xref="GOA:E8MX49"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX49"
FT                   /protein_id="BAJ70352.1"
FT                   /translation="MEFSIFSTATALIAAAALTWLVLRFFFGTQKATAGAMDASGERQS
FT                   ATITVKGGYSPAVISMRTGTPITLTFDRQETGECTSHVVFADLGLDAMLPGNATTDVEL
FT                   PALPAGEYPFACGMNMVHGLLRVEGEESKDGADKDGLRPRADGSAEAEGVSPSDLRVGA
FT                   PVVDAAEAERREAAERANEIKALTKLVIVGAVLTLPVFAVTMLHMANPALVPHWMVNPW
FT                   LQAILITPVMFYCGRPIHTVGFPALAHRSPDMNSLVSLGTSAAYLYSLVTCIAPWVFPE
FT                   GSREPYFESVGVVITLVLVGRLLEAKAREGTGKAVQSLIRLRPRTAHKLNATSADNVDG
FT                   IEWRNPAHFTDTDIDAIVTGDLLIVKNGERVPTDGVIVAGEARIDESMITGESKPVSKT
FT                   AGDPVTGATVLLKGDCVMRATQVGADTVLSQIAAMVARAQATKAPVQQLADKIARYFVP
FT                   AVMIIAIWTFAIWVSLGPAPQLAHALVTAVSVLIIACPCALGLATPLSVTVSLGLGATN
FT                   GVLVTSAKALEQARRIGTVVFDKTGTITRGVVDAAADWDKPSYEQDTVKEGSREAVAAL
FT                   RARGIRTVMLSGDKAEVAGRIAREVGIDTVICEVKPDGKAYWIAKLQRERDEAAAKSAY
FT                   GTSRTAAQSRTLIAMVGDGINDAPALAQADLGIAIGTGTDVAMQSADVTLMSGDLRGVI
FT                   KTINLSNATMRNIRENLGWAFGYNVIGIPVAAGVLYPFTGWLLSPMIAGLAMALSSVCL
FT                   VLNANRLHGANINVGAADGPAGSGSSTADIESAGSAESANAANITGSATSNAPHEPTVI
FT                   IDDRTTLNQTNHVSDQSNNPTNKENTMDTGMHMHHTAPADGETATDPVCGMTVAVNADA
FT                   ITREYEGKSYYFCGEHCATNFMKAPQVFLEQ"
FT   CDS_pept        275739..276020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70353"
FT                   /db_xref="GOA:E8MX50"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX50"
FT                   /protein_id="BAJ70353.1"
FT                   /translation="MHGYDEDKAKVIARLRRIEGQVRAITQMVEDDKYCIDILTQISAS
FT                   NSALKSVALLLLDDHLNHCVRQASIQGGEVADEKLAEASAAIARLVKS"
FT   CDS_pept        276063..277487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70354"
FT                   /db_xref="GOA:E8MX51"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX51"
FT                   /protein_id="BAJ70354.1"
FT                   /translation="MFEQIGTVIIVIVVLVVGAGLGLFAGFVLGRHKGQEMARGVKSEE
FT                   LEEAKTSLENARFENAELSARNAAAQAQIEGVNQQLAFAKSQLAQAQQAEQIRIQQERE
FT                   RAAAEAERKRQADAQAAEVKRAEQEARLKEQSKVLEALAPVAKNLDTLQNKVTQIEEGR
FT                   KREMGALGAQLKGLNDQQARLDKETSSLSAALRNNKVRGAWGEAQLKNIVESAGLLEHV
FT                   DFDTQVVVTDADGRTLRPDMIVHLPGGKTIPIDAKVPYADYQRACEIPDTASPEDIARR
FT                   DDLLRSHAKALREHVRALGEKAYWNAFDVAPDFVVAFIPNEALLQAALEADPTLMDDAF
FT                   SRKVALTSPVTLWAVLKSVAYAWQQQSLTDDAKQLFDLSRELYERFSTLGDYAIKLGTQ
FT                   ITKTVSAYNKFASSLERRVLPTARKLQKIEPTKIIEEVPIIESDKGNVSELSAPEVVPA
FT                   DEGDTHLTASGDSLES"
FT   CDS_pept        277556..278113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70355"
FT                   /db_xref="GOA:E8MX52"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX52"
FT                   /protein_id="BAJ70355.1"
FT                   /translation="MLEPREQLATLLKEHVVGRPFSELAAVTFDHRAATVMGHVLIDAL
FT                   EDAGYSIDDFDAVGALTAASVPMVSAMIQAAASRGEDLDGFVMDFVYPSIKGPSIEGRR
FT                   VVLLDAWLSEKSYVQTSSLVTLRNGNELSLDFGIVEQLGAKVVAIASLVGGGVKDINVV
FT                   NPSTGDEQTLPFIQVFDESELR"
FT   CDS_pept        278207..279055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70356"
FT                   /db_xref="GOA:E8MX53"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX53"
FT                   /protein_id="BAJ70356.1"
FT                   /translation="MHAPNQISLAAKASGEPEFREIGLGPWSETHPGEPRPDDPTSSNY
FT                   DGRFDSVLLNDGDRRNVLDRYRYWTVAAIKADLDARGRHDFEVAVENWTHDFNIGSMVR
FT                   TANAFQAKRVHIVGPHKWNRKGALMTELYQHVEHHPSIAELVESWHHRIAGEIAYERAK
FT                   AGAAAVHAHDVAVDGDNKHLHELLAEIDACDARIKELQAARVIALDIIPGAVPMEAYAF
FT                   PKRCLLLFGAEGPGLSEKALALADDVVYISQFGSVRSINAGAAAAVAMHAWIAQHAVSG
FT                   V"
FT   CDS_pept        complement(279490..280458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70357"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX54"
FT                   /protein_id="BAJ70357.1"
FT                   /translation="MKHHKAVDILITKAEATQQCAYGTTKAHRSALARRVQARELKRVF
FT                   PNMYAASEYWDSLQPDERIRHIARTLHNRHPDWVFAGVTAAAIHDFEHQWHLHAGTITL
FT                   ATTSRGPNASSAKVKRIFTSSSTPEYANGLPVTSKARTVVDCGLSVDFRFALPIIDSAL
FT                   RNGVAITDILNVCSTMRRDCTPIFRLLHYANPASENGGESLGRGTIIAGGLLAPELQQN
FT                   ITDPQTGALYRVDFLWRLPENRLIVGEFDGYEKYVNPDMNDRKGVRGAVQAEKERETAL
FT                   YRAKVDTIVRFTYEEVMQQHPLLNKLRAAGIPHAGTVMGAG"
FT   CDS_pept        281035..281340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0211"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70358"
FT                   /db_xref="GOA:E8MX55"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX55"
FT                   /protein_id="BAJ70358.1"
FT                   /translation="MAMPTFSREEIVHLGDLARIALTDEEITRLQGELNVIADSINKVQ
FT                   EVASDDVPPTANPVPLEAYLRPDVAETPLTQEEALAGGPKTEAGMFVAPRILGSEE"
FT   CDS_pept        281344..282885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0212"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70359"
FT                   /db_xref="GOA:E8MX56"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX56"
FT                   /protein_id="BAJ70359.1"
FT                   /translation="MSNETATLVKLSAAEQAAAVKKGDVTSRELVEAHLKVIEAAEPSI
FT                   KAFLKVSGDVALEQADAFDAKSAEDKAALPELAGVPIAIKDMIVTKGIETTAASKILEG
FT                   WVPPYDATVIEKLKAAGMPILGKTNLDEFAQGSSTEHSAYQTTHNPWDTERVPGGSGGG
FT                   SASAVAAFEAPIALGTDTGGSIRQPGALTGTVGVKPTYGGVSRFGAIAMASSLDQIGPV
FT                   SRTVLDSALLQEIIGGHDKRDSTSIPEGPRPMVAAAREGAKRDLKGMKVGLIKELGGDG
FT                   FQPGVEARFNEAVDKLKEMGAEVVEVSVPHIGYSLGAYYIIMPSEVSSNLARYDGMRYG
FT                   LRVMPPTGVPQTAANMMAYTREAGFGDEVKRRIILGTYALSAGYYDAWYGSAQKVRTLI
FT                   IEDFKKAFEQVDVLVAPTSPSTAFKFGEKMDDPLAMYMNDIATIPANLAGVPAMSIPAG
FT                   LSDDGLPVGFQFIAPQQRDEVMYKPAAALEAALEDSWNGPIWNDLKTPWLDGLGK"
FT   CDS_pept        282911..284410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0213"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70360"
FT                   /db_xref="GOA:E8MX57"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX57"
FT                   /protein_id="BAJ70360.1"
FT                   /translation="MAEKLMKYADATKKYDVVFGLETHVELSTNTKLFCPAHIEFGGEP
FT                   NTELTPVSLGLPGSLPVINKTAVDYAIKLGLALHCEIAEWSQFARKNYFYPDMPRDYQI
FT                   SQYDEPTNGNGYLDVELEDGTVFRVPIERAHIEDDAGKNTHVGGADGRIEGADHSLVDY
FT                   NRAGVPLIEIVTKPIEGAGDRAPEIAGAYVRAIRDIVRALNISHARMEQGNMRADVNVS
FT                   LRPSPDAPYGTRSETKNVNSFRGIEKTIQYEIRRQAARLDDGKEILQETRHWDEATQTT
FT                   AGGRLKSDADDYRYFPDPDLVMLHITKEHIEEMKAQMPEMPRERRNRLKSEWGLSDLQM
FT                   RDILNADALDLIEETVKAGAKAAGARKWWLGELSREANAKGVSLEELPITPADVAEVEK
FT                   LIASGKLNDKLAKQTVEGVLKGEGTPDEVVKKHDYKIVEDNGAIEAAVDAAFEANPDVV
FT                   EKLKSGNMKPMGVIIGAVMKATRGQADAKAVTKVVMGKIKG"
FT   CDS_pept        284706..285770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0214"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70361"
FT                   /db_xref="GOA:E8MX58"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX58"
FT                   /protein_id="BAJ70361.1"
FT                   /translation="MTATNETLSMATEAQLKRDLPQSIVIPPIRGEMVHLRPATVEDLP
FT                   RLDELDAFYGASKITGKDAVTERAIVHTWVRRSQAWEAGQAPAESGVGDPESRRTIAWA
FT                   VLTDADHDDDGQLDAASTDNVIGMIFLIDIDGWSKSARIQIILGREYRGRGYSRDAMPR
FT                   VMTYGFAPEPAGLGMHRIWVSVPEKNSRSISVYQSLGFVPSGTSRDALWDAENNKYQDL
FT                   IVMDTLADEYDPIRSLDAFGMHLIEDNPGVKEALSAREHSIAIQQNKPEPEPAQRGEAA
FT                   GATTSDVQSQAQTPAAAQPVEPQAEHHDDTQKNTRHSLEEESNWPYGQAERKPSKEAWW
FT                   RTLGRGRKRDTESE"
FT   CDS_pept        285781..286095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70362"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX59"
FT                   /protein_id="BAJ70362.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRSSRFVKSVRIVTFKDVNVEEVQKTDIDIPDDIH
FT                   "
FT   CDS_pept        286254..288122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70363"
FT                   /db_xref="GOA:E8MX60"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX60"
FT                   /protein_id="BAJ70363.1"
FT                   /translation="MNTHHMQQGLKGSIAGVVAAATLLAGGILTVPHVMALEADGQYYS
FT                   SKQPYVAPSEATTASYSQAPEGYETVYTESMARHGSRGLSSYKYDALLMKMAEAAEADN
FT                   GFKSDAIKSEFMKNLKAITAANVENGYGMLTGQGADQHQGIGARAYERNKTLFDNAAKD
FT                   GGKIAYQSSGEARATESGENFARGFNAASNNKLANSTVTPADPAGTGEAAAFDKTPNTL
FT                   YFHKSENPDGTEKTGEAKQRADDYQNFVENDAIIAGAEQTIAENEDVKTASHDLLSQIF
FT                   TDDFLAKLADGTYAWYNTVDGTKGGEANCAPGADPSKDADACGAAKKKIASEYDAAMDL
FT                   YNLYIIAADMENENTGSHTFDFNQYFQGEQADDAKLFAWALDAEDFYEKGPSYAGQDET
FT                   YTIAQPLLDDFFSSIDERVNGGSTVATFRFAHAETMMPFAALLGLPGSTQQAAASTTDV
FT                   YTYANNEWRGESVTPMAANVQWDVAVKSGNDPKTGRAYTPLVRMLYNEQEIAFRSECTP
FT                   IADGSTWYKLTELKSCLASDHQTLGDDAHLTDDSTTQPGTGPNTGEGTSTTPNNNGAGT
FT                   HQPSNTQANGTENELSRTGVAVTGVAGIMMLLALAGISLNLWKVRR"
FT   CDS_pept        288341..289954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70364"
FT                   /db_xref="GOA:E8MX61"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX61"
FT                   /protein_id="BAJ70364.1"
FT                   /translation="MTDKQSVVIIGGGPAGLTAAWELIKDGGADKYDVTVLEGTREFGG
FT                   ISRTVKHNGNRMDIGGHRFFSKDERIMDWWKTVLPLQGAPSYDDKKLGRDHDMEPGGPD
FT                   PETEDKVMLKRHRVSRIFWNRHFFDYPISLSPNTLKAMGFKLTMVAGFSYLKSMFHKLP
FT                   EDNLENFYINRFGRKLYSMFFEGYTEKLWGRHPSQISADWGAQRVKGLSIMGVLKNAFQ
FT                   KLLPKKRSNAEVETSLIEEFWYPKYGPGQLWETVESNCEAAGVKVLTDARVVEVRQTDG
FT                   AVSSVVYEDSEGNRTELSGDQFISSMPVKDLVNAIDAAGADPEAVDSKPAPADMTEVAN
FT                   GLPYRDFVTVGLLVKHLKLKNTTSIPTLGNPPIVPDCWIYVQDPGYKVGRLQIFNNWSP
FT                   YLVKDVDDTVWIGLEYFCEEGDSFWNMSEEDVTKFAISELTRMRVINGPDEVIDSHRER
FT                   VRKAYPAYFDTYEHMDELIEYLDGFGNLYCVGRNGQHRYNNMDHSMATAMEAVGNIKTG
FT                   KTSKKNVWSVNTEKSYHEEK"
FT   CDS_pept        290160..292229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0218"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70365"
FT                   /db_xref="GOA:E8MX62"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX62"
FT                   /protein_id="BAJ70365.1"
FT                   /translation="MANSQNLEDMKLPELKELAKQMGLRGTSTMRKPELLATLQAARNG
FT                   GEPPAGVTVRAPKAAKTAKVVKAPQSDAAEANTTDNADVATQSPAPAPAATEPQLDLPL
FT                   PVADDAKKDETEPRRTRRKAADDAASEPRAARRRRDDDQPDFARRKPRKKADEAGDLLA
FT                   TLDLGDAAPTERRRERHEDVEVPLIRRVRDDEDEQPRRRRRTAENSEETVRDLDDILAT
FT                   LPTQKHEETSEDGEQNDDHEFVRRNRRDRSDRNDRDTRNDRSDRRNRRMRGRDRDNADD
FT                   DRRYDDRDNRSDRNDRDSRREEPQEDLVPVAGIVDVLDSYAFVRTSGYLPGPNDVYVSM
FT                   GQVKKYGLRKGDAVHGSIRAPREGDRRNQRQKFVPLQAIDSINGQSVEEALNRPQFSKL
FT                   TPLYPQERLKQETAPNKLTGRIMDIVSPIGKGQRGLIVSPPKAGKTITLQNIANSIAAN
FT                   NPEVHLMVVLVDERPEEVTDMERTVQGEVISSTFDRPASDHTTVAELAVERAKRLVELG
FT                   QDVVVLLDSMTRLARAYNIAAPASGRILSGGVDAQALYPPKKFFGAARNIENGGSLTII
FT                   SSALVETGSKMDEVIFEEFKGTGNMELRLSRELADKRLFPAIDINASGTRREELITNPQ
FT                   ELPIIYRLRRLLGGMEPEQAYQTLVPRLKKTATNRDFLAAIVQQANTGNAVNGN"
FT   CDS_pept        292336..292482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70366"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX63"
FT                   /protein_id="BAJ70366.1"
FT                   /translation="MPSTFTCTLTIYEMKEASLGSIVLGVGSGAAMFGDADASHILTGD
FT                   YDI"
FT   CDS_pept        292537..292926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0220"
FT                   /product="chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70367"
FT                   /db_xref="GOA:E8MX64"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX64"
FT                   /protein_id="BAJ70367.1"
FT                   /translation="MSETSSDWQRTTIDSAQAAAHPETAQAVARIKALRQTIDNIDSAV
FT                   IALLAERFKATSQVGVLKANAGFAPEDTKREDYQIERLHRIAIDAGLDPEIAEMYREFV
FT                   VTEAKKRHQRIADAGGDPGVLDVFA"
FT   CDS_pept        293048..295132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70368"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX65"
FT                   /protein_id="BAJ70368.1"
FT                   /translation="MRCGAALVSCALCVASILGGAWMSRPTPVDYGPVLATASDMYAVT
FT                   DAEGEPVRWYVVGKGGAGNGASADSGNSGSTDTDSANSNSGTSKVSRIPASAATLPWKV
FT                   SVTYSLDGPNVEANEVAGASGLIGVYIDIKPQTKEANRTIPVVAFTVPTQVADDVSADN
FT                   SITVTTQGSNTVVAAAGKAATGLEFSCYMNAKDFSMSSVALAVLPSNSSSPAVGANPDA
FT                   ANAANAAAQPAADTDVAQLTASAATLVDSLTDAGSGEQQQLIEQLQTLRDNERALNKSV
FT                   VAERETAHKRTFEDYMAAYVGSYTTHLSGSIGTSTQLPALMGTAGELSGDTPLAQAVLD
FT                   LANAVNNVSAAHQHAGAVDALDEVIRRIQQQGTTGLVDDLIAEASEEATQGSKQYADGQ
FT                   SQLSAAMIPYSMKYTDVYTANLSALTGGTSSGATAYESQAIAETNGSDELADAQSKVDA
FT                   AMSTLATASEHTGKATALRQIVLRFSDQFEGGASSASGSDGDGSSGDVSSDPVTEAQAL
FT                   TGLVDSQSQSFYGKTRVAQAKRKADAARKQAKAAQQQQSQHSKASLVDDTMSMSAGDVM
FT                   NYAGGLTSAIGGGDKSDSSKSAGSGTNDSAKSSDTGDSGNGKASDASDSGNNLDTAPVL
FT                   FGFGTGGTLFKHDMNALINETVKISDAGTLLAQAVAQLDSPNTQQKTAETRYLIVIPTV
FT                   "
FT   CDS_pept        complement(295358..298093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0222"
FT                   /product="valyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70369"
FT                   /db_xref="GOA:E8MX66"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX66"
FT                   /protein_id="BAJ70369.1"
FT                   /translation="MTEGKSIINANLTPLPDKVGVDGLEDKWRTVWDEDGTYKFRNTRD
FT                   RKAVYSIDTPPPTVSGSLHVGHVFSYTHTDVIARYKRMRGYDVFYPMGWDDNGLPTERR
FT                   VQNYYGVRVDVSLPYDPDFKPPFEGTDGKKIDAKDQVPISRKNFIELCERLTAQDEKLF
FT                   EALWRKLGLSIDWSQTYHTIGQHPQRVAQKAFLRNLARGEAYQQDAPGLWDVTFQTAVA
FT                   QAELESREYPGFYHKVAFRFEDGTPIYIETTRPELLAACTSLIANPNDERYKQYFGQYV
FT                   YSPLFKVKVPILAHPAAEMDKGAGIAMCCTFGDVTDVEWWRDLKLPTRPIIQRNGRIVM
FT                   DTPDWIEDPAGREVFAETAGKTTFSARKIIVDKLRESGDLDGEPTPTKRMTNFYEKGDK
FT                   PLEIVTSRQWYLKNGGTDAKLNAELIERGKELEFHPDFMRVRYENWVHGLNGDWLISRQ
FT                   RFFGVPFPLWYPVNASGEPDYDHPITPSEDRLPIDPTIDVPEGYDESQRDVPGGFTAEK
FT                   DIMDTWATSSLTPQIVTHWAEPDEASKALFASTFPMDLRPQGQDIIRTWLFSTVDRAHL
FT                   ENKCLPWAHATLSGWILDPDHKKMSKSKGNVVVPNEPIEKFGADAVRYWAAAARLGLDA
FT                   TYDIGQMKIGRRLAIKLLNATKFALAIGREDENHHVGAAAEAAWNPADVTEPLDRAAMA
FT                   KLALVVRQATEALESYEHSKALEVIESYFWQFCDDYIELVKNRAYGTPDEHGNVPSEKA
FT                   VKSARTALGLGLDAFARLLAPYLPYATEEVWSWMHAGSGSVHRAAWPVVDPYVEAATGA
FT                   SPELLTWAGKAVEQLRKIKSEAKVSMKTPILSVALSAASEGVEAIHAALGDIAQAGRVV
FT                   GKFDLVAKHAEESAAEGTPETEVAVEASELGEPPAKKPKH"
FT   CDS_pept        complement(298237..299763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0223"
FT                   /product="ABC transporter substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70370"
FT                   /db_xref="GOA:E8MX67"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX67"
FT                   /protein_id="BAJ70370.1"
FT                   /translation="MQHSKRDNTWSKWGIFLGVAVALGALVVVGWTFMQNRFQPGSSLD
FT                   ADVTIGIDDMPQSLDIRSDSSAAAERLLVDNVYETLVTVDQDNKLQPGLATSWKTSDDG
FT                   LTVTLTLQSGVTFSNGHTLDASDAVWSLQQNVTNKVADVDELGDLASVANPNATTVVIT
FT                   LAKPNPTLLRALSGRLGIVYDSESSSADYQRKAIGSGPFTVADFQPGHSLKLARSDTYH
FT                   GTKAASNVVEFMQYSDADALSKALTDGSLDMAAPVSASTATGLNGKDGLTVKEGATTDK
FT                   VLLAYNNGTDSLLSDEQARKAFRYQIDAAGIASAQPDAAGALGGPISLLEPGYEDLTGL
FT                   YPHDENQAGQMFSYFGAQYLTTVNLVVPEEYRSLAETIKQQIERQPRPTVNLEVLSDED
FT                   YAKRIKDGKWELTVMSMDGTDDAGIFADPDSMFHYDHTEAQQAYADARAATNDADYEAR
FT                   MKAYARLISEDAASDWLYTRKCFTVASTKVSGYPTSMINRRMPLAGLTVK"
FT   CDS_pept        complement(299825..300511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0224"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70371"
FT                   /db_xref="GOA:E8MX68"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX68"
FT                   /protein_id="BAJ70371.1"
FT                   /translation="MRETKSARLTRMHDEYDILRQVIPAPACALHFSNPLELLIATVLS
FT                   AQTTDKRVNTVTPELFATYPTARDLAAANPAQVEDIIHPLGFYRSKTQHLIGLATALDE
FT                   RFGGVVPRTMDELTSLPGVGRKTANVVLGNAFDIPGFPVDTHVMRVTGRLRWRSDWRSA
FT                   HPDPVKIEKEITSCFPPEEWTNLSHRLILFGRATCHARTPDCANCPLSDTCPSYAPPAG
FT                   KSTSKR"
FT   CDS_pept        complement(300570..301370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0225"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70372"
FT                   /db_xref="GOA:E8MX69"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX69"
FT                   /protein_id="BAJ70372.1"
FT                   /translation="MTDLTLMTFASDPATVLPSLALLSHRVRVLPMDAASLVKMPENTI
FT                   LFLDARDDLATAKTLCRLIHASGLSTPIVLVLTEGGFTVVNSQWGIADVVVATASPAEV
FT                   EGRLRLVSERGNAPAAAAAGSPAESTTTVEDGQIRSGDLIVDTNGYTASLHGRPIDLAY
FT                   KEFELLKYLVQHPGRVFTRAQLLQEVWGYDYYGGTRTVDVHIRRLRAKLGGEYEHLIGT
FT                   VRNVGYRFDPPETDKETAAAQQAAKASSAAIDTDDDTPDLNTVA"
FT   CDS_pept        complement(301531..302235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70373"
FT                   /db_xref="GOA:E8MX70"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX70"
FT                   /protein_id="BAJ70373.1"
FT                   /translation="MTEITQEGWKNKALSMLLAQLTSYVLFIAATVIPSPGTVPIIPLI
FT                   IAALTLAAFVVFWPFRGSILDRIVTLVFGAISLIFVIVPFPTSEVPPDQTAADGSVLPW
FT                   YSWALAMGLLLVVLVVFSFGRQMAREKREHLIRALSHAVTSGVAALAVAGWCFLPDLGA
FT                   MLAKGTVAGTVALIILIVLGLALAVASTLWVRDADPDPDIRYPWIGTGLMPVMLMGVTI
FT                   AATALVLGRIIG"
FT   CDS_pept        complement(302344..302928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70374"
FT                   /db_xref="GOA:E8MX71"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX71"
FT                   /protein_id="BAJ70374.1"
FT                   /translation="MISIIIQILLISVSVAMDAFAVSIGKGLTVSRVRVQDAVKSTLWF
FT                   GGFQMLFPILGYFAASTFSKYVTQFDHWIIFALLVFIGGNMVHEAFEEDEENSKETAQF
FT                   DWKHMLPLAVACSIDAFAVGVSLAFMFTKAHMAFAILSIGVVTGLFSAAGLHIGRAFGS
FT                   RWQKPAQIAGGVVLILLGIKVLLEHLGVIAF"
FT   CDS_pept        complement(303162..303656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0228"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70375"
FT                   /db_xref="GOA:E8MX72"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX72"
FT                   /protein_id="BAJ70375.1"
FT                   /translation="MAETFNVVVEIPRGSKNKYEVDHETGRVFLDRTLFTAMGYPDDYG
FT                   YIDGTLGEDGDPLDALVMIPNSVFPGCVVECRAVGLYHMVDEAGGDDKVLCVPADVRFD
FT                   DIKDIDDVNEYHKAEIKHFFEQYKALEPGKEVLPGDYWTGADAAEKEIIAARQRLADSE
FT                   K"
FT   CDS_pept        complement(303884..306124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0229"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70376"
FT                   /db_xref="GOA:E8MX73"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX73"
FT                   /protein_id="BAJ70376.1"
FT                   /translation="MAAVQHRATTRTSNTDNSTTKTKSKATSARKSPATKRKRVSAETA
FT                   RAAAALKGLAVEAPAPSIEANEPGQFGRINVMDITPAEERGIFPARVELGEPFEMTAQV
FT                   FIEGRTKVGATAIVRNPRGKETMRRAMTCVNPGLDRWTVMVKCGEHSDLKPWEDGYAAV
FT                   KRQLGEWTVTIEGWEDAYVSWLHDARIKVRVMDDVDNALNSGAELLARWAETPDTGLTA
FT                   RDRKTLEKAAETMADQTLSAEDRLAAGDNPTIAALHETHPLRDGISPSQPQRFKVERPK
FT                   SSFAAWYQFFPRSEGATIDPNTGKIIQGTLKTSMAGLERAAAEGFDIVYLPPVFPIGVT
FT                   NRKGRNNTLVAGPDDPGSPFGIGSELGGHDTVDPLLGTMDDFKALCQRAHELGLEIALD
FT                   FALQCSPDHPWVKAHPNWFRHKPDGSIAFAENPPKKYQDIYPIDFNADMPGIEKEVERI
FT                   MNLWIEAGVTIFRIDNPHTKPVRFWQDVIAAVTKKHPEILFLAEAFTRPGMMRALSYVG
FT                   FTQSHCYFPWRNTKDELEEYLPVTNGDDGYYQHNTFWPTTPDILTAYVRDNGVAGHCVR
FT                   AVLAAMGSPSWGIYNGYELIENKQRPGFEEQIDNEKYEVKVRDWSKAKQYGVAEMLTAL
FT                   NKIRRAHPAALSYHNLTVLPTSDPNILAFARHTPAELTGTGQADTLIVVVNLDGHNAHQ
FT                   SMIHLELSELGLPTDRPLNVRDELTGREFQWGWDNYVSLAPWADVAHILSVQ"
FT   CDS_pept        306368..308359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0230"
FT                   /product="putative cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70377"
FT                   /db_xref="GOA:E8MX74"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX74"
FT                   /protein_id="BAJ70377.1"
FT                   /translation="MITTWRQRGMAIVAMLTGLIIMVGVVFGSANTAYAATLTPADERY
FT                   HVAFPYNDMEYYVGVAGLDASGNKYYCIEAGKLSDYVIGPTTVLASDENARRMAWILDR
FT                   YRDTDAATHAAIGIIVQDHFGRDRDEWARQMAVIQGRYPEIVAKAARIWDQSAGKTPAG
FT                   TTVERTDAEALRSGSISVKVVNRAGDAIAGVPFTVTLQGAARFVQGGNTFSGVSTSAGS
FT                   SIAWEATGAGEVTANTTYEYGRMHVMDSTQDMLAFDSMASTGGASTTFRVRKDFVPAVS
FT                   TKVSEKVLDVASPVFDDVTSGVADADSYWVPDLELQARGYYFDGLDTGDVGNVITPNAQ
FT                   ESADAFLARLATLGYEPVAYGKASFTGVGQQARVQAMTKPDDGAAYRTKQNSGFGTWVW
FT                   VFRRSEQSKQAQEYLIGDWISPFMEATESNTSRRKLEVMSTVTEHSADIGAELSDTITV
FT                   SGFPADHGQYAGNEEYEFAADRPYATVSVWWSGDPDNPSNDEAYKPSGGEVPTEDDNHR
FT                   LLATWEIPAMNGTFKIGAGALDAHGAPMYLTAERPGWYVFVWRFEGDDRVSPASSRYDD
FT                   AWERVRVLPPCESEKPCEPEKPETPPAPAEATTPNPRPSLPVTGGDVSLASVLAVSALA
FT                   IGAILSIVVRWRRRYDRFKHWTMRWPIR"
FT   tRNA            complement(308675..308751)
FT                   /locus_tag="BLIF_tRNA11"
FT                   /product="tRNA-Met"
FT   CDS_pept        308967..310001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0231"
FT                   /product="homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70378"
FT                   /db_xref="GOA:E8MX75"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX75"
FT                   /protein_id="BAJ70378.1"
FT                   /translation="MPIKIPSGLPARDILDSERIFALEKPEAERQRVRPLKLVILNLMP
FT                   KKIETETQLLRLISKSPLQVEIDFMKTSTHEATHVSADHLVKFYENLDAFKDNYYDGFV
FT                   VTGAPVEHMPFEDVDYWDEFKTILDWASTHVFSTMYLCWGAMGALYYRYGIHKVDYPEK
FT                   IFGVFPQYLQDEYCFLTNGFDEIDLQPHSRLAGVNENEVRANHDLQILTWGPQSGPGLI
FT                   ATRDFSEVFALGHWEYGKYTLAEEYERDMAKGMTNVPFPKNYFPHDDPKLEPLFAWRAH
FT                   ANLLWRNWLNWVYQTTPYDLTEVPQLRAEKKLGTDRSIRHEPGGPRQDDFKPFVHDGYG
FT                   VIQG"
FT   CDS_pept        310463..311275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0232"
FT                   /product="ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70379"
FT                   /db_xref="GOA:E8MX76"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX76"
FT                   /protein_id="BAJ70379.1"
FT                   /translation="MVGSLSAGLLLADEAGAHLPSVDDFLPPEILFQGTPFAINRIILI
FT                   RIVATIVLLVVLGVTAKRAKLIPGRWQGVVEYGLDFVRDKVVYDVMGEARGKRYVPMIT
FT                   TLFFTIFIFNLCGIIPGMNMAANATVVMPLVFAVWTLIQYWIAAIRSQGLGHYLRHELF
FT                   TPGVPWPVYFLLAPINLLELLIIRPASLTIRLFANMVSGHLMVATCLAFAQFWMVDAVN
FT                   KLQGIPVGALWFAGGFAMTCFEAFVAFLQAYVFAILSTVYINLSFPEE"
FT   CDS_pept        311379..311606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0233"
FT                   /product="ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70380"
FT                   /db_xref="GOA:E8MX77"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX77"
FT                   /protein_id="BAJ70380.1"
FT                   /translation="MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPE
FT                   MSGKIQTIMFIGLALVEVLALIGFVAALII"
FT   CDS_pept        311663..312181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0234"
FT                   /product="ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70381"
FT                   /db_xref="GOA:E8MX78"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX78"
FT                   /protein_id="BAJ70381.1"
FT                   /translation="MTQAASGIDLFIPEVYDIVWSLIILVIVAVFFYKFFMPKFNAIFD
FT                   ERAAKIQGNIAKAEQARKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIIADARSR
FT                   AESDAAQITASAQRSIESQHQQAIVSLKGEVGALATALAGKILGAKLEDSDVQSSMIDS
FT                   MIDDLGAKK"
FT   CDS_pept        312216..313052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0235"
FT                   /product="ATP synthase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70382"
FT                   /db_xref="GOA:E8MX79"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX79"
FT                   /protein_id="BAJ70382.1"
FT                   /translation="MRGEASRIADRESRDSLAPKLRDTREDAWRIGNELFTITKVLDDS
FT                   IQLERALTDPSRPVADKVAVLKELLGDNAHPMTMEIMTDLVSRRWSRARDIANAVEDFG
FT                   VDAMMYYADATDATLQVSIELSELHSALLNLPVVRAKLYDYQATSEARVKLFREVFSGK
FT                   TLNKVTMRLAEHATCNLRRRRYLETIQWLINKFSRHMGESMVTVTTATPLKKEQIKRLV
FT                   EVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRKVQTEATPA"
FT   CDS_pept        313128..314759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0236"
FT                   /product="ATP synthase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70383"
FT                   /db_xref="GOA:E8MX80"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX80"
FT                   /protein_id="BAJ70383.1"
FT                   /translation="MAELTIDPASIRKALDDFVSSYKPSDTPTQEVGYVATAGDGIAHV
FT                   TGLPGCMANELLTFEDGTLGLAFNLDAREIGVVILGDFAGIEEGQEVRRTGEVLSVPVG
FT                   DGYLGRVVDPLGKPLDGLGEIQGIEGRRILEAQAPDVMHRHPVDEPLSTGLKAIDAMTP
FT                   IGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDPKKQVRCIYVAIGQKGSTIASVK
FT                   QSLEDAGAMEYTTIVASPAADSAGFKYIAPYTGSAIGQHWMYNGKHVLIVFDDLSKQAE
FT                   AYRSISLLLRRPPGREAYPGDVFYLHSRLLERCAKVSDDLGGGSMTGLPIVETKANDVS
FT                   AYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGAAQTKALKKVSGTLKISL
FT                   AQYRSLESFAMFASDLDAASKAQLTRGAHLTELLKQPQFHPYSPEQEVVSVWTGTHGKL
FT                   DDLDLKDVLPFEQGLLDYIDHNTDILKTIRETEEFTADTEAALDKAVDEFRSTFVSSAG
FT                   KPLVEKKPDVDKAAPVDQEKIVAGEK"
FT   CDS_pept        314763..315686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0237"
FT                   /product="ATP synthase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70384"
FT                   /db_xref="GOA:E8MX81"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX81"
FT                   /protein_id="BAJ70384.1"
FT                   /translation="MGSQLALKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPY
FT                   TDAIFDAVQALVAHTHITHPIAVKDEKNPRVAVLALTSDRGMAGPYTSSIIRETESLLS
FT                   RLDAAGKQPELFVYGRRGSTYYRYRNRDIAATWEGDTDQPGVEIAETISNTLMDAYMKP
FT                   AEKGGVSELYIVYTEFINMVVQKVRVLRMLPVEIVKNETKVPDSDEEAPATADVAPLYT
FT                   FEPSLEKVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNARNLIDDLTRKLN
FT                   ASRQASITQELTEIIGSADALTKKEE"
FT   CDS_pept        315695..317167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0238"
FT                   /product="ATP synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70385"
FT                   /db_xref="GOA:E8MX82"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX82"
FT                   /protein_id="BAJ70385.1"
FT                   /translation="MADNQTTAAEPTNGRVTRVQGSVIDVEFPVGHLPDIYNALKVTIV
FT                   NTSAKEEGEAKETEITLEVEQHLGDSTVRCVALKPTDGLVRGASVSDTGAPISVPVGDV
FT                   TKGHVFDVSGNILNKKPDETITVSERWPIHRNPPAFDQLESKTQMFETGIKVIDLLTPY
FT                   VQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEMAEAGV
FT                   LEKTALVFGQMDEQPGTRLRVPLTALTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVST
FT                   LLGRMPSAVGYQPNLADEMGSLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHL
FT                   DATTELSRDIASKGIYPAVDPLSSTSRILDPRYVGQAHYDCANRVKAILQRNKELQDII
FT                   ALIGIDELGEEDKTTVNRARKIEQFLGQNFYVAEKFTGRPGSYVPADETIEAFTRICDG
FT                   VYDDVPEQAFSGIGGIDDLEEKWHNMQKELGA"
FT   CDS_pept        317164..317460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0239"
FT                   /product="ATP synthase epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70386"
FT                   /db_xref="GOA:E8MX83"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX83"
FT                   /protein_id="BAJ70386.1"
FT                   /translation="MMAAEKTTMKVNIVAADHPVWHGEATSVTIPASEGGMGILPDHEP
FT                   VLTVIKQGTLTVVEPDGDRHMFEVTDGFISFDSNKLTVAVERGHDVQYSGTAE"
FT   CDS_pept        317548..318318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70387"
FT                   /db_xref="GOA:E8MX84"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX84"
FT                   /protein_id="BAJ70387.1"
FT                   /translation="MRVIVADCSAEYSGRLNASLPLAKRVLLIKADSSLLIFSELGSYK
FT                   PLNWMTAPCTIREIDPAAKSAQHSRESVAGGAVDGDSATHSPESVAAGEPEKVLRVSAD
FT                   KGSDILEVTLQHIYSDQTYDLGEDPGLIKDGVEDHLQRYLAEQIERIGKGAKLVRREYP
FT                   TAIGPVDIMAVNAEGEHVAVEIKRHGGIDGVEQLTRYCELLNRDPLLAPVHGIFAAQTI
FT                   TPQAQVLAKDRGFTCLILDYDDMKGTEDDSLRLF"
FT   CDS_pept        complement(318364..319332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0241"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70388"
FT                   /db_xref="GOA:E8MX85"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX85"
FT                   /protein_id="BAJ70388.1"
FT                   /translation="MRKSVKSMLSPLGKAVALACSLAMCVSLAACSSSSSDSKSSSDSS
FT                   DKKGQIAGVTAKGKLGEKPTISFNTPMTVSDGSYVVLQKGDGDVIEEGDRVCAQGIALN
FT                   VKDGTELMDTWTKNTPDCSLKVDSKTLSSTYYNQIKGAKINTTIGFGVNAQDSSGYSYI
FT                   LAMTFVSKSKDLEKATGEEVKDVPANLPKVTRAKNGEPSIDMNGQGSVDSLISQTLIKG
FT                   NGAKLTDKNTVVVKYTGWLTNGKQFDSSWDRDSTIDADLFSDSSGQHQVIEGWQKGLVG
FT                   QTVGSQVLLVIPPDQAYGDKEQGPIPANSTLVFVIDILAAY"
FT   CDS_pept        319413..320492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0242"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70389"
FT                   /db_xref="GOA:E8MX86"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX86"
FT                   /protein_id="BAJ70389.1"
FT                   /translation="MSAEEQTTRPDKGAKRPSRHAKIMRGVVTPIFGLLAVAAVVLGYM
FT                   NATMWKPSTEITASATMSGSRYVVTDPNVLTLLDQNATITVDSGSSQDEACVALGSSKD
FT                   VAGWVASEKSYTRITGLASWSELSTQKGSSTSQGAPTSADDAVSFKDSDMWTAVKCGTG
FT                   SVSLKSKKTGASTVAIVDLGENVTNAKVQLHWVRSEVPDFAMPFYLSGGLLAVLAVLCA
FT                   SVFAMPPHKRRKRMVEGMASAVIEEEAPASIAVSGKPDGASRRNRRRHATHRRSGRASS
FT                   QSSQSEATETPVIIDPSSRNLVADQQTGAESGAEPGLSAGDNESTSVITPDELQAYFSR
FT                   LAQEVNTGDDSADDGQEES"
FT   CDS_pept        320492..321499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX87"
FT                   /protein_id="BAJ70390.1"
FT                   /translation="MNKRWNKLCVSALACMALVVPLTACEGQLPTPAADTSTKVAPDLT
FT                   EAQEKKIRLKILKTIDEADQAKNPDGYAAVMGGPQLDIRISQTTINQRGGGMSKYATIP
FT                   KDIAQTVIPTDDGWPRSVFTITTTTEDQQSKRLLVFDQESAQQNYKLMAMARLFEGAKL
FT                   PKFEIPTIGSQMGTAKDEKLVAAPADALAQYADVLQNGSKSQYASKFADDLLRQELANT
FT                   TAKVQEGMQRNNGTQEQKFTAVPEQMWVMRAADGAGDLVVGRINGEWTRKAGDGRESQP
FT                   ASDDEKALFNSDKYTSTMKVTYVNVVALYIPLASSGEQITAVGADRQPVKVEAL"
FT   CDS_pept        321713..322720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70391"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX88"
FT                   /protein_id="BAJ70391.1"
FT                   /translation="MYANRVESGGIMAEQQFNPGVSLAGAVDLEALKHQVKAKPGQAGG
FT                   APAAGGYVIDTTENTFQAMVQTSATFPILLLLWIPTDDRLFPMARALGDAVNALNGQIQ
FT                   LSRIDISSNPSIAQALQVQGAPALFALIAGRPMPLLQGLPGDDELKQLTDEVIPKIIQA
FT                   AAQSGVNGTAPYSGDPDSDAAKSAGATGAGVGAEQVPPEHAEAHRLAEEGDYAGAAAEY
FT                   ERVLESDPSDALAARERAKALLLARSGAADVRDVRAAAAAAPDDVEAQLAVADIDMIGG
FT                   QIQDAFDRLLDFLAAGHKADIEQVRKRLLEYFAIPEPTDPRLTRARRRLATLMY"
FT   CDS_pept        complement(322803..323429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70392"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX89"
FT                   /protein_id="BAJ70392.1"
FT                   /translation="MSEPTDDFEYERRFFCRELPAEYDDGDAPTLIIQSYYVHADNYAL
FT                   RVRLVSRKVHVDMTPDVNPVAVLDEYRDRFSEAYVTVKGPSVGGTRYEVEREIDTRIAA
FT                   ELIKRGGSVIIKNRYSVWIEEDGWSVDVFGGPNAPLIVAEAERSGPVTNLTIPKFCITE
FT                   ITDQARFNNDGLANRPFCKWADDFEEELALEGPRFQQYFGKNRMV"
FT   tRNA            323527..323602
FT                   /locus_tag="BLIF_tRNA12"
FT                   /product="tRNA-Arg"
FT   CDS_pept        323968..324357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70393"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX90"
FT                   /protein_id="BAJ70393.1"
FT                   /translation="MSEKMEAVATSEAPAALGAYSQAVKANGFVFVSGQLGIDPATGEL
FT                   AGETAGEQAAQALKNIKHILDTAGTGIEHVCRATIYLKNVEDFKEVDARYAEAFIGSVK
FT                   PARVAFGNNMIPKGALVEIDAIAVE"
FT   CDS_pept        324465..325457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70394"
FT                   /db_xref="GOA:E8MX91"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX91"
FT                   /protein_id="BAJ70394.1"
FT                   /translation="MWFRGTFPGTLRWNRWAVVRATIETMASKGKPSPRSAVSPLSDEQ
FT                   VKRLAVRHTLVDSTQYYPTGPRTPNQPEINAQNPKATKRLLGGVSIVFRASCKTKAWGL
FT                   EQVPETGPFITAASHVTMFDVFVPMMSLFHIGRRPRYMAKAEMAKWPLIGKWFQLVGMQ
FT                   PVQRHSGKAKQIEETSIDILTSGRPLTVWPEGTVTRDPKKWVMSIKEGVGYIALESSRR
FT                   LGHQVPLYPAVTWGAASINHWWPWPRKNVVMCYDHALDYSDLLADMDSWGEEPPAEAVN
FT                   ELMWRVLKRMNTVLEEIRGEQFPAEGYWDYRSMSRKPWPEAGGPFPAEK"
FT   CDS_pept        325551..326552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0248"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70395"
FT                   /db_xref="GOA:E8MX92"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX92"
FT                   /protein_id="BAJ70395.1"
FT                   /translation="MGKNITVLGAGAWGTAFGQVLADAGNTVTMWAKEQQIVEGIRDHH
FT                   HNAVRLPSVEKLPDNMTATGDRAEAVKNADIVVVAIAAQFARVALVEFKGLIPDHAIVV
FT                   SLMKGIERGTNKRMDEVVRESLDLPADRFAAISGPNLSKEIADRHPAATVVACTNLDNA
FT                   TKVAEACTTSYFKPFVTTDVIGLEMCGSLKNVTALAVGMARGAGYGENTAAMIETRGLA
FT                   ELTALGVAAGADPKTFFGLAGVGDLIATCGSSLSRNYTFGANLGKGLTVEEATKVSNGV
FT                   AEGVPTTDAVVALGDQLDVPTPLAYQMSRVLNEGISCSEMLAGLFGHEVTGE"
FT   CDS_pept        326739..327926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0249"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70396"
FT                   /db_xref="GOA:E8MX93"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX93"
FT                   /protein_id="BAJ70396.1"
FT                   /translation="MAKKRVVVLYGGRADEHSISCISTAGVLGAMDTERFEPIPVGITK
FT                   DGKWIINGEDPRGWNLDGGELPTVKITPESRPVMLDPSRGQDGFFIGEPSHINSADSGF
FT                   GTSFVSMSDPEMHHVLTSLGHVDAVLPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASA
FT                   ACMDKHYTKVVLDAAGIPTAPGVTVDARNFTAADVLAEIEDAGLTYPLFVKPSRAGSSF
FT                   GVTKVEKADDRETQQDRLAAAIATAGEHDWKVLVEQGIDGREIECAVLCPKAGDEPEAS
FT                   WPGEIVLDHQNDDQFYDFDSKYMDASASHVEVPANLPVSVLEDVRDVARRAFKAVDGAG
FT                   LSRVDTFVTPDGTVMVNEINTMPGFTPISMYPKAWDATGVSYTELITRLIEGVLR"
FT   CDS_pept        328179..329345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0250"
FT                   /product="ABC transporter substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX94"
FT                   /protein_id="BAJ70397.1"
FT                   /translation="MNNLRKIAAGSLAAVLAFSMAACGSSNASSDGTGESTGKAVTVNE
FT                   KSAKATSLADFGTMEDLEKAAKEEGALNVIALPHDWSNYGEVIESFKKKYPEIKVTELN
FT                   PNASSKEELDAAKTNKGTDAAPDVFDVGQAIAATSTDYFAPYKVQAWDKIPDTAKDADG
FT                   AYYADYTGIMSVGWNADKYGDISSLDDLLDPKFAGTVALNGKPAEAGAAFNGYLMANQL
FT                   AGGDINNLQPGLDYFKKLKEAGNLTTVDVTNGTIDSGQTGVVFDWTYNQASYKKELKDK
FT                   GVNWKYKTFPKAQVVSYYNQAINKDAPHPAAARLWEEYLYTADAQNLWFKGGANPVLLD
FT                   SMKEDGTVDQATLKDAITIEGEPVSYTNDDSTRITEWLQNNWDKTIGN"
FT   CDS_pept        329357..330307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0251"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70398"
FT                   /db_xref="GOA:E8MX95"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX95"
FT                   /protein_id="BAJ70398.1"
FT                   /translation="MTAAIAPIASNGPAAAKAAGPSATPASPLSSAMAKHRQELGTLAT
FT                   TLPFFAYTACFLLAPTVIVIVGAFQDRSGNFTLANFNKMFEANTIAAFGTSILVSLASS
FT                   LIGAVVGALASYALVIGAKPNGLLRRMVSAISSVLAQFGGVMLAFAFIATIGINGIGTM
FT                   LIKTLTGYTVNPNWLSSLPGLVTIYCYFQIPLMIIIFLPAVDSIRPQWREACESLGGNT
FT                   FQYWTRVACPILAPRFISAFLLLFASAFSAYATAAALFSQRSILVPLMIQGAMRNELDP
FT                   NQQGFAQVLAFAMIIVVAIVMLLSHAVEKRAGRWQ"
FT   CDS_pept        330304..331158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0252"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70399"
FT                   /db_xref="GOA:E8MX96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX96"
FT                   /protein_id="BAJ70399.1"
FT                   /translation="MTETSATKPPQLRAARARKQSIIKFVILFVTLAFLFVPLLAMLIF
FT                   TLRHPLSGRWSAAPWIAIFTGNGESLGADLTVLWQGIGTSLALSAVTVVIMLVLLVPTM
FT                   VIVHIRSKVLERAIEWVATLPLTIPAIVLVVGLGPIYRWLSADVLSTNPIWLCFAYVIL
FT                   VMPFAFRAIAVGLNSIDVKTLVEASRSLGASWPKVFFKVIIPNLWQSILSASFISIAVV
FT                   LGEYTVASLLGRMNLQVALYQLGQSNSQISTAMSLLALLFGAVLLVALDLISDAMRKSR
FT                   EGK"
FT   CDS_pept        331163..332440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0253"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70400"
FT                   /db_xref="GOA:E8MX97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX97"
FT                   /protein_id="BAJ70400.1"
FT                   /translation="MNSNSIFTRRHAGADAAASVSAPATTSAAAEDAFKNDPTATLEGV
FT                   RGKDVTKAAKALLKDSVKRGGGSIQMRDVVKIYPGSTVHALDDFNLDIKPGEMVVLLGG
FT                   SGCGKSTALRSLAGLEDIQGGRIMVGGQDVTGVPVNKREMAMVFQAYSLFPHMTALENV
FT                   EFGLEVRGMGKAERRKIAMEQLELVGLADQAKKYTQQMSGGQQQRVALARALAVKPRVL
FT                   LLDEPLSALDAKVRVQLRDQIRRIQLTTGTTTVFVTHDQEEALAVADRIGVMNKGKIEQ
FT                   IAAPQNLYQRPATEYVATFIGLTNRLPGASNGDEAVVFGQRVPLLAGSAKGDSVAVLVR
FT                   PENLTLALAGSSDSHVGERARVEVIHFLGSLVRVDTVITSGEYQRWNKGEQLKATVQLP
FT                   ASELPAGLAVGDDVIVTPRPVAALAC"
FT   CDS_pept        332756..333787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70401"
FT                   /db_xref="GOA:E8MX98"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX98"
FT                   /protein_id="BAJ70401.1"
FT                   /translation="MPPAQQPQAPQQSQQPQQSPRDWWFTAHRRFSTIGSALAIMMVFW
FT                   IGLNILATEALRTLLGTDVPAWAVLLASSGPLYVVAMPLSMLAFTRVPVIRTRQYPMKA
FT                   GEFIQIFVMCIPVMFLGNMIGNILSAGATDGQATNRINDVILGSDWRVNALFIGLLAPV
FT                   CEEWIFRKEIISRLRRYGEKTAIIFSALAFALFHMNVFQFFYAFGLGLMFGYVYTRTSR
FT                   LRYSVAMHMLINLNGSVLAPLVIQQIDPRILDGTVSEAEIMRMAEAGNMGDMGIMMLYG
FT                   TVMLGLCIAGIVLLITKRKSWEFYLAPEELPAGLKIRTAYANPGVIAYLLLTVMLTGWM
FT                   LFA"
FT   CDS_pept        complement(333826..334623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0255"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70402"
FT                   /db_xref="GOA:E8MX99"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX99"
FT                   /protein_id="BAJ70402.1"
FT                   /translation="MTEYAEDIARWFQVNAGKLIWLTIVLAIVFVADRVISRVLRKILD
FT                   NSQIPSASIFVNLTRVTIWVTGAAMVLQPVFGINPTTLITALGVGGVAISLGLKDTIAN
FT                   IIGGFGLMLGRVIQPGDLVTIQGVTGTVHDITWRQTVVRTRSGDMMVIPNSVLNTAALT
FT                   KLTPVSEGMATLEFTAKASGDPSAISQDILDRVTKATADVALEGQPPLVKFTGFSPYGM
FT                   TGQVLVFAREGVLPSTIKDMAARAIAGSGTEYLVEDGGSSGNL"
FT   CDS_pept        complement(334704..336176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0256"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70403"
FT                   /db_xref="GOA:E8MXA0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA0"
FT                   /protein_id="BAJ70403.1"
FT                   /translation="MLAFPTHAQEDGSMSETSNKTRLEHDCIGQMEVPANVYWGIHTQR
FT                   AIGNFPVSGITDSQHPELIRAYATVKRACAIANEELGLIDPAKAEAIRAACLEIEAGKL
FT                   ADQFPVDVMQGGAGTSSNMNMNEVIANRALEIAGRQRGDYTYIHPNDDVNKSQSTNDTY
FT                   PAACKLALIDAIGPLAESTKKLAKAFHDLADKHINDVTIGRTQLQDAVPMTYGQEFHAF
FT                   ATLLKSDLAAFDRVVPLLAQLNLGATAIGTGICADLRFRKSAIKHLSQITGLPVTAAPD
FT                   PVAAMTDMGAYVATSAAIKSLAVHLKKAADDLRLLNSGPRCGFNDLNVPARQAGSSIMP
FT                   AKVNPVIPECVNQCCFTIFGMDVTVNWAVAEGQLQLNAFDPVMVHELLTGMALLTHAME
FT                   TFRVNCVEGIEINADLGRSYAQSSPSISAALNHYIGYEHAADIAAEAVHTGRTVREVAG
FT                   ERTDLPAEQLDEILDPIRLARGLGQTCRERQE"
FT   CDS_pept        complement(336255..336986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0257"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70404"
FT                   /db_xref="GOA:E8MXA1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA1"
FT                   /protein_id="BAJ70404.1"
FT                   /translation="MPRPRHDSEVLPAKERLENAFWELLADRDYRKITVTDVVREAGVN
FT                   RNSFYYHFSSLPELADSAILHQVESIPINRTPDPNGNPEEQWRDRVTATLSDPEQRQRL
FT                   DHLALLAGPHSTLELTESLRDFCRLQMLSTLQRDPKNLDLKTDLMVEFTVGGMLAVLQR
FT                   WPELSDTIEIKDLLKEDVSVLAMGIYLAMSQKDMLNYWNRIFVHNAQDSTAPGMSVAAT
FT                   HAAPSTISSSNGPAGFPGYTA"
FT   CDS_pept        complement(337077..338483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0258"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70405"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA2"
FT                   /protein_id="BAJ70405.1"
FT                   /translation="MTGIIDYAHTETRSFADLPFNEIDALIISTLIYEDVASVCPTLML
FT                   DETRSGSFAARIRAFEPKHPLIWLKGIWHPELESVSLDEANRELHRSPETHADDKPHEA
FT                   QMVSAVNPDLTHDLFQAAGENPRYANVRLGAVVEHINQGEQTQFAAATFQLPDGHKRRK
FT                   PTYKGTLVISFRGTDDSLIGWKEDFNMAFQYPVPAQRSASAYLDMVARLWEGPIILVGH
FT                   SKGGNLAIYAAMNADPKVRKRIQHVYSLDGPGFPPEIVTSPAYRTIQPKVTKIVPSSSI
FT                   VGMIFETPEPCRVVSSDSDGIMQHSAFTWLLDGDQFITEPDLSSSSQLFNEELNHWIAT
FT                   LTPEQRERAVDALFTVLHANGATSFSEVMSNFPASIPAMLGAYVGLTPADRRHLVEALA
FT                   ILFKASTAKRKPTPAPASAPSSATSKATAEIPAETAAGADSAAPARADTDADAGTTASP
FT                   SAEDATEIAD"
FT   CDS_pept        complement(338805..339305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0259"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70406"
FT                   /db_xref="GOA:E8MXA3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA3"
FT                   /protein_id="BAJ70406.1"
FT                   /translation="MMMASDGEGLTELCLEDWWWATDHQAVLDSNRESDSEPDVFRITR
FT                   EWLTAYFAGERPGSDQVPPLHPAGTPFQHEVWNLVAEIPYGMTVSYGELAAELAERRGG
FT                   GRMAAQAVGGAVKRNPVTIIVPCHRVVGSGRAFGGYGGRLDIKAELLELEGVDLARFDL
FT                   PNL"
FT   tRNA            339550..339622
FT                   /locus_tag="BLIF_tRNA13"
FT                   /product="tRNA-Gly"
FT   tRNA            339669..339740
FT                   /locus_tag="BLIF_tRNA14"
FT                   /product="tRNA-Val"
FT   tRNA            339789..339864
FT                   /locus_tag="BLIF_tRNA15"
FT                   /product="tRNA-Val"
FT   CDS_pept        complement(340881..342158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70407"
FT                   /db_xref="GOA:E8MXA4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA4"
FT                   /protein_id="BAJ70407.1"
FT                   /translation="MTDPTNVHEPVPQSAKLTAREKKWIIYDVGNSAFVLLSTAVIPIY
FT                   AKSLMPADGNIVSAWGYAQTIASLVIALLMPLLGSIADVQGMKIKFFLGFFGTGVVTCC
FT                   AMALPLTWLPFLVVYILATIGLNGSLTFYDSMLIDATSNERMDKVSSHGYGWGYIGSTV
FT                   PFIFCIALIFGGPSLFDWSTVACTRASFIITAIWWVAFTIPLLTSYRQVHYRATRDQLG
FT                   SAVRGTFSELAGTFGKIVKNKPLWMFMIAFFFYIDAVNTVISMSTSYGAELGIDSTQLV
FT                   VALLVTQFVAFPCAILYGRLAGRFGCKVMITAAVVAYMCIVFFAAFFLKSAVEFWILAI
FT                   LVGMFQGGIQALSRSYYGKIIPKDHANEYYGFYDIFGKTASIIGTFLVATTTSLTGNAS
FT                   LGVLSIAVLLVAALVFLLLQKDPTRE"
FT   CDS_pept        complement(342345..343361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0261"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70408"
FT                   /db_xref="GOA:E8MXA5"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA5"
FT                   /protein_id="BAJ70408.1"
FT                   /translation="MLNLKRGIGTHEPSVISLGQVWVDIMLNVDKVPAQGGFAVADHPK
FT                   PSIGGSYRVLQAASRMGVPTEHAGILGNGLWAHFIRQSFQDNGITHIGQDRLDEDSGFR
FT                   VVLSSGAPKKTFIASYGAEAHGDSDTFDTLEPQPKDVVHISGNTLMDHTATGVDGFLLK
FT                   AGTDPAARDYTLVINPTNTLRLVNDHMLEDLVLARPVWSCNRQEAMTLAERLGAPIDDS
FT                   KVTIGGGLDDFMHQLCDGLGATLRAPLVVRVGARGAWIREPGGETIHIEGYPTKAVHTR
FT                   SAGGCHTGVMCAMLAKGHSLAESVKIANAAASIAIQHSLNGVPQCPDYDEAIALIGE"
FT   CDS_pept        343765..343959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0262"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70409"
FT                   /db_xref="GOA:E8MXA6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA6"
FT                   /protein_id="BAJ70409.1"
FT                   /translation="MAARCAVCGKGPQTGFTVSHSHRRTKRSFRPNLQSVRTTIDGENT
FT                   RLRVCVKCLKAGKVQRVAA"
FT   CDS_pept        344071..346902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0263"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70410"
FT                   /db_xref="GOA:E8MXA7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA7"
FT                   /protein_id="BAJ70410.1"
FT                   /translation="MGTTLASLVTNKRRVSALKSLGIVTVGDALTYYPFRVTEPVPLRA
FT                   IREAAPGQQMAFAAVIRDMRVVPMNARRGYRLEATVDDADFARSRRVPGSTARLTFFSY
FT                   RKSYVDWVSVRLRAGTSVVVSGMPGEYMGQLQFTHPEILTVAPVPAGAGAGLEGYARGA
FT                   ASGNGAFAGSADPYASAQSAYPPAATAPSGAALKYDADTVQEALTRVCRPRPVYHASSR
FT                   ISSEHIHETILGLLWMMGARTSSTPDGQLAGAGAAGIVAPATDTIAVQNGEEKSGTTAE
FT                   SGAEALSQSIPDVLPESVRKAKNLMHRAEAFLAIHDPASTARFKEAIETLRYEEAFVSQ
FT                   TSLLKSRQHAHKSSAHPCPLNEALETARASVGEAVAEPSTQPEASERGSATDLPDLPNL
FT                   PNLRDRFIASLPFTLTAGQSQVVDDIASDLERDWPMQRLLQGEVGSGKTVVALAAMLQA
FT                   VGAGYQAVLVAPTQVLAEQHYETISKMVSGLTLAQPGAKETDAAADVEGAMGASGASTV
FT                   SSSKVTAEIPVTLLTGGMKLAARRKALAAAASGEPGIIVATHAAFSKTFQAPHLALVVI
FT                   DEQHRFGVEQRESLNAKTDDGTTPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRK
FT                   PIRTVVVNEADAATMGRMFAHIRARVDAGERAYIVCPRIDADDEENEGGSGVSAAAGSA
FT                   RGRAAASGSSARTAAGGRATRAAADAIGIDDPYETFDENGETVARPPLHAVAEIADRLQ
FT                   KLPQFQGIRFATLTGRDKDDVKTQVMADFAGGETPILVSTTVIEVGVDVKQASCIVIFD
FT                   ADRYGLSQLHQLRGRVGRGGTNSWAFLISRAEPGSPAEQRLEVIHHSLDGAEIAQADLE
FT                   FRGAGDVLGDAQSGGKSSLKLLRVVKDADMIADARTRAEQLLAADPELAGEVQLAGAVL
FT                   DFTRGNETFLTSS"
FT   CDS_pept        347129..347740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0264"
FT                   /product="putative methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70411"
FT                   /db_xref="GOA:E8MXA8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA8"
FT                   /protein_id="BAJ70411.1"
FT                   /translation="MRVISGRFKGVALATPKTGTRPTTDRTKEAIFSHLDSWGVLDDAR
FT                   VLDLFAGTGALGIEALSRGARELVAVESSRPAAALITKTLAQLQKNRSWDASLKARVLV
FT                   KKAEQVAGGFGEPFDVIFIDPPYAYETAECNQLLSDLAAGSATNENTVIMLERSVRSDD
FT                   PTAPGGWQITESRNYGETAVFYIESADDDSDIERSDDSAA"
FT   CDS_pept        complement(347764..348579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0265"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70412"
FT                   /db_xref="GOA:E8MXA9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXA9"
FT                   /protein_id="BAJ70412.1"
FT                   /translation="MKIDIVSVFPEYFEVMNLSLMGKAQAKGLLEIKAHNLRDWTHDVH
FT                   HSVDDTPVGGGAGMVMKPEVWSECLDELLGFSQPSGSPAPSGAPVLIFPNPSAPLFTQR
FT                   DATELSHADHLLFGCGRYEGYDARIPDYYRAQGVDVREYSIGDYVLNGGEVAVSVMLEA
FT                   ITRLMPGFMGNPDSIVEESYTGEGALLEHRQYTKPAVWRGIAVPDVLLSGDHGKVDRFR
FT                   RDEALARTAEIRPDLIAALDCKALDKADRKTLMALGWEVSAAHPRRLAD"
FT   CDS_pept        348653..350299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0266"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70413"
FT                   /db_xref="GOA:E8MXB0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB0"
FT                   /protein_id="BAJ70413.1"
FT                   /translation="MNLPTRKKPEVLSPAGNLRGLKTAVDYGADAVYCGGKAFGMRSAP
FT                   KNLSLEDFEEGSRYAHERGARVYVTCNVLPRNNEIEAMHEYVGQLKDTGVDALIVSDIG
FT                   VMMMARQVAPNLELHVSTQAGVTNYQAANAFYELGARRVVLAREMDLQAVRDIRANIPD
FT                   DLDIECFVHGAMCMAFSGRCLFSNYLTGRDGNHGECAQPCRWKYSIVEEKRPGQYFPIE
FT                   QTENGAYLFNSQDMNMLGHLDDLIDSGATSLKIEGRAKSAYYIAAMTNAYKTAVNEYMI
FT                   QRGFEDADGNVLKPFHDRVIRPGDPDFGQGTEDQVMRNADAAFAGVADEGYDRGSDTAV
FT                   ADSVTGSVAAERDRVTVADAVDSTASGTPAGTAVEPDGMSSHARSTRRKSNTAVEQIET
FT                   DWKHAAVRPAPHVELPEWLLEETDKVAHRDYSTGFYYPEHKVTQNTDRSAYFRSWLVVG
FT                   EVLSWSADEDGRVTLMSRNKIEPGQQVEFLLPGERPLVFTVPETGLRDADGAPVPAINN
FT                   PAHVFSMPCPHQVPINAAIRSRTKKPTLKAE"
FT   CDS_pept        350380..351360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0267"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70414"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB1"
FT                   /protein_id="BAJ70414.1"
FT                   /translation="MPEYSEEILDSNSISSTDKAGRPIPVTIPIALAPGIKVVYTTRLG
FT                   GLSAGDYGNLNLGGKSGDEPEAVLSNRIALAEAVQARLSLVSQVHSGVAVDVDDSFVIN
FT                   TPFGFDVSGTHGETDTPHVIEADGQVTAQSGIALGMFAADCLPVLLGDPVTGIIGAAHC
FT                   GRRGLERGVIGATVDLMKSKGADPANIVATLGPRICGDCYEVGDEIADQFIKRFPLTKT
FT                   KTRFGGAGIDIAEAAMIDLAFAGVHQVVDSMPRVHAATQYLEEDPELAELCRTDGEGPA
FT                   ELAERIDNISRSMCTLENPLWYSHRRAALANKTHEGRLLALIVRD"
FT   CDS_pept        351440..352315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0268"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70415"
FT                   /db_xref="GOA:E8MXB2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB2"
FT                   /protein_id="BAJ70415.1"
FT                   /translation="MTERDFDTPVETPTVQPAPAQGAKTAQTVPVVAVVLAAGFGTRFD
FT                   PDNPKQLVSVGGKPIVCWSIDAFEHCDRVSDIVVVVNPKVRGEVETLVGEMGYTKVRVI
FT                   IDGGDERVDSTAAALDMLATAGIPDDAKILIHDAVRPFVEQSAIDGSIDALDQFTAATV
FT                   AYASTDTVLLTEDLGDLKVVKSVPDRPNTFRAQTPQSFRFATIRHAYDLAAADPDFHPT
FT                   DDTRVVVDYLPDEPVAIVSGAETNLKITTLEDIPTAERIAEEILGRDPKEEARARMHAL
FT                   LAQAAGQMHR"
FT   CDS_pept        352325..353002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0269"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70416"
FT                   /db_xref="GOA:E8MXB3"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB3"
FT                   /protein_id="BAJ70416.1"
FT                   /translation="MRELNVVISGFDHYDGVEVNPAVEVPKAIAEQGLGVSSAPDDPLE
FT                   QVAVTVHAVSIPVSFAKAWPTLKETIEATKPNIVIATGLKHAARGVMLERCATNLMDAI
FT                   KPDADNVTPRREPIDPNGPAAYWTRLPLRSILNDFTDDSIPATLSSDAGTFVCNSLFYN
FT                   LLNWTATQERVLGGFVSFPPVVPADSSQHGLPLDQQIAAGRDVVREAVRYYLKPSSSGI
FT                   LIA"
FT   CDS_pept        353150..354718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB4"
FT                   /protein_id="BAJ70417.1"
FT                   /translation="MVDRFPVVLRGYDKEKVDAAFDATQESVKRAQQTLASMREQIAAD
FT                   DDRILQLQAQLQEEKNKKPEGNSFASLGANAQQMLASAEQTSTELLERAKQDASSIRTT
FT                   AQDQAETLINNAKLDAQHIVDDANAKAASILTNANNQAESVTTSANEDAAQLRSETAKT
FT                   ITEQRQTVELELSNAREEHTKKMASERSTQEREIADMKAEATQQVAAMRKSANEEITKL
FT                   KSDSNDQIEAALAEANKKLADVREQVSKMMTEAQRKASEIIDAAKTKGQEITDEAEVKR
FT                   TSTMSQVNAEVEQIRHDIAAQQDEATKKVNELLQHLEERRVAAKREADELVGQAKNTRD
FT                   QADSYAAAKREEADIQAAAIVHKAGEEADAQIEERRAAAQSELDGLSKRIADLQERESV
FT                   ITQRVSELRSMFSQAFSGFAFGGNAAASGQSQEAAAVASLPVVAPVPEVKPVHNEADDQ
FT                   PGELSGNESAADDHNETDAAPADSADSAAQNEQSESSEPSEHQTQGEPEAPTQENPAVS
FT                   EQNGE"
FT   CDS_pept        354839..356182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0271"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70418"
FT                   /db_xref="GOA:E8MXB5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB5"
FT                   /protein_id="BAJ70418.1"
FT                   /translation="MSELTPLTGEALNTLRGDFAQSGTNRLAMNAVTAAGIDKVARNYD
FT                   RARLLQRRFSTIVDNGEATHQDRSGRCWLFSSLNVARFVAKKNMNLKEFEFSQNYAMYY
FT                   DKLERVNYFLKDVAALVAAGEPSDSRLMQHLLADVMGDGGQWTMAMNVYKKYGAVPKDL
FT                   FPETESSKNTGEMNTQLRHLLHTAVAHMYAAEGDAAKVEQIIAETTAAGHRILTIHLGE
FT                   PPVSFDWEWTDADGEFHRDGEITPVEFWKKYVGPAGLEDYVCLVDDPRAEHAKGKKIGI
FT                   EHLGNVAGGDATEYLNVPNQFMKDCVKQILVEQGIPVWFGADCHPFMDRESGAWATDLF
FT                   EYGKVYDVDFDLDKEARVRFGDSAMNHAMAFAGVDVADDGTTRRWRVENSWGAKIADKG
FT                   YFTMSDDWFTEYVYEVAVPKSMLPAEYQKALEEPATMLPAWDPMGALA"
FT   CDS_pept        356623..357960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0272"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70419"
FT                   /db_xref="GOA:E8MXB6"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB6"
FT                   /protein_id="BAJ70419.1"
FT                   /translation="MTEITKLSVEDLQSLRDSFTADETNRIAMNAVTAAGIDKVAKNYD
FT                   RARLLQRRFSTIVDNGEATHQDRSGRCWLFSSLNVARFVAKKNMNLEQFEFSQNYAMYY
FT                   DKLERVNYFLKDMACLVEAGEPEDSRLVQHLLREVMGDGGQWTMAMNVYKKYGAVPKDL
FT                   FPETESSKNTDPMNNKLCKLLRQAVAHMYENPENIDQIVKNATEAGHRILTIHLGEPPV
FT                   SFDWEWTDKDDEFHRDGEITPVEFWKKYVGSADLESYVCLVDDPRKEHPKGRKIAIEHL
FT                   GNVVGGDATEYLNVPNQFMKDCVRRVLVEQGIPVWFGAECGPMMDREAGAWATDLFEYD
FT                   RVYGVRFDLSKEQRVRFGDSAMDHAMAFAGVDVADDGTTTRRWRVENSWGAKIADKGYF
FT                   TMSDDWFTEYVYEVAVPKALLPEEYQKALEEPAISLPAWDPMGALA"
FT   CDS_pept        complement(358041..358583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0273"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70420"
FT                   /db_xref="GOA:E8MXB7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB7"
FT                   /protein_id="BAJ70420.1"
FT                   /translation="MASFATLTADLPKKELRCQARYTSLYVFAILAAFTILGSFILDMF
FT                   HLELPAIQIAGGFVVAHSGYRMLVPASDHGDPEAHQDNDIAFTPMALPLIAGPGAIGEV
FT                   IGLSARYTEPRERLAILIAVLVISIVIMALLRWCTPLVHKLGPGGILGLTRIMGFIILC
FT                   IGVELMIHGVSTLAIGL"
FT   CDS_pept        complement(358754..359770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0274"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70421"
FT                   /db_xref="GOA:E8MXB8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB8"
FT                   /protein_id="BAJ70421.1"
FT                   /translation="MTVAKRNRVTLADVAKAANVSRSTASRALNNSPRISRETTARIKK
FT                   ITDSMGFIPNAQGRALAVGRNETIAILITEPLDELFDDPTYAMFISGITEKLSESSYLP
FT                   VLLQASTDFERHRVQQHLERRSFDAVIDISPYANNYLLEEMYKLRIPCVMLGQMEDRSY
FT                   EGIFSSVYSDDTYGAQIAAQAMHDAGRRHPISILGPRSNPASPDRLTGYRRVCGDELPD
FT                   DRVLFTGWDATAGFSAMMQLLDTHDDIDGLLAGSDRIAVGAIEAIRQRGLTVPDDIAVV
FT                   GFDDHPIAERCNPPLTTVQQPLREEGSTAADLAMRMIDGEAATTVIKHMTLVRRKSL"
FT   CDS_pept        359975..361207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0275"
FT                   /product="sugar ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70422"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXB9"
FT                   /protein_id="BAJ70422.1"
FT                   /translation="MFGNHMKKTVIAACATVASLSLLLAGCGTDSSSGKTQIRFATWDK
FT                   AEDVDRQQTLVDQFNESHDDIEVTLEAYGSDFDTKISAGMGSNDTPDVMYMWNYPSYAD
FT                   GLEPLDSYIEKEGSDWKSDFYSTLWNYNSYDGKTYGVPVGFTTHALYYNKDLFKQAGVE
FT                   APTNDWTWTDLQKAAKKISSKTDAKGFSFQMKPDPYDFEMYLWSNDTAYSDENGTLEGN
FT                   IDSAKAIDTYQMFQDMEKDGSAVATEGNGTDEFRAGTTAMYIYGSWALSTLDEDGLNYG
FT                   VVDIPAFADSDHDSVSILSSSGISIAKSSKNKDAAWEFIKYWANADSNKARIGSELPVL
FT                   TSVVESEGITDKSQYKPFYSMLEQSDGYSPSSFKVKGWSEISDKLALSFEKMYNPSSLE
FT                   DPASAITEALK"
FT   CDS_pept        361232..362176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0276"
FT                   /product="sugar ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70423"
FT                   /db_xref="GOA:E8MXC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC0"
FT                   /protein_id="BAJ70423.1"
FT                   /translation="MKVLAKVNKRAWPYLFILPWIIGFLVFTLGPLVLSFVMSFFDWSI
FT                   TGTPKFRGLGNYIEMFTTDDQVLKSLSISLKYAAIFVPLNMIIALVLAMLISQPVKGAK
FT                   FFRTIFYIPAVISGVAVSIIFGWLLNGNYGVINYLLSLLGIDGPQWLVDPKWAIIAVIF
FT                   ASAFGVGSMMLIFYTDIKNIPIDLYEAAAIDGAGPARQFFSITLPMITPTILFNLITSI
FT                   ISSFQQVTLVMLLTNGGPMKSTYFYGLMTYNNAFKFHKLGYASANAWVMFIIILLLSAL
FT                   VFKSSDTWVFYESTANKNKAKKGKKAKGKEVAR"
FT   CDS_pept        362173..362994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0277"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70424"
FT                   /db_xref="GOA:E8MXC1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC1"
FT                   /protein_id="BAJ70424.1"
FT                   /translation="MKMSLRSKVVIYALLVMVAIYFLSPFVYMLFSTFKTSAEAIAYPP
FT                   SLFPKEWQWENYAKAWDAQPFGKYLLNSVIVTVLNTLGTVLSCSLVAYGFARYNFKGKN
FT                   ILFMILLSTMMIPWDVTMIPQYMEFKAFGWINTLLPLIVPSFFGSAYYIFLMRQFLLGV
FT                   PKEYEEAARIDGCNDLQIWWKVYMPIMRPCLILVGVLNMITVWNDYLGPLIFLQDRSKY
FT                   TLALGLASFKGVHQTQIIPMLCITVVMIIPPVVAFLSGQKYIVEGTSGSIK"
FT   CDS_pept        363158..365491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0278"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70425"
FT                   /db_xref="GOA:E8MXC2"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC2"
FT                   /protein_id="BAJ70425.1"
FT                   /translation="MIRDSFSTALGFELPTDGWMVSEDAYEPDRNLQYESLFALSNGYL
FT                   GIRGSHEEGNKPTLPYLYVNGVFDKSETFMKELATLPNWLGIRLYVEKQLIGVDECEIL
FT                   EYRRALDLKHAALVKRVRLRDPKGRETLIEGVRFVSRAHAHRMAVRLWVTPLNYSGLIE
FT                   VEQITDGSIINFYDAPRFKVKHTVVTANEPLGENGVYMEVATRDENLHVGVGSHLEGTC
FT                   RDRDVLGNRVFHAFGEQGVEFCDFRADEGDSVVLTKYVAMFDGRDTPADELHATTCREV
FT                   EDFVAEGFEREFEVHADIYRKMWGQANIDIEGDPELDRAIRLNVFHLMSTANEHDDRVN
FT                   VGAKLLTGEEYGGHAFWDTELFMLPFFAYVFPQTARHLESYRYRLLGAAEANAAKNGFQ
FT                   GAQYPWESADDGSEQCPDWTIEPDGTCYRCYVAVYEHHVTAAVAFGIANYATITGDTSF
FT                   LYGRGAEILTQTARFWASRCEWKEDAGRYEITQVTGPDEWHEPVDNNTYTNYLARWNMR
FT                   YVIALVDRMQREHPDDYAALIAATGLTDAELASWDAIQSKIYLPRKEDTDLLEQFEGYF
FT                   DLEPVTIEEYDKNDWPVRPAALKQFKTSETQIIKQPDVVMLLHLLGNEFSQQEIETNYH
FT                   YYEKRTLHGSSLSPSIYAIMGLKVGDDSKAYRYLRRAAMLDLLNLQRNTREGIHAANAG
FT                   GVWQTVVFGFAGVNMDDDGVLSITPHMPHEWSSLTFRLHNRESWLEIRVGATNGVDVEV
FT                   LDGPSAILRINGETVTVPGVKDVS"
FT   CDS_pept        365488..366396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0279"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70426"
FT                   /db_xref="GOA:E8MXC3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC3"
FT                   /protein_id="BAJ70426.1"
FT                   /translation="MKRGMAVAGLIVVTAIWGGGFVASDIALNSLTPMQIMAIRFLLGA
FT                   VLMSFISVREFRNINLKEIGAGVLMGIALFAAFALQIIGLQYTTPSKNAFLTALNVVMV
FT                   PFIAFLVLRKRVGWRGVLGACLSVVGVAVLSLNGNMTLGLGDALSLLCAVGFAFQIFFT
FT                   GLFVQRYRATVLNCVQMVTAFVLSVVAMVAMGQVHLTPTTDGWWSVLYLGVVSTTICYL
FT                   LQTACQQYIDETKAAIILSMESVFGTLFSILLLGEVVTPRMIVGCTIILVAVVISNLAA
FT                   SSEDEQPTDTPVPEPSGEVSG"
FT   CDS_pept        366459..367100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0280"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70427"
FT                   /db_xref="GOA:E8MXC4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC4"
FT                   /protein_id="BAJ70427.1"
FT                   /translation="MRYQAIIFDLDGVICRTDQYHYLAWKQVADELGIPFDEQVNERLR
FT                   GVSRMASFDIILERYDGTMSDEEKIHWTDKKNEIYKSMLTQMGPDDMLEGVADTLHKLR
FT                   AMGLDLAIGSSSRNTKFILGQLGLSDFFDAISDGTNITRSKPDPEVFVKAAEFLNRAPA
FT                   ECLVVEDAEAGLQAATAGGMDSAAFGEIAIRSGLGTWNLERFSDLIGIVA"
FT   CDS_pept        367239..370403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0281"
FT                   /product="putative beta-D-galactosidase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70428"
FT                   /db_xref="GOA:E8MXC5"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC5"
FT                   /protein_id="BAJ70428.1"
FT                   /translation="MMSKQNDWENPSLTGRNRLAPHAYFFGYECEADASTYERERSYGY
FT                   QSLSGAWRFRLFNGPATVPQQALLSIADDWDEVQVPHMWQFDGYGGLHYTDEPFPFPVD
FT                   PPLVPSTTPTGVYQRMVNMQPAADGERIILRFDGVDSYAEIHVNGTYVGMTKGSRLSAE
FT                   FDVTDAVHAGLNLFVVTVLQYSDGTYLEDQDMWWASGIFRDVYVVRRPQTHLKDFMVRT
FT                   HRVDDTLARVTVQAWTEGESCVEWTILRDGNIVSAAHSDSGERAVMNIPDPEYWNPEHP
FT                   FLYDMRMRIVGRDGSDEIVPHHLGLAEVTVEDGLMYLNGSYFTMHGVNRHDSDPRHGRA
FT                   VSMERVRRDLEMMKRHNINAVRTSHYPNDPRFYEMCDELGLMVMAETDLECHGFENVGD
FT                   IALITDDPAWEVPYVDRIERHVMQQRNHVSIVMWSLGNESGFGCNFRAAAERCRQLDPS
FT                   RPVHYEEDRFGESVDVLSTMYSRVSQMNDFGEHPANKPRVICEYGHSMGNGPGGLSEYQ
FT                   QVFDRWPSIQGHFVWEWSDHAVAMRGDRLALLAEREVQAKGVDPNGLDDLWYAYGGDFG
FT                   DYPTGGNFCVDGLVFPWQEPSPGLAEYRQVICPVKVSCTYTEEDGTALLGIDSRRYFTD
FT                   LSDTRLRVSISVDGETVDTTLLEVGPVPPLGHMDIPLRREALLEHHGGEAMLTVTVLSV
FT                   EQHEWCDPDEPLGSYQFRLHAGQGGYGPVRSNDGSALAVTSPVRQTLSTVEDERYLTIR
FT                   AGAMVLRFDKALGAIANWSDGDRNVIDSPICFGLWKPLIDNLTQEYSALWKPYYLDVMQ
FT                   TDTRGVQWHAERDQVIIEVEQRLAAPVVLAGMRTRLTYTVHADGHVDVAVTATAYGDYH
FT                   DIIPRRGLSFTIPRDCRQVAWYGHGPGENYPDSLAANPVGVWTNDVDAMFTPYVMPQDC
FT                   ANHEGTRWVTFRDGNGNGVMVTRTAPADGESEAFSFSAWPYSCADIDKAKHVNELPEGH
FT                   GSVTVNINDGVLGLGSNSWGSEVLDSYRIRFEDCAFSFTLTPIHDDEHVSRNPNCGAGA
FT                   VGKEVQ"
FT   CDS_pept        370403..370876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0282"
FT                   /product="putative beta-D-galactosidase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70429"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC6"
FT                   /protein_id="BAJ70429.1"
FT                   /translation="MRLYDSLEMFDTGLSHVRKWMRCGQAIRQSTRLPLDTAYSLGDSL
FT                   TFWAVPAGALADDRYVGHRRYHTVLSPIDEPLAVYVRAKTALRPAGAYSDVSDREWFGL
FT                   PNDDEEGVPCVVPVGGVLIMEECEAMRINATPEAVGRVSVVRVTVEGFTFPNK"
FT   CDS_pept        371103..372236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0283"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70430"
FT                   /db_xref="GOA:E8MXC7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC7"
FT                   /protein_id="BAJ70430.1"
FT                   /translation="MAALRGPDSSEDERRLGEQAVFPETVDVNIRQLDPIPAPRAFLRE
FT                   QPLTDEMSELVLHSRQEIRDVLNGRDDRLLVIVGPCSIHDPKAAHEYAEKLAAVKRELE
FT                   DRLVIVMRVYFEKPRTTIGWKGLINDPDLDGRFNIRKGMWLARKVLTDVLSLGLPAATE
FT                   WLDPITPQYICDAISWGAIGARNTESQVHRELASGLSMPVGFKNSTDGSIKAAADSCFA
FT                   AGFEHHFLSINLDGRVISAETKGNPDCHLVLRGSSHGPNYDAESVRQALEDLKVSKASG
FT                   PSQHGLVIDAAHGNCGKDENREAEVIEEIAERLAHGEQGITGVMMESFLVGGHQKPAPL
FT                   DQLVYGQSVTDSCVPWERTNELLHTLADAVTARRSAK"
FT   CDS_pept        372365..373597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0284"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70431"
FT                   /db_xref="GOA:E8MXC8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC8"
FT                   /protein_id="BAJ70431.1"
FT                   /translation="MQQQEEAAHSLHPLQVGPQPLNTPEELRAIRQAMGEGKNPLVATD
FT                   VPRWEDQVGVSRIINRRVLELEPLPTPAQVLAELPLTDQAQEIVAYSRDEIRACLYGQD
FT                   DRLLVIVGPCSVHDPKAALDYARRLAKLKDELGEQLLIVMRVYFEKPRTTIGWKGLIND
FT                   PDIDGSHNIRKGLLLARKTLLGVLKEGLAAATEFLEPTSPQFISDAVSWGAIGARNTES
FT                   QIHRQLASGLSMPVGFKNATDGSVKAAVNGCFAAAQQHTFFGIDHLGRACAVETLGNPD
FT                   CHVVLRGSIHGPNYDAESVAKAMEDVRAEMPAESAASHGLIVDCSHGNSGKDEHRQAEV
FT                   VRNIASRIAAGEQGITGIMMESFIEGGNQKAAPLDQLVYGKSITDKCISWEETEALLRE
FT                   LAEAVATRRWH"
FT   CDS_pept        373719..374432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0285"
FT                   /product="putative nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70432"
FT                   /db_xref="GOA:E8MXC9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXC9"
FT                   /protein_id="BAJ70432.1"
FT                   /translation="MGMKTVAIIGALDEEVALIAKSLTHVTHTAKGSLDIVSGTVDSFG
FT                   SDVIKVAATVGGMGLVNAAATTQLLIDEIAPDAVIFSGIAGNLNTHLHINDVVLGGTLR
FT                   YLDTDMRLVGQWKPGTADAPVEEFHSDDRLLEVADEALANAGITHITGIIASGNYFVDT
FT                   PQKVEEVIRLTGADAVEMEGAAVAQVAARNNVPALVIRALSDNADTDYEVFKEFDISEY
FT                   ADTAARLAVDIVKRL"
FT   CDS_pept        374683..376014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0286"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70433"
FT                   /db_xref="GOA:E8MXD0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXD0"
FT                   /protein_id="BAJ70433.1"
FT                   /translation="MDIWQIVVIVVLAALILVWVAVIAYNKGRVSGRLAAEQDLSGDED
FT                   THSLFGDDAPVRPTERRLIEVLPEALIVTDRNGLVQYSSPGSVPFGLVSGDRLNSREVE
FT                   DILTQAAADGGMREREVQLPVNRNSYPSSNGRGLEAGQSRPSNTLYLRVRIGDIGDDLY
FT                   AIFINDMSEQRRFEAVRRDFVTNVSHELKTPAGAIALLAETVTDAADDPDAVRYFSGRI
FT                   SKESARLTELVHHLIDLQKAQSPQSVIDARRISALDVARAAIAANQTQADSRHVDIRLS
FT                   VNGQSVPTKVEEPADGEGSLEESGSPATNGPMIKADKEAMQTAVKNLVENAIHYSPEHT
FT                   TVAVGVGERDGKVTIRVVDQGIGIPAKSLDRIFERFYRVDPARSRETGGSGLGLAITKH
FT                   CVQENGGRISVWSRTGEGSTFTIELPAAPDEDDDEARSDESTQA"
FT   CDS_pept        376213..376917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0287"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70434"
FT                   /db_xref="GOA:E8MXD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8MXD1"
FT                   /protein_id="BAJ70434.1"
FT                   /translation="MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG
FT                   IDLVLLDLMLPGIDGTALCRRIREQSRVPIIMLTAKSAEIDKVVGLEIGADDYVTKPYS
FT                   FRELLARIRAVMRRNQATAQASGTVDDDIPLVCGDIAMQVGQHQVTVRGETVFFPLKEF
FT                   ELLEYLMQNKGRVMTRHQLIDRIWGSDYVGDTKTLDVHVKRVRSKIEEDPAHPKYLTTV
FT                   RGLGYKIDTPAE"
FT   CDS_pept        377167..378300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0288"
FT                   /product="phosphate ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70435"
FT                   /db_xref="GOA:E8MRP1"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP1"
FT                   /protein_id="BAJ70435.1"
FT                   /translation="MQKNILVRSIAALSGIVMLASVAACGDNTATTTDNSSSSDSTSKS
FT                   TPISGNFSGAGASSQQAAVEAWIAGFQGTNPEAKIAYNPSGSGAGVQTFLTGATAWAGS
FT                   DKALADDEVEQSKSVCTEGTAFDVPVYISPIAVVFNLKGVSDAGKHINMDAATIAKIFD
FT                   GKITKWNDPAIADQNKDLKLPDTAITVVHRSDKSGTTQNFVSYFKDVTPDNWTYDLSEN
FT                   WPNEVGQGAKGTSGVISTVKQADGTIGYADFSQVGDLGTVAVKVGDKYNEISAEAGSKV
FT                   IGDSKQDDTVKGDNRIVIKINHATEAEGAYPIVLVSYDIVCPAYKDTKQAEFAKAWLTY
FT                   VTSDEGQKAAQDAAGTAPLPSSLKSEITKSIEAIKTK"
FT   CDS_pept        378511..379464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0289"
FT                   /product="phosphate ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70436"
FT                   /db_xref="GOA:E8MRP2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP2"
FT                   /protein_id="BAJ70436.1"
FT                   /translation="MSSQDKTAVQPVGGKTADKVFRGVAYACGILILVVLAAVFLFLFF
FT                   RAWPLIGGDQAANSQTVSSFTGGKASSFWGYVLPLLFGTVLVSLLALLIAFFVSIGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVANHLGFIPLFE
FT                   GPAANPPRTVATVAVVLAVMILPIITSMSRDIFMQTPRLHEEAALALGATKWEMIRLAV
FT                   LPFGKSGIVSASMLALGRALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSTLIGTGLILFLITFVVNFIARKLTEKATA"
FT   CDS_pept        379461..380462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0290"
FT                   /product="phosphate ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70437"
FT                   /db_xref="GOA:E8MRP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP3"
FT                   /protein_id="BAJ70437.1"
FT                   /translation="MMTAAENTEKTPMDGAPEIDFDRFRPTRSAIQRRNIMDHFMWVLI
FT                   AVAFVIACIPLISLLWTTIVNGIKRLNLNFLSYNMTGVVGGNQTPSGGYGGVLHAIIGT
FT                   LEITAGAMVISIPIGLMCAVYLVEYSNRGKLATTVSLLVDVMSGIPSIVAGLFAFSMFT
FT                   ILLGPGTINGFEGSVALSLLMLPTVVKSSEEMLKIVPNDLREASLALGVTKQRTITKIV
FT                   LRTALPGIVSGAILAIARVIGETAPLLMTAGYISSTNVNLFSGQMTTLPVFVYQEYSKL
FT                   SANCPPNADATCVTTIPMERAWAAALVLIVIVLLLNLIGRIVAKVFAVKTER"
FT   CDS_pept        380515..381294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0291"
FT                   /product="phosphate ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70438"
FT                   /db_xref="GOA:E8MRP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP4"
FT                   /protein_id="BAJ70438.1"
FT                   /translation="MGQRIDVNHENIYYGDFLAVEDVNINIEPNKVTSFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHVEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVRLNNHHLAKSDADDLVEWALRGANLWEEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKSDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTITMFNNPQNEEAERYISGRFG"
FT   CDS_pept        381591..382169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70439"
FT                   /db_xref="GOA:E8MRP5"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP5"
FT                   /protein_id="BAJ70439.1"
FT                   /translation="MSTGLIVGIVVVVIIVVLIGWGVSAYNNLVTLKNRVKNGWAQIDV
FT                   QLKQRADLIPNLVNTVKGYASHESEVFTQVTAARAGVVAAASNPSTTTAQRAAAENQLS
FT                   RALFNLQATAEAYPQLQANQNFMDLQNQLKELENKIAYARQFYNDVVLKLNTAIETVPT
FT                   NIIAGLFHFEQAQYFEADDASRQVPQVQF"
FT   CDS_pept        382233..384503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70440"
FT                   /db_xref="GOA:E8MRP6"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP6"
FT                   /protein_id="BAJ70440.1"
FT                   /translation="MRIRFIRAGIVSIVATVVLAVITLAIIGTSAFGDSADLSYRTLDY
FT                   DVTATANGDLKVTQHIDVKMRERTDSDDNTKPWKQLFQQYTLNSGTLTDISDISVRNVT
FT                   DGIDYAQQSEPKLPSDVSSDKEWNSDYANHWYVADVSDGSDHPKAYTPGTDGLKPSASA
FT                   TEDDTTVEIGWNIPVTTEADSMKFDVSFTMHDVATKWKDVASFQWEPFGKKNQVPIGTV
FT                   TGTVHFPNGITGKTSWAWLHTERTSETKRNSDGSYTFTAYNIHNGDYLDVVAAFDAAKA
FT                   KGIARKGTGNHLKDLKQDEYKQQQRWLDKQRFAARARLVSWIVSIVLGIALCAWGIWAV
FT                   ISSNRRAQYRGSVEYWRDQPGISPASAARLIRVVDPSTRQSDEDRQLTATMLSLAVKKA
FT                   IAVYPGPSDMYRGIDMSQATPVGLSQMIAADQGKQYAAGITSTIVILPLAIDEAPNAQQ
FT                   LGLSESEDALLNLLIVISQRVGSPVFDLNQMKATCQNWQDGYIELGKFTGACSMEYQRL
FT                   GATRSVGWQWILPGVLAAVLGFGSLLANSFIGYPVAGLIELPIFLVGLFCSMAGAMTVL
FT                   TDQGQDIAGRTLGLKRYMEDFSNFTDRGAADLALWDWYMVYAAAFGISDRVMRELAKAY
FT                   PQVNDPAWLDANASNSLFYWNYRPYGWYSHRHNGPFDHDAAGQMDPGISGPAPAYGGTS
FT                   FAGGFSDLGSQLNSGLADISSTISAAAPSADSGGDFSSFGSGGGSGFGGSFGGSGGGSF
FT                   GGR"
FT   CDS_pept        384569..385432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0294"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70441"
FT                   /db_xref="GOA:E8MRP7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP7"
FT                   /protein_id="BAJ70441.1"
FT                   /translation="MALFRNLGPFSTTAIGHGEMPLTIENNRGHEVGIETLHASLDAGC
FT                   RHIDTAWAYYCSGGEEQTGEKLVREALETWKGSKDEVLVATKVGHFRNFTDGRPTWDVD
FT                   GRPENLIRRGKESALALGVDTIDLLYFHRPDPKVPYNESVEAIKQLVDEGVAQEAGISN
FT                   ASIEQIDIARGILGDKLVAVQNQYSPIHLETQDTLDYCAKVGLAFVCWSPLGGYRHPYD
FT                   ETKFDPFREVAAAHGVSYQQVVLAWELAKGDHMFVIPGAHRPETILDSLKADQLELTPE
FT                   ELAKLG"
FT   CDS_pept        385530..386582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0295"
FT                   /product="inosine-uridine nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70442"
FT                   /db_xref="GOA:E8MRP8"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP8"
FT                   /protein_id="BAJ70442.1"
FT                   /translation="MRKKLILDLDTGIDDALAIAYALGSADEIDLIGITATYGNVAVPL
FT                   AARNALAVLHLFGRDDVPVYPGVDHPIAPATLPKMRGTTPDERAQAYARWQNGGADGWQ
FT                   TDASWSPTPGSVAVHHSNGIGGAIIPDSPRAPEAPGSAVDFIITAAREYGPDLTIVPTG
FT                   AMTTMATVFRNAPDLKDSGVNVTLMGGALTLPGNVSPAAEANISQDPEAADYLFKCGAR
FT                   TTMIGLDVTHQTALTREKAHEWASLGTPAGDFLVTMTDYYIDFYLKNQPEIRGCGLHDP
FT                   LAVAAALDPSLVTTFGFNLQVDLEGPFRGRTIGDRSRLQDPDKHTQVALGVDVPEFLDR
FT                   FMGRVTAAAR"
FT   CDS_pept        complement(386705..387328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0296"
FT                   /product="putative 16S rRNA-processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70443"
FT                   /db_xref="GOA:E8MRP9"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP9"
FT                   /protein_id="BAJ70443.1"
FT                   /translation="MAQQDMHDDPQQLELLRVARIGRAQGLKGEVTVRLYTDDPEWRFE
FT                   PDSVLYSQDGETEYIVEGSRTFKDRWILKLEGVDDRNAAEALNGVELYGEVDDAEDMLE
FT                   ADEWYPKDLIGLEARLVEGNGLGLPAGQVVGKVVDVIDSPAQSLLKIRLTEPVVTGQNS
FT                   KGEDVVEKTALVPFVEALVPDIDLEEQYLTLDPPGGLIPGCGMI"
FT   CDS_pept        complement(387351..387584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70444"
FT                   /db_xref="GOA:E8MRQ0"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ0"
FT                   /protein_id="BAJ70444.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENARGELLRVRVNPEDIGRV
FT                   IGRGGRTANAIRTVIQALSDHKVRVDIMDVRR"
FT   CDS_pept        complement(387605..388066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0298"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70445"
FT                   /db_xref="GOA:E8MRQ1"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ1"
FT                   /protein_id="BAJ70445.1"
FT                   /translation="MATKIRLKRQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQ
FT                   PSTIQIKSDRAQYWLGVGAQPSEPVFKLLNITGDWQKYKGLEGAEGTLKTVEAGPDAEA
FT                   RIAAVEDQAQKLKAAKSEAAAKAKAEAEAAAAAEEAPAEEAAEEAPAEA"
FT   CDS_pept        complement(388299..389408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70446"
FT                   /db_xref="GOA:E8MRQ2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ2"
FT                   /protein_id="BAJ70446.1"
FT                   /translation="MTTILSAVAIIALLWTTLSALPAGLEARMPLPYMIALTPLLCVPL
FT                   MILAAVAAWQHEWTAMSLLIVVALIASSQRINYWGTSIDPAGKRKESHRETARETTSPT
FT                   LSKSHNSNTSGTSNTSKEGPETISDGHRETTRETLSPQFSVMTMNCRYGRADAAEIIRN
FT                   IRERNISVLALQEVTDDLITRLTEADINELLPYHQFGDAKETDNGGFNVIYSRYEPSAA
FT                   VPNVVSIPAADVPAITLKTSGNRTVTLCSAHPKSPMRGCADWSAGILGLRELARAKSVS
FT                   NRNIVVVMGDLNSSTDHPSFRALLKSGFKDASLIQAAGPNLTFPSWLKWPRIELDHVLF
FT                   TPGLKPSGVKSFEVEGTDHLALTATLALR"
FT   CDS_pept        complement(389485..391119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0300"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70447"
FT                   /db_xref="GOA:E8MRQ3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ3"
FT                   /protein_id="BAJ70447.1"
FT                   /translation="MTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVR
FT                   SFTGKVRERALGTEVSDALNPAQQVVKIVNEELTDVLGQGVDRPLNFAKNPPTIIMLAG
FT                   LQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGIQ
FT                   SDGGEAVAAPGQTSGDPVKVARDSIELAKQKLYDTVIIDTAGRLGVDEELMKQARDIRD
FT                   AVRPNEILFVIDAMIGQDAVKTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKP
FT                   ILFASNGEGLKDFEVFHPDRMASRILDMGDIMTLIEQAQKQFDEEEARKAAEKISEGSF
FT                   GLDDFLDQLQQVRKLGSMKSLLGMIPGMAQHRKELEQFDEREIDRTEAIIRSMTPAERR
FT                   DPSIINGSRRARIAYGSGVTVSQVNALLQRFEQAAKMMKRMSNRGGMGGGIPGFGGPAM
FT                   GGGKKKGKNKKKGGKSGNPMKREAEEKALRDKLAGKSSGSTGGSAFAKKPQNPALPAGL
FT                   EQMMGNVDGGTELPPNLGGGLGGLFGR"
FT   CDS_pept        391442..392350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0301"
FT                   /product="Co/Zn/Cd cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70448"
FT                   /db_xref="GOA:E8MRQ4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ4"
FT                   /protein_id="BAJ70448.1"
FT                   /translation="MPTQKLLERKALIVGIVINVLQVLAGMAVFFMTGLKAMFLDFSFT
FT                   AISVLSGMVAVYLSSRTVRTTERFPNGMFALEPIYAICKAIFTMSLLVYSLIDVCRVAY
FT                   DYFVFGSGERIETGPVVIYEILTVIVCFSLYTYYRRSNRSIGDSSTMLTAECKSTLVDG
FT                   SMSFGIGVVAIFLMLLPAGGPLDFLHYTGDFFITVALVALTIKEPFSVLKEAFVELVGG
FT                   VHDDDETNAYVEAEAQRHLPANTDYEQTLIFKTGMNYTVDVYLSGIGETIDVADLIECK
FT                   RSLEKELSKRLHIVDVDFVFD"
FT   CDS_pept        complement(392369..394018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0302"
FT                   /product="cysteinyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70449"
FT                   /db_xref="GOA:E8MRQ5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ5"
FT                   /protein_id="BAJ70449.1"
FT                   /translation="MGNSQEPQDFNISVMPSSLTPVHVAKAAEGLNLYDTASHQVSHFV
FT                   PLKPGEVGIYVCGATVQSSPHIGHIRAAVAFDIVRRWFLKLGYKVTFVRNVTDIDDKIL
FT                   VKAAAAGQRWWARAYYYEREFTEAYNTLGVLPPTVEPRATGHMSDMIDLIQRILDNGHG
FT                   YVVTDADGKPTGNVYFDVASWPHYGELTHQKQTSEVDEAAAVADRMGPSVDATGADKYN
FT                   PVDPADASPDKHDPRDFALWKAPKDTDPEDARWSTPFGVGRPGWHIECSAMSHRYLGDG
FT                   FDIHGGGLDLRFPHHENEMAQTRAAGYPSAARWMHSAWVTAKGEKMSKSLGTGLSVPSV
FT                   LAEHSAWVVRYALGSVQYRSMLEWSDQALVEAQAAYDRVSNFIERAGVALGGQPSREEV
FT                   PAVSADDLPADFVAAMNDDVNVSGATAAIFTAIRSGNTLLSQLADRADSETAKAEVREA
FT                   LLAVRAMLDTLGLDPLAEPWVSAGAAGGAADGTAESPEHAALEALIAEQLNARAEARKA
FT                   KDFAKADQIRDALTEAGIAIEDGPQGSTWSLK"
FT   CDS_pept        394297..394965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0303"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70450"
FT                   /db_xref="GOA:E8MRQ6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ6"
FT                   /protein_id="BAJ70450.1"
FT                   /translation="MSNLEDIGLETVTMNIVDKKKPDLPDFGELAGVVIMGGPMGALDY
FT                   DKYPGLKAEAKLARAAVASGKPILGVCLGHQIIATALGAQLRKGDAPEIGFAPIKRVDK
FT                   HDFFSMWDKQLTVLHWHNDVVGLPAEGQLLSRSSSTKVQAFRLGSALGMQFHLEVCGSL
FT                   LDEWLDEPSMVKDLKAAGGSKSQLREQFAQYDQLLQPLAEQVFSGFAARCNSYAQTLNK
FT                   "
FT   CDS_pept        395013..397289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0304"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70451"
FT                   /db_xref="GOA:E8MRQ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ7"
FT                   /protein_id="BAJ70451.1"
FT                   /translation="MPTYDIGLEHVSLAFATKTIFTDVTQGVFEGDRIGIVGKNGDGKS
FT                   TLLHLFRGAQEPDSGRVTKRGGLTFGMLDQRDPLDDNATIREAALEGRADYEWASDNTS
FT                   REIVEALLGGMSLDAKVGSLSGGQRRRADLARLLLKDWDILALDEPTNHLDVVTIHWLA
FT                   EHLKNRWSKGQGALLLVTHDRWFLDEVCESMWEVHDGVIEPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLSRGARARSTKQKFHVKAARELIADVPPMRNTLELKQMATS
FT                   RLGKQVVDLVDVTQIFEKPQGMADIDPDVAALSASASRVDVVNAMYAEPQLHGSVEVAV
FT                   TDMTDPRLVDAGVPEAVESAEEARKKAEAESGNPQLADDREVRRMNTGGETIGGGTAAT
FT                   DSDDDTAAAGVTSAARKVTVSGREILDDVTWLIGPGDRFGIVGANGAGKSTLLKLIDGT
FT                   LTPTAGHVNIGKTVKFAVLSQRLDELEKLGKYKIKEVLSRYKPSYIVDGKEVTPGQLME
FT                   RLGFESAQLMTPIRDLSGGQKRRMQLLLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLD
FT                   TWPGTLIVVSHDRYLLERVTDQQFALIGGKVRHLPGGVQDYLDMVEAIKNGKGLPADTP
FT                   GFAGTGSSSAKSGKGKAAAVNAAASLPQSASRIAPSSEGANNGEDSTSKLTGKAFHEAS
FT                   KRVNAIERKLAKLEEQKADLEAQMAAHDPSDYEGLNKLNEQLTAVNTESDDLEAEWLEL
FT                   SEQLE"
FT   CDS_pept        complement(397342..397761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0305"
FT                   /product="plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70452"
FT                   /db_xref="GOA:E8MRQ8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ8"
FT                   /protein_id="BAJ70452.1"
FT                   /translation="MIILDTNVISEIIKKQPDEHVANWLRNQDTSNLATTAITVAELLA
FT                   GICRMPEGKRRKYTDTTVKLALMTLEDRTFAFDTQAAADYAHILVEREHRGTPTSIQDA
FT                   MIAAIACSWDAAIATRNIKDFEGTDVELINPWEFA"
FT   CDS_pept        complement(397771..398049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0306"
FT                   /product="plasmid stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70453"
FT                   /db_xref="GOA:E8MRQ9"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ9"
FT                   /protein_id="BAJ70453.1"
FT                   /translation="MATLTIRKIPDEQIQQLKEVAEKNNRSMESQVRSILEEWLAGTVA
FT                   HEITRKTNFYDEIREFMKNMDFEGLDKGELPLSERNSADSRPPVSFE"
FT   CDS_pept        complement(398205..398759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0307"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70454"
FT                   /db_xref="GOA:E8MRR0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR0"
FT                   /protein_id="BAJ70454.1"
FT                   /translation="MANYPASQPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEAVPLEQIIKQLNKLLHVLKIVELDPNSTVERELVLIKVAA
FT                   NESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGVIELVRSGAV
FT                   AVTRGPRALSEKVVGSEVTGR"
FT   CDS_pept        complement(398776..400743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0308"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70455"
FT                   /db_xref="GOA:E8MRR1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR1"
FT                   /protein_id="BAJ70455.1"
FT                   /translation="MALPTPLQAFSGVPKINTAPDKQTIVDGEKMTGAQALIRSLEDLG
FT                   VEDVFGIPGGAILPVYHEIKDNTKFRFVLMRHEQAAGHAAEGYALATGKVGVCIVTSGP
FT                   GATNVVTAIADANMDSVPMVVITGQVGVQAIGTDAFQEADIVGITYPVSKHSFLVTRAQ
FT                   DIPRVLSEAYYIANTGRPGPVVVDLTKTAQTGDMYYSWPQRMILPGYNPTTKAHGRVLS
FT                   DAAKLFSQSYRPVLYVGGGAARSNAGAQVKALADLTGAPVVTTLPARGIIPDSDPKNLG
FT                   MLGMHGTIAATGAVQRADLLVAIGARFDDRVTGKLDAFAPTARVIHIDIDPAEIGKNRQ
FT                   PDVPIVGDVATVLDDLIPEIQRTQAIQGKPNLAPWWKAIDGWREEYPMTWDEPTDGSLA
FT                   PQWVIKKLSEMADPSTIWVTGVGQHQMWASQFIDFENQHAWISSGGLGTMGYGLPAAIG
FT                   ASVGSAREFEGKKPVWLIDGDGSFQMTSEELAAAFLDHAPVKIAILNNSVYGMVRQWQT
FT                   LFYEHHYSQTNLLDGEAHGADGAAALADGDAPLEVPDFIKLAEAYGCVGIRAFTEEEAI
FT                   AAIEKANQINDRPVLIDFRVWKDAMVWPMVAAGAPNDEVTYKPGIKPLAGGTPAPGTGP
FT                   DEHATGVFEHETAAATASEH"
FT   CDS_pept        complement(400904..401632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0309"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70456"
FT                   /db_xref="GOA:E8MRR2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR2"
FT                   /protein_id="BAJ70456.1"
FT                   /translation="MSNETPQQPTPANELLEALGTTLSPDLLVQALTHRSFSHEHPGVA
FT                   NYERLEFLGDAVLELVSTETLFTIHPDMTEGQLAKMRAKAVSEDALSAIAKTKLKVGPY
FT                   ILLGHGEAEQGGAEKNSILCDIVESLIGATFLEHGIDEARKVIHRLIDDTLAEVATEGP
FT                   ALDWKTSLTVKAHGLGKEEPVYHMEVSGPEYAQIFTARVSLGENGDIIGIGKGSSKRKA
FT                   QLAAAEAGWKSLDSFKTRTK"
FT   CDS_pept        complement(401790..401984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0310"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70457"
FT                   /db_xref="GOA:E8MRR3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR3"
FT                   /protein_id="BAJ70457.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKATAAATVNCPNCGAPALPHMACPS
FT                   CGNYRGRTYRSAIQPAHTK"
FT   CDS_pept        complement(402073..402702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70458"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR4"
FT                   /protein_id="BAJ70458.1"
FT                   /translation="MARVEDSPWAIPVAQIASRAGQSKPIDADFPAPSGIGDSIVGIKE
FT                   GEPVHVSGQFDSIVDGLIFTGRLVAPFVSECTRCLKPIDEDWPVDVTVFFPYESGQDKA
FT                   NGKGGKSKKDDEIDIIAGEDESEDTYPLLENGAFADIEAMIRDTLVESLPLQPLCRPDC
FT                   RGLCSQCGADLNEDPDHHHDVTDIRFAGLAGLKAQLEAEQNGEQAE"
FT   CDS_pept        complement(402791..403681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70459"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR5"
FT                   /protein_id="BAJ70459.1"
FT                   /translation="MTMSDDHPTGYVDLTKPNADAASSTPEPSAPEPPASTQAAPAPTE
FT                   EADVLAGSPPAAPTPTPAQMQAKAQAQAAQQTRAQAQTAQAAGIRPSFMNEMPDLRETT
FT                   DDDPATVKSHEEFTTVYDIIDQLEAALGEAKSSIFAPGMVKVDRDEFTDQLSELKKMLP
FT                   VQLERASALMREAERRLESAQTQSNAIVASAQSRAANMIRDANEQAQFLAGQENVTELA
FT                   RQKARAILDQAQTKADHLTQGADQYCTTVMEGLSQQLGKLSQDVQAGLNVLEERQRAAR
FT                   EQMPHLTLNDYPEAQ"
FT   CDS_pept        complement(403689..404189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0313"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70460"
FT                   /db_xref="GOA:E8MRR6"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR6"
FT                   /protein_id="BAJ70460.1"
FT                   /translation="MTIAVCPGSYDPVTAGHLDVIERSARFFDEVHVVVAVNAAKTPMF
FT                   SEATRVDVIRRALDKAGCKNVTVSSTDGLITDYCKKVGATVIIKGLRQNGDYEAELGMA
FT                   LVNRKLAGIETLFLPADPILEHISSSIVKDVARHGGDVTGMVPDCVVPMLADALAEERQ
FT                   RKD"
FT   CDS_pept        404463..404756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70461"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR7"
FT                   /protein_id="BAJ70461.1"
FT                   /translation="MTFAEMFVDDAEPLRNPDQGAGTSVLERPETKESPVRDDGGDADR
FT                   FAHYVSKDRIAESRATGRPVVALCGKVWVPKHDPSKYPVCPDCKRIYEEMTR"
FT   CDS_pept        complement(404798..405808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0315"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70462"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR8"
FT                   /protein_id="BAJ70462.1"
FT                   /translation="MFEPTAIYAPNPHRYDTMTYNRAGTSGLKLPAVSLGFWHNFGDIT
FT                   PFDQMKSLVFTAFDNGITHFDLANNYGPEPGQAEKNCGLLLAKYFKHHRDELVISTKAG
FT                   YEMWTGPYGDLGSRKYLLASLDQSLERLGLDYVDIFYHHHPDPETPLEETMGALAQAVN
FT                   SGKALYVGLSNYDGPTMEKAAAILAELHVPFIINQNKYNILDRTVEKNGLKETAFKLGK
FT                   GLITFCPLAQGLLTNRYLNGIPADSRMAHDPRFLNDSALTEKLHKQVMDLNNLAAERGQ
FT                   TLAEMSLAWLLHDGKVTSVLTGASKPQQILDNIGALKNTHFSDEELKLIDEISAR"
FT   CDS_pept        405982..406410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0316"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70463"
FT                   /db_xref="GOA:E8MRR9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRR9"
FT                   /protein_id="BAJ70463.1"
FT                   /translation="MSYTIRQVATQFHMQPSTLRYYEDQGLLTNVERTETGQRIYEDCH
FT                   IDRLRAICCFKNAGMTIDDLKKFFVYESNEPEHIDEILDLLESRRESLDEQRRALNEAA
FT                   MHVQRKLHYYGDIKRAIDAGEDWPDWREYKNRAYSIER"
FT   CDS_pept        complement(406510..407136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70464"
FT                   /db_xref="GOA:E8MRS0"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS0"
FT                   /protein_id="BAJ70464.1"
FT                   /translation="MRFIVALWRFAIAGFCFVGTYEAWSKPQFWVYFTFQTGFVLGIVM
FT                   LWSGAATLLKGIQPPAWLKGCLTVYAIVTALVAFFLMPPDDPAYVPQVIGIMTNTMLHK
FT                   IAPIMAVIDFVLFDPHRRFRWHYMFSWLAYFPAYLVFVLARAAIWPGSGPAAGGSPYPY
FT                   DFINLDALGWQGFGISCGKLAIAFFVISLVVWLLDRALPSKALLG"
FT   CDS_pept        407169..407330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70465"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS1"
FT                   /protein_id="BAJ70465.1"
FT                   /translation="MVRLTYWLVVMIMVGVTDRHSADEYDDTEPGNIESGDTRIRRALP
FT                   ARLCPDYT"
FT   CDS_pept        407367..408689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0319"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70466"
FT                   /db_xref="GOA:E8MRS2"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS2"
FT                   /protein_id="BAJ70466.1"
FT                   /translation="MVDYSPALMTDMYEYTMLDAALKDGTADRKCVFEVFTRHLPEGRR
FT                   YGVVAGTGRILDALEHFHLDEADLKFLADRHVVSPETIKWLENFHFSGTIRGYREGEMF
FT                   FPNSPILQVEGTFGECTLLETLILSVLNYDSAVASAASRMASAAKDRPCMDMGGRRTNE
FT                   WAAVAAARAAVVGGFKGTANLLAAQLYGLKAIGTAAHCFTLVHDSERDAFESQIEALGK
FT                   NTTLLVDTYNIEEAVKTAVEVAGPELGGVRIDSGDLAAMAQRVRNQLDALGATNTTITV
FT                   TNDLDEYALAALQTAPVDSYGVGTMLVTGSGAPTCAMVYKLTEREGADGMMVPVMKKSK
FT                   DKATVPGRKLAFRSYEYALAEAEHVISGSEEKLAGFTPEPTWKNLLVDFMDHGHIDAQW
FT                   QGHDAIMAAHDYRAKALSELPITAQSLMKGEPVIPTETQVL"
FT   CDS_pept        409054..410358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0320"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70467"
FT                   /db_xref="GOA:E8MRS3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS3"
FT                   /protein_id="BAJ70467.1"
FT                   /translation="MQHLTYRKEGQVTRSHRNEDRGGEHRWTFNGVEYPTRKLMCEARR
FT                   AEYVRLLDEEGMNFTQAAHAVGVSKRTGKAWRNGRTRATGRNEKPLVDWYRSTMDKPKT
FT                   LHPRYLSQEERIQIADRLRLGDSIRAIARLLGRDPGTVSREVERNRNPESGGYEPYRAQ
FT                   QKAAGRLKRPKPRKAAEGTRLWDEIAAGLRRHWSPEQIANRLRLDFPDNGDMHASVETI
FT                   YQAIYLQARGELKQELKRAMRQGRTARRPQGGQGRKPRFREPMAMISERPPEIEDRAVP
FT                   GHWEGDLITGSRNKSAIGTLVERTTRFTILLHLPDGHDAEHVQQAIIDKMQHLPKLLRN
FT                   SLTWDQGAELALHKRIGASLDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYP
FT                   EDYLDAVAEELNDRPRKTLGFMKPSEKIIELLDAA"
FT   CDS_pept        411777..411965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70468"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS4"
FT                   /protein_id="BAJ70468.1"
FT                   /translation="MHVLHRYEEPLHDMDYTYLPLIDYELNAMQRKQFNQAFMEYGILI
FT                   PADDLSQSSSGTQALTL"
FT   CDS_pept        412109..412873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0322"
FT                   /product="putative ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70469"
FT                   /db_xref="GOA:E8MRS5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS5"
FT                   /protein_id="BAJ70469.1"
FT                   /translation="MVEIKDMLGNHQIIRADGRKVDELRPVRITRHFTDAPEGSVLIEC
FT                   GNTRVMCTATFTPGVPRWRKDSGLGWVTAEYSMLPRATAERTDRESVRGKIGGRTHEIS
FT                   RLIGRCLRGVIDMKALGENQIQLDCDVLQADGGTRTASVTGAYVALVDAVNWAEKHRHI
FT                   KSASRVLKDYVSAVSVGVINGTPMLDLPYIEDSQAMTDMNVAMTGSGTFIEIQGTAEHR
FT                   PFNRAELGTLLDLAEKGNKELQAAQRAALSLD"
FT   CDS_pept        412917..413675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70470"
FT                   /db_xref="GOA:E8MRS6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS6"
FT                   /protein_id="BAJ70470.1"
FT                   /translation="MQIVVATHNEGKLVEIRRILEEDLGADAENIELVSAGSLHLPDPV
FT                   ETGVTFQENALLKARAVAIRTGLPAVADDSGLIVDVMGNAPGILSARWAGAHGHDKANN
FT                   ALLLAQIEDIPDDKRTAHFRCAAALVVPDTETGADVTGGVAADGITVHTTAAAGSPAPV
FT                   HARYAIKSETVGLGDMPGRIIREARGEHGFGYDPLFVPDDQPAGRVSTEPDHEGEPLTS
FT                   AEMTPAEKNAISHRGKALKALVPAIEALLH"
FT   tRNA            complement(413843..413915)
FT                   /locus_tag="BLIF_tRNA16"
FT                   /product="tRNA-Thr"
FT   CDS_pept        414123..415391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0324"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70471"
FT                   /db_xref="GOA:E8MRS7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS7"
FT                   /protein_id="BAJ70471.1"
FT                   /translation="MRDFVLVKLTDEEFDDFSARHPQGNFQQTSAMGRLRTAQGIDVEY
FT                   LALKEGEKIVAAALFETHRSRFSTFAVIHDGPMCDYHDTEALTFFMDALKRHAKAKGAS
FT                   QLEITPESPYRLRDTNGASLPDDQNGAPDNKLIEQLEAIGFTHGGFTVGYTAVPRWRYL
FT                   KDLTGITDEKSLLKSYDKRTQWSVKRAQSMGVHVRELSDDELGVFARIEQQTAERRSFE
FT                   YRGEAYFHRFKEAFGIKAHFMVAEIHIDEYVADMTSKREALSAKVAALTAKNAEHPTTK
FT                   TERQLGEETRNLAAAEKRLNEAAEFAKDGDVLPAAASLFVEHPREVIYLFSGSVEQYKP
FT                   FYASALIQHDAMLHFCVEHGLSRYNFYGIDGVFDDPDDEGRGVLEFKQGFNGYVEELPG
FT                   EFVLPVKPVAYAMKQFAHKLLSR"
FT   CDS_pept        415465..416775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0325"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70472"
FT                   /db_xref="GOA:E8MRS8"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS8"
FT                   /protein_id="BAJ70472.1"
FT                   /translation="MTQSDAGVASLTPTKITPAELDAFSAAQVQGSFQQTSQMAAMGAF
FT                   NGPVDYVGVKRGDKLIAACYVVYTRSRFGLEGSVWCGPLCDYDNPQVVEAMTEALRRSA
FT                   KAHHAISVSCWPAAVYRLHDLDGKPTSDPDTTMMDNMARFGWKHGGFTVGYESVVNRWN
FT                   FVKGLDGIHNEKELLASFSKYRRKNIRIAQDSGLRVRRLERGELSTFVKLCDMSAARQG
FT                   FKSRDLAYYERLFDTFGDLIEFKVVETHFDEYLDTLQSKLNAASKDKRNLERLLQRTQQ
FT                   QPEGTAKKGASDPATLEKRIATADKKIAALEKTIGEVNGIIASDGPVIPVEAGVYFWHP
FT                   NEVVCLSSGEDDRFMDYYPSSLIHFEAMLDCIARGVERFNFYGISGIFDANDPSYGVWQ
FT                   FKTRFGGFVEELPGKFTLPVDGLRFGVSEAAHKLLHR"
FT   CDS_pept        416825..418105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0326"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70473"
FT                   /db_xref="GOA:E8MRS9"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS9"
FT                   /protein_id="BAJ70473.1"
FT                   /translation="MSATANRTDTTYTFGVITPEELDRLSEATSQGSFQQWSGQVRLAK
FT                   IRGHEAECVGVCDASGNLVTGCVILYLNGRFGADGSVYFGPIGISDDPALLRAITEAIC
FT                   ESARRHHAVSVACWPNVAYRLYSSDGQPDGEPNDALLAGFADAGWTHGGFHTGYDVVCQ
FT                   WMYVKDLTGITNGKELLASFGKRAQWSVKRAQSMGVHVREIGPDEFDVFADIERRTGER
FT                   RGFATRGADYFRQFKQAYGADAHFMLAEIHIAEYVADMTAKREALQAKVARLQAKYDER
FT                   PTTRIERQLGEESRNLAAADKRLAEVEGYARKGDVLPAAASMFVSHPNEVVYQYSGSLE
FT                   EYKPFYASALIQYEAMLHLCVEKGVSRYNFYGISGVFDDPNDEGRGVLEFKQGFNGYVE
FT                   QMVGKFTLPVDKFRFGVSNLAHKLLRR"
FT   CDS_pept        complement(418188..419189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70474"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT0"
FT                   /protein_id="BAJ70474.1"
FT                   /translation="MSAILTPVGLLLIILAGYLFKRFGLFGQKDYRVLQTAEFNIVLPG
FT                   AIVYSFATNPHDISLLLISVFAFLFAFIPVVFIFLATRKRNVTDRAFLMLNGAGFNLGC
FT                   FSFPVVQSFWGAGAVVPAAMFDIGNCVMVAAGTNVLTQQLLHIQPGKTLAEQHAGSAPT
FT                   LPYEKPKDRDAKRLARRALLRTIGKSFFGSVPFDTYLLMIVLTVANVKIPDWIASITQP
FT                   LSGANALVSMLMVGMLMDLPQSKHDVKEVMAVIAWRIPFSVAFALIAWFLLPFSASIRA
FT                   VMVICALAPIAIFSTLFTDKVLGNAKLAGFSLAITAMISLVMMAVAHALMGV"
FT   tRNA            complement(419379..419462)
FT                   /locus_tag="BLIF_tRNA17"
FT                   /product="tRNA-Leu"
FT   tRNA            complement(419550..419622)
FT                   /locus_tag="BLIF_tRNA18"
FT                   /product="tRNA-Thr"
FT   CDS_pept        419911..421611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0328"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70475"
FT                   /db_xref="GOA:E8MRT1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT1"
FT                   /protein_id="BAJ70475.1"
FT                   /translation="MAINPPVDATQTPEWAALQKHYDELQVEGVSLKKWFAEDAERVEK
FT                   LSFDAGDLHFDLSKNLIKPETLQLFANLAKAVKLDERTKAMYTGVHINNTEDRAVLHTA
FT                   LRRPVEDEGKYIVDGQDTVKDVRETLDKIYAFADDVRSGKWTGVTGRKIETVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGISARYISNIDPNDLAEKTKGLDPETTLFIIVSKTFTTLET
FT                   LTNAREARTWLLEELTANGAIAEGDEAQKAEAIKKHFVAVSTNLEKVEEFGIDPNNAFG
FT                   FWNWVGGRYSVDSAVGTSLAVVFGPARFEEFLHGFHEIDEYFANTPFEKNVVVLLGMLN
FT                   VWYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTSETGEIFWGEP
FT                   GTNGQHAFYQLIHQGTQLIPADFIAFVNTPNPTKDGDQDVHELFLGNYFAQTKALAFGK
FT                   TADEVRAEGTPEEIVPARVFTGNRPTTSIFGVALTPFAVGELIALYEHITFVEGTVWGL
FT                   DSYDQWGVELGKQLAKQITPAISQDDDALAAQDASTQSLIKFYRANREF"
FT   CDS_pept        422427..422792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0329"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70476"
FT                   /db_xref="GOA:E8MRT2"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT2"
FT                   /protein_id="BAJ70476.1"
FT                   /translation="MVNAVEAFDAKHMKPAEEIPAFRPGDTVDVNVKIQEGNNSRIQTF
FT                   TGVVIARKGAGVRETFVVRKISFGTGVERRFPVHSPSIDSIKLVRKGRVRRAKLYYLRA
FT                   LRGKAARIAERRDNSAK"
FT   CDS_pept        422959..423816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0330"
FT                   /product="putative signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70477"
FT                   /db_xref="GOA:E8MRT3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT3"
FT                   /protein_id="BAJ70477.1"
FT                   /translation="MQDDQDNGEFPVSDNPESNQTSYDDEADARDSRTFQVADHGIALS
FT                   PVPPAPARPAHAASSAGAGAAAGANAAAASSSDDDHFTLRDFFLWCGVPVLIVLLIRIF
FT                   AVGFYEIPSRSMMDTTVPGDRVVTSKLTPKIFDLQRGDVVVFKDPNNWLNEEQSSAPGG
FT                   GYLIKRLIGLPGDVVECKGAGQPVTINGVAINETSYIRPGVDPSAFPFSVTVTEGRVFV
FT                   MGDNRANSADSRYHQDDGDRGLVPISDVVGVGIAKYWPLDRLGAIDDHHEVFKDVPDAS
FT                   GSNS"
FT   CDS_pept        423936..424775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0331"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70478"
FT                   /db_xref="GOA:E8MRT4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT4"
FT                   /protein_id="BAJ70478.1"
FT                   /translation="MITPTLDLERILAAQGYDLIAGFDEVGRGALAGPVMVGCAAIWAR
FT                   DLEPLDGDDAVELSGRTYLGVPDGVADSKMLTEHRREAIFDELRDWCAAYAVGQASNAE
FT                   IDEWGITYALGVAALRALSQVERELGLRLGGESTIKKASGESAGEIVEGRPGGSVGEFI
FT                   GNCGGSVRALPKVAGILDGPSDYITKALNTFDAPDVPIPADITTKVKGDQHCATVATAA
FT                   VIAKVTRDRLMVDLAQSNPRYAAYEWAHNKGYGSAAHRAAIAEHGPTPLHRVSWHLT"
FT   CDS_pept        424902..426017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0332"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70479"
FT                   /db_xref="GOA:E8MRT5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT5"
FT                   /protein_id="BAJ70479.1"
FT                   /translation="MVTSRKPSKRPSMFEVAKLAGVSHQTVSRVINDSPDVSDATRARV
FT                   QAAIDQLGYRPSNSARALASRRSRTIGLIAGGLKFFGPISSISSIESMAREHGLFMSVM
FT                   MVHEALCAQADFDNLCDTFNEQNVDAFIFLTPTDVMFAAACRARVTQPRVIVTATHGQM
FT                   TVREGLGLISTENKRRTALVGIDQWGAMAKVVALLGEYGHKSALYFAGPNEWRDAHTRL
FT                   DAWRKLAASRSIDSQIVRCHTWDASEAYAHMNHLIDEYGRRGAALPTAVVAANDNQAVG
FT                   IMRALHEHGLRIPQDISVVGFDDMSGVDNMYPPLTTVHPDFEGLGVAAMRETLRLLGEG
FT                   GEPTFLTTQHGMGLIPAEVRARRSLGPAPRR"
FT   CDS_pept        426172..427818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0334"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70480"
FT                   /db_xref="GOA:E8MRT6"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT6"
FT                   /protein_id="BAJ70480.1"
FT                   /translation="MAATDNAAEQAAHIAEKIRAGKTTLGIEFGSTRIKAVLIDDNFQT
FT                   IASGDYSWASHLEDGLWSYTTEEIWGGLQSAYASMANDVETAYGEKLTHVGHIGFSAMM
FT                   HGYLAFDEAGELLVPFRTWQNTNTSEAHKKLSELFQYNIPERWSIAHLYQAVLNKEEHV
FT                   SKVAYFTTLAGYVHWKLTGKKVLGVGDASGMFPIDPTTHTYETAFIEKFDALPEVAAQP
FT                   WKLENLLPEPLVAGTPAGELTEEGAKLLDPSGALKPGIVLAPPEGDAGTGMVATNSVRV
FT                   RTGNVSAGTSIFAMVVLEHKLKALHPEVDLVTTPAGDLAGMSHANNFTSDLNAWVGLFG
FT                   QFAKAIGQPVDAGMLYGTLFRAAIADDVDANCGGLLNYPFRSGEFLAGLPEGRPLFARS
FT                   PEANMTLGNFMRAQLFSAFSPVKIGMDVMTKQERVQVDSLVGHGGIFATPKVAQKILAA
FT                   AFNTPIKVMSTAAEGGAWGMAVLANYLWNTNEDHSNLADFLDGCVFKDAQSTTEKPVAS
FT                   DVVGFEDFFARFTKGLPIEHAAIETINLEDK"
FT   CDS_pept        427903..428595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0335"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70481"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT7"
FT                   /protein_id="BAJ70481.1"
FT                   /translation="MATLADYGPEVRAEVKQVREVVSNLHQQLIKWNLVVWTAGNVSQR
FT                   LHTADLFVIKPSGLRYEYLTPSSMVVCDLDGNVVDGTEAPSSDTASHAYIYRNMPDVYG
FT                   VVHTHSTYATAWAATGQNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGEGVVETLKKYP
FT                   KSPAVLMQNHGPFTIGKDAEGAVKAAAMTEEVAHTMWAARQLGDIIEIDQADIDKLNDR
FT                   YQNVYGQH"
FT   CDS_pept        428800..430317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0336"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70482"
FT                   /db_xref="GOA:E8MRT8"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT8"
FT                   /protein_id="BAJ70482.1"
FT                   /translation="MVMENPFEGKEIWFGVGSQDLYGEEALRQVAIHSAEMVDYLNNTG
FT                   KIPAKIVLKPTLKSSDGVKEFMVEASANPNVIGVITWCHTFSPAKMWIRGLEVLTKPLL
FT                   QLATQHHKEIPWETIDMDFMNLNQAAHGDREFGYIVSRLGIKRKVVVGHYTDPEVAEKL
FT                   GTWARACAGWDASNNMKVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYD
FT                   AVKDDQVKEIIEDYKAKYDVDPALLDAKYDSLFIAAKEEAAMVNMMRANGCTAGVDNFE
FT                   DLGALPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYN
FT                   FTEGDELDMGSHMLEVSPSIGTIAKPKLEIHPLGIGGKADPVRLVFSGKPAKDAVVVSM
FT                   SDVRERFRLLMDVVDVVEPQGSLKELPCARAVWEPKPSLKTAVECWITAGGSHHTCMTT
FT                   SVGREAWEDFARIAGVELAVIDENTTARQFEKELELSEMYHRLNNQH"
FT   CDS_pept        complement(430501..431124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0337"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70483"
FT                   /db_xref="GOA:E8MRT9"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT9"
FT                   /protein_id="BAJ70483.1"
FT                   /translation="MRAGGTPGMLPLTDDTDILAQCAERFDAFLFTGGPDVGPMVGAAA
FT                   SATGRSEVLSPERDRMESILLPAVMAWDKPILGICRGIQFINAALRGTLWQDLPSQHPS
FT                   DIEHHMNPPYDAFGHNVSLVPGTPLASLFAGQTEIAVNSYHHQAVREPAAGLEVMAVAP
FT                   DGVIEALYRPASHFLWAVQWHPEFLYKVDPRSQAIFDAFVGSCR"
FT   CDS_pept        complement(431159..431329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70484"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU0"
FT                   /protein_id="BAJ70484.1"
FT                   /translation="MLADRLHWFGTVAALLATESSDLRQNDENNTWAKRGRHDYESTAH
FT                   CGDSADGLRAR"
FT   CDS_pept        431491..433065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70485"
FT                   /db_xref="GOA:E8MRU1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU1"
FT                   /protein_id="BAJ70485.1"
FT                   /translation="MNQACVRNDTIDAGNHHGRPQYRSFLRFLTSQERNVIWLLLAIAF
FT                   LPVDGTTLGLYAPFWSPISPALFAVYCLCNWRQLRIAANRYLPMFLLPVACIILSIPGW
FT                   LKFGIHLNAAFMSITGLLGVLATLGAIALAFDIKRIPWRTPLRILIASYWVSFGVGVVQ
FT                   WLSIRLHAKPLTDYFSHLMYRQYISDNSVWGGGRPQFLFAEPSYIGMHLFGILLPLMWL
FT                   MRGRDRIYAKRLRDLIVTYAVGAVLMQAGTRIVIDSVVALLIALVARTDWHDGARRVRG
FT                   MLQILGAFALGLLGVLADSRLSAIAENGAEGDGSFFARIYQSLDPICGLLTHPWTLLTG
FT                   YGAGNIINAVWAGAAKAGRLLDGLGMNGGAATGFAAGVNADTVWTMCAYTSVIAEYGLI
FT                   GLAMLVGASMVCMTRGRTVCRGGADGASSDELAHGVCVADVADVADVAGGNSGGGVAGA
FT                   GSGESGVWHKTVICWLVLVAYLYIQCENYAFAALPLLVFAASKVRREPDFSRADASTRP
FT                   EMDQNPE"
FT   CDS_pept        433307..434581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0340"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70486"
FT                   /db_xref="GOA:E8MRU2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU2"
FT                   /protein_id="BAJ70486.1"
FT                   /translation="MLSTIAVSRAAQQAAGRIEKEAVGGFVLSSNMQGSMLTPRGGGMV
FT                   RPADVRRIAQLPGVDSYMVRQNATADLVGANVAKVPGGDDYDATQEQQFGNAANVMGTN
FT                   DSSKLNVFTSRTLGMAEGRHLKASDKYTSMIHEDLAKANGLKVGDTLTLKANAYDADNE
FT                   SHSTATVKTTIVGIFKGDSARKVSSRAELTANTIYTDLDTTRDLYQYKDGKEIYQDATF
FT                   VLSKGVDVEKTMDAAKKLPVDWNNYQITRNDQYSSSMLHAARGVRSMMRGALIGVTVSA
FT                   VLVLSLMLLLWMNDRRQEMGILVSLGVGKPSLVAQYLTEMVLIGLPSLALGWLCAQGMA
FT                   QWLGATALHSVNASAAKELSSMGQVGGDLESSMSVRTLDSLTVSVDGTAMLYVALGLLA
FT                   VMLVCVAVACMPMLRKSPRDLSEIR"
FT   CDS_pept        434578..435801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0341"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70487"
FT                   /db_xref="GOA:E8MRU3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU3"
FT                   /protein_id="BAJ70487.1"
FT                   /translation="MMSMNVWKRATLAIVRKPVRSGIIGLLMLMVFTSLVAQVGVSTAL
FT                   RTMSDGIGAGMGIGFTVSAGENPISAEEASRFSRIPGVTKTAYATKTLAQVDGARPVMP
FT                   RQGPRLDSDLAMQVSVLGTTDSSLSEEFQSGLYRLEQGRHISGDGDNVLVHRDFAMQNG
FT                   LSVGSTFRLRQEGRNATVRVAGIFSGNVQAQSPLPSDTSENLIYSGRRVASALTGNDRI
FT                   DMIRCLSDNPQDLSAAIGRAKTMAGGKYDVTDDSARLSGVLQSVQTVRNLVRMVLLSVC
FT                   LADVLVLAMALVFWIRSRIHEIGTLLALGIDKMRIVAQLAIETGLMAAVAALCSLGTGA
FT                   MLSGYVSSRLLRDSGVAPLESLHVEALPPEQTMLILLLGCAVIAVALAVSCAAVLSKSP
FT                   KSILSSMR"
FT   CDS_pept        435814..436449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0342"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70488"
FT                   /db_xref="GOA:E8MRU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU4"
FT                   /protein_id="BAJ70488.1"
FT                   /translation="MSNCLQLDHVDYAYGAAKIRVLSDVSADFESGKMYAITGPSGAGK
FT                   STLLSLLAGLDAPSRGVVRFEGEDIAASGYAKHRREHVSLVFQDHNLIDYLTPEENLRL
FT                   VSAKADMKILEELGLSREESKRNIMHLSGGQRQRVAVGRALVAPGRAILADEPTGSLDP
FT                   EMTDEVIHLLQHAAHQLGKCVIVVTHSKRVANSADVVLRLRSKKLTRA"
FT   CDS_pept        complement(436631..438454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0343"
FT                   /product="putative long-chain-fatty acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70489"
FT                   /db_xref="GOA:E8MRU5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU5"
FT                   /protein_id="BAJ70489.1"
FT                   /translation="MLDHYTTPGESIEIRDNQTIYSLLTDRLARTGADTVIAAKKIGPG
FT                   RWQNVTTGEFHERVVSAAKGLIALGIAKGDAVTIFSSTRLEWGILDFALAAVGAVSVPI
FT                   YDTDSAPQAQRIMNDSAVKLAFADNRERFDRLDSVKDHCPALKQILMIEGNALGALEGL
FT                   GVAVSDEELNERVATVRADDLATIVYTSGSTGNPKGAELTHKNFVSITISASQALHEVV
FT                   LDDHPRLLLFLPLAHCFARFIQYASIASDDGVVGYLPDTKTLLPDLRSFEPTYLLGVPR
FT                   VFEKVYNAASHKAGAGWKGRLFVKAAEAARVWSRKEQAGEQHTFAEIAERAKYETLVYR
FT                   TVRGALGPKIKYVACGGAPLSLDLAHFYNGIGLPMIQGYGMTETAAPFAATRVTDNVIG
FT                   TVGQPAPGSSIRISDEGELQVKGPNVFRGYHNLPEKTAEAFTADGWLRTGDLAEIDDEG
FT                   HIVITGRIKDIIITAGGKNVSPIPLEEEIAKCPIVEHCVVVGDQRPFIGALVTLDPESL
FT                   ALWLPAHGLSTETPVDRLATNAAVREEIQQYVDKANATVSRAESVRKFAVLDTQFTQEN
FT                   KCLTPSLKVVRPAVNRVFADVIDNEIYNGKR"
FT   CDS_pept        438616..438849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70490"
FT                   /db_xref="GOA:E8MRU6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU6"
FT                   /protein_id="BAJ70490.1"
FT                   /translation="MLYGYDTVSISGAIDFLQDKYALSPALQGLVISSIMIGGVIGAGF
FT                   SGFLSDKYGRRRSTGRRAKSSTRPRLLRLLAN"
FT   CDS_pept        439399..443460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0345"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70491"
FT                   /db_xref="GOA:E8MRU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU7"
FT                   /protein_id="BAJ70491.1"
FT                   /translation="MFDKRLFQLAPGLKKLIAGKVALMWVGLLANIGFMLSLVMLLNSL
FT                   LTAVAPPLLQCGGTSQGAACPVPLSDRHGADVLPMAGDVMIYVLLALVCIAVRYTATTH
FT                   ATRLGTEAAERVKLALRSKLYRKMVALGPSYKTRIKTSDVVQSAGEGVEQIQSFFELFL
FT                   PQLFYAILAPITLFVAIAPINVPAAAVMLVCAPFIIIVTGIVSMTAARAFKKYWVRYTD
FT                   MGAAFLDNLQGLETLKNFDADERAAIEMDKKAEGFRVMTMRVLQIQLRSLTAMDIVAYG
FT                   GAAAGIGVVLWQYAHIGDAFANGASGWSPIALASHLPGVLAYAAYGLHYLIPFGVGYPL
FT                   SLTGLLFIVLLFAEFFIPMRQLGSFFHVAMNGMTSTKRIFALLDTPEPEHGTATLPAND
FT                   SDSADDGLTVRFDHVGYSYDDAGHGDSKSASAKTDKQGETSPNSAVAPALTNITFAARP
FT                   GQFTAIVGISGSGKSTAASLLAGTLAGYRGSLTLNGVEVSDLSGETLAGAVTVIGASSH
FT                   LFAGTLRENLLMALPDDEIPDSPDSVDSRLWSALEQARIADFVHAQPNGLGMPIESDAA
FT                   NLSGGQRQRIAIARALLHDSPVFVFDEATSSVDMESEELILDTIRELAQSLGKTVIMIT
FT                   HRMANAEHADQVVVLEHGKSVERGTHTELMTADGVYAKLFTTQADIENFGEGHARRVLQ
FT                   VGSRKQELSDDSRTEGGAARVSAEAGMTVDRLQSALPTASVGGSEQASAETPAGVANSD
FT                   SSSKMSTFQVIRRLLKEARPLAGLMAVASTAGTIGHLSSTFLPVFGIIAAFALTGNPVW
FT                   GMGVAPAVIMMIICALLRGITRYVEQYLNHNVAFHLLALFRSKAFAALRRLAPAKLAGK
FT                   GKGNLIAMLTTDVELLEIFFAHTISPVAIAVTSTIIYTIVAATLSPWMALALIAAHLVI
FT                   GILVPRFFATGVRNLGPAIRGAAGELDNVMLDDMRGLDEIILFGRGEERAQAIEDRTHA
FT                   LWKDHAKLSKVNGRFTGISGLLVAVLAAASAAVAIACAGANPQSIPALIAAFVLFASSF
FT                   GPTLALAALPANLTQTFASASRLFGLMDEVPAVTENGTVVPQEYMGMRLDDVTFAYAGE
FT                   REVLSDFSLDVPQHGVLGIQGPSGRGKSTMLKLLLRYWDPQRGQVTLSGTPLPEVDVHA
FT                   RRRIQAMMSQETHLFDGSIRDNLLIALPESEVEAANVAGNGEVGAKTVDSRQQRLAAQS
FT                   AEGDAVQVAASDGLDARLRQALAKASVLDLIDSLPDGLDTQVGELGDRLSEGERQRIGL
FT                   ARVFLRNADLVLFDEPTSRLDALNEAIILRSIHAMAVGEQHADKERGAAVVLVSHRESA
FT                   MRIADAVLNL"
FT   CDS_pept        complement(443702..443971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70492"
FT                   /db_xref="GOA:E8MRU8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU8"
FT                   /protein_id="BAJ70492.1"
FT                   /translation="MLGLGAIPAAAFLLSMVRAPESPRFLIQAGRTEEGFAVLEHIIGT
FT                   EQARLRTDDIHASVKLETEMSHEFHDLFRPGLRKALIIGALIKA"
FT   CDS_pept        444809..446158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0348"
FT                   /product="ABC transporter substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70493"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU9"
FT                   /protein_id="BAJ70493.1"
FT                   /translation="MRNTKKVIAATAAVATLVGLAACGSSNDNGANKGDADKAELVFWG
FT                   WDSGNSMKEILADFEKANPGITVKFNNTGTAEKTSTALSNAIAAGNGAPDVVMLEDPTV
FT                   TQFAVTDGLVDLSEFGADKLADDFAAGPWNKLQYNNKPYALPIDSGPEMFFYNKAVFDK
FT                   AGVDGESIKTWNDYYEAAKKIRATGSYITNLAGTSNDYQPFTAQIWQAGAQPWKVDGEN
FT                   ITINMTKDEGMQRYIQFVQKLIDEDLVDAKTPNWSDDWNRELNDGTLASLTIGAWMPIN
FT                   LMTGAPDQAGNWRVAQLPQWEEGKEVSAEDGGSALAVTSQSKNQAAAYKLVEYMTHGEG
FT                   AQTMADTGTFPSLKKILRSDSFTDPTTESNKKTNDYFGGQNVNEVLSAAAQRPTEKFQY
FT                   LPYNPYAQTAYGDEVSKAYSGDITLEKALENYANKLAEQGKQQGYNVTVK"
FT   CDS_pept        446377..447339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0349"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70494"
FT                   /db_xref="GOA:E8MRV0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV0"
FT                   /protein_id="BAJ70494.1"
FT                   /translation="MSDQTMAAAPQPTVGILPEEADLHTAEARVNKHKADWRGWKFMWP
FT                   FAVVFVFVFIIPIVYAIYISFFKKQMVGGTKFVGFENYARLIQDPQFWSSVGRVTIFTV
FT                   FQVPIMLFLAAAMALALDSMKLHGTKFFRISTFLPYAVPAVVSTMIWGFVYGAKYGLVG
FT                   SLNDFLGTNIDVLNPDVLLASIANINTWEYAGYNMLIFYSSLSTIPHSLYEAASIDGAS
FT                   EWQIVKKIKLPELKGSLAITVIFSIIGSFQLFNEPSILQNMVPGNAITTYYTPNMYAYN
FT                   LSFTGNQSNYAAALAIVMAIITMAIAYVVQLKSMKEQMK"
FT   CDS_pept        447342..448349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0350"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70495"
FT                   /db_xref="GOA:E8MRV1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV1"
FT                   /protein_id="BAJ70495.1"
FT                   /translation="MSTATMTSTTTMTLADLKAQEKAAKKAEKERQKRIDADEKAERKR
FT                   AAKTGFSNPANPTRSMALTIVCAIFAVYCLFPFVYLMINATKTQSDFTSTFGLGFGKTF
FT                   ALFDNIATVFTYQDGIFGRWFVNTILYVVVGAGGATLLAIMGGYALAKFRFPGRKLCFV
FT                   IIIGAISVPGIALAVPQFLLFAKMGLTNTPWSMIIPSLVSTFGLYLMWIFSDQAVPDEL
FT                   LEAARVDGAGEFRTFFQISLPLLAPGIVTTALFAIVATWNNYFLPLIMLKDSNWYPLTI
FT                   GLNQWKDQASTAGGQAIQNLVITGSLITIIPLVIAFLCLQKYWQSGLAAGAVKE"
FT   CDS_pept        448536..450668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0351"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70496"
FT                   /db_xref="GOA:E8MRV2"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV2"
FT                   /protein_id="BAJ70496.1"
FT                   /translation="MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGE
FT                   AGVNVVSLAIFSWDKIEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESH
FT                   PEVLPVDRYGHTVNAGSRQSWQPTSPVFKEYALRLCRKLAEHYKDNPYVTAWHMGNEYG
FT                   WNNRYDYSDNALAAFRTWCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAM
FT                   VNPSQQLDYERFGNDMLLDFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEV
FT                   DFVSNDHYFHEGESHLDELACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGEL
FT                   MRDSLAHVAMGADAICFFQWRQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLS
FT                   DAGLQGTELERAGTAILFSAESEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVV
FT                   PLAYDWTGYKTIVLPTVLSLSDEDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYP
FT                   GAGNGLLRDMLGIRSEEFNILGEEAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLAS
FT                   YAGESAADWELERTPAITSRPYGNGTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTE
FT                   SGQTPTYPTTDPRILHTIRRSADGSTRFDFYLNRSNQPVAINGVEGDPIIAHRCETDAV
FT                   GYTLNRNAILIAKTSC"
FT   CDS_pept        450697..451767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0352"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70497"
FT                   /db_xref="GOA:E8MRV3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV3"
FT                   /protein_id="BAJ70497.1"
FT                   /translation="MEECGMSDEKTAKRRVTLRGVAQAAGVSLKTASNVINGSGRMTDE
FT                   TRAKVESVIKDLDYRVNVAARNLNRDHTGFITLAVPSLIPPYLAELANRTIEAARQRDY
FT                   SVYVTTYAEGSAKGARDLLKKFNSTVSDGMILSMSEVENISSDDLKVDFPLVIVGARTT
FT                   WGIVDHVTPDDVSAAAMAAGYLYDRGSTRLAVIGARDVYDEDALLNAVEGNAQLRLRGI
FT                   IEETRRRGLSLDPQLIGNTDQDWTIGAGARVTQRLIDSGVPFDGVIALNDQLAIGALTA
FT                   LRTAGYEVPVQVQVIGFDNNEEAPYLQIPLTTMDSRLDWTAPTAVNRILGRIDGSITKS
FT                   ELLTTESQVIARASTR"
FT   CDS_pept        451963..454656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0353"
FT                   /product="putative arabinogalactan endo-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70498"
FT                   /db_xref="GOA:E8MRV4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV4"
FT                   /protein_id="BAJ70498.1"
FT                   /translation="MRRNTALTRIMASGVAAIMLCAGGTFTVNAAEEEPVKADVSVKAI
FT                   QGLSDDFIGGMDVSSMLSLEESGVTFKNANGEVEDLFTLLKESGVNYVRLRVWNDPFTA
FT                   DGQGYGGGNVNADRALTMAKRATAAGLKVLVDFHYSDFWADPSKQQVPKAWKSFEGDAD
FT                   KTADTVYDYTKQTLTTFKQAGVDVGMVQVGNETTAKIAGISGWDGMSKVFSAGSKAIRE
FT                   VLPEAKVVIHFTNPEKAGTYATYAKQLSNHNVDYDVFASSYYPFWHGTTENLTSVLKNV
FT                   ASTYKKDVMVAETSWAYTLDDGDDDSNTVPSKVTADNLKKYDISPQGQADEIRAVAEAV
FT                   NNIGDNDGDGENDGLGVFYWEPAWVPVGTGGKDNAELVDTWNKYGGGWATEAAGEYDPN
FT                   DAGLYWGGSGVDNQALFDFDGKALASLPTFKYIHTGAVTDHVFTKIDPVEITATDSDSI
FT                   DAIKAQLPSEVAAHYQDGVDETETVTWQSAALDWIRGAGTYTITGTTNAGHDVTVTVTV
FT                   TATPAKDYVTDGSFENAENDKNWTIAGTGASITEDSGNAADGKRALKFWASDAYSFSAT
FT                   QTITGLEPGEYVLTAMSQGAAADNAAITDGVALSATTGGKTTSDALELNGWVKFDTATV
FT                   PVTVGADGTATITITGNLPADAWGNVDKVSLVKKTETPVKPSTENLDKAVAEAGKINRD
FT                   EYTNESLAKLDQALAAADVLLAGSTYTEQDVNDVIKLVADAIAGLAQKEVSSLTVTPSK
FT                   TTYQVGDAIDADHDLKVVGNYSAGMGNVTLSADQFTLDYDFSAPADAAKVTVTLKSNPN
FT                   VTETYTVAVTARAEGGSGNGSDGAGNGGATINPDTGEGDKTNGANGDKITGVLSNTGSA
FT                   VTAVGLAVVVLGVAGGVSLALRRKRS"
FT   CDS_pept        455304..456173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0354"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70499"
FT                   /db_xref="GOA:E8MRV5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV5"
FT                   /protein_id="BAJ70499.1"
FT                   /translation="MTNGHINPANVPDIALKDGHSIPQVGLGVLRIDDEGVVPVVESAL
FT                   EAGYRHIDGAAGYNNEAGVGRALAASGYNKGTKRETLWVTTKLRDSQQGYDSALKAFDN
FT                   SLKLLQLDYVDMYMIHWPTPFDWRSTDTWKAFVKLRDEGMARTLGVCNFMPADLKRLHE
FT                   ETGAWPAVNQIELHPTWQQREVVAFCKEHGIAVEAYSPMARGADLNAGDGTIEKIAAAH
FT                   EVSPAQVILRWHIENGTIIIPKSVHADRQKENLNLFGFALTADEHAAIDALDGPTRAGH
FT                   DPLTFTYA"
FT   CDS_pept        456177..456920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70500"
FT                   /db_xref="GOA:E8MRV6"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV6"
FT                   /protein_id="BAJ70500.1"
FT                   /translation="MARRNAHFRRRFNASGPLERVLILIVLAVAIGVTIGLLLPQVSSD
FT                   AAKITGGYTATGSAADTLNALAVDDNQSSSGYDRDSFGFRTTDVDGNGCDVRDDVLARD
FT                   LTDITYKYAGSCVVESGTLADPYTAQTIHFVRGRATSAKVQIDHVVALENAWQSGARDW
FT                   STAKRHEFGNDPYNLLAVDGPANQEKGSASAAYWLPTNADYRCDYVARQIGVKDKYQLT
FT                   VTSQEKDAMLAVLHTCPGQAVPADE"
FT   CDS_pept        complement(456924..458294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70501"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV7"
FT                   /protein_id="BAJ70501.1"
FT                   /translation="MYLKRKADAYLNAWKSDPNRSPLIIKGPRQVGKTETIDYFAAHNY
FT                   RSVVEINFVEEPKYRAITADGYGADTIVRNISLINPAKKFIPGDTLIFFDEIQAHPDIV
FT                   TALKFFKIDGKYDVICSGSMLGISYKQIESNSVGYKTDYEMRSLDFEEFLWARGYDEAV
FT                   IESMFTHLCDATPFSEVEMNVFSTAFMDYCVLGGMPAVVASHIRTGTFEGTLQLQRQLI
FT                   LDYQEDIRKYAQGLDQARILNVFNHIPVQLAKENKKFQISKVASGARFKDYRGCVEWLE
FT                   TSGMVNICRCMSYPELPLKGNYDENKFKIYFGDTGLFVAMLDDEASDDLRANRNLGVYK
FT                   GAMYESIVSEALRKSGYDLYYYKKEDSTLEQDFFVRTREWLVPVEVKSKKGTAKSMRTL
FT                   IASDSYPEIQFGVKLSAGNIGSSEHVFTAPYFTTFLLRRLLRAYDEGQAPMLNNPER"
FT   CDS_pept        458521..459912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0357"
FT                   /product="manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70502"
FT                   /db_xref="GOA:E8MRV8"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV8"
FT                   /protein_id="BAJ70502.1"
FT                   /translation="MKGTGTNDMAVTHTAADATAATAMTNAVADIEQETPEIGKERQLA
FT                   GVGTGAGAGTNNNKKPHDHALASILGPAFVAAVAYVDPGNVAANITSGARYGYLLVWVL
FT                   VLANAMSVLIQYQSAKLGIVTNKSLPELLGERMSDAGRFMFFMQAEVIAIATDLAEVIG
FT                   GAIALNLLFGLPLFIGGLVIGTISTVMLWFQGGKTQTTFERIIIVMLLIITFGFIAGLF
FT                   VAPPNPGEVVKGMIPRFQGADSVLMAASILGATVMPHAIYLHSTLVNDHYAGGEKPSIK
FT                   TQLKGSKIDVAWALLLAGTVNLAMLVLAANSLHGMSGTDSIDGAQRAITQVLGPVIGTI
FT                   FSIGLLASSLSSTSVGTYAGSEIMHGLLHVNAPMWACRVVTLVPALIVLWFAKAPTQAL
FT                   VIGQVVLSIGIPFAVIPLMRYTHNKELMGKWADGTVKHVIFMIVVALIVALNLLLIVLT
FT                   LMGRA"
FT   CDS_pept        complement(460011..461600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0358"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70503"
FT                   /db_xref="GOA:E8MRV9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRV9"
FT                   /protein_id="BAJ70503.1"
FT                   /translation="MTGAQGIKNRRGELQRVLSREESYVDGKLSRAAFISIAILTFITF
FT                   VGNFTQLQLSSALPIIVSEFHISVTTGQWLTSVFQLVMGVMVPLTAFLTRRFSTRQIVI
FT                   CSMAVFTIGSVLAWLGPNFVWVLVGRVLEAAGTGVMWPVLQITVFSIYPLSRRGFAMGT
FT                   VGMAMSVAPAIGPTLGGWQTDANGWRSIFLTMTIIGVISLLAAMFGLHNFGSHDPSARA
FT                   DFFSACLSVIGFGGLMFGFTNSETYGFAAPVTWGPMVVGLVGIVWFVMRNLRAGKRYRE
FT                   AVAKDESALPQPPLLDLEVLKNRSFTVGTITASLAFFAFSSILVIMPLYIQTDRGYSAT
FT                   MSGLIMLPGAIGQCVSQFFGGRAMDRFGARPVALFGSIVLTLGTLGMSLVAMDTWIWWV
FT                   SICQFIRQIGMGFLLMPITTWSLNCLNGPSEVSAGSSVTNTARQIAGAVGAPVLVILME
FT                   TFAALHKQGGASAVAASIFGIQWALRISAIICLAMVLMVFFGVKGDGAGRTRDIISLRA
FT                   LRERRARRMAAN"
FT   CDS_pept        461965..462702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0359"
FT                   /product="truncated conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70504"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW0"
FT                   /protein_id="BAJ70504.1"
FT                   /translation="MGSVTDLGNLDNLDTVSQQISQAKTETAAANEIAHGTLWNIASKA
FT                   PVYGDDITTVQGMTSVVDSLVSDSVSQFMDVLSTLKSAQLSSGDGQLNLQPILEAQKNI
FT                   ATANQSLQQQVRKYQQLPKAHIGMVKNAYAAGNTQLTKMADKVNQLSGTFQILPDFLGS
FT                   DQPRTYALMAMTTSEERSSGGLIGSVGVVTTDNGKISIGDFRSDGEYIPYGAGDPTEDE
FT                   QRIFRQWGPLNMSFDVRDLAVYP"
FT   CDS_pept        462674..463345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0360"
FT                   /product="truncated conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70505"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW1"
FT                   /protein_id="BAJ70505.1"
FT                   /translation="MCEIWPYTRDTSRSAEGMRAIWQRTPWGSNTQLDGVLMVDPVFLQ
FT                   ELTKISGNVTIPDGTVLTGDNTAEFLLNKVYVDYPVSMQDALFAQVAEQAVGSMFSNID
FT                   LAKLTKVAQLMGSMAEGRHFSMYAFDETAEKTISDAGFTAQTPSSEEHPQVGVYVTEQN
FT                   PSKMGWYIHRTSKVTRSTCGNDGSQTYHVEYKMTNTLENSQIGALTSYILGSGGQGVEK
FT                   L"
FT   CDS_pept        463439..463609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70506"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW2"
FT                   /protein_id="BAJ70506.1"
FT                   /translation="MYASNATIAPGESVTYSFDVTTSTKAVSDLTIDQTPMGWIDSGVT
FT                   TDTAACSINKQ"
FT   CDS_pept        complement(463719..465437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0362"
FT                   /product="galactosyl transferase CpsD"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70507"
FT                   /db_xref="GOA:E8MRW3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW3"
FT                   /protein_id="BAJ70507.1"
FT                   /translation="MSRISTTASATAQHMSNTTAETETLHRVQISRAQAAHTDSHIADA
FT                   TPDTAAPTFFDGTYFSSSPDGTVTHNDAGDRPHLIEYSVPKWRYLYNTTMVILDLLMTI
FT                   IATCIVFACNPGAYANVQNMGPSDYGVFSFLSLACISWLISLYAARSYERHTMGEGYGL
FT                   YAKLLNAAFIDFIMLCTLGYLFHLNVPRSLNVFIPILSLILVIVERYLMRRALHRNRAK
FT                   GEFNYPTIIIGSPEGISKTLKQLKACLSLGYAPIAVCPVASVCDSDDPNAAQHLVSVPF
FT                   IPANDEEARLKVLALNSHLPQTAKRMKVRTILIADVLTRDSETMRTLSLAVESMGIELA
FT                   LTASVADLSGANLQLHNDPSMPILTARLAQYSLPTRIFKRVCDIVLSLVAIILSSPIML
FT                   WAAYKVKREDGGPVFYSQTRIGIYGKPFTMYKFRSMRLNADKMDAEVAAAAGVELGTTF
FT                   KVKDDPRVTKIGKFIRKTSIDEVPQFFNVLKGDMSMVGPRPQRQYEVDQYSPLYSTRLL
FT                   VKPGITGPWQISGRNDLSQEQSEYADVSYIQNWSITGDIAILLKTVGAVFNGTGM"
FT   CDS_pept        465558..466700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0363"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70508"
FT                   /db_xref="GOA:E8MRW4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW4"
FT                   /protein_id="BAJ70508.1"
FT                   /translation="MKVQHPLDWKLPRKPVRRDVAPMGEVYSHLSEEERQVIQIEVGNG
FT                   ASIRGIGAMLGRSPSSISREIKRNTWFPSNENESYRPYRPKRLKAGPWTGRYYIAGPAQ
FT                   RKADRRRSKPRKPYRLSHDRLWAQVAEWLGRGWSPLLISGRLRVLWPDDALMRVCPETI
FT                   YRWVYSSRPLRERWARCLPRGHRRRRRHGGRRTSRFPIPGRVPISERPPEADGRSAFGH
FT                   WEADSVIGVGCNLHTEVERRTRFLMARVVPDKTAGESVGAQLDMFSPLPAGARVSVTHD
FT                   NGTEFAHHERLRDGLGMATYFADPYSSWQRGSNENRNGMIRRYLPKRCEIRMDMAKEVR
FT                   EIVDEINNRPMRVLGYRTPAEAFADELLELQDQQGCCTSK"
FT   CDS_pept        467090..467482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70509"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW5"
FT                   /protein_id="BAJ70509.1"
FT                   /translation="MAKSADLILCFEKDQRKDIVTLAPTAVKYTFLLGDFANMCEYCAR
FT                   NGLVKGLTIQERLQSVIDSASIIRPMLPEPEDIEDPHGKEYAKFRTAAEQTNKALRTIL
FT                   TSMRKHYRVEEAPVRPQITRQYAYTV"
FT   CDS_pept        467668..467793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70510"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW6"
FT                   /protein_id="BAJ70510.1"
FT                   /translation="MQGICFCFASWDSIIANNNKSNTLIAAHGEINKSLIFQHEY"
FT   CDS_pept        468706..469935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0366"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70511"
FT                   /db_xref="GOA:E8MRW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW7"
FT                   /protein_id="BAJ70511.1"
FT                   /translation="MRDEHGAEVSLSTVTRAVARLRREFAAERDEAFMDLVWHPGEAQA
FT                   DFGEVDVLLRGVVQRMHHFVLDFPYSNVGLVQLMPGENAECTCLALRNLFEWLGGVPER
FT                   IVFDNAAGVGHKGYGEREPRLTHLFQAFQAHYGFDCSFCNPYSGHEKGAVESKVGMVRR
FT                   KLFVPRPSVWSLENFNAGLPDRCLELATKPHYRKDTEERGLFSEDRAALLPLPGKRFDV
FT                   VTWRHMKADRYGVVTLEGRHRYSADRANAGRGVIVGLRALEVEVLDSSGKHLATHPRAY
FT                   GQASTNSEDPSMQLALLCNKPASWPNSRVRDALPDPLREWLDRQDRQTRNEALQTLKRV
FT                   DRESGWANAVEAMLSILESTGGADRAGVTLLAARLAEGVAGIEYDDDRPDLSEYDIAFT
FT                   ADVGVQEGGR"
FT   CDS_pept        469932..470693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0367"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70512"
FT                   /db_xref="GOA:E8MRW8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW8"
FT                   /protein_id="BAJ70512.1"
FT                   /translation="MNTKTDEGLYEKARKLFISKASIDEFAGWATPRQVDAVHRLLDTE
FT                   LANRERAKHDRLLRRARFPVVKGLDGYDFTNVRLPDGYMLDELLGLGFIPRAQDLVFYG
FT                   KTGRGKTHLAIGLGMKAIDMGLGVRFHQTAELVLQLGKAKRDGTLETMLRDIGRADLII
FT                   LDEFGYVPFDIDGARLLYQIIAGSYERRSIIFTTNIEFSKWGTVFADDKLAAAIIDRIV
FT                   HHGRLLEFTGQSRRVSEALMFGRNTSAQPEK"
FT   CDS_pept        470790..471857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0368"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70513"
FT                   /db_xref="GOA:E8MRW9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW9"
FT                   /protein_id="BAJ70513.1"
FT                   /translation="MAWIDELAPGQRKLRHGPVPEELKREAVVAVAPGRMKSREAAAGL
FT                   GVQAAVVRNRKRQMLAKSREEPVSETERGKAVARAGNPAGARPAVPNSSDAAGPADALA
FT                   SMQRKAAELQARLDALDADVERQRREKRELDVEIAIRRGTLELLGKGPGADPENPASRE
FT                   KAILAKRTGERLGVTAKSLFDAVGIPHSTYHYQPDAMNGPDRHAWLLPLVEEAFENSEK
FT                   RYGYKRVHLELKGMGMTVSSKRVMRLMAKHGMVPLRKSAKRHGSYKGGPAKAPADLVNR
FT                   DFHAERPNMLWVTDLTEFSIPAGKAYPSPIIDCYDGLPVAWTIGMSPNAALANGMLSDA
FT                   CSTLGEDEKPVIHSD"
FT   CDS_pept        complement(471944..473707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0369"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70514"
FT                   /db_xref="GOA:E8MRX0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX0"
FT                   /protein_id="BAJ70514.1"
FT                   /translation="MRLAHDPDAYVLSDQWKAGSPRPTPYLLTDREAALFLRAAGTLES
FT                   PSPWAWQSRAFFMLMACCGLRTREVRRLAVGHVDHKARSIDVVDSKAGRSRRLPVGDEV
FT                   AAELLECDQRSRERFGDDRPAFFVTSTGNPVSPGMPGVVFRRVWTRAGLEWPQAGKRPR
FT                   PYDFRHRFAFANIERWTRDGVDVMAMLPYLAAYMGHAGIDSTLYYVHASPDFHGRIRGP
FT                   RRRRRTRGPGNGGTMSKARKTAASSGEPDFWRVARDWLHHWLPKVRGSSPKTVEAYRIG
FT                   LESYVRWLETTEGTQRSHIGFGHFDRARLGRWVEWMRTERGYSDRTIMLRMTTMRVFLD
FT                   HAGLEHPALTALGNDAAGIRVKPPARKPVDHLGEEHTKALLTAWGTGDAKSRRNRMLLI
FT                   LMYDTAARIGELAALTIADVGMDKPARVTLTGKRGKSRVVPLGERTRTHLAAYLEEFHP
FT                   GPSMRDGDRPLFHSTRNGAIQPLSVDRIDEILKTAAARARRGTCPSMPERVHCHLIRRT
FT                   RAMDLYQQGVPLPLIMQLLGHESMSTTSAFYAFATLDMMRKAVDAANPGPDPSKETWLS
FT                   EQRLRQLHTLK"
FT   CDS_pept        473774..474028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70515"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX1"
FT                   /protein_id="BAJ70515.1"
FT                   /translation="MGDPSLHDAPLQTHGPVFEAMPVERAQDPDAGGAMPAHGRLEADV
FT                   LLQFAGERADESVFRGSHDDPPSGTGSTHASIPPRCVAM"
FT   CDS_pept        474035..474202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70516"
FT                   /db_xref="GOA:E8MRX2"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX2"
FT                   /protein_id="BAJ70516.1"
FT                   /translation="MESGSAWPSTALIVGNGVAASSILVAALRRNSLEPPRRPSPACRM
FT                   TRLIASYTDE"
FT   CDS_pept        complement(474429..475028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70517"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX3"
FT                   /protein_id="BAJ70517.1"
FT                   /translation="MRCTRVGWARGSPRRPSVSGRAVSAGSGGSITAGWRVCATRICGP
FT                   VRWTWASGAGAGLRSRWFRVWPWSWSVGRRISPVRDWLRRRWGITVGWRACSSRGWNLM
FT                   GSCRWMVRMARMCWGSWPGCVHAGRSRRCGTPRRTCARCSDGSGGMTWRTRSAWPAYAG
FT                   PTRSRERCPTTSTAACWRRAPRGRCRRGTRRSPCCR"
FT   CDS_pept        complement(475151..475852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0373"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70518"
FT                   /db_xref="GOA:E8MRX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX4"
FT                   /protein_id="BAJ70518.1"
FT                   /translation="MSRSLTLTRSVLAGTLAEATPNQLDFIERWFTAELDSRERSKRLR
FT                   LLKQAGFPADKTLDGYDWTNLKMPADWGRAQLENLDFVAGCEDLVLYGPVGTGKSHLAI
FT                   AIGRLACERGVPVRFFTATGLLMRLRRAQQENRLDRELASIGKARLLIIDEFGYLPIDE
FT                   EGSRLLFQIISDSYETRSIIYTTNIEFSGWGRVLGDKNMAAALIDRTVHHGRLIRFEGR
FT                   SYRSEHALMTK"
FT   CDS_pept        complement(475933..477315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0374"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70519"
FT                   /db_xref="GOA:E8MRX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX5"
FT                   /protein_id="BAJ70519.1"
FT                   /translation="MEDCSPKPKADRRYGSKIDPYAHLVDEWLEADRLLPRKQRHTIRR
FT                   VHDRLLAETDYDGEYSTTMRYVHRWREANRGVPDREGYVRLEWAAGSMQVDFGVARARI
FT                   AGEMADVHCLVVSLPYSNMRLCVALPGENAECLCHGLMLVFEHIGGVPPVIVMDNATGA
FT                   GRRNAKGEVALTGVFSAFVAHYRLEVRFCNPYSGNEKGSVENAVGFLRRNLMVPPMRAE
FT                   SYGQLSRFMLERCDGLAASSYCPRLLDVPVAEVFDEERAALMPLPSTAFDPVRWESRTA
FT                   DKYGLVDIDSNRYLAGPDSARSKVLAAIRWDTVTLASPATGELLAEYPRQYGRSRNVED
FT                   PALVLPRLAVKPRAWRESSIRPDVPDDIRAWLDSMDEKTLRESLKAIGDACRAAGFDPA
FT                   MQACGEILRSNRDMGLHADSLTPIALRMRDGEWEYPGGIEEPDLSGYDRFITGTDDGGE
FT                   ER"
FT   CDS_pept        477349..477657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70520"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX6"
FT                   /protein_id="BAJ70520.1"
FT                   /translation="MKTPRYLRARHSLPVESPDILHNGHRYRHVPFLPERRPAATGRIK
FT                   TDWQLGNIQAAAPMPITSPGNDDDTGENHQPTLRKNTAEPVEQTLKQNSLRRTVPTP"
FT   CDS_pept        complement(478619..478792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70521"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX7"
FT                   /protein_id="BAJ70521.1"
FT                   /translation="MSKGTAQTFILGQNHQIEKSGMLLMKHIDCIVQFMGQWTVLNEDN
FT                   LLGWNCLSKHAM"
FT   CDS_pept        479379..480530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70522"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX8"
FT                   /protein_id="BAJ70522.1"
FT                   /translation="MTDNVKDTKPTIAVVTLHNSPNYGSCLQTYATQTVLSRIGATTSI
FT                   VDYYRHDAIPENETERALNGQLAKKMPIFRIPGVKSLARIPVSRIVARRAKPLNDFRQS
FT                   KLALTDRKYYSVEALEQNPPQADIYCTGSDQVWNSTWNEGFNKAFYLSFAPEGAKRIAY
FT                   AASIGKSSLEDWEKPLMRNALKKYSHISVREVEAAELLDSIGVHGAVPVIDPTLMLNRD
FT                   DWSVLRDDSVLPTGSYILVYQLNKNHEFDQYVQRFASKVGLPVYRIAYGVHEKRKGEHT
FT                   IVCPPVGGFVSLFMNAEYVITDSFHGTAFSMNLGRKFVAISPGRFSGRIMNLLGMTGET
FT                   RHYLDDWRDLDIANQPIDHAHVAQVLETKRTETKAFLVKAINE"
FT   CDS_pept        480557..482338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70523"
FT                   /db_xref="GOA:E8MRX9"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX9"
FT                   /protein_id="BAJ70523.1"
FT                   /translation="MYTEIKPYQIIIQLLKERGIRHCVLSAGSRNVPFVHSIEEDPFFK
FT                   CYSITDERSAGYFALGLSQRIHEPVVISCTSSTATCNYWPPVAEAYYQHVPLIVLTGDR
FT                   DYEMLGQWEDQMIDQVGMFDRHVRKSVNLPIVRDDDDYIYCRRLVNEALLELNHNGTGP
FT                   VHINVPMKYYSTTFPLHSLPEVQAIHRVDWNSSQDEWQEKVNQLAAAKRILVVCGQESY
FT                   VSDEQQRQMTEFFHKFNSAIAVDYMSNIECEGTFNPSVCMDTRYVSDKKFEELLPGIVI
FT                   SFGGMVFSGLKAMLLRYHGKYEHWLVQEDGEVCDLFKSLTTIFACTPEYFFKYFNEHVE
FT                   NGIANDMKYHNELVDYADSVKYPDFGWSNIYAIKNVVTRIPSESLLHLSINNAIRITNF
FT                   FKLQPHVKVYANIGTHGIDGCLPSFLGQAVADSDTPSFLVIGDLSFFYGMNALRSRHIG
FT                   KNVRILLLNNHGGEEFYYNGMWRNKASDLHTTARHNAKAEGWAKSCGFTYLTASDKKSY
FT                   DAAVDQFMDSSVEGPILFEVFTEMSTDAQAIYDFYDLSRPRDFISEVKRKGKEFVKNTI
FT                   GKETALKIAGSLGVKLK"
FT   CDS_pept        483255..484391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0379"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70524"
FT                   /db_xref="GOA:E8MRY0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY0"
FT                   /protein_id="BAJ70524.1"
FT                   /translation="MSAKQLRVLQVVPSLSRAAGVSRFVYNMERYHDEKRVHYDFMHHA
FT                   IRDGVYMHKKRYDEELKARGCSVYPVNYAGDNLRRFMSEVHEAFEKVGFNYDIVHCHMP
FT                   NSAFCVLREAELVGIEHRVLHSHLNSSSDKFLHRLRNAPLNAIGKHYATDCIACSDDAG
FT                   RFLFGSRPFTVINNGIPLEQFAYDSESRKLLRSELGIKETDPVVGCVGRLVKQKNYPFA
FT                   VHVFAKFHEAFPDAKMLILGDGDDREELEGIISSEHLSNVVILAGVREDINKLYSVMDV
FT                   FFMPSLYEGLPVSAVEAQAAGLPCMYSDNVPRETDITGTGTFLSLDADIDKWTKTLENA
FT                   FNRGRLTDNPALLEQRGYSAKANAELLMQHYERLMESK"
FT   CDS_pept        484398..485633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70525"
FT                   /db_xref="GOA:E8MRY1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY1"
FT                   /protein_id="BAJ70525.1"
FT                   /translation="MSTRSNYIHQGVISESRNKKRLPVRHAFSRPLRFMPIYYVLFTIY
FT                   CALNLLKFTSFQELSWMNIGLLYLLIRIVSTLVLGVRILVQRFQAKQYVLCLVVGSCVL
FT                   ASTFISGSWNILLLLLFLIAGREVDLRKIAICVLCTNVAVIFLTVICANNGIIKKTTFI
FT                   AGNGMPERQAFGFTHPNLFGLAVVTACCAYAVLQYRKFGWKDLLIYGVAFYACYELAYS
FT                   RTSAISILLIVFLSLFVTIDKHGRWDKLILVLGSLAFLGLSLFSIWLMVYFKPSISWMS
FT                   NLNSMMTGRLDLMHHYFETYGVHMFGFDFSKMQENYRGYYDTFICDNAFAHVVLESGIV
FT                   VAALLFLAYEYVLLRGLIVYGELTPELFGLIIFAFVAFSESGAFWVCVNFCLVALAEPF
FT                   FSLYSKLPNNNK"
FT   CDS_pept        486330..487499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0382"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70526"
FT                   /db_xref="GOA:E8MRY2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY2"
FT                   /protein_id="BAJ70526.1"
FT                   /translation="MTQLFTLFRMGRRKMQRVLQVVNIMDRGGVETLLMNIYRKVNRES
FT                   IQFDFLTHPYDQDYSYEYESEILSMGGQIYKAPSFSQNPHDYQTYIEDFFRNHPEYTVI
FT                   HAHNLDSASLVYMREAKKSGRYLIAHSHSTNDHGGRLKRQMLQICHHIVRRYPDHFYAC
FT                   SKQAAEFAFGKKIASSCNCEIFYNGIDLARYCVNEIEHNTARKKLSLDVDGPVFGTVGR
FT                   LLSQKNHTFLLDVFAAILRREPSSILIIVGKGDLRTTLERKAKDLGISQHVHFAGSVPN
FT                   VPDYLKAFDVFLFPSLYEGLGMAAVEAQACGLPTLMSDEVPSLAACTDLAEFISLSADA
FT                   EKWADESLRAYRESIGHRSDRIEQVRDAGFDINEIAKKLCFFYNNHNSN"
FT   CDS_pept        487550..488983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70527"
FT                   /db_xref="GOA:E8MRY3"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY3"
FT                   /protein_id="BAJ70527.1"
FT                   /translation="MVEYKINTTKKDVIWNYIGTIVSISSNFIFIPLLLIFLSSEQIGL
FT                   WYVFVAIAGFAQLLEFGFTSTLSRNILYTLSGKHALVKTGLASDRGSRETDWHLFNVVL
FT                   KTSRIIYSVIGVLGLFLSATFGTVYIASVTNDFSIEHSFLSWIIFVASIITNLYFLYCL
FT                   TFLRGIGDVAGENRSKTIARLGQFLITAILLIAGLQILAAAIGYFMYGLLLRLFASRAF
FT                   NKHIDIKHGISSDIKKISKDEVKETLRTVSFVASRDGLVSVAWYGATQAMTLLCSAFLG
FT                   LSEAGTYSVMIQLTSGIYNVSSAYMRSFFPSFQSAYVKGDLTVQRSIIARGLSCYIAMF
FT                   ALGTAFVTIFLPFLVFFKSDFICDPVLYLGLSIYMFLLNQHSLFCNVIVNMNEIPYFKA
FT                   YLISTLAGLVLSCILCAYFKLGTWGLVLGQMLPQLAYNNWYWPVYVMKKIKSTYLSTVA
FT                   AGLQWWFSKFKGKLNLILS"
FT   CDS_pept        complement(489234..490505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0384"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70528"
FT                   /db_xref="GOA:E8MRY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY4"
FT                   /protein_id="BAJ70528.1"
FT                   /translation="MTRSHRNEDRGGEHRWTFNGVEYPTRKLMCEARRAEYVRLLDEEG
FT                   MNFTQAAHAVGVSKRTGKAWRNGRTRATGRNEKPLVDWYRSTMDKPKTLHPRYLSQEER
FT                   IQIADRLRLGDSIRAIARLLGRDPGTVSREVERNRNPESGGYEPYRAQQKAAGRLKRPK
FT                   PRKAAEGTRLWDEIAAGLRRHWSPEQIANRLRLDFPDNGDMHASVETIYQAIYLQARGE
FT                   LKQELKRAMRQGRTARRPQGGQGRKPRFREPMAMISERPPEIEDRAVPGHWEGDLITGS
FT                   RNKSAIGTLVERTTRFTILLHLPDGHDAEHVQQAIIDKMQHLPKLLRNSLTWDQGAELA
FT                   LHKRIGASLDMAVYFCDPHSPWQRGTNENTNGLLRQYFPKGTDLSVYPEDYLDAVAEEL
FT                   NDRPRKTLGFMKPSEKIIELLDAA"
FT   CDS_pept        490491..491705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70529"
FT                   /db_xref="GOA:E8MRY5"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY5"
FT                   /protein_id="BAJ70529.1"
FT                   /translation="MASGHLTLLAVGQVLQRSLEPAQPTDSKWGGKRNSSIELLRLLSM
FT                   LMIVSFHLCVGNRYDWFLAQPPTPTKVAYQFLMGGGWVGNFIFFTISIWFLLDRQNTLK
FT                   SSLKRIWILERELLFWSLALFAATLFLRKAGLYSGSVLKLAAHSVLPLTTSLWWYPTSY
FT                   AMFLLLLPFLVTGMKALGERAHRSLALIALLMWGIAGLLPFTRNDLHGGSVLVFVYWFV
FT                   LLSYYRWYMERISAATCWKLILAGLGIEVVYCLAFSLVFAMTGKGAGFQFFIFDNWKIP
FT                   SMFIGFGLFELFARREFHSRCVNCLAGSAFGVYLVHYHPAVKTLWMNWLPLEKLYLSAH
FT                   PLAAMTVCVLAIFACCLALDLVRQGLFAMTVDRNRGRWFELVWNKATERTKPMPVHTVP
FT                   VHTEK"
FT   CDS_pept        complement(492861..494594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70530"
FT                   /db_xref="InterPro:IPR026487"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY6"
FT                   /protein_id="BAJ70530.1"
FT                   /translation="MTKNKLSIYLIKQDIPPEKITVEPDEDKGIMTLPVEGHDDYRLLV
FT                   RTRGEHKPTWVESFFGSSVDGECLSVENVSLVLVIPVLLECNEIGDEEFDDGSSNGMEQ
FT                   NVRYFALTFGYGRALINRSSVEERFGLKCILNTVEPNTLRAVRFADVSGSAKRSSEQLP
FT                   KAGGIDDFAFDADCNLLGQVTAKGEDGSFLSGMMTGRDSLSVTKEVNLENAEAFLRELY
FT                   KVYRKDTYKQLFDWIDRIASVKDTELINALWNEALHQISHFSEYADTNNNLWMAVPDVI
FT                   NWDDIEGFQIGNEKDPHGEPRLHNDILLGDVIRSFKKKPDSLEKLKSKKIKAISRIDGC
FT                   ILRTWSSSECLMGELNYNDKAYCICDGKWYEIQREYLERINEDIESIEEAKTSFIPFKE
FT                   DYRNSSDYKERDGKEINLENEGRYNYELTRQLNKDDNHFILMDRQLISYGGGASRIEFC
FT                   DVLSDSGQRIHVKQYSGSSVMSHLFNQGLVSASIEKDGTDFAEKVDGKIQKVGEQGHLA
FT                   QDEIDGFLLENNPVREVVFGVIQKKDNRNLPFFSKVALSSVKKQLKRMGIETKFNWIAR
FT                   E"
FT   CDS_pept        495669..496100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0387"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70531"
FT                   /db_xref="GOA:E8MRY7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY7"
FT                   /protein_id="BAJ70531.1"
FT                   /translation="MAVYGYRKTHAQLLARGWDPAEIGRDQVMNVMRESGIRGVRRGRT
FT                   PVTTKPAKGTGGRPDLVERRFEAEAPNRLHVADITYVRMANGSFGYTAFVTDVFARRIV
FT                   GWACATTMDTRELPLQALEQAISWAASHGGTDGLVHHSD"
FT   CDS_pept        496230..497432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0388"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70532"
FT                   /db_xref="GOA:E8MRY8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY8"
FT                   /protein_id="BAJ70532.1"
FT                   /translation="MGETTVGHVAGEVVRALYGAGYMESTIGQYRKSIRALERYAGGPD
FT                   AVYTRGLGAGFAASTFSERTGGFSRQRWFDYGRLARLCDSYLRSGSVDLGKWRRSRLAE
FT                   PVVPGLAVVMERWEAYLAGSGLASATVGHYRRMAGLFLTWLESHGVVSLDGSDGSHVLG
FT                   FLAGLRSRWSESSMRHAASDLRPLFRWLGRDDLADAIGLAGIRRTHAIAGTLPDDEHRR
FT                   LLEACASRSVPSRDAAITLLSLTCGLRACDVIGLRIADVDWDSMSIGLVQRKTGNPLTV
FT                   PMTGPLAARLASWLLDERPATDDDRVFVRYKAPHVALRGHSSVYEAISRVMRHAGLGRR
FT                   GGSRLLRRNAATRMLEAATPLPTISAVLGHADPDSTRVYMATHRGGMLACVLPVPEGGS
FT                   S"
FT   CDS_pept        497684..498466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0389"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70533"
FT                   /db_xref="GOA:E8MRY9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY9"
FT                   /protein_id="BAJ70533.1"
FT                   /translation="MRLAHDPDAYVLSDQWKAGSPRPTPYLLTDREAALFLRAAGTLES
FT                   PSPWAWQSRAFFMLMACCGLRTREVRRLAVGHVDHKARSIDVVDSKAGRSRRLPVGDEV
FT                   AAELLECDQRSRERFGDDRPAFFVTSTGNPVSPGMPGVVFRRVWTRAGLEWPQAGKRPR
FT                   PYDFRHRFAFANIERWTRDGVDVMAMLPYLAAYMGHAGIDSTLYYVHASPDFHGRIRGP
FT                   RRRRRTRGPGNGGTMSKARKTAASSGEPVCFSKLASAL"
FT   CDS_pept        complement(498547..499248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0390"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70534"
FT                   /db_xref="GOA:E8MRX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX4"
FT                   /protein_id="BAJ70534.1"
FT                   /translation="MSRSLTLTRSVLAGTLAEATPNQLDFIERWFTAELDSRERSKRLR
FT                   LLKQAGFPADKTLDGYDWTNLKMPADWGRAQLENLDFVAGCEDLVLYGPVGTGKSHLAI
FT                   AIGRLACERGVPVRFFTATGLLMRLRRAQQENRLDRELASIGKARLLIIDEFGYLPIDE
FT                   EGSRLLFQIISDSYETRSIIYTTNIEFSGWGRVLGDKNMAAALIDRTVHHGRLIRFEGR
FT                   SYRSEHALMTK"
FT   CDS_pept        complement(499329..500711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0391"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70535"
FT                   /db_xref="GOA:E8MRZ1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ1"
FT                   /protein_id="BAJ70535.1"
FT                   /translation="MEDCSPKPKADRRYGSKIDPYAHLVDEWLEADRMLPRKQRHTIRR
FT                   VHDRLLAETDYDGEYSTTMRYVHRWREANRGMPDREGYVRLEWAAGSMQVDFGVARARI
FT                   AGEMADVHCLVVSLPYSNMRLCVALPGENAECLCHGLMLVFEHIGGVPPVIVMDNATGA
FT                   GRRNAKGEVALTGVFSAFVAHYRLEVRFCNPYSGNEKGSVENAVGFLRRNLMVPPMRAE
FT                   SYGQLSRLLLERCDGLARDSYCPRLLDVPVAEVFDEERAALMPLPSTAFDPVRWESRTA
FT                   DKYGLVDIDSNRYLAGPDSARSKVLAAIRWDTVTLASPATGELLAEYPRQYGRSRNVED
FT                   PALVLPRLAVKPRAWRESSIRPDVPDDIRAWLDSMDEKTLRESLKAIGDACRAAGFDPA
FT                   MQACGEILRSNRDMGLHADSLTPIALRMRDGEWEYPGGIEEPDLSGYDRFITGTDDGGE
FT                   ER"
FT   CDS_pept        501012..502043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0392"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70536"
FT                   /db_xref="GOA:E8MRZ2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ2"
FT                   /protein_id="BAJ70536.1"
FT                   /translation="MKQNKPDFWRVARDWLHHWLPKVRGSSPKTVEAYRIGLESYVRWL
FT                   ETTEGTQRSHIGFGHFDRARLGRWVEWMRTERGYSDRTIMLRMTTMRVFLDHAGLEHPA
FT                   LTALGNDAAGIRVKPPARKPVDHLGEEHTKALLTAWGTGDAKSRRNRMLLILMYDTAAR
FT                   IGELAALTIADVGMDKPARVTLTGKRGKSRVVPLGERTRTHLAAYLEEFHPGPSMRDGD
FT                   RPLFHSTRNGAIQPLSVDRIDEILKTAAARARRGTCPSMPERVHCHLIRRTRAMDLYQQ
FT                   GVPLPLIMQLLGHESMSTTSAFYAFATLDMMRKAVDAANPGPDPSKETWLSEQRLRQLH
FT                   TLK"
FT   CDS_pept        complement(502676..503008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0393"
FT                   /product="putative truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70537"
FT                   /db_xref="GOA:E8MRZ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ3"
FT                   /protein_id="BAJ70537.1"
FT                   /translation="MCLLVDLVNRGIAGHSAGRTRDAGLVLAAFATLDFPLTDVQVFHT
FT                   DRGSEFDNTRIDELLDVFDIKRSLSRKGRPYDNAVVESTNRLLKKELAYRARVPEPLRH
FT                   DRAAEA"
FT   CDS_pept        503221..503409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70538"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ4"
FT                   /protein_id="BAJ70538.1"
FT                   /translation="MPFLFSRLTVDACRPGIMAMRRTLAPLPISIRMTYRSSSDRCEYT
FT                   WPKAQHPSVWLSGQSPI"
FT   CDS_pept        complement(503496..504887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0395"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70539"
FT                   /db_xref="GOA:E8MRZ5"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ5"
FT                   /protein_id="BAJ70539.1"
FT                   /translation="MSTPNNTQLGNKSVQEKRRNSGHCPALQRGAMTETLTRITITPSD
FT                   MLMFAAVAMLPFDGTKIGIPLPYWTPISPWLFTLYTIINWRYLRDTARRFLPFFLFPLL
FT                   LVLTSVYGWQSYGIHASATAKSFISILLGLACLASLDIAIRIKRVPVRTLLTTLFTAYV
FT                   VAFLIGILQYIALERHLNWQPVRAYFWGALYRNYASVRPQFMFAEPSYIGMHLFGVLLP
FT                   VFWLTRDRKIGILIPIFAAGAIAMGSGTRIILDTVVATFIWLIATINFHSRKATAGFVG
FT                   ALGLLGAGGLSAITINPRLNSLATNGLLAGDGSMSARIFHMLAPMWSWKHDLPHFMFGW
FT                   GAGNISNAVRTGYAGARQWYDAHGGAPSTEIDGLANPPADTFTMSIYASFITEFGLFCF
FT                   LAFLLLVLAHVAVHHGWSRRNICWFILLAYLYIQFESYAFYAIPLFIWAVCTIMNRGKN
FT                   NINSL"
FT   CDS_pept        complement(505194..505424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0396"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70540"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ6"
FT                   /protein_id="BAJ70540.1"
FT                   /translation="MKFSKGEGKQTTSVSIKDAVLVEAISKYFTLVEAPEGEVSFASVN
FT                   GTAYPKDKTVIFDVANATAGTMKRRGRKKAE"
FT   CDS_pept        505930..507366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0397"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70541"
FT                   /db_xref="GOA:E8MRZ7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ7"
FT                   /protein_id="BAJ70541.1"
FT                   /translation="MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEV
FT                   FATYAGQSGETQTTNDMSSGANYLNTQITTYPELVKTEAVLQPVIKDLGLDMTTTDLAD
FT                   VVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIKLTV
FT                   VQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSL
FT                   GTVPQATILDDSRPVVVAQPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLIITSTDPSE
FT                   GKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIEGHVGLSHVLSRQASPADVIQ
FT                   KYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFG
FT                   RMAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYED
FT                   GNKRSSHKGAKSKGEKKARK"
FT   CDS_pept        507588..508949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70542"
FT                   /db_xref="GOA:E8MRZ8"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ8"
FT                   /protein_id="BAJ70542.1"
FT                   /translation="MGTDERPEPNAESGSSTSPARGDIVDTFWDIPPISFDENDGGIAQ
FT                   GDNGTGTVAGGVQSVFPSFDEVLEWPTASAANTAGDAFSPSDAVATAPMTFAAPDTAES
FT                   AQSPQQDNNATLPLFAPVPEAKPQRDSAIDDLNIDFSAIEQNPEPVEEPEEDRVAETPR
FT                   GGKGGKKRTKGIIISVIVALVVIAAIIGGVWYWRFSEQRRESHQLHQDALTACTEAVGQ
FT                   NSTAQKALAKALADAKSAQSITADQVADGATVDALKKAIAAVKNVEAVECKTSASTSDL
FT                   KEYAKTATSQTKTAKKNATAITAAAKAVTDSKNAKDQGNAQQALQSKIAEAQTLLDNSL
FT                   YAVDDNSTRVTLESDIANANTVLSQQGTDVKAMQDAVNTLTASMDAVNTSMANYSAAVE
FT                   AQREAARQKALNDYYARLRQQQLLQQQQQKQPDDEGTGDPAAGQGTKPEDEPKP"
FT   CDS_pept        complement(509064..509213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70543"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ9"
FT                   /protein_id="BAJ70543.1"
FT                   /translation="MRMMPVPNHRGPASAFLRLISRILALCNALEVTFTASYEVPSTTD
FT                   YANP"
FT   CDS_pept        complement(509296..510279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70544"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS00"
FT                   /protein_id="BAJ70544.1"
FT                   /translation="MSKHAERTSFVKTLSRGQWAKIAAAVAAVGLIATAGVISRDFYQS
FT                   STATPSITPTSFSATDGAASRSASRGALKSTTYVTVKVNGKSRVVLGEKANMTTVKDVL
FT                   ETGDIVLDPEDSVTPSLDSKVSESTVISINRANTTVETTDTEIAFNEVRKETSSLPKGQ
FT                   EKVETEGEKGVMETTSLVTRSGDQVVSSNVFTSWVKKAPVDKVILVGTSTVSSPSAASL
FT                   GTTTPAGEIQSWAHDYLISNGYSEADFTAANFIISHESGWSPTATNPSSGAYGLPQALP
FT                   GSKMASAGADWQTNYQTQFKWFVNYCKDRYGSISGAYAYWQAHKSY"
FT   CDS_pept        complement(510452..510823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0401"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70545"
FT                   /db_xref="GOA:E8MS01"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS01"
FT                   /protein_id="BAJ70545.1"
FT                   /translation="MAATAITSAEFEKTITDNEIVFVDFWATWCGPCRAFGPIFEAASN
FT                   EPENANIAFVKVDIDANQDLAQAAGIQAVPTLMIAKQGEVIFQQAGALQASDLDDLIAQ
FT                   AKALDLAAAKAQQAAQEQQ"
FT   CDS_pept        510991..511653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70546"
FT                   /db_xref="GOA:E8MS02"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR032582"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS02"
FT                   /protein_id="BAJ70546.1"
FT                   /translation="MFINARDNETMPVMNDEVPDEGDYDAGRGRGEFDNITPEDFIHGG
FT                   GSGHGNPPGWLGPSDINRARHQMPIAYVEIVPVRTDEMGRISQVGSLLRVSEDGSIERT
FT                   LITGRVLYHETLREAIARNVAKDLGDIALPLLPIGLQPFTVAEFFPTPGLSEYYDPRQH
FT                   AIALCYVVPIAGDCKPQDETLDVEWVDPKSDVMDTFVAQMVNGHGRIVRQALAWAGI"
FT   CDS_pept        511779..512636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0403"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70547"
FT                   /db_xref="GOA:E8MS03"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS03"
FT                   /protein_id="BAJ70547.1"
FT                   /translation="MAIELANHIYRDGEGVPVVLMNAYPVDHRMWDVCAKALADFADLN
FT                   DVPDFPIWAPDMAGSGASPVPSDADSGPRMANGAYSEALDRLAGAYVDLIKAAGYEQAI
FT                   WVGLSMGGYVAMDIQRLYPETVAGLALCDTMAASDGVGGENRLKMADAAEQTNSVEPVM
FT                   HFAQPAEGDSTVKKTPEFIATMTGWINEQNPAGLAWRQRMTYGRPELGAVPETISAPSL
FT                   VVSGELDPSSNPSVMRPLAERITGAEFIDIPDCGHFSAVEHPDTVARALLSLVKRVQSA
FT                   QKNA"
FT   CDS_pept        512646..513938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70548"
FT                   /db_xref="GOA:E8MS04"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS04"
FT                   /protein_id="BAJ70548.1"
FT                   /translation="MTADIHFSPLALTHALPFLPLAQGDIDYQVDRRSEPGLIDELLAE
FT                   PTTKVVLTRGGLVAVPRGQGELVDYENVKMRLATLPGAYVSAELARYPEAVAMFLGSYV
FT                   GARGESVVAVDITRVPEAGVPGVGGIAGVGGAVGGVLGIQDSGTVDGALGKNGISGGAA
FT                   AGIRQSGNAKGNGGVAAAKIAGPLGVPDSAGQGADDAFDDSVGASVQPLAPKPTLLQQA
FT                   VTRFDWVDLRGFAPHANAREAGQATSAITLSIWHSRQRFCPTCGAAVRSALAGWAQRCT
FT                   NEADGNRVLFPRVEPAVITAIVDGHDRLLLQHNAAWKDSRLYSVSAGFVEAGENLEHAC
FT                   RREAMEETGIKLGEVRYLGSQPWPFPASLMMAFKAHAITTDVRVDGEETMTARWVTRDE
FT                   YTAELIAGRMAAPGRATIARYMIEEWLGREL"
FT   CDS_pept        513970..514377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0405"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70549"
FT                   /db_xref="GOA:E8MS05"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS05"
FT                   /protein_id="BAJ70549.1"
FT                   /translation="MSDDNENEQPLNLDIPDHLEYSEEHAWVDRSVDPAIIGITEYAAD
FT                   QLGELVFVDLPEPGARVEAGDEIVELESSKAVQPLISPVAGTVKYVNRDVADDPSVVNG
FT                   DPYGEGWLLKVELDDDEPELLSADEYAKVVR"
FT   CDS_pept        514445..515776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70550"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS06"
FT                   /protein_id="BAJ70550.1"
FT                   /translation="MRSPREDFEAAGKRLPWDAAACNAALSATAPVSDVKASANGADNA
FT                   SNAEHSDDMPTVPIPARKAATTFDTPSKRERIEVKPPITRFIRRAVTRVFGVWSRISTQ
FT                   VVRQWDWYPRVEPYVGYGTGDYSRLICRTVYAPRHAQSGELIRGIRGMLAIPAPRTHVQ
FT                   ASIDDMPLNTVQIGVSEVYDKVDRTRDLGSEYAISDSAGYLDLVAEHRLVPGIHRVSYS
FT                   VANRKPVSANLYTIPASAKVGIISDVDDTIMITQAPVPWKAAYNLLFLDPKKKASVPGM
FT                   SVLFTRIADLFPGAPFFYLSTSPWNVESSIRNFITDHGFPEGPLLLRDLDPRPKTFVPT
FT                   GPQHKLEFAEQLMADFPDMKFILVGDDGQKDPTTYATIARRYPGRVLAIVIRELSPRES
FT                   TGLASVTGLTSTQPTPVTDVPVFTGTTGSNILKTMLPYLKTVLR"
FT   CDS_pept        515837..518353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0407"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70551"
FT                   /db_xref="GOA:E8MS07"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS07"
FT                   /protein_id="BAJ70551.1"
FT                   /translation="MTDESTNAAAAMPPYAKREPKRREFHGDVFEDDYEWMRDKDSDDV
FT                   RSYVAAENQYCERRMAHLADFRHTLFEELKSHVEETDMSVPTRVNDYWYFTRTQQGKQY
FT                   GVQCRIPVRDADDWDPPVVDPQGAPGSMPGEQVVFDANKESEGHDFFRLGGLDLSKDGR
FT                   WMLYGVDVAGDERYDFRIRDLAGLETGEPVSELPEQFTGIGSACFTPDGQWVFWVELDD
FT                   SWRPLAVWRHRVGTAVESDVCVYRETDERFWVGVGISFDERNIVIGTGSKTTTEVLMLP
FT                   VATPEGEFQAFIPRQNDIEYDVSFACFEGAGENGADVPLAVVYHNAANPNFEIDVIDMR
FT                   GHEPPYRLGEGVCIAAGSPYGCEHGEPDKPITEAYFNAVNPAILQGAHGLGIEGIALHR
FT                   NFVSLSYRADGQPHVAYMTKSAAAADFLAGRPWRFTELLPPALEDDWDMVADDRENFTG
FT                   DHGEILWTEDEAPTDHTSSSDGASDDHLPGETRRLYTIGVGGNPSYEAPRMRYSFASYT
FT                   RPGELHEIDPATGEDALLKRATVLGNFNPRDYMERRVWITARDGERIPVSLVWHRDCPA
FT                   QDSPMFITGYGAYEISSDPGFSVSRLSMLDRGVLYAVPHIRGGGEMGRAWYEQGRRLNK
FT                   KHSFEDFVDATRALQKAHLADAWRTVANGGSAGGLLMGAIANMAPECYAGVEADVPFVD
FT                   ALTSILDPDLPLTVTEWDEWGDPLHDPEVYQYMKSYTPYENVPVAVLEGGNDEAAGDGS
FT                   ADGAATGAVAAAQFPRIFITTSMNDTRVLYVEPLKWLARLQSAGVDAVAKIEVEAGHGG
FT                   LSGRYKQWEEVSYENAWCMDVMGLAH"
FT   CDS_pept        518418..519449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0408"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70552"
FT                   /db_xref="GOA:E8MS08"
FT                   /db_xref="InterPro:IPR023698"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS08"
FT                   /protein_id="BAJ70552.1"
FT                   /translation="MAKTYKIAVIPGDGIGKEVTPWAQKALEKAAEGVADFEYENFDLG
FT                   AERYLRDGAILPEDEEERIKANDAILLGAVGDPRIKAGILERGLLLKLRFDLDQYVNLR
FT                   PSKLYKGVTSPLANPGDIDFVVVREGTEGLYCGAGGAVRRNTPQEVATEVSINTAYGVE
FT                   RVVRYAFKLAMKRKKHVTLVHKKNVLVNAGDMWQRIVDKVGEEYPEVTHDYQHIDAATI
FT                   FLVSDPSRFDVILTDNLFGDILTDEAGSVVGGVGYSASGCINASDEFPSMFEPIHGSAP
FT                   DIAGQNKANPTAAILSAAMLLEHLGFDDAAKKIHTAVEADIEELGSTVRSTDQVGKDIL
FT                   ARM"
FT   CDS_pept        519831..520592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0409"
FT                   /product="putative lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70553"
FT                   /db_xref="GOA:E8MS09"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS09"
FT                   /protein_id="BAJ70553.1"
FT                   /translation="MGSPDAPNIPASINTQTKQPDKSSEYRERWNALKPQLTVIHGHPR
FT                   TPDEQMAIDETWAREVAAGTRQPTIRLWEWAGPAVVIGRFQSAQDEVNLDIAKQLGFDV
FT                   VRRCTGGGAMFIEPGNTITYSLYAPLDFVQGVSIEESYRLCDWWLVEALRELGLDVRFA
FT                   GLNDIASQYGKIGGAAQRRFPVGSGGAVLHHVTMAYDIDAAKMSRVLNTSREKMSDKAV
FT                   KSAVKRVDPMKSQTGLSREHIVEHLIDWFAA"
FT   CDS_pept        520831..521550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0410"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70554"
FT                   /db_xref="GOA:E8MS10"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS10"
FT                   /protein_id="BAJ70554.1"
FT                   /translation="MSLETPNAFADEENILLHTALFKQVSPAEAEELLPHLKHATFDKG
FT                   DYIFSEGDTDQRMYLLEQGRVKLIRTSSDDRVQLLSIHAPGEVLGEIPVFDPHGGPRTA
FT                   SAVSMSHGTRVVWLEHDALFAWLDEHPRVAIDMLQVMASRQRGNNERISDLVFMDVPAR
FT                   LAKTLLNLGSRFGEPVEQGLKVPHDLTQEELAQLVGSSRETVNKALMDFSNRGWIARDG
FT                   RSIIIFQPGMLIRRSRR"
FT   CDS_pept        521654..523969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0411"
FT                   /product="putative penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70555"
FT                   /db_xref="GOA:E8MS11"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS11"
FT                   /protein_id="BAJ70555.1"
FT                   /translation="MGPMPKKKSLTLQRVLVLLLAYIMLAVCGGVAASVLFVPGVIGAN
FT                   KAAKAVIPSLKVENVDFDVTSLPQKSTMYARDGSTVIATFYNQNRIVVPLKKISKTMQQ
FT                   AVVAREDRRFWTHAGVDVQGVMRAFVQTYLVKGSQQGGSSLTQQYVKNVLLMQAIEDDD
FT                   SIAQYHATEDTIARKIREMLISVQMEKKYSKAEILQGYLNIAQFGNNLYGVETAAQRYF
FT                   SVSAADLNVVQSATIAAITKNPSLYDPLVEENQKESENQRNIVLKLMLQEGYITQKQYT
FT                   EAVNTPLKDTLKAQDVNVGCQDTGDYAYFCDFVVHRIQNSEEFGKTRAERNKLLQEGGL
FT                   KIVTTLDVEANSTMMETARNTIPPDDPSGMEIAMAAVKPGTGEVLSFGLNRYYDATPAA
FT                   ANDPTKTSQNYAVDLADGGGSGWTIGSSWKPINLIAWMEAGHSINDNLQTSTSYPTTDF
FT                   ACSNYSGGADSWNVSNAMGAGTVNPESPFLGLVRSHNTTQASMGAILKLCKVADTATEL
FT                   GYHDAATGETIDKTQVYTPSMMIGSVNVSPLTMASIFAVYASNGVQCNPIAISKVTDKD
FT                   GNDLKVPSANCHQAVDKDIIQTLAYTLNQGTVRPDGAGWSFRLADGRKSFGKTGTSEDL
FT                   AVSGGSFIPNQIAAFAVVGDAQNPYTNRISNIAINGRYNSYWDGSTIAAPAVTNFFNSY
FT                   ISKKKIPIDNDYGQPVSKYTTTGKYLGIGGRTFSVPQTTTNGNSQSQSSNNQSQSQNTG
FT                   QNNTQTQGTNSEQSNDGQ"
FT   CDS_pept        524161..525525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0412"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70556"
FT                   /db_xref="GOA:E8MS12"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS12"
FT                   /protein_id="BAJ70556.1"
FT                   /translation="MSNDDLTHENFDFRGFDVPDLKAVTLASSSDGDQSKQPKTKHEDA
FT                   SKNRKHGKKKSKSDARSKKRAGAGKTSESFDDYEEREAVSKADKKVSKDRPGLFAPMTL
FT                   REVTVRNRIWLPPMCTYSSFARDGRATPFHYQHYVSRAFGGFGMVIVESTAVAPEGRIT
FT                   PCDLGLWEDGQIDAWRWIVDGIREAGAVPAIQLNHAGRKASTGCFAVGYDGQSVPEEAG
FT                   GWPTMAPSEIAFGGLRTPRALSVDEIHGLVGAFAVAAGRAVAAGFQAIQIHAAHGYLIS
FT                   QFLDPLSNERDDEYGGDLTGRSRFLVEVVDAVRGAVPEGVPVLVRISATDWAAGGWDLD
FT                   QTIALSKVLKEHGVDVMDVSTGGIMSGVSIPVKPNYQVPFAEQVKSKADIPVTAVGLIT
FT                   KPKQAAKILAHGEADAVEIGRAALRDPYWPLRAANKLGIPSTEVPYAPQYVAGAY"
FT   CDS_pept        complement(525693..526844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0413"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70557"
FT                   /db_xref="GOA:E8MS13"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS13"
FT                   /protein_id="BAJ70557.1"
FT                   /translation="MTYVSESFWHDAVNKATTDLFTFGYKHIIKPNFVFNHRPDEAHDQ
FT                   MIEFCHVVKNVPPLLLAEQLMLDYTDPILETNVMGVDFTNPFGLSAGLDKNCDMPVVLD
FT                   HAGFGFETVGSTTSRPCPGNAKPWFHRLPEYDSMMVHVGLANIGSDKVIERAEKAWTQA
FT                   RQMQLSVSIARTNDDQCGDLDEGIEDYCISMRRAAGRTAMVEVNVSCPNTHVGEPFTAT
FT                   PEALDRLFTALDKIDRPQPTLVKMPLNKPWGEYKELLDVLADHNVQGLSIANLQKDRTG
FT                   LGIPRDWEGGLSGGPCTNASTELIRKVYKEYGDRFAIAGIGGVFTPEQAYAKIRSGSSL
FT                   VMFISSLMYRGPQQITVLKRGLAQLLRRDGFEHVSDAVGVDVE"
FT   CDS_pept        527289..528002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0414"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70558"
FT                   /db_xref="GOA:E8MS14"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS14"
FT                   /protein_id="BAJ70558.1"
FT                   /translation="MSAMTIRRDIAELADKGLLKRVHGGAVTTSTLLSEPLFSVKSQMD
FT                   IGLKDAIAQEAIKYVAPGDVIAIGGGTTAYVFAQHLLESQQSSGITILTNSIPVAELVQ
FT                   ALESKDVEVIVTGGVITRSNSLVGPIADKVVASLRVNTVFLGTHSVSIPRGFLMPNSLE
FT                   AATDMAMMDIADRAIVLTDHTKWSCTSLSLFARFDQVDTVITDDGLDPDSAAKTKDLVK
FT                   ELVLAHQSEIIEESE"
FT   CDS_pept        528007..529257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0415"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70559"
FT                   /db_xref="GOA:E8MS15"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS15"
FT                   /protein_id="BAJ70559.1"
FT                   /translation="MADFANYTPGEYAKEHIRITPTTLADGRDFFYLDDDPEFVSGAKT
FT                   RELKDPRPLDYRFAPHLDADGNEVPYAAPQMRRDPLTGDWIPMATARMNRPITAGPGAT
FT                   AKGNPLAARKPGDPYQDGEVPDTDYNVVVFENRFPSMVRVPGVSEDVTYVDGNPLWEKK
FT                   LAAGRCEVICFDPNEDGLPADLPVSRLRTVVEAWAFRTAEISKMEGIEQIFPFENHGQE
FT                   IGVSLAHPHGQVYCYPFIAPKMEKELQHTEAYHEKTGGNLLKDIMNAELEAGERIVMRN
FT                   HSWVAYVPAAARWPLEVHVAPVRDVLTLDQLNDEERWDLASMYSHLLKRGNAFFDKGDG
FT                   KGMDLPYIAAWHQAPIHDARRENYRLNLQFFSFRRAANKIKYLAGSESGMAAWISDTTP
FT                   ELIAKRFHELGSIDIAD"
FT   CDS_pept        529274..530524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0416"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70560"
FT                   /db_xref="GOA:E8MS16"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS16"
FT                   /protein_id="BAJ70560.1"
FT                   /translation="MTAVEFIEPLTHEEGVSQATKLFVDTYGAAPEGVWAAPGRVNLIG
FT                   EHTDYNAGLCLPIALPHRTFIALKPREDTKVRVVSGVAPDKVAEADLDGLKARGVDGWS
FT                   AYPTGVAWALRQAGFDKVKGFDAAFVSCVPLGSGLSSSAAMTCSTALALDDVYGLGYGD
FT                   SDAGRVTLINAAIKSENEMAGASTGGLDQNASMRCTAGHALLLDCRPELTPLENVSQQE
FT                   FDLDKYNLELLVVDTQAPHQLNDGQYAQRRATCEEAAKILGVANLRVTADGISKADDQF
FT                   QALKETLDALPDETMKKRVRHVVTEIERVRSFVRAFANGDIEAAGRLFNASHDSLAADY
FT                   EVTVPELDVAVDVARKNGAYGARMTGGGFGGSIIALVDKGRSQEVAQKIADEFEKQGFH
FT                   APRALAAYAAKSASREA"
FT   CDS_pept        530607..530879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70561"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS17"
FT                   /protein_id="BAJ70561.1"
FT                   /translation="MNKAIITVVGQDTVGIIARVCTYLSQHNVNVLDISQTIIDGYFNM
FT                   MMIVDYANADKDFGAMVGNLEDLGDDIGVRIRCQREEIFTKMHRI"
FT   CDS_pept        531015..532379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70562"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS18"
FT                   /protein_id="BAJ70562.1"
FT                   /translation="MLNIMEVHETNQMIEQEKLDVRTITMGISLLDCASDDVDKTCDNI
FT                   YRKITTYAKDLVSTGKAIERDYGIPIVNKRITVTPISLVGASSCKTSEDFVKIAHALDK
FT                   AAKEVGVDLIGGYSALVSKSMTPAEELLIRSLPQALSETDIVCSSVNVGSTKTGIDMNA
FT                   VELLGHIIKDVAERTADNDSYGCVKFVAFCNVPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASRRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLEQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAASSGCLTIEKLEAMTCVCSVGLDMIAIPGDTSAATISGMIADEAAIGMVNQKT
FT                   TAVRVIPVAGKGVGEMANFGGLMGYAPIMPVNQTSCEAFVTRGGRIPAPIHSFKN"
FT   CDS_pept        complement(532686..533348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0419"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70563"
FT                   /db_xref="GOA:E8MS19"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS19"
FT                   /protein_id="BAJ70563.1"
FT                   /translation="MTNEAEQNSQNAQNPETKVEKMFEYGYRKSNYGPDELVTDAHGNP
FT                   ISVVDAMLSAEKAATTETVTPHLCYYSPRIPGNTGSAIRLCAVTGTILHLVEPLGFNLR
FT                   DTKLRRAGLDYHDMAHVVLHPNFDNLVESMPNSRIIAFTAHATKLYTEVEYKPTDILLF
FT                   GPEPGDIPDPMDIMEGPHVAEQVRLPMRPSLRSLNLTNCASIAIYEAWRQLNFAGGR"
FT   CDS_pept        533369..534355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0420"
FT                   /product="putative adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70564"
FT                   /db_xref="GOA:E8MS20"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS20"
FT                   /protein_id="BAJ70564.1"
FT                   /translation="MNDTAISLRLGAWWEANARDLPWRFGRATPWGVLVSEVMSQQTQM
FT                   SRVVPYWTDWMERWPDARALAEAPKAEVITAWGRLGYPRRALRLQECARVVAEDYADKL
FT                   PRTYDELTALPGIGDYTASAVMSFAFGERIAVIDTNIRRVLSRVFLGVESRGGATSPAE
FT                   RALANRMLPKDEILGCDADVADNAGSAEHVVNSTIRGGKRSRLHRGERPSVTWNQSVME
FT                   LGAVICTAKSPLCDTCPIADDCAFLKAGRPGLGERRTRPRQRFQGTDRQVRGLVLAALR
FT                   ELPAGATLPREDADKLWKDQIQLAACIASLDDDGLIEILDGGLRLPS"
FT   CDS_pept        534420..535142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70565"
FT                   /db_xref="GOA:E8MS21"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS21"
FT                   /protein_id="BAJ70565.1"
FT                   /translation="MAVQRNTSGARTARGAGTGANGPSGGPSQNNRSGKPRKRRISKKQ
FT                   QAIYRRRRIVAGTVLLLIIALIVFCVYSLGRGIGAVNSMIHHDEVYAISRDATPAPKKV
FT                   SNVKDCSASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGNCLVDGSDSGRVLTITSGQ
FT                   ETIYKSDVCPADSRLLLMAKGDKDVQKVTWNTNANATLAKCTDESGWAKVNAGTYVAQL
FT                   SLKDHPKVKSDPVTFTVQ"
FT   CDS_pept        535297..538860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0422"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70566"
FT                   /db_xref="GOA:E8MS22"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS22"
FT                   /protein_id="BAJ70566.1"
FT                   /translation="MATESTTNTTTIIARADQHDIDLHKASDRVNFGSIKEPIDVPYLL
FT                   GVQTDSFDWLIGNERWKARVEEDEKNGTNTVAHTSGLDEVFNEISPIENFAQTMSLTFS
FT                   DPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQTVFMGDFPLQTPHGTFI
FT                   IGGTERVIVSQLVRSPGVYFDRQQDRTSDKEVFGAKIIPSRGAWLEFEIDKKDQPQVRV
FT                   DRKRKQSAIVFLMAIGMTKSEIAQAFKDYPLVLDALEKETLETQDEALVDLYRKIRPAD
FT                   TPTPEAGKNLLDSFYFNTKRYDLARVGRYKINRKLGVEADFNDRSLHQEDIIATIKYLV
FT                   ALHDGAATFPGKRNGEDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRE
FT                   RMTTQDAEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLSGVTNKRRLSALGPG
FT                   GLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRVNPFGFIETPYRKVV
FT                   NGHVTDEVEYMTADRDLDHVIAQANQELDENGNFVSKSALARVGEEEAVDVPVSSVDYM
FT                   DVSPRQMVSLGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGSEWRAANDS
FT                   GDVIKSEKDGVVTYVSADLIRVMNDDGTTSSYKLAKFQRSNQTTCYNQRPIIHDGERVE
FT                   AGSVLADGPAIQKGDLALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYE
FT                   IDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELT
FT                   PEERLLRAIFGEKSREVRDTSLRVPHGETGTVIGVKEITREDAEEDGDELPNGVNQMIR
FT                   VYIAQHRKITVGDKLSGRHGNKGCISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLG
FT                   QVLELHLGWIAHSGWDISLDPNMEAEWKKLVPSGAEKAEPNTPVATPVFDGVKPEVLKG
FT                   LLSTTLPNRDGDRLVGPDGKATLFDGRTGEPYTKPISVGYMYMLKLHHLVDDKIHARST
FT                   GPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGA
FT                   IVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVAIDMKDEDDDPASSADDLGFN
FT                   IGARPDAAAKEDQKAEEPEYQ"
FT   CDS_pept        539028..543065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0423"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70567"
FT                   /db_xref="GOA:E8MS23"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS23"
FT                   /protein_id="BAJ70567.1"
FT                   /translation="MLDVNAFDKIRIGLATADDIRGWSHGEVKKPETINYRTLKPEKDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSRVRRERMGHIELAAPVTHI
FT                   WFFKGVPSRLGYLLNVTPKDLERVIYFASYMVTEVNEDERHNDLPGLQDEFDSEIKRLE
FT                   QRRDSDIEARAKKVEEDLAALEETGEAKGPARTKLRNGAERDMAAIRTRYNDQIARVDA
FT                   VFDKFKKLKPGDMVDDVDLWREMQDRYGDYFDGCMGAEAIKKRLQSLDLETISKELREE
FT                   IKDASEQRKTKALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSD
FT                   LNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRP
FT                   LKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVI
FT                   KRLVDLNYAQNMKSAKRLVDRGDAEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPIL
FT                   VEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVT
FT                   MPSQDMILGLYYLSTVLEGAKGQGRVFSSLEEAEMALDRHEIDMQAKVLIRLPESFVLP
FT                   KNWEPGEVKVLDPREGEDEVVKEERFHDGTVLFATSYGRILFNETLPTDYPFVNEQVAK
FT                   GRLSKIVDDIAMRYSTQQVAATLDALKDLGFTRAPWSGVSFAFSDVNEPPERDEKIAEY
FT                   EAKADKVNANYEMGLLTEEARRQELIDLWTECTAEVSKEVEEKFDPTSNLAIIVQSGAR
FT                   GNMMQINQIAGMRGLVANPKGEIIPRPVKSNYRDGLSVLEYFISQHGARKGLADTALRT
FT                   AESGYLTRRLVDVSQDVIVREEDCGTKAGLPIRVAERDNDGNLVLVKAADGGPYSRLLA
FT                   ADVIDPADGQTVLYKRDDALSMDVLNDLVAHGVEEVKCRSVLTCESKRGVCAKCYGWSL
FT                   ATNKLVDVGETVGIVAAQSIGEPGTQLTLRSFHSGGVAAASDITQGLPRVTELFEARTP
FT                   KGEAPITEFAGSIKIVENDRGRQIILTPDADSGAPKEDGVIKPITYQVSKRVPLKVADG
FT                   DHIKVGTQLVEGSVDPKKILTILGKRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQM
FT                   TRRVTIIDSGDTDLLPGELVDNARFREINRNIVKNGGRPAVGRPALMGITKASLATDSW
FT                   LSAASFQETTRVLTEAALSEKVDDLKGLKENVIIGKLIPAGTGLARYRNAVVEPDKAIR
FT                   DTIYPNFGLGGDGDLGDATFSDADLSDLNFSNLEFGDLKLGDDFNPDDFYSDQGGQPDI
FT                   EE"
FT   CDS_pept        complement(543224..543856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70568"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS24"
FT                   /protein_id="BAJ70568.1"
FT                   /translation="MAKLPYPPAPELGWYSDDPVEGTPDSAVGTAEPQNDYGQPSTAEA
FT                   ATNTAFTAEPAATAAAAEPAATAPADTTPHTAENDIEDWDGTVLSSSFTSKAPKKTYLL
FT                   HNDVTGQTIVIDKSTLLGRKPSMDVPQGAKAERIKDPTRTTSRNHAAISIDTDGALWIE
FT                   DYGSLNGTYIITNGQETQVTKGTTLKLSAPSTVRIGDQFFQFTEKQA"
FT   CDS_pept        complement(543872..544387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70569"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS25"
FT                   /protein_id="BAJ70569.1"
FT                   /translation="MVDYDAAVAAVQDPNADPILLAKIAYENPEFGANVAVNPRCYPGL
FT                   KRWIAEFGDDRARETLAQYGFTAEAFGGPVQDQKATAQAAQQPAAEQAQQPAAQAAFEE
FT                   PVATNPYGFTAEQALTTTDQMQIAQIAQYAPELRACIARNPNTYPALIEWLGQLGDPAI
FT                   NAALASRQ"
FT   CDS_pept        complement(544414..545346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0426"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70570"
FT                   /db_xref="GOA:E8MS26"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS26"
FT                   /protein_id="BAJ70570.1"
FT                   /translation="MTTGSIRIAMTSDVGLRRKNNQDTGFAQQGVFMVCDGMGGGMGGE
FT                   QASQLAAQHFAQLAAMPSRTRQDIDDTLARAQHDILDLGDRLGGVAGTTCSGLVLPQDH
FT                   ADSASARSAALFSDADDQDFSDQTYVVNVGDSRTYHLSPLAHADAPATDIIPVWDAASL
FT                   TRITRDHSQRQEAIDSGQMLPEEAEATIPRNIITQCLGDPDGIMPDVYVADLTGRFIIC
FT                   SDGLHGEVPDEQIAAIAAAHSSPQEAVDALVAAALDAGGTDNITVIVADMPLTEPEHHA
FT                   FSAFRLDEGEDIGAIEDATLQTLRTIRSA"
FT   CDS_pept        complement(545343..547856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70571"
FT                   /db_xref="GOA:E8MS27"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS27"
FT                   /protein_id="BAJ70571.1"
FT                   /translation="MTFDQSSITNTNTAAYAGSSGTYTGTSSGTYTGTSTTTGSWADST
FT                   HSVIWMTRGNVLRGMGLSRQPWGKRIASLVLIAAMMLLAQANLIDVYGGVATWAIAAVP
FT                   ATLLGAIIALAGMLPALRLWWQIVFLAFAQFIIGPVVTLSSTTSHYVIPTLKTLSSGWE
FT                   MTFGSFKYIISVDPPLGTQDGVLMAVWTIGLWLTFLTGVFAINANAWLSLVGVLPLAAA
FT                   VAVCALLGTDSGWQRAICGIAFALLLIIWLSWRLELLEWGRWISALIIVVLAAGLAFGG
FT                   TLLVPQDRFVLRDRYDPPLSPYDYTSPLSGMRSYIKDHKKDVLLTVHNLPAGTPVKLAV
FT                   MDRFDGTVWNLSDSSEATDSSNYHRVGTTIKADEQGKSFTATFTVDQGLTDTWLPLAGA
FT                   ATGVSFANDADNGNDTFYYNTDTDSAIIPAGTRKGLTYTESGIIARKPTDKQISSAAAA
FT                   RITQPEAQDVPDSASKLATSIAGGQSSGGAAATALADTLKDSGWFSHGLEGDYPSDAGH
FT                   GNYRINKLLAGTAMVGDSEQYASAMALMARELGLPSRVVLGFLPKNEDGEITDARTEKT
FT                   SGNGTKIEFTGNDVTAWVEIKLQGLGWVAFYPTPKETKVPDENQNLTPPNPQTLVRQPP
FT                   VPLTDPLRDQTQARGQSSLAGADADDSPTNLFWVRFWRVTRKVALYGSPLWTLLIVCGL
FT                   ILMFKAMLLARARRHGSPKARVAAGWNAIRMLAEQSGITAKGTRRDQAGAIARQLGTDD
FT                   QALIQLGREADYATFSGQDIESGQATTYWTGVDQLRKAMLASLPRFRRIRTRLSLKSVA
FT                   ILSNGHAAKPHTTHVKRAHKKGKAS"
FT   CDS_pept        complement(547853..549076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70572"
FT                   /db_xref="GOA:E8MS28"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS28"
FT                   /protein_id="BAJ70572.1"
FT                   /translation="MASTSATSRRRRRAERMFKRAVRRIRRFFASYVSPLGWAVTGAGI
FT                   ACLIAFPFLGWYELLVFGIVAMVMMLAAIALSLGNTRFHASIAVSDHRVTVGDTISVIV
FT                   GIDNTGRTPTTTARGYLPIGDAHERFNIPMLAPGQSKQTDVEFRTVSRAILPIGPLRIR
FT                   KGDPFGLVRHEKELADRIIVFIHPRTVRLDTLNAGVPRDLEGQPSGQIVDDDLDFYGLR
FT                   EYEPGDDVRNVHWLSSAKTGTLMIRQYEATRRTDTSVTISVNPDEYVNGEEFEMAVSIH
FT                   SSIGVKCLLQDRPLFCHAGNAHGQPRNAMEFLDNASAIEPDREDNPNLAEGTLKHSPDA
FT                   SFYFFTVGSLKDIEQIKRMTLALPRSASCVVLQASAGANRGIRRFANFTLATIGELDDL
FT                   PLIMGVLA"
FT   CDS_pept        complement(549101..550474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0429"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70573"
FT                   /db_xref="GOA:E8MS29"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS29"
FT                   /protein_id="BAJ70573.1"
FT                   /translation="MSENIDDATQLSDTTRLSDSTQLSDSTHLSDATHLASAPHTGTTP
FT                   STESAPQSVALPNLPQRPSQAPSEKPSSTTDAASIPAGDDSTVLKPRKGSTPAIPQQAT
FT                   AQSQPQSQPQRQSSKAAQAAASALPASINSGLLPQPTAQVRDFQQSFNALVENVSKVVI
FT                   GKTIPIKQCVTALMVGGHILLEDNPGTGKTQLARGLANSISTGFKRVQFTPDLLPSDVV
FT                   GVTFYDQKRGEFEFREGPIFASIVLADEINRASPKTQSALLEVMEEQKVTVDGVTHDVP
FT                   QPFIVIATQNPIEQLGTYKLPEAQMDRFLIKTSIGYPGHDVSVDILKQVDITDRAQTIS
FT                   PVLSGDDVMRLRQVATEIYVDDAIREYIVRLVEATRHNEKITVGSSMRGALALTRCARI
FT                   WAAADGRAYVVPDDVKDLAVAVLAHRITLTPEATFDGATQESLIAQVLEDVPSPTIGS"
FT   CDS_pept        complement(550485..556469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0430"
FT                   /product="putative adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70574"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS30"
FT                   /protein_id="BAJ70574.1"
FT                   /translation="MATSSQSYDRRRRISAALRRLMPSGGHTWTVPVITLLLLLGLVAG
FT                   AVIMSTVTRRHVQLDDGTVWVTSLKNQKAARFNVKNKEADAGVSSSAPRFDIAQHNGDT
FT                   ILTETTKASTIKASTVSTGVKTDIKANTTTVVGGDTAALINEKTGNVWTGLSENLDSVT
FT                   PTTSDPKIKLGEGGRIAVTHDGKVYGYRPSDGMVLRLDNPSSAKAKTLESLTDGKQQTV
FT                   ESFTVIGSTPVIATGKTVIFKGGRVDVDTTGTLTLQEPPTDDIQSDWVAAASPRGLALI
FT                   PLKSNAKANFIANGGKANPARPVSSKGCVYSAWSQKASNYIRACSPTDTSVKPQTLESV
FT                   NTTSELVFRTNHRLVVLNDTVNGNVWNPEDSTKVIKIQWNKIQTEQTEKEQQNNDSANN
FT                   HHDFSKTCSAQSGQIKAEDDEIGARAGSEQILDALRNDEQTDCSVLKITKVGAPNNKDV
FT                   TISPIYDGRYLQLDASAASAGTVTFTYDISDGRGQTSSATVTVTLNDGGNHAPVQFDTP
FT                   PEIDVEQGASYTANALSSFNDPDGDPLTLVSAVAQNTDQVQVSTRADGQLTFNTGALAS
FT                   GRVGVEVTVSDGTATGTGMVYFSVKPANTLAAVIDPVAKTTVPNTDTVVKLSSYVHGTS
FT                   LQPAQLTQVDTPNGASTTTNAADMSLTFKATNPGTYYVPYIITQGSIPATGLARVEVQP
FT                   ATGEAAKPVAANDVALLGADNTAIVEPLTNDVDPMGGVLSVTTVSAPADSGIKVGLVSH
FT                   KRVYITARQVPTKPVALTYTVANASGTAKGTIVLQPPALATSNSVPKASNINAQVRTDG
FT                   IVSVDVLDHVAYSDGTTVKLKNNLQYDKGTFKGLAFVSGDTVRYQASSETGNFPITYTV
FT                   EDNLGNVASANITITVHKSDAASKAAPTPHDAEAQVAAGQKVRIPITLTGIDTDGDDDQ
FT                   LLGLGNKAPTLGRISEVGSDYLVYEAYPDSSGTDTFSYAVEDWTGQRAQAQIRVGVFQG
FT                   SSDSGVYARDDEITLRPNTAATVPVAQNDISGDNTNLTVDKHVEVQGLDGVSVKDNMIS
FT                   FTTPGSATTDYIAYTVKDKAGLSDTATLTVNVDPSAAIEPPTAYDYRVPSAATIDKKSV
FT                   DVDVSQWIANPSGTANELKVGVHPSASAHAHVKGGEHSTTITVDLTSQARAVPYTVTNT
FT                   KYNITSTAFIQVPAYGVFPPTLRPKAPELKVNSRETIEININDYVRVGAGKEPYIESAD
FT                   SVSATKASNSDFYVNDKTLKFTAAKDYAGPASITFTAVDGKQGSDKTKIINSAVITLQI
FT                   TVIGRDVPPPTFSSSTIDVEAGADPKTVDLTALTHAPSGVYDDEKQYTYSGGSSSSRQI
FT                   TANLSRSGSLQVSATKDAAPGTTASIPVQIAYGAGTVNAGVTVRVVSSTRPLTRVGNKT
FT                   LKIKAGASDAVNVLTGAYNPFPDSSLTVISCKADDAAKLTIAGCDASGNITIAVASDVG
FT                   ASTNTVLVTVQDGTKSKDREVTASITVSVIDKPEPPLLSPVAGEPQDSAVSLTWTPGAA
FT                   NGSPITNYKVSWTGAVTGEKDCGTVTSCQVTGLKNGKTYSFTVAARNDVGWSKPSTAVE
FT                   ATPDKVPSAPTDVTVTGGNKTAKVTWKAPSGDFSAVDNYSVTVTGAGAPQTKETGNTAT
FT                   ELSFTFNNNDISDGTAITATVKAHNKINWSAESAASPSEKIWGDPDAPNIALSNDDTTV
FT                   TAKVTLGNNRNAGCRRISLGGDVKDTIDCSDSGTTFDINENDLNTREITVTATVVPQRD
FT                   ASSGTGKSSFVPQYKVQPPTDVYTTGSGSTCTVHWTKQGHAQSYSVTADGIDSGTATNR
FT                   NSLDFRMSPWAKCNTASVQQVFNGATSDAVTGGPHNGAPYTYEKKAVINKPQELRWSDN
FT                   AHVINVTGGSVDVYGKSATVQIIINGQPFTWNSGQPLDVTDLAVAADGNYAWSVKVTGG
FT                   PGYSGLDNTADGGSVAGTRPSDSSEGTKSLKSGTDVTTLAKNPWILGFGNTPISSTTIH
FT                   KQ"
FT   CDS_pept        complement(556636..558057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0431"
FT                   /product="putative kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70575"
FT                   /db_xref="GOA:E8MS31"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS31"
FT                   /protein_id="BAJ70575.1"
FT                   /translation="MDNIPMRPPKLPGYDFVQMLGSGATATVYLYNQRMPARPVAVKAS
FT                   AKTLDPRAAALFNREANFMAKLSSHPYILPVYGAGVTSDGHGYIVIEYAPGGTYNSIMK
FT                   ARSMTCEQVLDLGIKLSSALFTAHRSNIIHHDIKPSNILITSQGLPVLGDFGISTDVYD
FT                   RTETGFSPPWAPPEVLQHLTNGSEAADIYSLAATLYAMFVGCSPFQHDYHPRSQSELIS
FT                   LIVNQPLPRLNRPDVPADVEAVLRRALNKDPDQRYYSALEFARAMQRVQFAYFGHATPV
FT                   TVEGMPAYPKDIERRRRATDQRDQITRSSRRWVKPVGITVGILAAITAAALIFAFVVVP
FT                   RMDSATGSDTKQVATPGTKDDDNNRNNQDDVITDTANAQIPSPENLNGTYAADGSSVTF
FT                   TWTNPDPQSGDTYAWAIVQGSNTDQSAQTVTTSDPTVTVNAQEGSQTCIQVSIVRKNRQ
FT                   MSVSPAIACAAKPQE"
FT   CDS_pept        558213..562499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70576"
FT                   /db_xref="GOA:E8MS32"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS32"
FT                   /protein_id="BAJ70576.1"
FT                   /translation="MLDGIDRDGAARLIVGTPGSGKTEFALSVLMAGLRRYGGTQAVMA
FT                   VSGRVAADALGNRVIRELGFSVQARPVTTLGAVAFRAISASREGTGLPSPRLLNGAEQD
FT                   ALLRQVMAVHLRHAVAGDDCGTCDLLRVYFAQDDWARLIRDAGAGEMPGSAASAQSSLS
FT                   QQGSDSPSPTSAGGSTSADRFTRGISDAFISQLRDMLARLDELGVGVHEEPRLLDAVTE
FT                   DARLSVQWRLAFALRREYIAAQSAVYPGQYRLDASYLLVAGARVVREAFAADHADDSDR
FT                   PMCVEALGLPRLLVVDDVQDTTLAGMRFLEELGNAGVKLVLVGNPDESVQTFRGSYPEY
FT                   LMRRAVEGRLKAKEEQLVGGSAVADQSHMTMADVIASRISLSIPSPEDEPLPPAERPGK
FT                   LTAILGGVDAANYQADGTVTAGLYRSSREELDDVVWRIKRAHLDRHIRWNDMAVITHDN
FT                   AAVRLFGERLRRDGVPVRYSSVTRPLKDETFVQGLFALVELARLRAEGMAECQMTLASC
FT                   AAYIRTRVATLMNGPLVSAGAKPGQGRPARLAPIESAMGSLESLAHLATDDAMLTSLTT
FT                   AWETLRETYHETRRETGRETSSSVVSTSAVSSSVTSLPVSVEILGEPSGDDLAFGVDAL
FT                   YVMLAIDDAAAPAQAALASIHAVLGNDPQARAFANLWHLVGSVASGLERLPASQRVQPR
FT                   YALSVAWNATGLAPVWQRAALFNTAEGRTANDRLDAAMRLFQFADDSTASRDITSFMAQ
FT                   VRGMEVQADSLAHIGPVEDAVTLTTPAGAAGRHWEYAWIPVVQQDVWPNLAGRNTMFGG
FT                   EDLAELVLRGALEESDKTGHDPRFAAVLSGEKKSFLVALTRARRIMISAVWNDSMSPSD
FT                   FLFGYLPEYYPRNRQQAPFTTVGAHAGFAEYDLAGLDADPRGLVSAARAVLATAQPQQA
FT                   AAKDAAIALTLLLEHGVRAANPQSWAFVESPAQSDSASSGGASSGGASSGDTSSDSASS
FT                   DSASSGGVQPDGIQTGKGKTDAQAAPMVTLSPSAVDSLWACPVCWMLENRFAGPRPSSV
FT                   ATSFGTLIHAVAQQGSEEGLDHLSHNAQALAALGLDSTAGAERRIEAVSARLNAIYQSK
FT                   RPDPNAIADTRNRYEATRKDESAADTLRNIADYFVRSDADPETYLGKNSSNFSIGALAG
FT                   AECEREFAARFDVCDILDAYNAVPGLHPIGRNTLVRLMGALVGGWPEGMDEHLTVRLSG
FT                   RIDRMETRVLADGGECIRLIDYKTGRTPTVKQIFNDLQLVCYQLGLVFPEDGPRGAKAL
FT                   AAMPHISQSVLFHVGQNAAPARSYAPEGAFQPPLFTDGSLNAEPFTPRYWYKDPNRFFD
FT                   IPAIDPATPPEGVSAEAWAQFAALAGTQTLWSLTMIARVFYAAAASRSAIIEAHPQDTH
FT                   IGFCRMKNVCPACAGQIDTIFETRQA"
FT   CDS_pept        562496..566527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0433"
FT                   /product="DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70577"
FT                   /db_xref="GOA:E8MS33"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS33"
FT                   /protein_id="BAJ70577.1"
FT                   /translation="MSTFTPSAEQAAIIDAPVDADVLVVAGAGSGKTFTMTQRIIALIN
FT                   RGVAPERILGLTFTRKAAGELLERVSAAVAGDMAGSTTATVSDRAFLKPAIFTYDAFFQ
FT                   TIVRQYGLLVGFDQNTQPLSAAGALQLATEVIDSHMDLAFSEDFGAFSSLANRVLALSD
FT                   AIGSAMIGAGCTSFDDAINRVRQWDSAFINRLQQAVADEPMPEDEPKIPKIKRLKKDTD
FT                   ASWQAKLDDRAEHLHARCTYHCGALLETTRKRDILLQLVEAYAQAKRERNMAEFSDFTI
FT                   AAYQLIERFPSIGERTRRRYSHVLLDEYQDTSTTQAALLAALFHVDASQRSAVNAVGDP
FT                   FQSIYAWRGASPGAFRMFQQDFHLSAGYKPFPLSVTRRNSRIVLEAANNLTLPLRSNPS
FT                   RPSSSLMREVDVSSLDPMPDAPEGTLGVLGFATAGQEIDAVVRFCKTAIARHRSAAEQQ
FT                   EQMPGEQKAPVAVLFRSKSHMPEYQAALEQAGLTTFVVGYSALLERPEIRDLMALLHVA
FT                   ADHTDTGSLMRLLATPRFTMSAADLTMLARFAEEQNTEQRFQALVQAGLAQPDTPANEW
FT                   AAVVREYRDQVANAVFLPDVLLRGDLVKLLERLSAHGRNAITRAAVMLRQVHDAVGRPL
FT                   GDVIRAGIEALDLDIDTVLAGVLHNPQHRANPALAHMPMDAIVDLVDTYTQEIAAEQTP
FT                   SLHGFITWVDHLASVEDEAASLPDAPVDVELMTVHQSKGLEWDAVAVVGLTAVGFPSNQ
FT                   GDHLKIVLDEHHTGGTEQGHWTAPEYHETADSWLTNPTAVPVPMRADAGILPRFPHDAD
FT                   VEADPIASLAALDDVELIDDEVFGSMREFGDGVEEVDASGWYLTQAEEYGRRLHADERR
FT                   LMYVALTRAREDALMTYCAYTGESGRDPSVVPKGSRAAQPSNFWLEVHDALQAREHAIS
FT                   AQDCVERLQAANAGKPMLISAQGEAIATPEGFFIGEHAAAYGDAVVGEAWQTPITQTDA
FT                   AVELPWPATLSDAVHEQLSRGIDVIAADSSSLEQHQDAGPLLQRAQLLVDDADLMADAA
FT                   SGQSLDEAVKAKAQRVLAVGRQNVTSLQARVGGMNEREERLYWRSIIRPIPRISSPAAE
FT                   AGTQFHAWAEQFINAGKPDEAVLAYEAESSMPHTGQDAGFVSREAMLADLAERERQCRK
FT                   PSTRQPAVPQPTAQQSASAVSAASATSISSDNATESKLVAWQRRLAESSWAKRIPAWTE
FT                   RAIVVDVPGVGLVNGKLDAVFIGGLDPSSTTARFTVVDWKTGRRPTKPDDITRKLAQLD
FT                   MYRLLLAAVEGVELDSIDATLYYVSEPDEGLRELHARAKTKQEILTELSSGIPEQSDND
FT                   "
FT   CDS_pept        566740..568059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0434"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70578"
FT                   /db_xref="GOA:E8MS34"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS34"
FT                   /protein_id="BAJ70578.1"
FT                   /translation="MSTTRAVSKSSAAHSPYQRLFMLPGAKAFCLSGAVARLPISMMSL
FT                   GIVLALNHLYDNWTIAGTMSAAYVLAMSCVTPFYARAFDRFGQARVGRLALAVQIVAML
FT                   AFAFAALVRVPIPLLFALAIIMGLTQFSFGALVRTRWSYALRGVEDGEQLLNTAYAMEA
FT                   AIDEIVFILGPILAAWLATSVHPVSQLFVPTVACGIGGTIFFSLKSTQPPVIVEQVSVA
FT                   AHDDGSPAASEDADQLTLRQLKRSGAKPKSVLLYAGVLPLLAVFIVFNMSFTSFDVSIT
FT                   ATMKSMGLEPFLGLQLAMFAVGSCIGALVFGSCQLKGSHWAHMVMFLSLLTVGYVFFRL
FT                   SMDNLILLGVFEILAGLTVSPTFATGNLIVKDLVPAESLTEGLSWVTTAGTVGTSIGSS
FT                   VAGIVLDASNPHVGMMLPFIFTLASVPLALAGWALAKRRG"
FT   CDS_pept        568395..569150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0435"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70579"
FT                   /db_xref="GOA:E8MS35"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS35"
FT                   /protein_id="BAJ70579.1"
FT                   /translation="MIKVSVVGAKGRMGSHVVEAVNNAEDTQLALALDAGDDLTQITTD
FT                   NTDVVVEFTVPSVSLNNVLTLIGQGVDVVVGTTGWTDEKLAQVKSAIANGPKPETQKVF
FT                   IAPNFAISAVLADYFATKAAKYFESAEVIELHHPTKVDAPSGTAIHTAHGIAEARKAAG
FT                   LAPVPDATETDGGSRGQVVDGIHVHAVRLRGLNAHEEVLFGNAGEQLTIRADSFDRTSF
FT                   MPGVLLAVRKLAGDAPAGLTIGLDHFLDL"
FT   CDS_pept        569328..570218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0436"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70580"
FT                   /db_xref="GOA:E8MS36"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS36"
FT                   /protein_id="BAJ70580.1"
FT                   /translation="MHLLDSAPFGRILPAMVTPMKSDGSVDFAAAQKLAKYLVADGADG
FT                   LVVNGTTGESPVTHMDEKVELVRAVKEVVDVPVISGAGSNDTAHTVRMVEQTQEAGADA
FT                   VLVVMPYYSRPSQDGIVGHYKAVDESAEKPIIVYDVPGRTGLKVKVGTYDRLAELEHVK
FT                   AVKDATGDLAAAVEKQQRTGLAWYSGDDGLFLPFLSIGAVGIISVIAHVASNPMQQLVQ
FT                   AFDRGDITTARRLANQLAPLVHALNGDGYQAVMAKAALKVKGVIPSTTMRLPNIGPDAT
FT                   QLDKAEEGMRAAGLL"
FT   CDS_pept        570303..572153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0437"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70581"
FT                   /db_xref="GOA:E8MS37"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS37"
FT                   /protein_id="BAJ70581.1"
FT                   /translation="MAQEQKKTSKNTNSRRRGSARGRNANGSNSRTPSRKINATRQATA
FT                   PQQDAVLIAPPKYRKGSMRITPLGGLGEIGRNMNVIEYNGHLLLIDCGVLFPEEEQPGV
FT                   DLILPDFSYIKNRLDKVDALVLTHGHEDHIGGVPYLLKLRPDIPLIGSKLTLAFVDAKC
FT                   KEHHQNPTKVEVAGREKLKVGPFDLEFVNVTHSIPDALAVYVKTPAGSLIDTGDIKLDQ
FT                   LPLDHRITDLVEFGKIGEKGVDLLMMDSTNAEVPGFVKPETSIGPALDQAFAQATRKII
FT                   VASFSSHVHRVQQVVDAAHKYGRKVVFVGRSMVRNMSIAADLGYLHIPEGTVVDLKQAN
FT                   DIQDDKLVFMCTGSQGEPMAALGRIADGNHRDIHINEFDTVILASSLIPGNEHGVYKVI
FT                   NKLVQLGAKVVNRDNAAVHVSGHCNEGELLYMYNIVKPKCAMPIHGENRHLVANGLIAV
FT                   KTGVDPQNVVLAEDGDVVDLYHGRAAVVGSVPCGYVYVDGDSVGELTDDELEKRRILGT
FT                   EGFVSAFVVVDTDNHEVVTGPKIYLNAVAEDESEFDKVRHQIVEQLNDQMMQGTRDTYK
FT                   LQQTMRRTLGSWVARQLHRKPMIVPVVADIAQDVETVETK"
FT   CDS_pept        572195..574804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0438"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70582"
FT                   /db_xref="GOA:E8MS38"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS38"
FT                   /protein_id="BAJ70582.1"
FT                   /translation="MPGSNLTRIEAEERKAVIEAPIHYHVDLDLTVGAKNFGSKSFICF
FT                   NAKPGSSTFLDLIADEVTSIDLNGKSLDPAVAFQDNRIELTDLKEKNEVTVEARCRYSN
FT                   TGEGLHRSVDPSDGNIYLYSQFEVPDARRVYAVFDQPDLKATFDFKVLAPDSWIVTSNM
FT                   PVATIEDDPRETLDGTLGDKPNESTRLWDFEPTPVMSSYLTAICAGPYAEWHTEYLNED
FT                   GRTVPMAQYCRQSLAKAFAKDVDYLFDITKKGFAFYAKTWGVPYPYAKFDQIYVPEYNA
FT                   GAMENIGMVTIRDSYVFESKVTDALAERRVVTVLHELAHMWFGDYVTMKWWNDLWLNES
FT                   FAEFTSTLATAEATEWHDAWATFCSGEKSWALRQDQLPTTHPIVAPINDLNDTYVNFDG
FT                   ITYAKGASVLKQLAFYVGRTQFFEGIHNYLNRHAYSNATLADLLSELEKTSGRDLKAWS
FT                   AKWLEESGINTIATGLTVNADGTIAELKLTQSAPAEHPVLRPHRLAVGFYNEDAATGKI
FT                   VRTEQFELDVDGETTIVEAAAGKPRPAFVLVNDDDLTYTKIRFDAESQAFAEANLHRFD
FT                   DALARAVTWLAFWDMTRDGEFPAERFVDMTLRLLATETESTTFRYALACMSTTAHHYVA
FT                   PARRDDVLRHVAAELWTLANAAEAGSDTQFQLVTAYLGYGEEGDAAFAANAHGLLDGTV
FT                   RLEGLEIDNNFTWTIVQALTSVNEMTNDDVDAQLAKKETTENREFAYGARASMATAEAK
FT                   EWAWDQALHNDELTNSQLEAVARGFSATPRPDLAEPFAAKYFETVDWVWANKTYHMAEA
FT                   LLNGLYPGYADPATLVKLGDAWLDEHIAADNALKRLIVENVASSHRTLKVREYNEAL"
FT   CDS_pept        574982..575896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0439"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70583"
FT                   /db_xref="GOA:E8MS39"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS39"
FT                   /protein_id="BAJ70583.1"
FT                   /translation="MIAGFSITSLLLILLAGIGAGFVGYAVGASSLVSYPALLAFGIPP
FT                   VLANASNTVGVVGTGIGGVMGARKELKGQAVRSITYVVIGAFGGVAGAFLLLKLDPSVF
FT                   EFAAPVLILLSSLIIAINPRGRMQAKQAAADATAQLKHIEATEATEATEATEATEATEA
FT                   AKRATTPTAPHRPPEQLVQPMSQDSWWVWLGVAAVAIYSGYFGAGAGTLALAVLDAAKI
FT                   GSFHKINALKTLIGTGANISASVVFIIQGAVDWLAAIMLCIGCFIGGYIAPSITRKIPA
FT                   NIMRAAAVIAGIILTIDLGLKTY"
FT   CDS_pept        576095..576427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70584"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS40"
FT                   /protein_id="BAJ70584.1"
FT                   /translation="MLIGGSRREQVLFAGVMKELLAPINNPRYVIIGKEWGVRAYGVSF
FT                   PCPSVFARRQQDAEILSRQLDRCLTHCTMVYTRTEEGRHTLLRCQTRSFLNRDEQLPHI
FT                   LTTTSE"
FT   CDS_pept        576876..578261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0441"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70585"
FT                   /db_xref="GOA:E8MS41"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS41"
FT                   /protein_id="BAJ70585.1"
FT                   /translation="MPKMFGTDGVRGLANRDLTARLALDLGDAAVRVLGDAGTQDDQPE
FT                   GRRRALVGRDTRVSGDFLASALSAGMAAGGFDVIDAGIIPTPGVAYLTSVLNVEMGAVI
FT                   SASHNPMPDNGIKFFARGGFKLPDQKEDDIEAVLGQDWDRPTGAGVGRVSHDQTTATNL
FT                   YIDHLVATIAPLNDDKTQPKPLKGLKIVADCANGATSVVAPEALRRAGADVIVINASPD
FT                   GYNINKNAGSTHPEQLQAMVKATDAVMGVAFDGDADRCLAVDEDGNMINGDQIMGILAR
FT                   AKQREGKLNHDTLVVTVMSNLGLKLALKDMGIKTVETAVGDRYVLEEMLKGDYSLGGEQ
FT                   SGHVINREFATTGDGTLTALTLCNEVVKSGKSLKELAADFPQLPQTLINVPNVDKKAAS
FT                   TNKRIQDAVAREEELLGDTGRVLLRPSGTEPLVRVMAEAATQAYADEVCTRLAKIVAEE
FT                   LAL"
FT   CDS_pept        578285..578938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0442"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70586"
FT                   /db_xref="GOA:E8MS42"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS42"
FT                   /protein_id="BAJ70586.1"
FT                   /translation="MFGKNAKVDLELNRDVEQLIKTGGKEKLLPIVQAGEPVLRQRTVA
FT                   YNGQLSKRTLAKLIDTMHTTMLEAPGVGLAATQIGLGLALAVVEDHVRDDEDDPREIAE
FT                   FPFHVIINPSYKPTSDKTASFYEGCLSFDGYQAVRKRWLDITAEWDDEDGKHHSEPLHG
FT                   WPARIFQHETDHLSGELYIDRAEIRSLTTNENLEDYWCEDPVPTEAAEELGFAL"
FT   CDS_pept        578935..580416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0443"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70587"
FT                   /db_xref="GOA:E8MS43"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS43"
FT                   /protein_id="BAJ70587.1"
FT                   /translation="MTDRAWFDAAKGDIPQWAASMPKDADGTTIDWDWVRSLDLAHGVG
FT                   TIPESTPQSIHDALKVDYATRERLESIIAQCNSAFMTDFDRFIGSYRLPRALAYANRRL
FT                   NDNINTLLHLGEQQHLWAVSRERRGRATIAVLKPYSGSGPSNDDQGMLDLSGETGGASA
FT                   GNTAAENSDVKFPTTVALDDIQDRTAAILDARAERRKAQRFQKRAGDAAMARANLSGAT
FT                   SPGGAALPGGAAASGNATGHHPKPDWRDAYLPGRDVDAVMGIDIETTGIDPARDYIIDV
FT                   GFEFMNMASPRPAGEPETYAYEQGYYAAGDAYGQSRLAFGVPPENAALGNVLIAKLTGI
FT                   DVRGRSSEAGYRLFDEWPQAQAGLLARLTQQPYVAHNATFEHSWFMLNVAGYAESYRAG
FT                   RITIIDTLPMSRQWDPGAVPTNEHPYGDNTLDAYAKRQGALDSAHNERHLGLEDSHIML
FT                   VAMKHHLAALKAQGKGPWGPTGRAGVGGKSCGRKR"
FT   CDS_pept        580433..580564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70588"
FT                   /db_xref="GOA:E8MS44"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS44"
FT                   /protein_id="BAJ70588.1"
FT                   /translation="MSNYQDSRQQRENRRRTIVRVVCVVIAVAMLGSLVIPAIYAGL"
FT   CDS_pept        580799..581923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0445"
FT                   /product="peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70589"
FT                   /db_xref="GOA:E8MS45"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS45"
FT                   /protein_id="BAJ70589.1"
FT                   /translation="MAEFDFTQAIGEARAKYESIAKALDVDRLKADIKDLETQAAAPGL
FT                   WDDPENAQKITSRLSAAESQLKRLNSASQRIDDVETLVELGREEGDQDSLDEAQSEIGE
FT                   IQKDLDQMEIQTLLDGEYDERSAVVTIRSGAGGVDAADFAQMLLRMYLRYCERNGFKAK
FT                   VMDTSYAEEAGIKSATFQVDAPYAYGRLSVEGGTHRLVRISPFDNQGRRQTSFAAVEVV
FT                   PLVEATDHIDIPDTDIRVDTYCSSGPGGQGVNTTYSAVRITHLPTGIVVTMQDERSQIQ
FT                   NRASAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGYE
FT                   TSQTQAVFDGDINAFIEAGIRWRHEQRRAAETEE"
FT   CDS_pept        581932..583110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0446"
FT                   /product="cell division ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70590"
FT                   /db_xref="GOA:E8MS46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS46"
FT                   /protein_id="BAJ70590.1"
FT                   /translation="MALISLDNVSKIYPKGTRPALDDINLDIERGDFVFLVGASGSGKT
FT                   TLLSLLLREEEATNGEIRVAGNDLRRITNRQVPQYRRSLGFVFQDYKLLNNKTVWENVA
FT                   FALEVIGTRRSTIKSLVPKVLNTVGLTGKEKNYPHELSGGEQQRVAIARAYVNHPQILL
FT                   ADEPTGNLDPTTSLGIMEVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHNGKIVRDE
FT                   AHGSYDSALFFPDAEVEAKSDTAHHVLAAATKAIEGSDEPSEGIARLANSVHSGRTGRY
FT                   GETFAPLEDTLTWGKGIPLDEQAAALESTHAFDPFKDESAATAATAAVADTSVSSAAEP
FT                   PAPPEPPAPPEPPAPPANEQSAAEQPADEQSADEQSAADQTSDDQPAEGAKE"
FT   CDS_pept        583122..584045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0447"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70591"
FT                   /db_xref="GOA:E8MS47"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS47"
FT                   /protein_id="BAJ70591.1"
FT                   /translation="MRARFILSETWANLTRNLSMLLSLTLVTFISFLFIGASVLTQAQI
FT                   TKAKGDWYDKVEVVVWLCPDGTSQSANCASGKSPSANEITALQKTIRDELNDVVSNIDY
FT                   VSKQDFYDNTFTKQYPNGEFQGRTLTADDMQDSLWLKLKDPTKYQVVSEVLSGKEGVED
FT                   VTDQRQIFDPVFAVLNRATAVTAVLAGVMVVVAILLTGTTIRMSAASRRTETEIMRYVG
FT                   ASNWTIRLPFILEGAIASLIGSVLSCLMLSAIVNVFVTGWLAKSVTWIPYVNQLTVLVI
FT                   SPFLVVGAILLSIIASTISLRRYLRA"
FT   CDS_pept        584148..585509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70592"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS48"
FT                   /protein_id="BAJ70592.1"
FT                   /translation="MTNVRVIKPALAALVAAAACVGGLAFSSAQPAQADTYSDLINAQN
FT                   QHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEA
FT                   DAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGAT
FT                   STQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAA
FT                   SAQTAAETAQSERDALDKLRQEGEARRDELSSMIDSLDSQSAKQAAQTVLIASQVDSYN
FT                   RQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPAPSVGGQGTSNG
FT                   DYGNAYVAGQCTYWAYERRRQMGIGTPSYLGNGGDWWRSAPSYGLRVDHNPQVGAALSF
FT                   LPGQDGADGTWGHVAVVEAVYGDGTFQISEMNWGGPWNIHYRTLTNLGQYWFVH"
FT   CDS_pept        585660..586136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0449"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70593"
FT                   /db_xref="GOA:E8MS49"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS49"
FT                   /protein_id="BAJ70593.1"
FT                   /translation="MPKETGEKLIVQNKKARHDYAIEDKYEAGLALTGTEVKSLREGRA
FT                   SLSEAFISIDRRGEMWLEGANIPEYLNGTWNNHAPKRKRKLLLHRLQITKLARGIEAKG
FT                   YTIVPLSLYFKDGRVKAEIALARGKKEFDKRQALREEQDKREALRAMRYANMRH"
FT   CDS_pept        586299..587252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0450"
FT                   /product="putative ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70594"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS50"
FT                   /protein_id="BAJ70594.1"
FT                   /translation="MSLSKGIQSAAAAALSAAMLIAVAACGTTDGTDTASKSGDSSKDS
FT                   SSTSIQGFDTSSIQKDDEIAALLPDSVAGDGTLTVGTDTSYAPAEFLAEDGKTPVGFDV
FT                   DLSKALAAVFGLKENTVSSTFDSIIPSVGSKYDIGISSFTVTKERMEAVDFVTYFKAGS
FT                   TFVVQKGNPNKVDSSNLCGVKVAVQTGTTQEEEVNKANEQCKADGKDAIDIQSYKLQTD
FT                   VTTAVASGKADIFYADTPVAGYAIKQTGDTLEALGEDVGVTPEAVAVKKGDSKTAEAVQ
FT                   KAIQKLMDDGTYKKILDTWGVSSGAVDKAEINPSVE"
FT   CDS_pept        587386..588327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0451"
FT                   /product="putative ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70595"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS51"
FT                   /protein_id="BAJ70595.1"
FT                   /translation="MQSTKLKSIMAIALSSAMLFATAACGTSDKADAGTDSAKGSDAAT
FT                   ITSYDVSSVEKDDTIAALLPESVTKDGKLTIGTNPSYAPAEFLDADGKTQIGYDMDLAR
FT                   AMGNIFGLETEIVSSNFDTIIPAIGSKYDLGIAAFTITKERMESVDFVSYFTAGMGYAV
FT                   ATGNPKNVDENDLCGLNVAVETGTVEEEAINKTAKQCKADGKKDITIQSSKQQTDATTA
FT                   VVTGKADVFFADSPVVGYAIAQTDGQLEQLGKDFDEVPNAIAIKKGDSQTTEAVQKAMQ
FT                   KLMDDGTYTKILQHWGVESGALDKAEINPAVE"
FT   CDS_pept        588458..589453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0452"
FT                   /product="putative ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70596"
FT                   /db_xref="GOA:E8MS52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS52"
FT                   /protein_id="BAJ70596.1"
FT                   /translation="MAKKEVDGEGVNIPNRIKALPVKRPGPIVAAVIVVLLAAMLIQGL
FT                   ITNPRLDWPTVWKYLFNENVLEGIRYTLELTVISMVVAIILSVILAIMRKSINPVLRGV
FT                   SWFFIWFFRGTPVYTQLIFWGLFAVLIPKISLGIPFTSVEFWSIDSNVVVTAFNAAWIG
FT                   LALNEAAYLSEIVRAGLEAVDPGQTEAAKALGMNRTLIMRRIVLPQAMRIIIPPTGNET
FT                   IGMLKTTSLVTAVPFTLELQFATNAIANRIYKPIPLLLVACFWYLLITSILMVVQSRLE
FT                   AHFGKGFNARPVGTKGKQPPYNPPYPGKSDGEPKDDVNKINQTTFAGLNA"
FT   CDS_pept        589470..590300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0453"
FT                   /product="putative ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70597"
FT                   /db_xref="GOA:E8MS53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS53"
FT                   /protein_id="BAJ70597.1"
FT                   /translation="MTTNDITNSAPVVRKAVDGSVIPAVKAVQVHKAFGPLHVLKGIDL
FT                   TVMPGTVTVILGPSGSGKSTFLRLINQLETLTGGSIEVDGELIGYKHVTKNGQDMLQTL
FT                   DDKEIAAQRSRLGMVFQRFNLFPHMTALENVMEAPIHVQHQSKKAARDLAVAELQRVGL
FT                   GDRMDYYPSQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLNVMRSLAKE
FT                   GMTMVCVTHEIGFAREVADQIVFMDGGVVVEKGGPDIIDHPTEPRFKDFLQHVL"
FT   CDS_pept        590508..592400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0454"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70598"
FT                   /db_xref="GOA:E8MS54"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS54"
FT                   /protein_id="BAJ70598.1"
FT                   /translation="MCGIVGYAGNIETACGKPLEVCLQGLERLEYRGYDSAGVALTAPG
FT                   MDKVVVRKKAGRLKNLVEDIERKPMPLATVGIGHTRWATNGEPSDVNAHPHTSMDGKVA
FT                   IIHNGIIENASQLRFDLQAEGYRFASATDTEVAAKLLGKIVDKIIADEGKPDLFKAVRR
FT                   MARMLEGAFTILATDCRQPDIVVGARHDSPLVVGLGEGENFLGSDVAAFVAYTKRAMEV
FT                   DQDQAVCVSADKVIVADFNGNVVENPKTYTVDWDASAAEKGGWDSFMDKEIHEDPAAVQ
FT                   RTLLGRFDTNGDITLDEVRIDEHDFKAIDKIIVVACGTASYAGQVAKYAIEHWVRIPVE
FT                   IELAHEFRYRDPILTPRTLVVAISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPR
FT                   ESDAVLYTHAGPEVAVASTKAFVAQITAAYLLGLYLAQVKGAMFRDEIHQMLDSLKDMP
FT                   RKIQWVLDTQPKTIQAAAERMVNANSFLFLGRHVGYPVALEGALKLKEIAYTFTEGFAA
FT                   GELKHGPIALVDEGEPVVFIVPPQRGRNVLHAKVISGIEEVKARGAYIIAVAEQGDPDV
FT                   ERYADVVFWRPACPTLMSPLVDVVPLQLFAMGMAKLKGYDVDKPRNLAKSVTVE"
FT   CDS_pept        592414..593178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0455"
FT                   /product="putative ribosomal pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70599"
FT                   /db_xref="GOA:E8MS55"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS55"
FT                   /protein_id="BAJ70599.1"
FT                   /translation="MIDEPHIPFEMDVLYEDERIIVVDKPHFLATMPRGMWYRQTALIR
FT                   LRERLGEPDITPAHRLDRMTAGVLVFVRDSACRGAYQMLFQNRQAVKIYECLAPCRPIS
FT                   GPRFGTIMQVEPPRPFPLLRRSHITKEHGTMAAFEEPGLANAETLIERGDLCFPPAGGR
FT                   WREAPEGGPHPGNHPICRYTLHPRTGKTHQLRVHMNSLGLPIVGDDFYPRIQTRPYDDF
FT                   SQPLQLVARVLRFTDPITGEKREFVSRVPLKI"
FT   CDS_pept        complement(593214..593375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70600"
FT                   /db_xref="GOA:E8MS56"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS56"
FT                   /protein_id="BAJ70600.1"
FT                   /translation="MAQRLGVSRRWLIEFEHARVPNPEFSTILSALTELGLSLDVRKTP
FT                   QPAELYEW"
FT   CDS_pept        complement(593466..594452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0457"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70601"
FT                   /db_xref="GOA:E8MS57"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS57"
FT                   /protein_id="BAJ70601.1"
FT                   /translation="MQDIAKAAGVSPQTVSRVANGSDAVKPETRQRVEAAMERLGYRPN
FT                   YAARALKHGRFQDIGVVMFNTATFGNARILDSIVANAADDDYSVTIQTMRHGAERTLSA
FT                   AIDRMQRQPVDGVIVVLEERISDFVGYKPPREFPVVLICESAADHCPTVDADQYGCSTA
FT                   IVDYLMSKGHKTVYHIAGPSTSRAAESRARGWREALEQMGARIPSMYIGDWCADSGYQA
FT                   GVALAHDPDCTAIYAANDQMAYGAMLGLQSAGKRVPEDVSIVGVDDSLVDMVPRLNLTT
FT                   MKLRFDDIGATAFSMVRRQCEGEKIPVGVKTVIPPELIERGSVLDIS"
FT   CDS_pept        594699..595625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0458"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70602"
FT                   /db_xref="GOA:E8MS58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS58"
FT                   /protein_id="BAJ70602.1"
FT                   /translation="MASADIAAAPVHSGKARVNKHKADWRGWKFMWPFAVVFVFVFIVP
FT                   IVYAVYISFFKKQMIGGTKFVGFENYARLLGDGQFWSSVGRVALFTCVQVPIMLCLSAL
FT                   MALALDSMKLHGTRFFRISTFLPYAVPAVVSTLIWGFVYGAKYGLVGSLNDFLGTDIDV
FT                   LAPSVLLASIGNIVTWEFTGYNMLIFYSSLSTIPHSLYEAASIDGASEWQIVKSIKLPE
FT                   LRGSLAITVIFSIIGSFQLFNEPSILQNMVPGNAITTYYTPNMYAYNLSFSGNQSNYAA
FT                   ALAIVMAVITMAIAYIVQLNSLKEQMK"
FT   CDS_pept        595681..596691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0459"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70603"
FT                   /db_xref="GOA:E8MS59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS59"
FT                   /protein_id="BAJ70603.1"
FT                   /translation="MMSAATTSAAGRLTDAELKAREKAARKAEKARQKRIAADEAAERR
FT                   RSAKAGFANVNNPRRSTLLTVLCAVFAVYCLFPFIYLLINATKTQADFTSTFGLGFGKT
FT                   FALFDNIATVFSYQDGIFARWLFNTILYVVVGAGGATLLAIMGGYALAKFRFPGRKAVF
FT                   VVIIGAISVPGIALAVPQFLLFAKLGLTNTPWAMIIPSLISPFGLYLMWIFSEQAVPQE
FT                   LLEAARVDGASEFRTFWQISLPLLAPGIVTTALFTIVATWNNYFLPLIMLKDADWYPLT
FT                   IGLNQWKDQASTAGGQAIQNLVITGSLITIIPLVIAFLCLQKYWQSGLAAGAVKE"
FT   CDS_pept        596883..598958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0460"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70604"
FT                   /db_xref="GOA:E8MS60"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS60"
FT                   /protein_id="BAJ70604.1"
FT                   /translation="MERKEFKWPQPLAGNEPRIWYGGDYNPDQWPEEVWDEDIELMQQA
FT                   GVNLVSVAIFSWAKLEPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHP
FT                   EILWVDYRGDVCQPGARQHWRATSPVFLDYALNLCRKMAEHYKDNPYVVSWHVSNEYGC
FT                   HNRFDYSEDAERAFQKWCEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFM
FT                   NPGKLLDWKRFSSDALLDFYKAERDALLEIAPKPQTTNFMVSAGGTGIDYDKWGYDVDF
FT                   VSNDHYFTPGEAHFDELAYSASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVR
FT                   DSLAHLAMGSDAICYFQWRQSKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADE
FT                   GLLSTKLVKSKVAVVFDYESQWATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPV
FT                   RGPWDEYEAVVLPSLTILSEETTRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGS
FT                   IRDVVGVRVEEFAPMGNDFPGAMDHLDLDNGTVAHDFADVITSVADTAHVVASFKADKW
FT                   TGFDGAPAITVNDFGDGKAAYVGARLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVE
FT                   RADETGENHFVFLFNRTHDVAVVDVEGEPLVASLAQVNESEHTAAIQPNGVLVVKL"
FT   CDS_pept        599077..600096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0461"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70605"
FT                   /db_xref="GOA:E8MS61"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS61"
FT                   /protein_id="BAJ70605.1"
FT                   /translation="MTMADVAHEAGVSVASVSNFLNKQPYMSEAMAARIAEAIDRLGYK
FT                   VNSSARNLRSGRTRLLKLVIPDLRQVYFSELAEDILAEARQHGYGVIVESTTNNRAREL
FT                   ESIASMGTHSADGLILSPLMMTVDDIAALDGDYPLVLLGERLFGVNAPHVVIRNREGAA
FT                   AATYHLLDAGCRRIAVVGAVPHPEHDFSSGSIRTHGYREALAARGIPCDDSLLIETQGW
FT                   GSADGLVAVDTMLESGLQFDAVFALNDLLAWGVLRELRERGVAVPDDVRVIGFDDVEES
FT                   AYMVPSLSTVNPGREAIARLAVESIIQQVESGSRAPAQTIEAPYSLSLRESSPALARA"
FT   CDS_pept        complement(600216..601916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0462"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70606"
FT                   /db_xref="GOA:E8MS62"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS62"
FT                   /protein_id="BAJ70606.1"
FT                   /translation="MTTHNSQYSAETAHPDKQESSPAPTAAGTTASNVSTTGNATTPDA
FT                   SIALNADATPVADVPPRLFGSFVEHLGRCVYGGIYEPSHPTADENGFRQDVLDLVKELG
FT                   VTCVRYPGGNFVSNYNWEDGIGPRENRPVRRDLAWHCTETNEMGIDDFYRWSQKAGTEI
FT                   MLAVNMGTRGLKAALDELEYVNGAPGTAWADQRVANGIEEPMDIKMWCIGNEMDGPWQV
FT                   GHMSPEEYAGAVDKVAHAMKLAESGLELVACGSSGAYMPTFGTWEKTVLTKAYENLDFV
FT                   SCHAYYFDRGHKTRTAASMQDFLASSEDMTKFIATVSDAADQAREANNGTKDIALSFDE
FT                   WGVWYSDKWNEQEDQWKAEAAQGLHHEPWPKSPHLLEDIYTAADAVVEGSLMITLLKHC
FT                   DRVRSASRAQLVNVIAPIMAEEHGPAWRQTTFYPFAEAALHARGQAYAPAISSPTIHTE
FT                   AYGDVPAIDAVVTWDEQARTGLLLAVNRDANTPHTLTIDLSGLPGLPGLGTLALSKAQL
FT                   LHEDDPYRTNTAEAPEAVTPQPLDIAMNATGTCTATLPAISWISVEFHG"
FT   CDS_pept        602103..603455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0463"
FT                   /product="sugar ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70607"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS63"
FT                   /protein_id="BAJ70607.1"
FT                   /translation="MKFGKKTIALIGAVAVLSSVAACGSTSAGDGGSTGSSDKKVELTV
FT                   WSWDSTLPRTVKGFEAKNPNIKVKVTNAGTNKDEYNALSNAIEAGSGAPDIAQIEYYAL
FT                   PEYVIRGHLENLSDLGASDFKDFYTPGTWSSVSINDGVYALPMDSGPMAWFYNKDVFDK
FT                   AGVDPTQVRTWDDFYEAAKKIRAVDSYITSDSGDAGFFDSMTWLAGATPFETSKDGETV
FT                   TINLTGDKNVKTFTDFWQKMIDEDLIDTKTVGWTDDWNKGLDDGSIASLLTGAWMPYNL
FT                   LSGAPNGDGKWRIAQMPTADGSETNSENGGSSLVIVKSDDKAKVAAAYKFMEYACHDAE
FT                   GIKTRVDGGAFPADNDTLKSNDFLNMTSLTDSDGKAHEYFGGQKFNEELAKAAANVSTG
FT                   YKFLPFEVYARGKFGDYAGDAYTGKTTLSDAVASWQKDLQDYAKQQGYQVK"
FT   CDS_pept        603787..605130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0464"
FT                   /product="sugar ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70608"
FT                   /db_xref="GOA:E8MS64"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS64"
FT                   /protein_id="BAJ70608.1"
FT                   /translation="MKFTVAKKAIALTGAVAMLGSVAACGSDTASGKPAQDKDVTEITV
FT                   WAWEPTLTQVAKDFTKKTGIKVDLKNVGTNTKEYTQLDNAIEAGSGAPDVAQVEYYAIP
FT                   QYAIKGNLLDITDKTSGYSDFYTPGPWASVQFAGKVYGLPMDSGPMAFFYNKEVFDKAG
FT                   VDAEQIKTWDQYYDAAKKIHALGDNYYITSDTGDAGFFDSMTWLAGAKPFQTSSDGSEV
FT                   TVNLTEDKGVKTFTDFWQKLLDEGLLDTKTAGWSEDWFKGMVDGTIASLFTGAWMPANL
FT                   ANSAADGAGKWRVTQMPTADGSTTNSENGGSSLAVLASTKKADAAYQFIEYANHGDGVA
FT                   TRVAGGAFPADKASMESDSFKNTTTVKNADGEDVDYFGGQKYNEVLAQAAENVSSDYQF
FT                   LPYEVKARTIFGDYLGKSYTGDQKLTDGIAAWQKALQDYGKDQGFTVK"
FT   CDS_pept        605291..606667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0465"
FT                   /product="sugar ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70609"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS65"
FT                   /protein_id="BAJ70609.1"
FT                   /translation="MTAILSVSLASCGQATDDNRTEISVWSWEPSMGEVIRRFEKANPD
FT                   IRVKWTNISGYGNLNTAIQDGYGTPDVAQIEYYALLQYAVSGQLLDLTDKIGSDYSNFF
FT                   TLGTWSSVQLAGRTYGLPMDSGPMGFFYNEDVFRQAGVDATKIKTWDDYYEAAEKLKEI
FT                   GAYIAADSGDGSFYDAMVWLAGGQPFHTSADGKTVTIDLDEDAGTQRFTEFWQKMIDEG
FT                   LVDTTSATWSDRWKSRVGTGTIASVFSGAWMPSLLLSNVPGAAGLWRVAPMPTYDGQPT
FT                   NAESGGSALTVLQLTRKPDAAYRFVDFVAHDAQGISARVDGGAFPADYATLNSADFLDK
FT                   TTITNDRGIEIPYFGGQKFNRVLSEAAEDVSVGYQYLPFEVYARSDFKSTVGQAYEWSG
FT                   SFHAYQQRQEAIEMGMKDEEGNPLEPLEKPGKKVSLSDGLAQWQKDLREYGFNQGFTIK
FT                   "
FT   CDS_pept        complement(606727..607497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70610"
FT                   /db_xref="GOA:E8MS66"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS66"
FT                   /protein_id="BAJ70610.1"
FT                   /translation="MLVAVDIGNTNIVLGFLDGDTIAGTYRITTKANHTSDEYGLFLTE
FT                   FLRMSGFQPSDVDDVIICSVVPKVMHSFRSSIVKFLDIDPMVVGPGIKTGMNVRVDDPK
FT                   SLGADILADCAGAYYEYGGPVLVADFGTATTFTHVSDKGVVDSGVITTGIRAGAAALWG
FT                   DTAQLPEVEITRPDTILGTNTKTCMQAGLYYTFLGGVERTIRQFRKELGGEDFKVITTG
FT                   GLGRVFENDTELIDVYDPDLIFKGMAHIYSRNVK"
FT   CDS_pept        607623..609242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0467"
FT                   /product="peptides ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70611"
FT                   /db_xref="GOA:E8MS67"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS67"
FT                   /protein_id="BAJ70611.1"
FT                   /translation="MSQDNGAHVEDGATTDASLASRAKNPKKSGPKWWLISLIAVIVAV
FT                   AVVIGVTLAFGGKKDDKSASSSNQYADTVTIGLKLAPTNLDIRNTAGSALDQILIGNVY
FT                   EGIVARDSKNQVAPAIASSWETSKDGLTYTFHLNKNMTFSNGDKLDAEDVAWSINELIA
FT                   KGYHDADALAAVSKVEAKDADTAVITLKTPNSNLLWTLTGRAGLVFDKDAKYDLKTQAV
FT                   GSGPYTVAKFVENSSITLKANEKYWGKNKAKTPTVVVKYLADDNAAVNALKSGDVQVLA
FT                   PITENLAEPFKSDSAKYTVKAGNGTDKFVLGFNNASGSKLADKRIRQAIRYAINHKELI
FT                   ASRGGADKALGGPIPSLDPGYEDLTNLYPYDQNKAKSLMAEAGYSTDKPLQLTLTYANI
FT                   YGTELGDQLRSQLKPIGIDLKVNVVEFSTWLQDVYTNHTFDISLVDHNESHDFASWTDP
FT                   TYYFGYDNKNVTKLYNEGVAATSDKERDAKFAAAAKLVSEDAPADWLFNYRITTATAKG
FT                   VEGFPFDLNQTVLPLYNVTYTK"
FT   CDS_pept        609307..610284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0468"
FT                   /product="peptides ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70612"
FT                   /db_xref="GOA:E8MS68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS68"
FT                   /protein_id="BAJ70612.1"
FT                   /translation="MRFVLKRLALFVVALFGLSVVVFAALRILPGDVASVMAGVNSPPE
FT                   RVTQLREQLGLNRPLIAQYFDWMSALARGDFGTSILTGRSVTSLVGARASITFPLIILG
FT                   LLIALAIGLPLGCAAVLARSATVRAVFHVLAIVGGAVPALWGGLLLILLFGRGVGLLDV
FT                   FPSQGFPLDGWGAPGSAISALVLPAVSVGIIVGASLMRYTRAALGDLASSGYIDMACSC
FT                   GMTRTQAVLRVGLRLATPQLVSVIGLTFASMVTGVMVIENLFALPGIGNGLVTDVGNRD
FT                   LIAVQSELFLLAAFFLTVGLVVDLLHRVLDPRLKTATAITEVTA"
FT   CDS_pept        610281..611183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0469"
FT                   /product="peptides ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70613"
FT                   /db_xref="GOA:E8MS69"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS69"
FT                   /protein_id="BAJ70613.1"
FT                   /translation="MSNVRRATTGGRRAAFVIVLHSMWRRAEGKFALIVLALWLLIAIV
FT                   SLFWTPQSLWATDGYHVWAKPSAEHWLGTDGTGADVFSWLLAGSHTNLVIVLLTVVASM
FT                   AWGLLLIAAMVARNAALASSSVVVVDALISVPTVLIALILAVPLGASIAVIVIACGFGY
FT                   GLNLARVARPAALLASRSSYVESALANGASGWRVLISHVMPNILPVLAVQLSLSAGTAV
FT                   LAESGLTYLGIGVPSGVPSWGHSLATSVKLINVFPLTVVWPGLIVTVVVVALNIFGDVL
FT                   RDAIDPVTNPALREIGGER"
FT   CDS_pept        611180..611971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0470"
FT                   /product="peptides ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70614"
FT                   /db_xref="GOA:E8MS70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS70"
FT                   /protein_id="BAJ70614.1"
FT                   /translation="MSVDVRGLKITIGGKPIVSDADMTIADGERVGLIGSSGSGKSMIA
FT                   KAMLGLLPLTAVTNGSIDMGGTEIIGASERALADLRGRYVGAVFQNPAASLNPVMTVAQ
FT                   QIALPLRLHYDLTKAERADRVNALLSKVGLDLDMAGKYPHELSGGQQQRVGIATALITS
FT                   PRFIIADEPTTALDSITQRQIVDLLTSLVDDAGASMLFITHDFSVLARATTRCYVLDAG
FT                   RIVESGPTADLLAAPTTPQAQRLVAAAQTLTLHTPKEDSHE"
FT   CDS_pept        611964..612749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0471"
FT                   /product="peptides ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70615"
FT                   /db_xref="GOA:E8MS71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS71"
FT                   /protein_id="BAJ70615.1"
FT                   /translation="MSNSSVPLLSAHSITKSFGPRTARHQVLFDVSADVHAGECLAVIG
FT                   GSGSGKSTLTRIMLGLESADSGSVEYESQSIVGGRKSPGFAALRRESGLVFQDPFSSLD
FT                   PRWRVAKSVAEPLSLQRRDLNNTDIDERVAAALTMAGLEPADFLNRYPIDLSGGQAQRV
FT                   VIARAIINEPKVILADEPMSAIDVAARIQILDTFAAIRAARPSTAIIMVSHDLGVVQHI
FT                   ADRILVLHDGRLEETGSTAEVLGNPQSDYTRQLIEAASL"
FT   CDS_pept        613234..614301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0472"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70616"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS72"
FT                   /protein_id="BAJ70616.1"
FT                   /translation="MTIHNSLAELIGNTPLVKLNHIPQAAGVKATIAVKVEYFNPGGSS
FT                   KDRIAERIIDAAEQSGQLKPGSVIVEPTSGNTGVGLALVAQQRGYRTIFTLPDKVSESK
FT                   RAVLRAYGAEVIVTPTDAGPDDPRSYYQVAERLANTIPGGFRPNQYDNPNGPLSHYYTT
FT                   GPEIWEATDHKVTHFVAGIGTGGTISGTGKYLKEASNGAVKVIGSDPEGSIYSASSRDE
FT                   VHQYDIEGVGEDFYPKAFDRNITDDIVRVSDAEAFEMTRRLAGEEALLVGGSSGMAVVS
FT                   AIKYALANDLDENQIVVVLAPDSGRSYLEKIFNDDWMRANGYGDIVERTSKPSLAEQYL
FT                   NGAPSDEGAGDGLHN"
FT   CDS_pept        614393..615577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0473"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70617"
FT                   /db_xref="GOA:E8MS73"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS73"
FT                   /protein_id="BAJ70617.1"
FT                   /translation="MSAEYNAKFANTDIATRAIHAGQEPDPTTGAVVTPIFATSTFKQD
FT                   GVLGLRGGHDYSRSINPTRTSFDEQLAAVEGGKYALSFSSGLAAIDVLLRSTIKPGDNI
FT                   LLGNDVYGGTYRLLSKVFVPWGVGLDVVNITDLKAVETALASKHYQYVWVETPSNPLLN
FT                   ITDIAATTEVAHKYGTKVAVDNTFASPALQHPLADGADVVVYSTTKYIGGHSDVVGGAV
FT                   VVNDEETREKVAFLQNAAGAVPSPFDSWLDIRGLKTLDLRVKRHSANALKVAEWLESQP
FT                   SDVIERVWYPGLESHPGHEIAARQMHGGFGGIVSVQLAAGAEAAKHFVDHTQIFTLAES
FT                   LGGVESLIEVPAAMTHASVAGTTLQVPANLVRISVGIENADDLIADLKQALDRI"
FT   CDS_pept        complement(615715..617439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70618"
FT                   /db_xref="GOA:E8MS74"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS74"
FT                   /protein_id="BAJ70618.1"
FT                   /translation="MASDTFSFSSPDDQETAVLQPVATDGLFAAADSGTATPQQSDNGT
FT                   NNHADNTAYVGEHVMASTTAKSHGKAARIAIITIFAVLLAALIAYFFVGRWYFQDKAAP
FT                   GVHLGNVSVMGQTREELANTVKQRLNNTTVTFTAEGNSVKASLKDLGVTVDTDKTVDAL
FT                   LNAKTGDVAKLNIFDQPHIALTATTDKETAEQFVTAGLVDEADRAQIATVVYNKSTKQF
FT                   DYTAGQDGKGPDTNVVNAAVKEAVATPGENATVPVKLQTAKNPIDDASAQQTQFDANAR
FT                   LGLKLTVDNGVNKSVTIPADTIASFLKPTVNKAEGTMSLVVDRDAITKYVTSDSVTKEL
FT                   TVPKVTREVYITPKDEGGVEIGADKTLGVDGIEVTGAGDAPERLATAIEQNQSTDSTVA
FT                   VKDSPYDVKQVEVPHNFDTANGDKWVHVDLTNQTATAYQGTTVVKKFNIASGKPTADGS
FT                   MLSDTGTFYVYLKYESQTMVGEGYNQPGTPWVSYYNGGEALHGVPAYMWGEHPIYVQQG
FT                   IPGSHGCINMQVADAKWMYDFATIGTRVVVDGTTPTSGQTLRPAGADATGWQGGNAS"
FT   CDS_pept        617689..619554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0475"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70619"
FT                   /db_xref="GOA:E8MS75"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS75"
FT                   /protein_id="BAJ70619.1"
FT                   /translation="MLAGRDVLGVMPTGAGKSVCYQIPAALSPGMTLVISPLISLMRDQ
FT                   VDALNDLGLPAAFINTTQTPDEQAMVFAQAAAGQIKLLYVAPERLETGRFRDFAARTPI
FT                   SLIAVDEAHCVSQWGQDFRSSYLGIGDFIAGLPQRPPVGAFTATATERVRRDIVGLLGL
FT                   RNPAVTVTGFDRPNLYFDVVKLETKYKAAWVARYVADHPDESGIVYCATRKTTEALTDT
FT                   LNQMGHPAVAYHGGMSPDAREAAQRDFITDKVPVVVATNAFGMGIDKSNVRYVIHHNLP
FT                   ESIEAYYQEAGRAGRDGEPSRCTLLWNESDIVTRRRLLDNDYENERLTPEEQEIVRQSK
FT                   RRLLDGMVGYCRTTDCLHWYMTRYFGQELSPNAGSTAGEDIAADSSQSGKCGACSNCES
FT                   TFETIDVTRVAQAISRCVHDVGQRVGSGKIVKILRGSRAQDLAWLNPERMPTFGMLKDV
FT                   NEARVRDVLSQMATDGYLSIAEGRMPIVMFGARAAETAAPDFHYEIKRVERKSEAAGSG
FT                   RSGGVADTADSANVPGDALGSYIPDDDEESLFRKLRELRRTIAQEIGKPPYIVFSDKTL
FT                   RDMARIKPVTNAQFLAVNGVGQHKLDLYGQRFMQAIASFNAGSAS"
FT   CDS_pept        619667..620161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0476"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70620"
FT                   /db_xref="GOA:E8MS76"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS76"
FT                   /protein_id="BAJ70620.1"
FT                   /translation="MAEETAEKPVVESFQLDHTKVKAPYVRYIDTETGPHGDVISNYDL
FT                   RLTQPNKQAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGTHPTEEVA
FT                   KALKESLEFIAYKATWDDVPATTEKSCGNYRDHSLFTAKEWAKQILEEGISSDPFERKV
FT                   V"
FT   CDS_pept        620316..620858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70621"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS77"
FT                   /protein_id="BAJ70621.1"
FT                   /translation="MTQSNAANKATGRRFRHATMRDLPQMQKIYARARALMAANGNPTQ
FT                   WGNEFPRESMIEDDIANQRTMLLVDTCNGHERILAQFALCPGEDPTYAKIDGAWLDNDA
FT                   YVTIHRIAASGLVRHAARDCIRWALKHYGNVRADTHPNNKAMQHVLESSGFARCGLIQL
FT                   LDRPVDTTRIAYQRHEW"
FT   CDS_pept        complement(621046..622506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0478"
FT                   /product="putative amino acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70622"
FT                   /db_xref="GOA:E8MS78"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS78"
FT                   /protein_id="BAJ70622.1"
FT                   /translation="MDLFRKKSVDQLVAESTPLKRTMRTFDLTMLGIGAIIGTGIFVLT
FT                   GKGALTAGPALSVSFLLAAVCCGFAGLCYAEFAAMAPVSGSAYSYAYLAFGELIAFVIG
FT                   WDLILEYALQAATVSAGWSGYFNKLLEGFGLHLPVELTAAYGTNPDVTTYFNLPGFVIV
FT                   LIITWVLSIGINQTKRTNDVMVLIKLAIIVLFIVCAVWYVKPSNWQPFSPYGIYTFQPG
FT                   STQPYGIVPAASIVFFSFIGFDAVSSSAEETINPNKTLPRGILLSLAVSTVLYIVMTMI
FT                   MTGVVPYKEFAKYIDAPVAGVILETGMNWLAVIVNLGALIGMTTVMLVQLYGQSRICYA
FT                   MSRDGLFPKFFGHVHEKYRTPFKGTWFFGLLTAFAGGFININVLFELVNIGTLSAFIIV
FT                   SAGILWMRKTQPNAPRGFRAPGVPVTPILAIVFCFVLIAGLNWETWVRFAIWFGLGLIV
FT                   YFGYSRKRSKLGLEQKAGADTKVAATED"
FT   CDS_pept        622695..624053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0479"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70623"
FT                   /db_xref="GOA:E8MS79"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS79"
FT                   /protein_id="BAJ70623.1"
FT                   /translation="MSMNAAPEIAFSSEQGKANYAAARRQYPAQAIVNLKTMRDNMAHL
FT                   VSVVGGPNSGTAVMGVVKADAYGHGLLPAALAALAGGATWLGTAQSHEALLLRKLGIGP
FT                   DRCRILTWVYNGTEVPFDELIAADIDVSVGSLPGIDAVAAAARKLGKPARVHVKVDSGF
FT                   GRNGFTPAGFDAALAKLVPLAKEGVLHIVGQWSHLAVADSPDVPEFVSSTDRQIETFKD
FT                   FTRRMEQAGIPPEIRHLANTAATLDRPEIHFELTRPGIGLYGYEPDPAMGTPRDWHLTP
FT                   AMRLQAQLGTVKDVEAGHGISYGRTYLTPDNTSTAIVPLGYADGIHRSASGFDMEGAKH
FT                   VEKPGGPVRIMTTEGPKLYRVCGRVCMDQFIVDLHGSAAELGVHEGDTVELFGPGRGED
FT                   YVEPTADDWARAADTISYEIFTCLRNRIPRLYEHAAEVLPAADLAKLDPATLL"
FT   CDS_pept        624186..625532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0480"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70624"
FT                   /db_xref="GOA:E8MS80"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS80"
FT                   /protein_id="BAJ70624.1"
FT                   /translation="MAHIREVGITAADMCAYAWNMETTLDGEQVLSDEGYSAFDEERWA
FT                   PEPPKSKSRTAFERDRARLIHSSALRRLGAKSQILIAGTDDFARTRLTHTLEVAQIGRQ
FT                   IGALLGCDPDVVDCACLAHDLGHPPFGHNGERALADIAGNIGGFEGNAQTMRILTRLEP
FT                   KIFHPDGRSAGVNLTRAALDAAVKYPWTLAEADQHPKGERSKKFCVYPDDEPVFRWLKI
FT                   GAPQAAKPMECQIMDLSDDVAYSVHDVEDSIATGAFDPIVLADPKMLDHIIEQTRAWYG
FT                   AKWDADKLLAAFMRLRREHLFPAHFNGSRESLAQLKNITSDLIGRFCWSVETATRDTYG
FT                   PGPLTRYSANIVIPEDTNYEIVALKGIAVYFVMAPREREPFHQEELKIVSDLVDVLMAD
FT                   SPLPSDALESQFLADWNESTNDNERLRVAIDQVASLTDNSALALHSILC"
FT   CDS_pept        625705..627795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0481"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70625"
FT                   /db_xref="GOA:E8MS81"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS81"
FT                   /protein_id="BAJ70625.1"
FT                   /translation="MIKKEDVEKVRAAADLYDIVSATVTLKPSGTGTFVGLCPFHDEKT
FT                   GSFNVRPSLGVWHCFGCGLGGDVFKYVEQSENIDFREAVELLADKYHIELHYENSGNGP
FT                   ARENTGSKRTRLLEACEEAQRFFVSQILTKEALPARKLLGGRNFSQADCERFGCGYAPQ
FT                   GWDNLVRHLASKGFTQKEILDAGLARQGQRGIYDYFRGRVTWPIRDSTGRTLGFGARKL
FT                   YEDDQIAAKYINTPDTQLYRKTQVLYGIDLAKSAIVKKRQVVIVEGYTDVMAMHLAGID
FT                   TAIATCGTAFGAEHAKIVRRLIADDSLGAVQLVGPLKVKDQPLSSRIVFTFDGDAAGQK
FT                   AALHAFGLDSAFLSQTFVAVADDNLDPCDLRIERGNEAVRSLIARAKPLYDFVIDAAIS
FT                   RFDLTYTPGQVGAMKAVAPLVAQIRDRSLWDAYARKSAGRIGVDLEVMRREVMNARRQM
FT                   HVRDEDAYAPKRRFERDEPRVEPGTNPYANPATRKALERRDAAEQAYFKIDDAVFIAEQ
FT                   QFMAVLIQVPRAIDRTMFGQLTIDHFMTSVFRTLFQAIAAAGGLPSDDTPQGLWMHNLT
FT                   KAGGPMLNQVINELAVMPLPLPGDDGGNGAQPPQSNVPGGVGGGAAAVQLRPATPEEQR
FT                   YATELLTRLLDMGFMRQIGLAKRRMAQLPDGEEKITLLGQITRMETARKDLQAQIYGNT
FT                   VG"
FT   CDS_pept        627926..629068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0482"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70626"
FT                   /db_xref="GOA:E8MRW4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW4"
FT                   /protein_id="BAJ70626.1"
FT                   /translation="MKVQHPLDWKLPRKPVRRDVAPMGEVYSHLSEEERQVIQIEVGNG
FT                   ASIRGIGAMLGRSPSSISREIKRNTWFPSNENESYRPYRPKRLKAGPWTGRYYIAGPAQ
FT                   RKADRRRSKPRKPYRLSHDRLWAQVAEWLGRGWSPLLISGRLRVLWPDDALMRVCPETI
FT                   YRWVYSSRPLRERWARCLPRGHRRRRRHGGRRTSRFPIPGRVPISERPPEADGRSAFGH
FT                   WEADSVIGVGCNLHTEVERRTRFLMARVVPDKTAGESVGAQLDMFSPLPAGARVSVTHD
FT                   NGTEFAHHERLRDGLGMATYFADPYSSWQRGSNENRNGMIRRYLPKRCEIRMDMAKEVR
FT                   EIVDEINNRPMRVLGYRTPAEAFADELLELQDQQGCCTSK"
FT   CDS_pept        629155..629781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70627"
FT                   /db_xref="GOA:E8MS83"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS83"
FT                   /protein_id="BAJ70627.1"
FT                   /translation="MATTKKLSFGLDKAGGAALILARIGAALLWIIAALAAVVWVVFLI
FT                   SPRSFAANFGSVDLNVGGAFTLSIKGDLLDYSYNLQNFHDGPVNMVATISTGLARMVVY
FT                   ALLALAFSEMAALCKDLTVWLADGRDATPFQGMASDRLNRAGWYLIVAPIVGLVNFIVC
FT                   FLAGTGGNWGLWMSGMMVMIGIILLLIARIFDYGMGLQREVDGLL"
FT   CDS_pept        630389..631264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70628"
FT                   /db_xref="GOA:E8MS84"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS84"
FT                   /protein_id="BAJ70628.1"
FT                   /translation="MTQNRAELNRNLAQMLKGGVIMDVTTPEQAKIAQDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIEIDYIDESE
FT                   VLSPADDVYHIDKNQFDVPFVCGAKNLGEALRRIAEGAAMIRTKGEPGTGDVIQAVRHM
FT                   RTMNKQIRELVGLRDDEVYEAAKQLAVPYDLAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVKATANWQDADLLAKLSENLGEAMVGINEDE
FT                   IQTIMAARGE"
FT   CDS_pept        631291..631929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0485"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70629"
FT                   /db_xref="GOA:E8MS85"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS85"
FT                   /protein_id="BAJ70629.1"
FT                   /translation="MVVAVEYISKEESADAETATHGVTGILAVQGAFAEHAAVLDKLGA
FT                   PWKLLRAAEDFDESIDRVILPGGESTTQGKLLRSTGLFEPIAAHIKAGKPVLGTCAGMI
FT                   LLAKKLDNDENVYFGALDAVVRRNAYGRQLGSFQAIADFGQADGPQRIADFPLVFIRGP
FT                   YVVSVGPEATVETEVDGHVVGLRQGNILATAFHPELTDDVRIHELFLSL"
FT   CDS_pept        631987..633498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0486"
FT                   /product="putative amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70630"
FT                   /db_xref="GOA:E8MS86"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS86"
FT                   /protein_id="BAJ70630.1"
FT                   /translation="MQFTLNRRSTVPMYRQLAAELREQIVSGAMAEGYRLPPERELASR
FT                   LEVNRTTVLQAYQQLKDEGLIASKVGKGTFVLPLQHIETARIPVVRHEPIDEEPKPSVV
FT                   RPPWSVLFSDYSNRFTYHDIASAERAQRGDTIIDFATGSPNPADIPDDLLRSVSIEAFE
FT                   SREFDGQPESPIEGFDELRALLAEHMSTRGVQCDVRNVMVLSGSEQGIDLIVRAFVNPG
FT                   DCVLVEQSTFFPALQTFRSADARIIGVPVDEHGMRTDLLDGYCARFRPKLIYTVPTFQN
FT                   PTGTTLPPERRSELIDVARRYQCLIVEDDAYGDLWYGGESSDAHRPIPLKGMENAGYVM
FT                   YLSTFSKTVTSGLRTGWVVADPHVINRLAALRRMVDQHTSTSSQRICLELLKEGRVAEH
FT                   LRGLIKAYRIRRDAAIAALERYAPDEVYWTVPAGGYYIWVSLPDGVRSLDVLESCRSQG
FT                   VTFMPGSVFDVDEMDDSHIRLNFVRPDAADIDTGIRIIGETIAQM"
FT   CDS_pept        633853..634785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0487"
FT                   /product="asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70631"
FT                   /db_xref="GOA:E8MS87"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS87"
FT                   /protein_id="BAJ70631.1"
FT                   /translation="MTTSSVSPVTTELAGSETGITLVIHAGAGSRGKHSTPERIAQVEL
FT                   DLQRALDAGYQLLESGAPAHEAVVAAIHVMEDAPEFNAGRGAALTSDGIAQMDACLMTG
FT                   DGEVGAVTGVSTVKNPIDAARAVKEQTKHVLFADPTDAEIADWGVATESNEYFITEQRR
FT                   QSLAEAQSGGDEWEKHGTIGAVARDAEGNIAAGTSTGGITNQMHGRVGDSPLPGCGTFA
FT                   NQSTVAVSCTGIGEAFIKVVAAHQVSDRVRFSGENVEDAATATLDEVAAHHGDGGMIVL
FT                   PAVGRGVVAYNSEMMNFGYRSAQGGKVQG"
FT   CDS_pept        634815..634949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70632"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS88"
FT                   /protein_id="BAJ70632.1"
FT                   /translation="MAGVLRILGKESAAHRPFMYAASAADQCGSARYLVIVLYVGMFV"
FT   CDS_pept        635334..636521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0489"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70633"
FT                   /db_xref="GOA:E8MS89"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS89"
FT                   /protein_id="BAJ70633.1"
FT                   /translation="MRRWLINVAKNETILIVAAILALISCFIVPPDADYKSYIHASTIS
FT                   QLICLMIVVCGFQRIGVFRIIGSRLLEKVSTMRGLVITLVALTFFSAMFITNDVALVTF
FT                   VPFAVAVLIMAGQEDKTILVVTLMTIGANVGSMLTPIGNAHNLYLKALTGMPTMEFLGI
FT                   MAPYSGTAAVLLVIVISVVFGGKPVGDLGDLETGVLAPERNKHQPDEIRITGYGAGYGG
FT                   WRTIVYSLLFIVCLLAVSDVIPLWVMCVIVVVVFLFTDRRVFKYVDWGLPLTFCMFFIF
FT                   IGNMKRVPEFYELARSLVGGHPLEVAVGSSQVISNVPTTILLSGFCDQWRDLIIGTNLG
FT                   GMGTLIASMASLISYKNVVRQYPHKKGRYLAVYSAVNVLFLAVLLTLSWIIEPSL"
FT   CDS_pept        complement(636546..636797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70634"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS90"
FT                   /protein_id="BAJ70634.1"
FT                   /translation="MFINLFRRQRPALARLARNSNAYRQPMVASVSSSAVGVSSITSES
FT                   NTATAAGVSTLDATIGRIHDIPQSAMSRLTGSPTVYAR"
FT   CDS_pept        complement(636978..639218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0491"
FT                   /product="putative alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70635"
FT                   /db_xref="GOA:E8MS91"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS91"
FT                   /protein_id="BAJ70635.1"
FT                   /translation="MGSPTHHTSGRLYGVFFEDINHGADGGLNANMVNNYSFDGVYLDH
FT                   HTWRMAGAERWRTQADSLRFWDFINCSAAGLGSEIRGIHGQRVTTDCPAPPIHAHSRYA
FT                   RITSDVPSETGPAYLENLGYNGGGDNGGEPAFSIVADHTYSVSLAVRPVHGRAELSVGV
FT                   VDRYGLPLTSITRLSYIVDSDPLDDTEETGLRQDDGADAQDSGVSISPDSSDGAIVIGR
FT                   DGWYRFNADVTGLNTDYGKLRITIDAGERTTFDLDLVQFMDADYWGAGDPKWRYGKLRR
FT                   DLVETIQALHPAFLRFPGGCIVEGVTPGNEYRWKDTVGSLAARRQQYSMWSFKMPDGSS
FT                   YSQSYQIGFYEYFCLCEDLKAKPLPTLFAGIACQSPGRDPRHMDINSATFRNNVIQDYL
FT                   DLIEFANGDPESSSWAAVRRDMGHPEPFGLDMIGVGNENFGADYVAKFDMISEAIHERY
FT                   PDMLCVMSAGLFPFQPAMKRSWDHARALAATDSGAHDSATGDAIIVDEHSYHSPEWFAS
FT                   QASRFDAYPRCGAGVYFGEYSANGYFAGQPQTEQGANTWKSALGEAAFLTGCERNSDVV
FT                   RMTSYAPLLAHIPAKGWAQNLIEFNPAHVNPTVNYEVERLFSTHLGDTTYAVSIEQTAS
FT                   RPAKHLYVSATGHDRDDACRYIKIVNISDSPVDVTLEIARGLAGLGASPSRPVRLEVTT
FT                   LSANPTAKTTIGYRGEASGAIVPERRAYTLPSPSSLLAMKIKPYSVTLVVSR"
FT   CDS_pept        639385..640254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0492"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70636"
FT                   /db_xref="GOA:E8MS92"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS92"
FT                   /protein_id="BAJ70636.1"
FT                   /translation="MQSSVGIRERIDHVYPSLRPAERAVAQYIRNHIEEAADLTVGQMA
FT                   DIAHVSQPTVIRFARKLGFGGYRELRYVLRNPAAEHKVTFNPLAGFDLNPWDGEDEIPG
FT                   KAADGAKALIDELHSALDPKAYRKAVALLAESEFIDIFGVENSLTPAMDLFTKLGYLGL
FT                   TCRLNTDAYLQQIGAGHLPHGAVAVAFSHSGSSADTVKALRLAKSHGAKTIAITNAIGA
FT                   PLASWADVTLLTGRDSHTIYGNAIFSRVADTALVDMLYMGVILSDYGRFSTALDESGRM
FT                   IRDRVFEN"
FT   CDS_pept        complement(640341..641549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0493"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70637"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS93"
FT                   /protein_id="BAJ70637.1"
FT                   /translation="MGTTESNVDHAASGQTVAGDSGELTFTYAQDRFASEGKDWESPVV
FT                   TNMAASVSADAGNVPAGSITNTGTNNTFTSTTESSLATLLSNQCPFVIKATIFEGNGKN
FT                   AIRERHTFTGSVLRQLDQASALLNGINESGQYPAIALREALVNALEHRDYTYSGPTLIN
FT                   IFDSRLEIVSLGGLTDGLEINDLLNGVCQPRTPRLAELFADLGLCENCGTGIQRIMDAY
FT                   AQSAVSPQLRVGPTSVAMVLPIPVSAEAASSHRTDADASAAPSTTDEAQHAKMYSFPTI
FT                   QRMTDNAADALAGARIIGCAPLQTLILGSGFGERPDGDDQASTRPLDTATLEPSPQTLE
FT                   QFTLNFLAFRGVKLSRKTMQKALGLNKDQMTQLLDQLELSGKIERHTHAKSTTYSLAHA
FT                   SGR"
FT   tRNA            641626..641702
FT                   /locus_tag="BLIF_tRNA19"
FT                   /product="tRNA-Arg"
FT   CDS_pept        641951..642706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0494"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70638"
FT                   /db_xref="GOA:E8MS94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS94"
FT                   /protein_id="BAJ70638.1"
FT                   /translation="MPRAIIEVRNLRKEYPVEDETVVALDRVNLSIPQGQICCIFGESG
FT                   SGKSTLLNQLAGMEKPTRGGVRIGGVPVSKLDERELAAFRQKHLGFVFQSYNLLPNLTA
FT                   LENVAMPLMFRGVPKEQRERAARGVLKRVGLGHRLSHYPRQMSGGQQQRVGIARAFVTK
FT                   PEVVFADEPTGNLDSKTKTEVMTMICAFAHDFNQTIVLVTHDPQMASYADRIVTLLDGR
FT                   ITSDRLNTDLSRPTVPSTPSAQRTQGVDR"
FT   CDS_pept        642703..643878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70639"
FT                   /db_xref="GOA:E8MS95"
FT                   /db_xref="InterPro:IPR036238"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS95"
FT                   /protein_id="BAJ70639.1"
FT                   /translation="MKHLSHRTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTN
FT                   STSQGSDGDSAPIAGPVPNIIVTNFTYGGDSVAAGADFNLDFTFQNMGQVAVTNMVITV
FT                   DGGESFAIAGGTNTFYVDALWGGYAMTQSVPMQALASAKSGAQPVTVNFRYEYVDASAR
FT                   SSSQSDVKISVPISQPDRFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEG
FT                   EGFDATMKTQYVGNVASGTTGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLTI
FT                   PVTDMQPMDDSGMADPNMDQNANQGLPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKK
FT                   NDIDEDWDDWSEGKDDKTDTGVTDGAAADTAPITPVTPASSVAPAGSSHKA"
FT   CDS_pept        643890..645479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70640"
FT                   /db_xref="GOA:E8MS96"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS96"
FT                   /protein_id="BAJ70640.1"
FT                   /translation="MRFGDILRLCRQNLWRRKSRTILTVLGVIVGCCSIVLMVSLGQGI
FT                   NEQNEKMLKSMGDLSIVTVYTNGYAGPMDDGGSSKMGDTKLDDKAVESFRAMSGVSGVT
FT                   PMMNFPYNVTARAGAGGRYIYDYVQIMGIDMTQFDQMGYKLVGGEKPVKKDQVLAGEWF
FT                   AYGFMDTLKNGEQRTSTRGDQYSSCTFNQATGQCEEDQDEDPFFDPLTTQISLTTGTNY
FT                   QGDQYSMNMYGGGGGGTGGAGGGGGAGGASGSAAGQSENVTLDVLASGIVAGDYNKGYA
FT                   TSDGLVMDLQALKELAAKVDPAAAKKATAYDQVLVKAADLKSVPEVESQIKALGYETSS
FT                   YEDMRKSLEEQSRAIQLILGGIGAVSLLVAAIGIANTMVMSVTERTREIGIMKALGCYV
FT                   RDIRVMFLAEAGAIGFFGGSIGCVLSGLISLGINVVGALYAGGMSGGMSGGMVSGAGGG
FT                   SGDGTGGGTSIWTILWQAIVGGENVTRYSVIPWWLFLFAVLFSTLIGLLFGFGPANKAV
FT                   KIPALDAIKNNE"
FT   CDS_pept        complement(645463..647664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0497"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70641"
FT                   /db_xref="GOA:E8MS97"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS97"
FT                   /protein_id="BAJ70641.1"
FT                   /translation="MRSASGNGFDSSDSFAVSGAAERTARLHDIPPSITPSHGDDSHLL
FT                   SRIASPADVKALAPNELAELCREIRTTLLAYGHQHGGHIGSNLGMVEATVALHRVFDSP
FT                   RDRIVFDVSHQSYVHKMLTGRAAAYLDPDRFSEVTGFTNPDESKHDQFVLGHTGTSISL
FT                   ACGLAKTRDMEGPNSGIGNVIAVIGDGSLSSGVAFEGLNNAAEQGGNLIIVFNDNEMSI
FT                   AGDFGGMYGPLARLRASGGTAQPNLFNAFGLDYRYVEAGNDVSALVAAFEEVRDIDHPV
FT                   VVHIHTLKGAGYDGAGHVAGASSASAGNVHELDPAVSDTGVRPTSNVLHSEPWHSDHCN
FT                   LSDHEPHEGQCEASHWQNPDAAIGKPDDPRKHYGKMAMAALEPRFAAEPGLVVISPATP
FT                   GSNGITHEFRERAGAHYVDTGITESHAVAYAAGIARAGGTPVVATTASFFQRAYDQFFQ
FT                   EMSLNRSRVTVLDFLGGLSGSDNTHSGAYDVTMFSNIPGVTMLVPTSARDYLADLAWAT
FT                   APAGSADAPAGPAVIRVPGEAILAAERDATLLPVTGGQIADRPQSASLPASASSASGGI
FT                   SAATVRGTVSVTAQHAGARHMLDWRVNQTGSQVAIIGLGNAYPLAEQTAAALSDDYGIT
FT                   ATVIDPRQCTSLDSDVLESLRDGHQQVITLEDGQLEGGWGEKVTAYYANHHVSDGSRNP
FT                   RVLNFGAAKEFTDRVSLGELNERYGLTVEQVTEAITRCF"
FT   CDS_pept        647838..648830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0498"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70642"
FT                   /db_xref="GOA:E8MS98"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS98"
FT                   /protein_id="BAJ70642.1"
FT                   /translation="MKAVYASTVNHADPLAALAVGEQPEPQARPFWSTVSVRAVTVNHH
FT                   DVWSLQGVGLAAEQTPMILGTDAVGILDEDIPGKHGLKAGSEVVLYTFVGTDGAGVAPG
FT                   ERRTILSEKYPGTMAEKTSVPSANVFAKPASLTTAEAAALGTSWLTAYSLLFDAAGIKP
FT                   GDSVLIQGAGGGVSTAAIQLAHAAGLEVFVTSRDADKRAKALKLGANAALETGARLPRK
FT                   VDAVIESVGAATWGHSVRSVRPGGTIAICGATTGDQPGAELTRLFFQDIRVQGCTMGSR
FT                   EDFARLLRFVEHADLHPVIDSVVSGLDAAPEAFAKMIAGDVFGKIVIEL"
FT   CDS_pept        648932..649432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0499"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70643"
FT                   /db_xref="GOA:E8MS99"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS99"
FT                   /protein_id="BAJ70643.1"
FT                   /translation="MANESKPEVAVVMGSSSDWETMKRACDILDQFGVVYHKQVISAHR
FT                   TPELMAEFAHNARANGLKVIIAGAGGAAHLPGMIAAQTTLPVIGVPVRSHALSGWDSLL
FT                   SIVQMPGGIPVATTAVGNSGATNAGLLAVQMLSAFEPELADKLEDYRNELKEKVAESNA
FT                   QLV"
FT   CDS_pept        649416..650594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0500"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70644"
FT                   /db_xref="GOA:E8MSA0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA0"
FT                   /protein_id="BAJ70644.1"
FT                   /translation="MPSLSEETGGRVSMLMPGSTIGIIGGGQLGRMMALSARYMGFRVG
FT                   VLDPTPNCPTGQVADFQITAEYDDKTAIHDLAVQSDVLTYEFENVDAGAIDEVRGITAT
FT                   PQGTDLLRVTQHRVREKQFINDHGTATAPWRAVNNFDELDAALGDIHYPAVLKTVSGGY
FT                   DGHGQLVLRSDADLEKIRSRSDRGGGFPPSILEGFVDFAFEASILVSGNGKDFVTFPIV
FT                   RNEHRNNILHMTIAPAEVSEHVAREAHELAIRLAKGFELAGTLAIELFITKDDQVIVNE
FT                   LAPRPHNSGHYTIEACSMDQFDAHIRGIAGWPLPKPKLLSPAVMVNVLGQHVEPTRALI
FT                   ATHPEWNVHDYGKAEVRHDRKMGHITVLTGDPAKTVADLEATGCWDDLKKKA"
FT   CDS_pept        650603..651031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0501"
FT                   /product="putative metal uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70645"
FT                   /db_xref="GOA:E8MSA1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA1"
FT                   /protein_id="BAJ70645.1"
FT                   /translation="MVEHIERQTKQKDAIRAALADCEEFISAQDLHRRLEDEGSKIGLA
FT                   TVYRQLNALADAGAADTIRLDGQQLFRLCGDDGHHHHLVCRRCGKTVEIDPPSEAWLRK
FT                   VADGHGFTVESHTLEVFGLCSDCQKEQKAQKAQKAVSE"
FT   CDS_pept        complement(651066..651281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70646"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA2"
FT                   /protein_id="BAJ70646.1"
FT                   /translation="MFMTSGGYKHVFGEQHQSNAYMVRLKNHETSNVESRSAKLMKLDG
FT                   VKGIVQNTTSKKQHARRAEVSGIAAE"
FT   CDS_pept        651531..652454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70647"
FT                   /db_xref="GOA:E8MSA3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA3"
FT                   /protein_id="BAJ70647.1"
FT                   /translation="MSIMSNAKRALAIAAAAATLFSMAACGSSNAASGKSDSSGAASSG
FT                   KIEVVASINQWGSVAEDLGGSNVEVTNIMTKTNVEAHDYEPTSQDVAKFGTAKVAVVNG
FT                   ADYDPWATKAAQSTKATLVTAAETAGIKEGDNPHVWFSAKVRSNTADAITAAYQKADPS
FT                   HKDDYAKLNKEWHAKEDQLESKIKETSAKTEGLPYAATESVAWYLADDLKMTDATPKGY
FT                   AQASANESEPTPADIKDFQDTLKAGFIKMFVFNSQEANSTTDQITGAAKDANVPIVELA
FT                   EQMPKQYTNLLDWMSALVDQFAAAVK"
FT   CDS_pept        652715..654790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70648"
FT                   /db_xref="GOA:E8MSA4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA4"
FT                   /protein_id="BAJ70648.1"
FT                   /translation="MSENTSNTTTVKPHFKLWAKKVEANEVTPQHPHKPFPGWVYGVLF
FT                   VIFDIIVVTALEVGVSSSSTRVQLSSPTVGFGFVSKMWTDGNFVFVLNVILVALLYLML
FT                   LMLFNRFWTASIVILAVGIIVAAIEHFKVEIRYEAILPADLGFLGSNTGNMLTFIPAGA
FT                   HVTILVALGAFAVLLALILVLRHFDGRKGRMIRTDNLSLNLTSRLILLLLPILVFALYC
FT                   IHVSTTDSLANKFSRALGDTPSMWDSVYDAQRNGPLVAFTRQLNPKIMDKPSNYSEETM
FT                   KKVAARYQKEAETINASRTNNLTDSTVVYVLSESFSDPSRVPGLKTNKDSMPNIRKIKA
FT                   GTTSGLMLSSGYGGGTANLEYMGLSGLSMANFESSLSSPYQQLVPSQHWTPTINQLWGA
FT                   PVNSLGYHPYESSMYSRATNYKKFGFSHFYTLTGPDVIKYQDKIDESPYVSDKSSYDSA
FT                   LEGIKSGKTNKFIQIITMQNHMPYHEWYENNDYTAESTTGTPLGDDEQQSIETYQKGVE
FT                   ITDQATQEFLNELDALDKPVTVVFYGDHLPGIYSSASEDDNNSLALHLTDYFIWSNKAS
FT                   SSQGNKASDAAYSSPNFFVAQAADHMNAKVSPYLAFLTEMHSKIAAMEPPVVNKIQGWD
FT                   RIPEGQNSYLDQNGNPMSTDDFDKETKQLLADYKLIQYDITAGKNYLKDTDFMTLP"
FT   CDS_pept        654911..656548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0505"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70649"
FT                   /db_xref="GOA:E8MSA5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA5"
FT                   /protein_id="BAJ70649.1"
FT                   /translation="MTNQTFEQLKKTYESGRTRPLAWRRAQLNALRRLVTENRDAFVSS
FT                   AMADLGKPAAETVLMELNLVAGEAQFVRNRLSLWTARHPKAMHWMLQPAAGWTIAEPKG
FT                   VVLIISPWNYPVLLALEPMADALAAGNAVCLKPSELSPNTSKLLAELVPQYLDSEAVRV
FT                   VEGGPKETGELLKCPFNHIFYTGGGHVGKIVMRAAAEHLTPVTLELGGKSPCFVDRTAD
FT                   INVAARRIAWGKFTNAGQTCVAPDYVLATPDVAEALAERIAVAITEFYGEDPKASPDFG
FT                   RIINDRHFERLCKLLPVGTVPPEEPSSPLVQVASAVGAAMDMVGRRFNAVTTGRGGAGE
FT                   MAGSANNAAKPTAGSNMAAADDGATASAAVEPSEIHKVPGVFDLAGRIVCGGKVDRAAR
FT                   YIAPTVLYGTSPDAPVMKEEIFGPILPILVVEDAESAIRFINKRSRPLAAYVFSRDHEV
FT                   RLTFERQTSSGALGYSLPLGHLLSSRLPFGGVGASGIGTYHGKAGFLTFSHVKTVVTKP
FT                   QFPDTLRLVYPPFNEAKAKLFDIIAKFS"
FT   CDS_pept        complement(656922..658190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0506"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70650"
FT                   /db_xref="GOA:E8MSA6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA6"
FT                   /protein_id="BAJ70650.1"
FT                   /translation="MGQKVLVIGSGAREHTIAYTLLKAPSIDEVTVAPGNPGMLKDGIH
FT                   TTQLSQSNHAALIEFVKNNGYDWVFVGPEVPLIEGIVDDFAAAGIKAFGPSKAAAQIEG
FT                   SKDFAKQLMDRHNIPTAQYKTFSDLEMAQDYVHEHGAPIVIKADGLAAGKGVTVAMDEH
FT                   TAQRALEDIFIDHRFGSAGAKVVIEDFLDGQEFSLMSFVNGTDFWPMPISQDHKRAHDG
FT                   DEGPNTGGMGAYSPVPQIPQSVVDEAIEKIVRPTVEGMAEEGTPFTGILYAGLIATADG
FT                   PKVIEFNARFGDPETEVVLPKLTSDLGAGISAILDGETPEFTWDESNATLGVVIASNGY
FT                   PENVIKGARVPEIEVDEDSHVYYAGVASDEHGNLVANSGRVLLVETSAPDIKSAQDKVY
FT                   AIIDKLELRGLFYRHDIGFKALK"
FT   CDS_pept        complement(658217..659254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0507"
FT                   /product="phosphoribosylaminoimidazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70651"
FT                   /db_xref="GOA:E8MSA7"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA7"
FT                   /protein_id="BAJ70651.1"
FT                   /translation="MPKAYENAGVSVEAGYEVVKRIKSHVARTNRPGVVGGIGGFGGLF
FT                   DLASLGYKEPVLISGTDGVGTKLMVAKLANKHDTIGIDCVAMCVNDIAAQGAEPLFFLD
FT                   YIACGKNDPALLEQVVAGVADGCVQAGSALVGGETAEMPGMYDEDEYDLAGFSVGVAEK
FT                   SAIVDGSTIAEGDVLIGLPSTGVHSNGFSLVRKALFEQAGYTVDTELDELGGEKLGDVL
FT                   LTPTKIYVKALSPLFKAGVVKGVAHITGGGFIENIPRMIPDGLAAEIELGTWPVLPIFD
FT                   VLEKAGNIDHKEMYNIFNMGIGMVLAIDPARKDEALKLLADNNEPAYVLGSITADTTGT
FT                   QIVLK"
FT   CDS_pept        complement(659374..660885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0508"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70652"
FT                   /db_xref="GOA:E8MSA8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA8"
FT                   /protein_id="BAJ70652.1"
FT                   /translation="MSAELEDIHEECGIFGVWGHPDASRLTYFGLHALQHRGQEGAGIV
FT                   SNDNGHLIGHRGLGLLTQVFGDEREIERLKGNCAIGHVRYATAGSGTTDNIQPFIFRFH
FT                   DGDVALCHNGNLTNCPSLRRKLEDEGAIFHSNSDTEVLMHLIRRSMQRTFMDKLKEALN
FT                   TVHGGFAYLLMTEDAMIGALDPNGFRPLSLGKMKNGAYVLASETCALDVVGAELVRNIR
FT                   PGEIVVVNDHGYKIVQYTNNTQLAICSMEYIYFARPDSDIYGVNVHSARKRMGARLAAE
FT                   SPVEADMVIGVPNSSLSAASGYAEAAGLPNEMGLIKNQYVARTFIQPTQELREQGVRMK
FT                   LSAVRSVVKGKRVIVIDDSIVRGTTSKRIVQLLKEAGAAEVHMRISSPPLKYPCFYGID
FT                   ISTTKELIAAKMSVEEIREYIGADSLAYLSLDGLVESIGLNADAPYGGLCVAYFNGDYP
FT                   TALDDYEADFLKSLTPEDRVRLPEFALYKSKYIGNEYNTVQPDAE"
FT   CDS_pept        complement(661289..662074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0509"
FT                   /product="amino acid ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70653"
FT                   /db_xref="GOA:E8MSA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSA9"
FT                   /protein_id="BAJ70653.1"
FT                   /translation="MSEMTNITTEASDSPVSNKTVLRLDDVRKSFGNTQVLRGISFDIH
FT                   QHEVVALLGPSGSGKSTLMKCVNLLEQVDDGQIWLGNTDITDPRADQDKIRARIGVVFQ
FT                   QFNLFPHMSVLRNVTLAAIKVHHWSKDRAETRAMELLERIGMRDKASAYPDQLSGGQQQ
FT                   RVAIARALMTDPELLLLDEITSALDPMLVGEVLNMVAELKAQGTTILMATHEMSFAHEA
FT                   ADRIVLLRHGVIAENGTPAEVMDESQDPETIEFFSHFRH"
FT   CDS_pept        complement(662071..663006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0510"
FT                   /product="amino acid ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70654"
FT                   /db_xref="GOA:E8MSB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB0"
FT                   /protein_id="BAJ70654.1"
FT                   /translation="MAPGHPGIQEASDIHHMTAAPTETRQHNAPDGHEVSQVELERRQY
FT                   RVHQQIQSTITSLISTIVFVVVIVIGLKLSPGWPRVKETFFSGEYFVKSFPHVLDGLWL
FT                   NIRVLLVAVVGVAILSTLIALVRTSRSPILFPLRILALIYTTVMRGVPIIVVLYLIGFG
FT                   IPGLGLFGRIDPSVLGTIAVVMGYSAYVSEVLRAGFNDVHPSQRASARSLGLTSGQTTR
FT                   LIVIPQALRKVAPALMNDFISMQKDVGLISVLGAVDAVRAAQIDVASTYNFTPYVVASL
FT                   LFILMSVPFILLNDWYTERLRKRELSGGTV"
FT   CDS_pept        complement(663068..663931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0511"
FT                   /product="amino acid ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70655"
FT                   /db_xref="GOA:E8MSB1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB1"
FT                   /protein_id="BAJ70655.1"
FT                   /translation="MFNKRHIVRTIAATVSILALSFTAACGSGQSTASNSTDSDDITQQ
FT                   TYKPGKLTIATGQPAYEPWVMNDKPESGEGYEAAVAYAVADKLGFKKSDVVWTRTAFDT
FT                   AIAPGAKDWDFNIQQFGITDERKKAVDFSSSYYNDSQSVVVKKDSKFANATKVSDLKDA
FT                   TVGVMVGTLAYDYAKANIKDDIQTFNDDAALAQALDAGQIDALVTSTVECVYMVQSEQV
FT                   KDAKVLGRLPDSEDKSGMGIVLPKDSKLTAAVTKAVDDLNADGTIKKLQDKWLAEYTTD
FT                   LTELKK"
FT   CDS_pept        complement(664133..664603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70656"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB2"
FT                   /protein_id="BAJ70656.1"
FT                   /translation="MSVALQDMSPYARSIVERLGLETHPEGGWYTRDWQSPHTDEASSR
FT                   PLSSLIYFLLPEGDASAWHKVDADEVWLWHGPASVKLELGGSDETPESDESKRTVITLG
FT                   SGITTDQADVTVSGHAVVPAGVWQRTVPGQGDALVSCVVSPGFVFDGFTLEQ"
FT   CDS_pept        complement(664673..666046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0513"
FT                   /product="putative chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70657"
FT                   /db_xref="GOA:E8MSB3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB3"
FT                   /protein_id="BAJ70657.1"
FT                   /translation="MTDNTWPTVDTELIDDVTLYSAKLIIPVTGPVIIDGAVAIHGDRV
FT                   VHVGKRRWVLKALKQEMTAHGTIHERHWDGVLTPGLINAHTHLQYSGMVQVGQGTYDRF
FT                   RAWELAFNEVYAEAQKTQPWKQWAEDGARQMVESGTTAAADIVTDLDAAGALASQGMHG
FT                   IAYWEVMGWHNAEWMEKGRTELIRQLRRMNEEQLPNLGISPHAPYTLESEPFVDLPDIA
FT                   RQLNMRLHIHLAETPLEAGTYPPVLTTYSAADWSDHDWESYRQLKEVGKGASAIQFVDQ
FT                   LGSLGPDVHIAHGVWANGEDRRILRQRGVGVALCPRSNRITNTGKDAPVREYLEEGNLV
FT                   SVGTDSLSSTPTLDLLDDVSMLYDLAREQGYASDDLTHRLIRMMTLGGAASMGMHVGRN
FT                   RIGQINAGALADFAFFDIPVDTSSPAGIEETLETLVRHGAGTNRATVISGREAYNNAW"
FT   CDS_pept        complement(666086..667588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0514"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70658"
FT                   /db_xref="GOA:E8MSB4"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB4"
FT                   /protein_id="BAJ70658.1"
FT                   /translation="MRTMGNMKKSITADSDFAAWAAARSQKTNRSLAGARLAIPEPQKH
FT                   AEIKSQAQQWGMTVEDATMTDEHNEEFLCDGTQSIDSITDMRKASGLEAMEYAEQHMPV
FT                   LRDTMDSLTTRVDFSGIRIAVCLILEPKTAILLRKLKAAGAIVGVYCGPDSTDPRVAEQ
FT                   LRREGITVESSRDWTAEQAHEAALHLLDEIQPDIIIDDGASFARLASLERPELTANLIG
FT                   VAEETTSGVRAFQQMQEAGALTYPVVAVNDSVLKTGFDNAHGTGETCVTTMQRILGEHA
FT                   FDGKNVTVIGYGPVGQGFARRIRALGAEVTICDIDPVASLKAVFDGFAAQDIDEALPCA
FT                   DMVVSATGVRHTVTLEHMRAMHEGAALAVIGGIANEIALDEVSDFTPQVNRDTVQLNVP
FT                   DGPTLTLIADGDGVNYTVGGGNPIEIMDLSFAVQASAVAYLLEHRGTLDHTLIRLDAAT
FT                   DQRIAASALKARGYRASHAVEDNGYNWRLTRFAENDRENADR"
FT   CDS_pept        667753..669342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70659"
FT                   /db_xref="GOA:E8MSB5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB5"
FT                   /protein_id="BAJ70659.1"
FT                   /translation="MGSGTVSTQREHTYIAIDLKSFYASVECVARGLDPLTTHLVVADE
FT                   TRTDKTICLAVSPSLKNYGIPGRARLFEVKQRLNGVNIERAVHAPGGRLIGESCDACDL
FT                   ERSPGLKASMVIAKPRMAHYLEISGQIYGIYLKYAAPEHIHVYSIDEVFIDATPYLRSL
FT                   GMGPHAMARTIVREILTKTGITATAGIGSNMYLAKVAMDIVAKHMPADKDGVRVAELNE
FT                   MSYRRLLWDHRPLTDFWRVGRGYAKKLEHAGLMTMGDIARCSVGRASDYYNEDLLYRMF
FT                   GVNAELLIDHAWGWEPCEIADIRSYEPGAHSISSGQVLTGPADYATARLITKEMADALA
FT                   LDLVDKSVLTNRLTLAVGYDIGSLDSSKLDSCADYAMKRAAERAAKSYQGPVTIDRFGR
FT                   KVPKSAVGSIGLGDFTSSSARIREAMTMLYERIVDSRLLVRRLTVIADDVATPEELAAG
FT                   KRYEQLDLFGDDGAQSYGSDSTSEKDGEHDIQRALLDVKRKFGRNAVIKAMDMEDGATG
FT                   QDRNRQIGGHRA"
FT   CDS_pept        669339..669557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0516"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70660"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB6"
FT                   /protein_id="BAJ70660.1"
FT                   /translation="MTLQETRAYDDIINLPHHQSRKHPHMSRHQRAAQFMPFAALTGYN
FT                   QVIEQTAKNAETAIAQAEAQGDTDFGA"
FT   CDS_pept        complement(669591..670568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0517"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70661"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB7"
FT                   /protein_id="BAJ70661.1"
FT                   /translation="MKYRSVGKSGLKISEVALGSWVTDLKGTAAEDVAKETVKLAYDSG
FT                   VNFFDCADAYSGGAAERFLGKTLKQYPRKELVISSKVYFPTGEGVNDRGLSRKHIFESI
FT                   DQTLKNMQTDYLDMYFCHRFDETTDLTETLRAMSDLVAQGKVLYYGVSEEWGSARLEEA
FT                   QRIIDRYNLYPITVVQPQYNLNDRYIEHEIMGTCRKLGIGITTFSPLAQGLLTGKYRKG
FT                   QPLPAGSRATWQSDHQINDLLTDENLDKVEQLRKVADELGTNLPVLSMAWILQHPEISC
FT                   VIAGASKPSQLENNMKAAGFVIPADAMAEIDKITGFHRFERHVG"
FT   CDS_pept        complement(670676..671641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0518"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70662"
FT                   /db_xref="GOA:E8MSB8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB8"
FT                   /protein_id="BAJ70662.1"
FT                   /translation="MNFLSIEYFAAVASEHSFSKAAKRLGITQQTLSANIAALERELGC
FT                   TLFVRHVPLELTYAGTVFARYAQRFRRDRDALGQEMRDIAGDQAGVLRVGVAYTRSRAI
FT                   MPPIVKAMQRDCPNIIVELIEGRNDQIQQWLANGDLDLAVADFAGKPAGIELMDFYNER
FT                   MVLVLAQSLWMDLAATGGAANGQVDAVRTAPDERAIAAGDLSSLEHCPFLLGSPQDIDG
FT                   RIADLLFRRAGFEPKVTARSDNVLTLLELCHYGMGACLCPERFLPALLDGERLRTLRVL
FT                   DCGPDTAYAIQFGVPATSYRWSVIDDFIRCAREVTTGVSQ"
FT   CDS_pept        671860..673374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0519"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70663"
FT                   /db_xref="GOA:E8MSB9"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB9"
FT                   /protein_id="BAJ70663.1"
FT                   /translation="MLEAGTMLLFCAVLFASVALGWSIIPALFVGVLLFMGYGLVRRCS
FT                   LRAMASRAAGSVRSAGIVVVAFVLIGVLTSLWRASGTIAFIVAHSTAVIHAATVIPLSF
FT                   LLCSAMSVLVGSSFASAATMGTICMSLGLSMQANPVMLGGAILAGVYVGDRCSPVSTSA
FT                   LLVKQLTHTNLFNTIARMLRTGAVPFVLSCVVYVAAAVVEWLCASGGSGFGAASAAATA
FT                   GSAGSARAAVSTNASSITDIGGLFSSAFDLHWLTLVPALLVIVLALLRVDVRLLMLASI
FT                   AASVAVCVGVQHMEWAELLRLLIFGYHAQNPQVAALLDGGGILSMLTVMATVCISSAYA
FT                   GIFAETRMLARLQQVIEMLGHRIGACGATMITATCAAALACNQTLTIMLTHQLCGGLYG
FT                   DDESERSAQAIDLEDSAVVIAPLIPWSIAGAVPLATINAPTLSLAAATFLYLLPLSRML
FT                   ASAVRRRSGFRTRHRSQNQNPGLAIPHRPKPMLHMFAHGFHPKSGD"
FT   CDS_pept        complement(673388..674047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70664"
FT                   /db_xref="GOA:E8MSC0"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC0"
FT                   /protein_id="BAJ70664.1"
FT                   /translation="MKHCDACTVDFTGDMARCPLCQNELRGEASPAAFPAQQIYLRPRR
FT                   LAVEIITFVTGAILLLHGFFSYLFSWPIPIASASAAALIISVLFINSAILHVPRPLRLM
FT                   FRYFYIMLAIALVWFVATMNHVVTMFVIPITCLVSLVFDVVLLIVLRAKAIDEYAKYLA
FT                   FDIVAGLMPLTFIPLGWAPWDVLVMVSGLVSLLVLLGLLVFARRQLFSEFGKQFSA"
FT   CDS_pept        complement(674044..675414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0521"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70665"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC1"
FT                   /protein_id="BAJ70665.1"
FT                   /translation="MARRTWYRLDNIGKFYSSQAGRSSQTVFRYSAELADGIDPDILQH
FT                   ALDHAIAQFPSFNVHLLNGMFWHYLEQSDGRPLVEPEHLPICSRLHYGPKSMLFRVSYF
FT                   RNRVNLEVSHIISDGRGAINLFKSLLHAYIAERYDVPGVPSDYDGSDSDKAENSFDKYY
FT                   EKDKAGAAPGTKIYRLAGPIDRAAPTFMEYHVSASKVLGAAHQCGVSLTSYLIAAILCA
FT                   IRDVMPSRARNRAIRVDIPVDLRAFFRSETVRNFYGMTYVAYTPAEIEADEDSAKTSAT
FT                   SPDAAGDGQQSAARTAHGNGMGGLLTDEPLADIARHVQEQLGHATSRERVESHMNRMIA
FT                   LEKNPVLRLAPSPAKDWVLELARFIADRETTTTVSNLGRVTLDERLARHVRSVSFLTTP
FT                   ASLNFTVCSFGDDLSIGISTIYHDLNVIKNLCRILAAQGISGRMNIAGVHVEKGASA"
FT   CDS_pept        complement(675387..676685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0522"
FT                   /product="putative lipase/esterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70666"
FT                   /db_xref="GOA:E8MSC2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC2"
FT                   /protein_id="BAJ70666.1"
FT                   /translation="MPINEALFAAMKAASYIKPNAGKSYKLQRVAEELIAKQAPDNPKC
FT                   RVEDAFAPMADGYAVPLRVFTPLVAYGAPLPEALEESSANGTPVASAISAILPAVLPKV
FT                   LPKILIKESTSSGNADGISGNANTELPSVTPRGTILFFHGGGWTTGGINLYTQACAHMA
FT                   VRLQRRVISVEYRLAPEYRFPTAVEDCYEVARQLFAGELPISGVGGSVDVDHPQSAAPT
FT                   APAGGGDISATIPAPDPDSIVLFGDSAGGNLAAAVSLMARDRGEFMPRTQMLLYPVVGN
FT                   DYNPETSPFESVRTNGTDYILTAQDMADYIDMYRSSVADLTNPYFAPLTAHDLSNQPRT
FT                   LVLSAEYCPLRDEDEAYARRLQLVNDNVSCYRIHDGIHGYLLNTSAVGLVATTYRIIEH
FT                   FLDGTPLEPAPGTGTTANAPEGGDAWQDVLGTD"
FT   CDS_pept        complement(676822..680556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0523"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70667"
FT                   /db_xref="GOA:E8MSC3"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC3"
FT                   /protein_id="BAJ70667.1"
FT                   /translation="MVFRVYVEKKPGFDVEAQQLAGELRTILGLTGLKALRIVNRYDVE
FT                   GISQELFDQTVPTVFSEPQVDNVAYDLPDFAGAKVFATEFLPGQFDQRADSAAECIQLI
FT                   SQGERPTVRSAKLYALEGDLTDADVDTIKHYVINPVEAREASLETKETLKTQVPVPGKV
FT                   ETIAGFNEMDAEAGQKFIDERGLAMDLADLEFCQKYFSEESREPTITEIKVIDTYWSDH
FT                   CRHTTFGTELDEVTIDDATVKAAFERYLAMRHELGRDAKPVCLMDMGTIGAKWLKKNGV
FT                   LTGLDESEEINACTVKVKVDVNGHDEDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRD
FT                   PLSGRSYVYQAMRVTGAADPTVPVSETLEGKLPQRKLVTTAAAGYSSYGNQIGLATGQV
FT                   DEIYHPGYVAKRMEVGAVVAATPADHVRRETPAPGDKIILLGGRTGRDGIGGATGSSKA
FT                   HNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGELADGL
FT                   FVDLNTVPKKYEGLDGTELAISESQERMAVDVAAEDVDEFLAYAREENLEATVIATVTE
FT                   DPRMVMTWNGDKIVNLSREFLASNGASKHQTVHVEEQQSYETPWGEGTLAERMNKLVTD
FT                   INVASNKGLSERFDSTIGAGTVLMPFGGKRQLTPNMAMVAKLPVFGETTTASAMAWGFN
FT                   PYIMSKNQFTGAYLSVVESLAKLVAAGFEHEKAYLSFQEYFEKLRDEPERWGKPAAAVL
FT                   GALMAQVDLGAGAIGGKDSMSGSFEDLDVPPTLISFAVAVGNMKRATSPEFKDADHRIV
FT                   RIAPRYLADGLTPDKDALLEVFSVIEELTDFHDALAVSTPGYGATAEALFKMTLGNRIG
FT                   VTLNNSIAVDDLFTPAYGSFIVELADDAKLPAVSNLVEIGEIGTTTSEYVFKAAGETLD
FT                   LDAVQEAWESGIESVFPYRSKGEDKGATVETIDFHAPKKTVYVGSSVAKPHVVIPVFPG
FT                   NNCEYDSAAAFERAGADVTTLIVNNLTPAAVAESTQALVDEINKSQIVMIPGGFSGGDE
FT                   PDGSAKFITAFFRAPAVTEAVRDLLKNRDGLMLGICNGFQALVKLGLVPYGDIVPMTDA
FT                   CPTLTFNTIGRHQSRLVRTRVASDLSPWLSKTSVGDIHTVAISHGEGRFVASDEVLAQL
FT                   RANGQIATQYVDETGTPGMDLDVNPNGSLLAIEGITSPDGRVFGKMGHSERSGNGLYVN
FT                   VPGNKYQPIFEAGVEYFTA"
FT   CDS_pept        complement(680619..681371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0524"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70668"
FT                   /db_xref="GOA:E8MSC4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC4"
FT                   /protein_id="BAJ70668.1"
FT                   /translation="MEKLEKLYEGKAKQLYATDDPEVLWVEYKNTATAGDGEKKEDFTG
FT                   KGRLNNLITTIIFDLLKKRGIDSHLIKRVDDTGQLVRKVNMFPLEIVLRNVAAGHFCSR
FT                   LGVEEGLPLKEPVLEYFLKNDDLHDPFVNDDDLVALGVCTREDLAEIAPLARKINEALI
FT                   EIFAKIDVKLVDFKIEMGRATDGTLLLADEITPDSCRLWDQKDHSGKVEHLDKDLFRRG
FT                   LGSIIPAYEEIEERLAELAKSEGIEVAE"
FT   CDS_pept        complement(681764..683107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0525"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70669"
FT                   /db_xref="GOA:E8MSC5"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC5"
FT                   /protein_id="BAJ70669.1"
FT                   /translation="MGMTENAVNTAVTSTSSPAIPAETSAVSPATRAANRPLGTPLGKH
FT                   PTRVLFLGAGELGKEVAIELMRLGAWVCAADSYAGAPAQQVAHEYRALDMANAAELQAL
FT                   FDEIKPDIIVPEVEAIATDVLAGTAAAGAQVVPSAEIAAICMDRERLRVLAHEELGLPT
FT                   TPYRFAGSLEELRAGASEVGYPCVVKPVMSSSGHGQSVVRSADAIDAAWTEAQEGRRAA
FT                   DEGDVSRVIVEALAPLERELTVLTVSSSAGIVTCAPIGQRQESGDYRESWQPATEPDGE
FT                   AERARDIARTAVEGLVAKAQAAGETGWGVFGVELFVLTDGSILFNEVSPRPHDTGMVTM
FT                   ASQRLSEFALHARAILGLPITPEHVSLTIPAGSVAASHAIVVAGDGEVEFTDVAAALAE
FT                   PGTDLRIFAKPEVHGHRRMAVALAVGESEADARAKAGLVADALTITVE"
FT   CDS_pept        683275..684435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0527"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70670"
FT                   /db_xref="GOA:E8MSC6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC6"
FT                   /protein_id="BAJ70670.1"
FT                   /translation="MRENGIEESIDRPLTIALVVDTVGNQGNGTSNSALQWAAELERQG
FT                   HHVRLVGIGAPEYPARVNRVPLVSWVAAKQLMQFAEPSDTLFRTAFQGVDVVHIYMPFK
FT                   FGRRAAKVAHQMGIPVTAGFHLQPENVLYSAGPLRRIPGISSFLYWLFKHWLYKHIDHI
FT                   HVPTEMTASLLRAHGYKAKLHVISNGYSPVYSPKKPADPDASAPVPFRVIASGRLASEK
FT                   DQITLIKAVSMSRHAGDIQLVIAGTGPLKQYLKFRAGRLLARKADIGFHKHADMPDLLR
FT                   SGDLFVHCSIADIESVSVIEAMACGLVPVIAASELSAASQFALIDESLFPVRDAALLAR
FT                   RIDWWIAHQAERAEWGEKYAEYTKAHYSVEASVHKFVDMERKAIGE"
FT   CDS_pept        complement(684582..685607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70671"
FT                   /db_xref="GOA:E8MSC7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC7"
FT                   /protein_id="BAJ70671.1"
FT                   /translation="MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIR
FT                   EACGQPDADVWFLVGGTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLT
FT                   IPQHNGKMDPTELDEFCKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVA
FT                   HKYDMPLFVDGARLGYALTATGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNT
FT                   PKHFLTLIKQHGALLAKGFVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTL
FT                   TFEAPTNQIFVTMDQPTIDRLEREVKLGFTEKADDTHTVMRICTSWATTHEEVDQLIEL
FT                   L"
FT   tRNA            complement(685757..685832)
FT                   /locus_tag="BLIF_tRNA20"
FT                   /product="tRNA-His"
FT   CDS_pept        686169..687230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0529"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70672"
FT                   /db_xref="GOA:E8MSC8"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC8"
FT                   /protein_id="BAJ70672.1"
FT                   /translation="MEKVKAFADWLTKWFTVIVIVWAVFNYFVPAASLWGKAYTGYMLG
FT                   IVLFGMGLTLTLDDFKRILTQPLMVIVGTVAHFIIMPLIAVALCAIFHLSGPLAVGVIL
FT                   VGCCPSGTSSNVMSYLSRGDVALDVSIGILSTLCAPFMIPLLMQLLASQYVSVPTQSLF
FT                   LNAVKVVLFPIALGVICHMIFGKKIEKVTVALPIVSQVAILLIIGVVVAANGPKLFVAS
FT                   SLVAIPVVILHNLCGYSLGFGFSKLMYKIYPKGFRYAQQKAITFEVGMQDSALGATLAL
FT                   TSFATNPLAAVPSTFFSVWHNISGSILSSWWRNHDDKHEIHWDSDNGEKGSAKSTVSAA
FT                   HPFDADKAAKVAA"
FT   CDS_pept        complement(687727..688869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0530"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70673"
FT                   /db_xref="GOA:E8MRW4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW4"
FT                   /protein_id="BAJ70673.1"
FT                   /translation="MKVQHPLDWKLPRKPVRRDVAPMGEVYSHLSEEERQVIQIEVGNG
FT                   ASIRGIGAMLGRSPSSISREIKRNTWFPSNENESYRPYRPKRLKAGPWTGRYYIAGPAQ
FT                   RKADRRRSKPRKPYRLSHDRLWAQVAEWLGRGWSPLLISGRLRVLWPDDALMRVCPETI
FT                   YRWVYSSRPLRERWARCLPRGHRRRRRHGGRRTSRFPIPGRVPISERPPEADGRSAFGH
FT                   WEADSVIGVGCNLHTEVERRTRFLMARVVPDKTAGESVGAQLDMFSPLPAGARVSVTHD
FT                   NGTEFAHHERLRDGLGMATYFADPYSSWQRGSNENRNGMIRRYLPKRCEIRMDMAKEVR
FT                   EIVDEINNRPMRVLGYRTPAEAFADELLELQDQQGCCTSK"
FT   CDS_pept        689162..689533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0531"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70674"
FT                   /db_xref="GOA:E8MSD0"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD0"
FT                   /protein_id="BAJ70674.1"
FT                   /translation="MPTIEQLVRKGRQAKPKKSKTLALKGSPLRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSSGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
FT                   QGVKDRKQGRSLYGAKKAK"
FT   CDS_pept        689539..690009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0532"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70675"
FT                   /db_xref="GOA:E8MSD1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD1"
FT                   /protein_id="BAJ70675.1"
FT                   /translation="MSRKGPSKKHVVLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKEKSDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPNRANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
FT   CDS_pept        690041..692164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0533"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70676"
FT                   /db_xref="GOA:E8MSD2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD2"
FT                   /protein_id="BAJ70676.1"
FT                   /translation="MAEEISDLHDVRNIGIMAHIDAGKTTTTERILFYTGKNYKIGETH
FT                   DGASTMDFMAQEQERGITIQSAATTCFWSRQSHDTKDKFQINIIDTPGHVDFTAEVERS
FT                   LRVLDGAVAVFDGKEGVEPQSETVWRQADKYGVPRICFINKMDKLGANFYYSVDTIKEK
FT                   LGATPIVMQLPIGSENDFTGVVDLVEMQAYVWNGTEELGAKYDTTEIPDDLKDKAQEYH
FT                   EKLVEAAAEADDDLMNKFFEDGDLSKEDIRAGVRKLTIAKEAFPIFCGSAFKDKGVQPM
FT                   LDGVVDYLPSPEDVPAIKGYKPGDESVEIDRHPVKSDPFAALVFKISTHPFYGKLVFVR
FT                   VYSGSVVPGDSVLDSTREKKERIGKIFQMHADKENPMDRADAGNIYTFVGLKNVTTGDT
FT                   LCAIDDPITLDSMTFPDPVIQVAVEPKTKADQEKMGIALSKLAEEDPTFQVTTDEESGQ
FT                   TLIAGMGELQLDIIVDRMRREFKVECNQGKPQVAYRETIRKAVMDQGYTHKKQTGGSGQ
FT                   FAKVLMNFEPLDTTEGKTFEFENKVTGGHISAEFIGPIEAGVKEAMESGVLAGFPVVGV
FT                   KATVTDGQMHPVDSSEMAFKLAGSMCFKEAAPKAKPVILEPIMKVEVRTPEEYMGEVIG
FT                   DLNQRRGNIQSMTDGVGVKVIDAKVPLSEMFGYIGDLRSKTQGRAMFTMEMDSYDEVPK
FT                   SVSEEIIKAQRGE"
FT   CDS_pept        692337..693536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0534"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70677"
FT                   /db_xref="GOA:E8MSD3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD3"
FT                   /protein_id="BAJ70677.1"
FT                   /translation="MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHEEFPDVNP
FT                   EYDFNQIDSAPEEAARGITINIAHIEYQTEKRHYAHVDCPGHADFVKNMITGAAQMDGA
FT                   ILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDEN
FT                   GFDRDCPVIHTSAYGALHDDAPDHEKWVQSVKDLMDAVDDYIPTPVHDLDKPFLMPIED
FT                   VFTISGRGTVVTGRVERGQLAVNTPVEIVGIRPTQQTTVTSIETFHKTMDACEAGDNTG
FT                   LLLRGLGRDDVERGQVVAKPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRT
FT                   TDVTGVIELPEGVEMVQPGDHATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA
FT                   "
FT   CDS_pept        693744..694475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70678"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD4"
FT                   /protein_id="BAJ70678.1"
FT                   /translation="MMTGAQAAHCGSVSAISLGLPVSTAIPEAKGTLPKALFVGKAPIS
FT                   GKLKQRLVNEIESITMLALARSANTGLADGKLIPEVLVIGLKLTAKATGIPNEVIDLIA
FT                   GQRKSGIVFVCVRDVPFEGSTREECAFAVRRAIPGRAGHTPIYQVYAGDWQPAGEAQLE
FT                   LAGSTIDELWASLCSQTILGTPEVENLDARIIRHTEIARLESEVDKLTRDHQRVKNPAQ
FT                   RNEIYAKLHKAKAQLAKLREA"
FT   CDS_pept        694612..695430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0536"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70679"
FT                   /db_xref="GOA:E8MSD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD5"
FT                   /protein_id="BAJ70679.1"
FT                   /translation="MFPLLETLVAVYEVGQFTLAADELKVSQSTVSSRIAQLEQMVGAP
FT                   LFVRNAKSDVTPTQAGRMLYQTAIGIDGLWRDTREQIARVQEAREPLAVSFSHTTAAIL
FT                   LPKALPVMARDMDGFDFAVHVMNSDAILEQASMKAVQLGVVEKPIVNDSVDRVTLCEDR
FT                   LVLAGEPDGVWMVREHGSGVRYYTDLYFKTAQVVPARTMEVSSNAAIVAALSAGFGQSL
FT                   ISEAAVPAGVPVQRELGDEFVRRFYALVPRSGLTHDQRELAETIIAALRG"
FT   CDS_pept        695600..696664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70680"
FT                   /db_xref="GOA:E8MSD6"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD6"
FT                   /protein_id="BAJ70680.1"
FT                   /translation="MREFCTKWWKRIATVDMLFIGVLTLLASLFASWLKQFPGFSLFGA
FT                   LIIALLIGMIIQFPIRSAYVGSNDGRKAGVKDAAGLISNKLLRLGIILLGFKLNLAVLF
FT                   TQGIKCLPIAAVVVTLTIIVCYAIARKLGVDPMLAILTAGGTGICGAAAVMGLAGSIKV
FT                   PEDKQDEKDNDVTMAVAIVAIMGTVFALLEIALGPLTGMTKDQLGITAGASLHEIAHAV
FT                   AGGDAFGAVDIATIMKLSRVLMLVFAAIIIAIWWEKKHSEVQSTGKKTVAFPWFMLGFI
FT                   GASIIGTFVPFVTSITPQLVDFAYIVLGMAMAALGINVNFKAIASKGKKPMLASFLTSI
FT                   LLMCFAAGVAMLFF"
FT   CDS_pept        complement(696721..697200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70681"
FT                   /db_xref="GOA:E8MSD7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD7"
FT                   /protein_id="BAJ70681.1"
FT                   /translation="MANNGADVKPNQGVGATNTSTTTNTAENTVGTATPKQNGLAVLGK
FT                   YVGVSATQTIVEYATFAILHLIGVPSQIANGIAVVCSATYNFVMNRNVTFKSSSNFTRS
FT                   VALFVLLWIWNFTFSTLLIGWMPGATGLSPYVVKFIAMACQFGWGYPLCKYVIFR"
FT   CDS_pept        complement(697281..697649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70682"
FT                   /db_xref="GOA:E8MSD8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD8"
FT                   /protein_id="BAJ70682.1"
FT                   /translation="MMTVFLPILVCLCGGVGASCRYLLDVTIKTYWQRAFPLSTFTINL
FT                   IAGFLAGLVAALALGGTLDEPWRLVLATGFLGGFSTFSTAINEMVTLFRKHRYPTAAAY
FT                   LVLSLGVPVVAAACGFLV"
FT   CDS_pept        complement(697646..698182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70683"
FT                   /db_xref="GOA:E8MSD9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD9"
FT                   /protein_id="BAJ70683.1"
FT                   /translation="MDSQSPSAGARPITHTTTPPARKLPDIHLDIVLVVFCGGAIGTAI
FT                   RYAFAQIPAAGSFHTGTFVANMLACFCYAGLTAYLAGASRFGARSKELASRGLGMGVCG
FT                   GLSTMSTLALEGFTAIRDGQVAAGIAYLLVTFALGLVCASAGVWAGTHLAGSSNVSAEA
FT                   SADTNAATTSKGGKA"
FT   CDS_pept        698588..699631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0541"
FT                   /product="putative alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70684"
FT                   /db_xref="GOA:E8MSE0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE0"
FT                   /protein_id="BAJ70684.1"
FT                   /translation="MSETMKAAIFVEPGKMTVEEVPKAALQQDDDIVIRMVRTCVCGSD
FT                   LWFFRGLSGQAAHSQVGHEAIGVVEETGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFE
FT                   SVCPHGGYFSACQAEYLRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAV
FT                   SAEVKPGDTAVVMGDGAVGLCGVIAAKMRGATRIIAMSRHEDRAALAREFGATDIVPER
FT                   GQEAIDKVLEMTGGYGADAVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGT
FT                   FYGNIGIKGGPAPVRHYDLDEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKV
FT                   IKALIRF"
FT   CDS_pept        699862..701223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70685"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE1"
FT                   /protein_id="BAJ70685.1"
FT                   /translation="MLKRKMLDKLIAWKQKAGGREALLIEGARRVGKSTIVEEFGRTQY
FT                   KSYILIDFTRLPRDVRDIFENQRDDFDTFFMLLSAYYRKRLYERESLIIFDEVQRYPAA
FT                   RELIKYLVADGRYDYVETGSLISIKRNVANIVIPSEERKMDMGPLDFEEFCWAMGEELL
FT                   AETIRKSFERLVPLPDALHKRAMRLWREYLLVGGMPQAVADYVEQRDFGEVDLIKRGIL
FT                   QLYSDDIGKFANGDAGRVRGIFAQIPGQLSKHEKRFTLASVDKGARSREYDSAFFWLED
FT                   ARLVNLCRNSTDPLVGLGLYEDNDSFKCYMADTGLLVSQAFADRETTPDDVYRDILFDK
FT                   LSLNEGMLVENAVAQQFRANGRKLYFFSRLDRADASKTMEIDFLIVREYDNAAMKPRIS
FT                   PIEVKSTKRYGVSSLDKFRKRYAQRLGKEYVLHPRQLEVDGERIKLPLYMAHCL"
FT   CDS_pept        701489..701812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0543"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70686"
FT                   /db_xref="GOA:E8MSE2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE2"
FT                   /protein_id="BAJ70686.1"
FT                   /translation="MLDLIECLKSTGMSLAEIKDFVDMTKQGDATLESRLAVFRNQRDV
FT                   VKRQIAELRRRYIKLDVVITSGASCTSSMKINIPYGSSIFCLVCAECRISKWGFGAKYR
FT                   ISK"
FT   CDS_pept        complement(701941..702594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0544"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70687"
FT                   /db_xref="GOA:E8MSE3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE3"
FT                   /protein_id="BAJ70687.1"
FT                   /translation="MSSTSNNAAVTGNDAVDDVMATSQSAENGTSHDTADGDIKNDVLS
FT                   SFISIGRIMAYRAIHRRLVSPGAKSPRGEHAFDPRRGQGRVLATLRESDQTSQKDLAAM
FT                   FGMSRQAMAELLKKLEASGHISRRPSRRDSRVMMVSLTNQGRKAADLLGKAPDQTSSML
FT                   DCLNETELQTLHGYLQRIIDTSSDDLPASTAEDVKKCELLIEHLKRRRMPTDRA"
FT   CDS_pept        complement(702611..703354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0545"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70688"
FT                   /db_xref="GOA:E8MSE4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE4"
FT                   /protein_id="BAJ70688.1"
FT                   /translation="MNITHDMSNDLTEYDPESRQVDGPNPIENRISSSAARVPDIISCT
FT                   SGITVQGRQLHSFAFTTDAAIIRNTNADAILAVYPFTGEPVITQALLTAAQAPLFVGVG
FT                   GGTTTGPRVIQLAMMAEMQGAAGVVLNAPAPPSTVYDVARITNTPVIATVLTCDDELDE
FT                   KIEAGASIINVAAGRRTPDVVQQIRQRHPSIPLLASGGSTDESMAETIVAGANALTWTP
FT                   PNAQEMQRSMMMRYRGESTGDNMQH"
FT   CDS_pept        703530..704156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70689"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE5"
FT                   /protein_id="BAJ70689.1"
FT                   /translation="MLFDADLSVERLIPALSIESGTRITPEDTLVIFDEVQEVPRAMTS
FT                   LKMFNEAAPEYDVLATGSALGIAMHPGFSFPVGKVSRLKLYPMSFVEFLYACKQYALAE
FT                   MLESKDSPLINVMHDRVMTWLRYFMYTGGMPEIVEAFASTLPNPDFTAVRKLQNSLVSD
FT                   YRDDFSKHVDMRDSPAVTTLRLNQVWDSIPSQLAKENKKFVYGVV"
FT   CDS_pept        704768..706525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70690"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE6"
FT                   /protein_id="BAJ70690.1"
FT                   /translation="MPSHARTVTRTTHRVRNALLVVLLLLVVCAAAAGFSGFKLYKSAM
FT                   SAKAHLNNVVNAAKVIKDGSTDDMVKALSDVSYIQKEAAAAKQDVSGGLWTLAEKMPVV
FT                   GGDVKTARTAIGTIDDFAQTTLPQLGKVVTTLTGASLSSGDGQLNMEPIIAAAQQLATV
FT                   DQSVQSQARTIQDLPDAKLGVVNNALQNGKTQMAALAQVTENLSGMLNMLPNFLGANGA
FT                   RNYVLLAQTNSEIRGTGGLIGSAGSFSADNGKIAVGEFHADAEFPSNAALDDVNQDGDG
FT                   TLYSGLYFGQVIHNLSSTPDFPRVASMAQKFWQAAPFGGSSDGVMSLDPVALQAMIGAT
FT                   GDVTLSDGRVLNGSNTAEFLLNGAYKELTPSAQDQYFSETAAQAVAHLFSDMNTQKLMT
FT                   VAKTMLRMAEQRHLYFWSFHEEDQAVLRSAGVTGEITNDAKNPVTGVYSNEMQASKMDW
FT                   YIQRKSTVKRTGDNTYHVTYSFTNTLQPGEAGSLPEYITANAKGGVAVNRVVIYTPAGG
FT                   EVSNVSASNGSSFAQVQAKDHMTYMDDISLAPQDTVTIEYDVTTAAGSANLKLDQTPTI
FT                   GDPAITYEY"
FT   CDS_pept        706908..709379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0548"
FT                   /product="excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70691"
FT                   /db_xref="GOA:E8MSE7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE7"
FT                   /protein_id="BAJ70691.1"
FT                   /translation="MRGARVHNLKNIDIDIPLGELVGVAGVSGSGKSSLALGVLYAEGS
FT                   RRYLEALSTYTRRRLTQASRAQVDEVLHVPAALALHQRPTVPGIRSTFGTMTELLNSLR
FT                   LLFSRVASHVCPHCGARNESTLNVAAGLPITCAGCGKEFHAPGAELLAFNSAGACPTCS
FT                   GTGIVREVNRAALVPDESKSIDDGAVLPWGSLMWDLMKQVCGAMGVRTNVPFNELTPEE
FT                   RDIVFNGPAVKKHILYKPKKGDDFAELDFTYFNAVYTVENALAKAKDEKGLKRVARFLK
FT                   EGPCADCGGTRLSVAARAPHVRGLNLAEAGAMTLDAAADWVRGVPESLPADMRPMAANI
FT                   CESFLDVARRLLDLGLGYLALDRAGATLSTGERQRVQLARAVRNRTTGVLYVLDEPSIG
FT                   LHPSNVDGLLGVMHDLVADGNSVVVVDHDVRVLKACDHLIEMGPVAGAEGGHVVTQGTV
FT                   GEVAANPSSRIAPFLSDQVSARIRERVAESQVFSLGHIRMTTSQLHTVKPLDVDIPRGR
FT                   LVAVTGVSGSGKTTMVLESLIPALKAQAAGELLPEHVRELETEGIRRANLIDATPIGAN
FT                   VRSTVATYADIHDELRRAFARTDDAKAGGWKAGDFSYNTGRLRCPTCDGTGLISLDVQF
FT                   LPDVTIECPDCGGSRYAPEAGAIRRAVKGESHLSLSLPQLMAMSVDQALSVTGDLKKVH
FT                   ARLTTLHDLGLGYLTLGEPTPALSGGEAQRLKLASEMGKAQLNAVFVFDEPTIGLHPLD
FT                   VRVLLGVFDRLVVSGATVVVIEHDLDVIANADWIIDMGPGGGESGGRIVATGTPEQVAA
FT                   NPNSITGRYLR"
FT   CDS_pept        709437..710795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70692"
FT                   /db_xref="GOA:E8MSE8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE8"
FT                   /protein_id="BAJ70692.1"
FT                   /translation="MVQIHGIRRASADAKYRQMTGQPVKPLILKLCLPAVISNLVTTAY
FT                   NLTDTFFIGQLGTAQSGAIGIAFSIMTVMQALGFFFGNGAGNSMSRELGKQNNDRASRL
FT                   LAVGFAGAVISGLVIATIGLLTLRPLVVMLGSTSTIAPYAVQYLTPLLVAAPCVCGSFA
FT                   LNGLLRYQGQSTFGMIGLVSGALLNFLLAPLFIFVLHLGIFGAGLATAICQTVSFTILT
FT                   TMSRKFGVMKLSLRNCRPDVLLMREVAGGGLPSLIRQGAGSISVTCVNIAANPFGDAAI
FT                   AGMAIVMRIMLGANSVIVGLGQGFQPVCGYNYGAGLFARVKEGYWFCVRLATCVLVVLA
FT                   VLLWVFAPQLVEIFRSDPAVVAVGVAALHIQCCTVILNGFNMMGNMMTQTMGRTGIASF
FT                   LALCRQGLFLAPIVLILPMMFGVLGVEMAQSVSDVLTFLVTIPFMRRILHELR"
FT   CDS_pept        710812..711495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0550"
FT                   /product="putative endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70693"
FT                   /db_xref="GOA:E8MSE9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSE9"
FT                   /protein_id="BAJ70693.1"
FT                   /translation="MNNRSAKRVPGVPSPAYIESLYRTMAAALGPTGWWPAETTFEIMV
FT                   GAVLTQNTAWGNVNRSLAALNAEGVLEPHKLAIMGPAHLQELIRPSGFYVNKSKTVQSL
FT                   SRWYVERCGASPEGAADIPDAELRTELLGLFGIGGETADDLMLYVFSRRTFVADTYARR
FT                   LFAFLGFDVPTGYLAFHKAYSPVVLDASLSVKDLQEFHGLIDEFGKAYRDDAAKSESFL
FT                   GGWRA"
FT   CDS_pept        complement(711669..711956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70694"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF0"
FT                   /protein_id="BAJ70694.1"
FT                   /translation="MSVELFCHRLVFDTQHRAQPVKFGGNLGVMHGDDATAIGVVDLLG
FT                   GERIAGVTGITVKAGATVQVIDRNPDKAAAAAAEGVTNQTPWTSGFKVVK"
FT   CDS_pept        711984..712103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0552"
FT                   /product="truncated acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70695"
FT                   /db_xref="GOA:E8MSF1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF1"
FT                   /protein_id="BAJ70695.1"
FT                   /translation="MMTEDKPIAKPIIDDATREKMALMFSGEVYLPDDVDGFF"
FT   CDS_pept        712081..712575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0553"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70696"
FT                   /db_xref="GOA:E8MSF2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF2"
FT                   /protein_id="BAJ70696.1"
FT                   /translation="MMWTAFFDLQAAQRDLQLELNATPLTNPKRRTELMQAFFGAAGEG
FT                   LYLECPVYANWGCNTYWGERCYANFNLTLVDDGEIFIGSHTMIGPNVTLVATGHPVRPD
FT                   LRYQGAQYSLPVHIGENVWIGANVTVLPGAPSGTTRSLAPTRWSPRTSPPTRSPMAARA
FT                   R"
FT   CDS_pept        complement(712668..712931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70697"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF3"
FT                   /protein_id="BAJ70697.1"
FT                   /translation="MLPVLREHHYTYCIPVISGRNVWVGANVSILPGVTIGDNCVIGAG
FT                   SVVTHSIPANSVTYGAPCEVVREIGDKDREYFYKNRKLDVWE"
FT   CDS_pept        713096..714184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0555"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70698"
FT                   /db_xref="GOA:E8MSF4"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF4"
FT                   /protein_id="BAJ70698.1"
FT                   /translation="MGQFGVMIGQLVGFLIMLMVGYGCVRLRFYGQTALDGMCSLLLNV
FT                   LIPVLVFSNAVDGADRAQLASNWGVMLLTAVMYALLILVFWLVAELLRLKGSRSHVFQA
FT                   SLIFGNAGFIGIPLIMALWPQNGAIYVALMSIIDQTLLWTYGVWLCEPVDETTGGNAIG
FT                   ARGAVVNGSVNGAGSVGNAGSASNAANGGSPAIVRPSPGTRVLGLLKRFVNPAFVGVML
FT                   ALILILLGVKVPDIILKPLHTIGNMATPMSLIYLGGLFALTKWWGVLKRYELYVGLVAK
FT                   MIAFPLAFYALLTALTGALPQLPIVHDMVLMITVIAGLPTMTTIAMFTGRKNNMPEYAV
FT                   GFVLVSTLFSLASLTIVSAVVF"
FT   CDS_pept        complement(714331..714453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70699"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF5"
FT                   /protein_id="BAJ70699.1"
FT                   /translation="MRIGNDRHFLITVASQCMPYIGYPRTLNALRCVDEAANSM"
FT   CDS_pept        complement(714474..714716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70700"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF6"
FT                   /protein_id="BAJ70700.1"
FT                   /translation="MLGSQSLTEFRGIVPAAMIAGLTPVKIKEATYQAVAYLGIARIYP
FT                   FIVALNEVLRAQGVKLPLPSQSTSSLPPRVGASRN"
FT   CDS_pept        complement(714958..716394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0558"
FT                   /product="glutamine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70701"
FT                   /db_xref="GOA:E8MSF7"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF7"
FT                   /protein_id="BAJ70701.1"
FT                   /translation="MTELKSKEDVEALINKEGIEYVSVRFTDLIGVQQHFTVPASEFLK
FT                   DAFTDGMPFDGSSVQGFQAINESDMKLVPDVETSFVDPFRKHKTLDVAFSIVDPLTDEP
FT                   YSRDPRQVAGKAEAYLKSTGIADTASFAPEAEFFIFDKVRFENSMQRSFYEVDSIEAPW
FT                   NSGVDVEEDGTPNIGFKNRVKKGYFPVPPIDHTQDLRDDMVANLQKVGLILERSHHEVA
FT                   GAGQQEINYRFNTLQHAGDDLMKYKYVVHETAALAGKAATFMPKPIADDNGTGMHCHQS
FT                   LWKDGKPLFYDEKGYAGLSDLARWYIGGLIKHSSSVLAFTNPSLNSYHRLVPGFEAPVN
FT                   LVYSARNRSAAIRIPLAGTSPAAKRIEFRAPDPSCNPFLAFSAQLMAGLDGILNHIEPP
FT                   EPVDKDLYELPPEEHAGIKQVPSSLAEAMDALEEDHDFLTAGDVFTDDLIETWIGLKRD
FT                   EIDQARLSPTPLEYELYFHI"
FT   CDS_pept        complement(716714..717496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0559"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70702"
FT                   /db_xref="GOA:E8MSF8"
FT                   /db_xref="InterPro:IPR025445"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF8"
FT                   /protein_id="BAJ70702.1"
FT                   /translation="MAEKDAKPKKQSTIKQIIQIYKYTAKEDKALPWLEAGAFLLPVVV
FT                   MIIIGLIAKWTWLTWIFTMITAIMLGMLLATMMLTRRADAVGYKQIDGKPGAAIGVLSN
FT                   MQKAGFNFPQEPVWIDPKTKDAIWRGTSMNGIYLIGEGEYGRIMKAMDRQEHDIKGVTA
FT                   GSSIPVYRISVGHGPKQVPLDKLRSTVTKSKSYEPTNHKNALIAKIHPRRRFLLTKAEM
FT                   ETLNDRLRTLQAKKGYAIPKGMDPNHPQKISRRAMRGR"
FT   CDS_pept        717649..718755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0560"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70703"
FT                   /db_xref="GOA:E8MSF9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSF9"
FT                   /protein_id="BAJ70703.1"
FT                   /translation="MGQQYSHLSSEERILIEKLHCEQHLSIRRTAERIGRDKSTVSREL
FT                   RRGLWFASNENGSYRPYRPKRLKTGPWTSGPFYSALAAQRKADLRRRGSRKPRRMDSGP
FT                   LRAWVLDALRRGWSPELIEGRLKAQCAGDPSMRISHECLYQWIYAKPQRALDLRQYLAR
FT                   GRKRRTRKKGRKAKGPRIPMRVPIADRPEAVGSRKGFGHFESDTVVGAAPSRRCMNTQV
FT                   ERRSRRLFARLVDDKSASATARAEYEIFKGMPPAARVDRTWDNGTEASLHVLVDEALGM
FT                   LTYFADPYSSWQRGSNENRNGRIRRYLPKGTSFEDLTQDELDAIVGEINDTPMKLLGYK
FT                   TPNEVWDEEMAKLQSKQADPKPAVALTS"
FT   CDS_pept        complement(718778..720268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0561"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70704"
FT                   /db_xref="GOA:E8MSG0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG0"
FT                   /protein_id="BAJ70704.1"
FT                   /translation="MSEQFDLVIIGAGPGGYSTALRAAELGMKVALIERDATVGGTCLN
FT                   RGCIPSKALITATHTIDTVHRAAELGVNASVNGIDFGTLRDYRLRVVKTMVGGLAGLLA
FT                   HRGITVFRANAAFHADETAPATSNHIVHLVPSPDQSDILTYHKADVPEPSGPTMDLTAT
FT                   NIVIATGAKPRPLPGNPFAGALIDSTQALEVNEFPSSAVIIGAGAIALEFASMWNAAGS
FT                   KVTLLIRKDRVLSAWDRRAGTTLTRELKRHGVNIITRASVTHVDTGANLGATVHYTREG
FT                   QDGEQSVWGEIALVAIGRDPITDPAWGVTIDDHGHVATDAYGRTDKPGVWAVGDVTAGH
FT                   ALAHRAFEQGIVIAETIAGLNPKPVDEATVPQIVFSFPEAASVGLTVEQAQAREDLIEI
FT                   KETNYPMLANARMLMSGTAGSLTIVSGCDAANPDTPRVLGVHMVSQMASDIIAEAEQLV
FT                   GNHVPLADAARLVHPHPTFSETLGEALLKADGRPLHTR"
FT   CDS_pept        complement(720416..721039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70705"
FT                   /db_xref="GOA:E8MSG1"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG1"
FT                   /protein_id="BAJ70705.1"
FT                   /translation="MTWNPFRKKEEAQVPVEQAPKKTADPSEKKGRPTPKMKQAQAAGI
FT                   RPLVPVDRKASAKAAKARLREKENAEYEAMQKGDINHMPKAERLPWRIYIRDYVDARFN
FT                   LGEWFIPVAFAILIVSMFVTSLMQNQWASIIMMALMYGYLIAVIIDVWLMWRKLKAKLI
FT                   AKYGEQSVSKGSRSFSYAWSRSIQMRRWRLPKPRYPKRGHWPAD"
FT   CDS_pept        721143..722510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70706"
FT                   /db_xref="GOA:E8MSG2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG2"
FT                   /protein_id="BAJ70706.1"
FT                   /translation="MATLTADEIRSRVETDWNRIVKVLAEKVALQSISAKGITAEHMKR
FT                   SAEFVADELRLVGVDAKVVQASNADGTPGAWEVIGSHIVSPDAPTVLLYAHHDVQPVPD
FT                   PAEWNTDPFVATEIDGRLYGRGSADDGGGIAIHSGALKALGDDLNVNIKVFIEGEEEMG
FT                   SPSFIPFIEAHRDEFAADVIIVADSGNWSADIPSLTTSLRGNTCVDVTVQGLEHPVHSG
FT                   QYGGPILDSNTLAAMLIASMYDENGDLAVAGVAVEEPIGGLQRDLDETTVREDSGVVAG
FT                   YEFAGTGSLASRLWTKPSVTVIGFDAHPVEGSFNVIAPETRFRLSLRTAPTQRPEEAQE
FT                   ALAAFLESHAPFGAKVTVERGENGMGWAMDPTAVATKDALEAMTEAFGVEPINKGEGGS
FT                   IPFIPELQRIFPNAQVLVTGPEDPKANAHSPNESISLPGLKNNVITEALLLDKLGK"
FT   CDS_pept        722810..723409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0564"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70707"
FT                   /db_xref="GOA:E8MSG3"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG3"
FT                   /protein_id="BAJ70707.1"
FT                   /translation="MTEAVAKANYKWRVVDIVVAAIIAVASGVIFWGWDIVCSAPLALF
FT                   EGVTPGFEGLLNGFWLFAGPLAAIIVRKPGAALFAETLAAFLELTLGNQWGVGGSLIVG
FT                   IIQGLGAEIAFAVFAWKKWNIGTTILSGALAGVGCWAYYWATNPGWNGLRVTWYLVGSI
FT                   ISGVVIAGVVVWYLSRALAATGALERFESGRSKARV"
FT   CDS_pept        723409..724884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0565"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70708"
FT                   /db_xref="GOA:E8MSG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG4"
FT                   /protein_id="BAJ70708.1"
FT                   /translation="MQVNPAAVEASGWGWRHATRKDFALRAVDFTIRPGERVLLLGASG
FT                   AGKSTMMAGLAGVLGGDEEGEQEGSLTIDGVDAREARGRVGLVLQDPDSQIILERLGDD
FT                   AAFGCENLNVPREEIRQRVRESLDMVGLGGLELDRSTRHLSGGQRQRLALSGVLAMKPG
FT                   LLLLDEPTANLDPEGVVEVHDAVKKVIEATGQTMVVVEHHIDVWLDLVDRVIVLGRPDA
FT                   SSPTGAVIADGKPDEVFAEMGDVLAAGGAWVPGRAIPDYSPKREPAHDAPVLSTENLSF
FT                   GRGTALGVGINLDFYPGEVTALMGPNGAGKSTLALTLAGLLEPIAGKVLIADNLKPAHA
FT                   GREPIDWKSKELLGRIGMVFQEPEHQFAANFVRDEVAIGPKSMGQSQDEAYRTADRMLE
FT                   QMNLTRFAKANPYTLSGGEKRRLSVASMLAAAPKVLVMDEPTFGQDFSTWNEMVKLIAA
FT                   IRDQGSCVVMVTHDEALVDALGARRVMFEEAKA"
FT   CDS_pept        724881..725708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0566"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70709"
FT                   /db_xref="GOA:E8MSG5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG5"
FT                   /protein_id="BAJ70709.1"
FT                   /translation="MSDVVTVSPQETRVEPVKASSPSWFIARINAVSRIIGALLLCVPM
FT                   FISLDVVSASTALGIEFVLLWIGGVAPWTVCRKTWPVWIAAAGSFISVFLYGRTSGEIL
FT                   WQGGWIVISEGSVNLAIATAIRVAAIAVPGVILALGLDPTDLADGLVEILHFSPRFVYG
FT                   GLAGLRMFTLLQEDWRALGLSQRSRGLGDGNAIARALSQAFGLLVLSIRRATKLATAME
FT                   ARGFGSGAPRSQARISRLKPIDWIFYVICLAVPLASIGVAVGTGNWHFAFQGV"
FT   CDS_pept        725904..726782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0567"
FT                   /product="putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70710"
FT                   /db_xref="GOA:E8MSG6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG6"
FT                   /protein_id="BAJ70710.1"
FT                   /translation="MPINAQILDNPKSDRVRRIADLTRAKGRERSGRFLIEGPQSVREA
FT                   VTWRPDVVQDLYVEVSQALEHPRIISSTLEKIVETSQDATIYVHYCTGDVMRRISPDAQ
FT                   GIAAVGNAESMHAGADDVELGKNGRAPQIAAFWQVRDPGNAGTVIRAADAAGCDAVIFV
FT                   DDCVDVLNPKVIRSTAGSLFHLPVLAMSTDEFFTWTGDHNMDVWAADVYGTEERKPESL
FT                   PAVLADKAAVEAPKAVLFGNEARGLEPDILTRCGRIVSIPLYGKAESLNLGTSAAVMLM
FT                   SLSMSGHVERM"
FT   CDS_pept        726848..727903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0568"
FT                   /product="phenylalanyl-tRNA synthase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70711"
FT                   /db_xref="GOA:E8MSG7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG7"
FT                   /protein_id="BAJ70711.1"
FT                   /translation="MVFDADQVTAEVAEGIEKIQNASNLEELKAIKTTYAGADSAMTKA
FT                   SKAIGSLPADQKKEAGKLMGKLRADFGRAYGPKEVELKEAAEKAALAAETVDMTLPVSR
FT                   KPLGARHPLPKLMEDVEDFFISMGWQISSGPEIEAEWYNFDSLNFGPDHPARQMQDTFY
FT                   VKGNQAKDAAGFVGSNMVVRTQTSSDQVRALLTRGVPLYIASPGRVFRTDELDATHTPV
FT                   FHQCEALAVDKHLTMADLKGVLDKLAVAMFGPEAKTRLRPSYFPFTEPSAELDLWFPDK
FT                   KGGPGWLEWGGCGMVNPNVLKSAGIDPDVYTGFAFGVGMERTLLLRSDINDMHDLVEGD
FT                   VRFAEQFVMGE"
FT   CDS_pept        727911..730520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0569"
FT                   /product="phenylalanyl-tRNA synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70712"
FT                   /db_xref="GOA:E8MSG8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG8"
FT                   /protein_id="BAJ70712.1"
FT                   /translation="MPMIDIDWLKDHVEVPEGLTYEQLAKDLVKVGLEEEEIHSSQVTG
FT                   PIVVGYVVDATPEPQKNGKTINWCHVDCGDEWNETDEDGNKVPRGIICGAPNMKAGEKV
FT                   VVTLPGAVLPGDFKIEPRKTYGHISNGMCASERELGLGDNHNGIILLRQYGFSEAEYEA
FT                   LKPGQDAMHLLHLDQPLLEINITPDRGYTLSYRGVAREYHHSTGAAYTDPAVALNEKAP
FT                   EPADYQPGTPVDIDVEIDDNNPIHGVPGCDRYYARIVKDFNPNAHTPNWMRRRLIRAGM
FT                   RSISLAVDVTNYVMLDLGQPMHAYDLDKLEGPIVVRRANEGEKLTTLDGKEHDLSVEDL
FT                   LITDSPNGERGSRILGLAGVMGGLYGEVTADTKNILLEAAHFDQVTIARSARRHKIPSE
FT                   ASRRFERGVDTALQPAATQMAAELMAKYGNGEPSEHPNDVNNTPRAKAIHFKASEVARV
FT                   AGLDVDINRISDILTDIGCTVAGGGNGEFAVTAPSWRPDLNEPCDLVEEIARLVGYDQI
FT                   PITVPPAPVEGLVGLTPDQQRRRRVADELAEFGMVESLSYPFVGDDDYKAFGFDPEATK
FT                   KVSVEIANPLYGDRPYLRREILPTLATTVQRNIRRGIENVSLYELGHVYLWDPNAPVIP
FT                   ALPGGVRPTDEQLAALDAGLPEQPDHVAGILTGLAEDDGWMGGKRPVDWSDAVEAVRRI
FT                   AGRIGAAIELDQPAADDVPVQWHPGRAARVMVGDVFTGWVGELHPRVNEALGFPAHSAA
FT                   FELNLTALFAMLTGKPVQAKPISTFPPVKQDLAFTVDETVTAGQLENVIRKAAGANLES
FT                   IELFDVFTGEQVGEGKKSLAYAVVFRSPSKTLSAEDSDAIRKAIVAEAAEIGAQLRA"
FT   CDS_pept        730551..731237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70713"
FT                   /db_xref="GOA:E8MSG9"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG9"
FT                   /protein_id="BAJ70713.1"
FT                   /translation="MSQAEQDKPKYGQYQQPEYGAMSGQYGPNYNPYIYGAPEPDTKKD
FT                   SAAAAGDNGGAAQSQQAGQPYGQQPAWPGNQQAGGWPYAQGGQQSGPGAYPGGYPGMQG
FT                   QPYGQQPNGQPHQPHYYHGIDLNDPNQNPLYGHWDSYAIISFILALFFPVPVLSALMGA
FT                   VAMWRTRTFHMKGFGLAVAAVVINVLYTIAVIWMAFNGYDAMSLYQEALQQLTGGTGSS
FT                   SDSISA"
FT   CDS_pept        731351..732430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0571"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70714"
FT                   /db_xref="GOA:E8MSH0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH0"
FT                   /protein_id="BAJ70714.1"
FT                   /translation="MAVAGATGYAGGEALRILAAHPDFDITCVAGHSSVGESMAKHMPH
FT                   IPQLANLVVEDTTPEVLNGHDVIILALPHGASGKLASQLDPNAVVVDLGADHRLEEQAA
FT                   WDEFYGGDFYEHWTYGMPELITGKAADGSYTRQRAALPGTKRIAGPGCNVTATTLALQP
FT                   GIAEGLVESQDIVADLVVGYSGAGKNLKRTNLLAAEALQSALPYSVGGKHRHIPEILQN
FT                   FAHAAGKSAAEASEFTLGFTPILAPMSRGILATVSARMTDKAKTLSDEEIRAVWSKAYE
FT                   GQDFMVLLPEGTLPATGNIIGSNAAHLQVVTDRKAGRIYAFAAIDNLNRGTAGQAVQSL
FT                   NIALGLPEDAGLTKIGVAP"
FT   CDS_pept        732427..733602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0572"
FT                   /product="ornithine acetyltransferase/N-acetylglutamate
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70715"
FT                   /db_xref="GOA:E8MSH1"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH1"
FT                   /protein_id="BAJ70715.1"
FT                   /translation="MSVTFAQGFSAAGVAAGISSVEGKKDLALVVNNGPLDAAAGVFTS
FT                   NRFCAAPVQWSRKVVADGHVKAVILNSGGANACTGEAGYAQSVATAETVAGLIGAEPND
FT                   VAVCSTGLIGELLPLDNVLAGAKSAHEALAATAEAGTDASHAIMTTDTKPKTVELTGSN
FT                   GWKIGGMVKGSGMIAPQLATMLCVITTDAVVSAGQMQAALAVAAEHSFNRIDVDGCMST
FT                   NDTVLLLASGASGIEPDKDEFNKLVREACASLSRQIIGDGEGASHDIRITVTGATSEDA
FT                   ALACGRAVAASNLLKCAISGNDPNWGRIVSSLGTVPPEVAPYDSNKVTVDVNGVRICEN
FT                   GGAGRDRSEVDMTPREVHIDIDLNTGSDAEATVWTDDLTHEYVHINADYES"
FT   CDS_pept        733713..734630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0573"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70716"
FT                   /db_xref="GOA:E8MSH2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH2"
FT                   /protein_id="BAJ70716.1"
FT                   /translation="MHTDLRADQKAEVLIEALPWLEEFAGQRIVVKYGGNAMVDDHLKQ
FT                   CFAEDMVFLRQVGLHPIVVHGGGPQISHMLKALGIKSEFKGGLRVTTPEAMDVVRMVLT
FT                   GKVSRELVGLINAHGPLAVGLSGEDGGLFSAMQRRPIIDGKSTDIGLVGDVVSVDASAV
FT                   EDLVAAGRIPVVSSVAPNEEDATEVLNVNADSAAAALAAAVGAHKLVILTDVDGLYADW
FT                   PDKNSLIGRIGVETLRDMLPDLESGMRPKMEACVRAIDGGVPQAHIIDGRKPHSILNEI
FT                   FTSAGIGTMVMPDEGLEMRSSYGY"
FT   CDS_pept        734620..735915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0574"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70717"
FT                   /db_xref="GOA:E8MSH3"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH3"
FT                   /protein_id="BAJ70717.1"
FT                   /translation="MATEHEEKLGTEDSKWLGEYSQVHMNVFGTPLRVMDHGQGAHIWD
FT                   VDGNEYLDFLAGIAVNSLGYAHPKWVKAVADQAAKVAHISNYFASEPQIELASKLVKLA
FT                   GAPEGSKVYFGNSGAEGNEAALKLAKLYGRTLPGALPSIGGKPARILAMTHGFHGRTMG
FT                   ALSATWKPGIRKPYDPLVPNIEFVRAGDKVALHDAFAQTGLGRYGKGPVAAVILELIQG
FT                   EAGVQPLGADYVKFVRELCDINHALLIIDEVQTGIGRTGKWFAFQRDDLSGGVTPDMVT
FT                   FAKGVAGGFPMGGMIAFGEKLAALFTPGSHGSTFAGNPLGAAAGLATLDVIEDENLVAN
FT                   AEARGEQLRDGIMATGNPLFVSVRGRGLLDAVELKHPCSHAVMNYCLEHGLIVNAVAPN
FT                   ALRFAPPLIVTAQDVDQALAILKDVPTDLPDD"
FT   CDS_pept        735959..736924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0575"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70718"
FT                   /db_xref="GOA:E8MSH4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH4"
FT                   /protein_id="BAJ70718.1"
FT                   /translation="MTPELRHMLRDDDLNHEEQKQVLELAIKFHHDRFYKQPFAGPQAV
FT                   AVLFDKPSTRTRSSFSIGVAELGGYPLVIDKSGSQLGRGEPVADTARVLNRMAYGVVWR
FT                   TFGQGRVEEMAKYSTHPVVNALTDDFHPCQILADFQTIAEHRGGVDNLKNQTIAYLGDA
FT                   ANNMANSYLLGGAVAGMDVRVAGPYGYLPRPDIVADAKRIAAETGGSILVTTDAKEAVK
FT                   DADCVFTDTWVSMGEEAEYAIRSKPFWDYQVNTELMALAKPDALFQHCLPAYRGKEVTA
FT                   EVIDGPQSVVWDEAENRLHAQKALLTWLTGKARGDESLLA"
FT   CDS_pept        736921..737433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0576"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70719"
FT                   /db_xref="GOA:E8MSH5"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH5"
FT                   /protein_id="BAJ70719.1"
FT                   /translation="MSETGPSLQRPASRAARLSAIEQALATHIITSQSQLSKILIDEGI
FT                   AVTQATLSRDLDEMHAVKTRLKDGTVAYTVGRSVVASEGEDVGERGEAQMSRVLNGLVT
FT                   SVAAARNLVVVHTPSGAAQYVASVIDKQSIEGVLGTIAGDDTVMVICTNDDTAVFRSDW
FT                   LLSLASK"
FT   CDS_pept        737516..738754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0577"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70720"
FT                   /db_xref="GOA:E8MSH6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH6"
FT                   /protein_id="BAJ70720.1"
FT                   /translation="MADNKRIVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGES
FT                   LETIKQRALACGAVESYVVDARDEFANEYCMKALKANAMYEGVYPLVSAISRPLISKHL
FT                   VRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLKAISPIRDLSLTRDVEIAFAKE
FT                   HKLPITQTEKSPYSIDQNVWGRAIETGFLEDPWNGPTKDCYSYTDDPAFPPVEDEVVIE
FT                   FKEGVPVKIDGRDVTPLQAIEEMNRRAGAQGVGRIDLIEDRLVGIKSRELYEAPGAVAL
FT                   ITAHQELENCCLEREQHRIKRDIDKRWGELVYDAQWFSPATQSLNAFIEDTQKYVSGEI
FT                   RMVLHGGRAVVTGRRSDSSLYDYKLATYDSGDTFDQKSSNGFIDIYGLPSRVAAARDVK
FT                   FGNGIEVPENTVE"
FT   CDS_pept        complement(738971..739189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70721"
FT                   /db_xref="GOA:E8MSH7"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH7"
FT                   /protein_id="BAJ70721.1"
FT                   /translation="MKPWIANKSDCLSDYQRWATYRWIQVVRIPWRQCQGYRSRRIDEK
FT                   NRIVYRITGNDVQNLEIAVCRTHYGEH"
FT   CDS_pept        739199..740671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0579"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70722"
FT                   /db_xref="GOA:E8MSH8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH8"
FT                   /protein_id="BAJ70722.1"
FT                   /translation="MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIAGSR
FT                   AHARALGRAGLLTADELQRMEDALDTLQRHVDDGSFAPIEDDEDEATALERGLIDIAGD
FT                   ELGGKLRAGRSRNDQIACLIRMWLRRHSRVIAGLLLDLVNALIEQSEKAGRTVMPGRTH
FT                   MQHAQPVLLAHQLMAHAWPLIRDVQRLIDWDKRINASPYGSGALAGNTLGLDPEAVARE
FT                   LGFSRVTDNSIDGTAARDLVAEFAFVAAMTGVDISRLSEEIIIWNTQEFAFVKLDDGYS
FT                   TGSSIMPQKKNPDIAELARGKSGRLIGDLTGLLATLKGLPTAYARDLQEDKEAVFDQVD
FT                   TLEVLLPAFTGMVRTMHFDGDRLEEEAPTGFALATDIAEWLVKNGVPFRHAHELSGACV
FT                   KLAEGRGQELWDLTDNDFIETFAAFLPADKAPGVREVLSSHGSVDSRNGKGGTAYGRVR
FT                   EQIADAKAEVEELKLFPASTSDGSAYKAPGTF"
FT   CDS_pept        741020..741214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70723"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH9"
FT                   /protein_id="BAJ70723.1"
FT                   /translation="MQVNGEQVTLETPVSVADYLEAHGFRAERVAIELNGEIIPRDKRA
FT                   DAMLDDQCVMEIVQFVQGG"
FT   CDS_pept        741226..742095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0581"
FT                   /product="thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70724"
FT                   /db_xref="GOA:E8MSI0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI0"
FT                   /protein_id="BAJ70724.1"
FT                   /translation="MSNINPVTEASVEATPLPPQPAVTNPVGTAAPILPVEDKPLNLGG
FT                   HEFQSRFILGSGRYDLNLIKATVEHAGTQIVTMALRRAQTTENSVLDYIPEGITLLPNT
FT                   SGARNAEEAVRIARLAREVCHTDFVKVEIEHETKYLLPDNAETIRATEMLAKEGFVVMP
FT                   YMFPDPIAARQLEEAGAAAVMPLGSLIGSNMGLRMRDFIEIIIANAHVPVIIDAGIGRP
FT                   SQACDAMEMGADAVMAYTAVASAGNIPLMAEAFKHAIDAGRAAYLSGLGKVTEGQAVPS
FT                   SPTTGYLH"
FT   CDS_pept        742172..742981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0582"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70725"
FT                   /db_xref="GOA:E8MSI1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012731"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI1"
FT                   /protein_id="BAJ70725.1"
FT                   /translation="MALTDEQVERYARHLILKGVGVKGQKRLLASSVLIIGAGGLGSPA
FT                   ALYLAAAGVGHIGLVDGDVVDMSNLQRQIIHTTARVGAPKVESAATAIRALNPDVTVDT
FT                   YYELVDASNIAGLIEPYDLVIDATDNFAAKFLINDACVLAGKPYIHAGVVGFAGQVMTV
FT                   IPGEGPCYRCIFRDLPAAGEIPTCKEAGVLGAVVGVIGSLEATEAVKLIAGVGEPLVAR
FT                   MLTVDALTMNIRRVPLPKHVPDCPVCGEQPTITAIDPANYIQPACAI"
FT   CDS_pept        743038..743394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70726"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI2"
FT                   /protein_id="BAJ70726.1"
FT                   /translation="MPIALHNAVDDDESSEASYRRITPAEFAKLDPNTVTLLDLREPAD
FT                   FAAHPVEGAINAPLDPLAHVLKTVPTDRTVVVYCAQGWWSEEVAEILADRGYDVASLDG
FT                   GFQGYLDYLETHHD"
FT   CDS_pept        743556..744089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70727"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI3"
FT                   /protein_id="BAJ70727.1"
FT                   /translation="MGHLLTRTQIQRLVAKHGREVIEHRHMQIERCCYQHGNVTTFEHS
FT                   VRVACLAVWMADRAHLWYRVDLKSLIRAALLHDYFLYDWHDWDNGEHQWHGFTHGHAAL
FT                   VNALKDFKLNDIERNSIENHMFPMTPVPPRYIEGYLVTLADKCSATAETFSFDRFNKRA
FT                   LPAAKPYAEIEARR"
FT   CDS_pept        744086..744853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70728"
FT                   /db_xref="GOA:E8MSI4"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI4"
FT                   /protein_id="BAJ70728.1"
FT                   /translation="MIITLEHYFLWFLFYSFVGWMYESILVSCQQHRLVNRGFLNGPLC
FT                   PIYGTGAILGVAILGNVHNPIIIFLISMVGATILEYTTSWVMEQLFHARWWDYSNFRFN
FT                   LQGRVCLLGALIFGLGGVGVVLGSQPYVERVTDMIPLPMLHTLVTVLALITIIDLAVTV
FT                   AGMLEFERVLDSVSQVVQDVAARAGGTWQWGSSAVSDRMRELSQDTVERLRWAVNGVIN
FT                   AQQKRMLKSFPKFQVPDRQDIIDSLRELMGPRR"
FT   CDS_pept        744979..746301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0586"
FT                   /product="tyrosyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70729"
FT                   /db_xref="GOA:E8MSI5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI5"
FT                   /protein_id="BAJ70729.1"
FT                   /translation="MAHVTDFKEAGFNTLLEELEWRGLISQSTDRDRLAEALNGEPITY
FT                   YCGFDPTAASLHIGNLVQLINMRHLQLAGHHPIALVGGATGLIGDPRQSGERTLNPKDV
FT                   VAGWADRLKNQIGGILDTEGANAVRFVSNYDWTASMTVIDFLRDVGKNFRLGTMLAKDT
FT                   VARRLNSEEGISFTEFSYQVLQGNDFLHLFDEYHCTLELGGSDQWGNLTSGLDLIHKVR
FT                   GVDVNVFTSPIITDASGKKFGKSEGNAVWLDATMLSPYKFYQFWINRPDVEMESLLKAF
FT                   TFLPKAEIERLVEESKTNPGKREAQKTLAWEVTSFVHGEAATQAAIDASGALFGRGGNL
FT                   EDIDEETLESVLDGFKVVDENGEHVFPVSKPGDRVIDAAQAAGLFKSASEARRAIKSGG
FT                   VYLNNNRIEDEEQVLAEADFLAGRFALIRRGKKALGAVENR"
FT   CDS_pept        746329..748116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI6"
FT                   /protein_id="BAJ70730.1"
FT                   /translation="MAEGNERSGKSYGGGHKGYGDRRPGNRGGKGFKPRGKGGFKPRHD
FT                   GEGFKPRRREDGEGYAPRRDGDGEGHGGYRKSYGKSGGFHKGGRSGFGGKGGYRGNGPR
FT                   RDGEGFKPRREGGYRSHEGENGENPRYQHRDNDRRDFRRDGERRSFRRNDDRRDFRRDN
FT                   RRDGDRRDFRRDNDRRDFRRDDRRDNDRRDFRRDGERRNFRRDDDRRDGDRRNFRRDDR
FT                   RDDRRDFRRDDRRDNNRRDGEFREFSQEEKRQYREEKRSEYMRRPRRNSDGTMSFPSQN
FT                   PYTDRRPDEPKMPKGMEWSMLSKDERERLRGLSKEHAENIGLHILAAFALEESDPELAL
FT                   EHAKWVARQASRIDFARETLAFVAYRQGDYKLALREFRTAYRMNGFLDYLPFIADCERG
FT                   VGEPKKAVELALSDEGKQLHGAPKVEMFLVYAGALGDLEMWDKAIEVVHTVGRSQGLPG
FT                   EYRMRAVQAEQYFLEEAGRSKEAEQLNDLLDRLEDQYADEEIDENSDDVVIDHDLEDIT
FT                   DDSDVLEKLGIDPDEAQYAPDPEQEYGDEDDEAEDGDAESDEADETETDSANDAEADDS
FT                   AESADSDSTEPETETETEE"
FT   CDS_pept        748125..749165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0588"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70731"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI7"
FT                   /protein_id="BAJ70731.1"
FT                   /translation="MTRFLKGTDRPLAEAYQLALLDLDGVVYRGKNPVEYAADSIRAAE
FT                   AAGMTIEYTTNNSSRFQHVVADQLKGFGLDVEPWQVITSSVVAARVVAKALPAGARVQV
FT                   LGAEHLRDEVTRNGLTIVDGPQDRPQAVIQGWYPDMTWQMMADAAFAVEAGATYFVTNR
FT                   DLTIPRELGIAPGCGSMIRAVITATGVEPVASAGKPEAYMYDEARELNAAEGHDLVPKE
FT                   ASIAIGDRLDTDIEAGNRGDYDSLAVLTGVTNPTELMLAPAHLRPTFIALDLRELGEAQ
FT                   PEPVRDESGTWECRKASAWFENGQVHVSDPTSMDGLRAAVCAAWEAADQGAQLSEATVP
FT                   VFAIEA"
FT   CDS_pept        749170..749316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70732"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI8"
FT                   /protein_id="BAJ70732.1"
FT                   /translation="MPTDSEHAPVTERYPELADIDEQDNDRKLETYRNVLESLQHELDN
FT                   SRS"
FT   CDS_pept        749422..750195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70733"
FT                   /db_xref="GOA:E8MSI9"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSI9"
FT                   /protein_id="BAJ70733.1"
FT                   /translation="MTEQHIDPVTPLDRLDMMLVASGLVESRAKAQRLIKAGHVRVDGE
FT                   TITKPSFMVKAGHSELAVDKGDDYVSRGAYKLLGAFETFAGNGLTGPESLECLDIGAST
FT                   GGFTDVLLRGGAAKVVALDVGHGQLDPRIANDEHVIEMSGVNIREVEADDLPYRPAMIV
FT                   SDVSFISLTYVIPVIARIAAPGAQIVLLVKPQFEVGRAGLGKNGIVEDPALRERALHDV
FT                   VACAEQHGLDVVATADSPIIGTHGNEEYLLYAVLR"
FT   CDS_pept        complement(750177..750851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70734"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ0"
FT                   /protein_id="BAJ70734.1"
FT                   /translation="MGKHTQNCTLIGKGVYGTIGVDQRSRLADGAHFHTMIVTSTLEAS
FT                   VIEGDKLVIKSGIVRCDGDIRVSSISGSGDIEVGGDIICDEITFTGKLRCNGDIVCSGN
FT                   LSVNGSLGTRHISGQTVRLNGVLKGHDVNSRALEVHPLRSTMFSRFDMDGYEDGSTVRH
FT                   ITAVTVEANHLQCRTLTADSAMLRNGSAVESATCATALGIDRTSSVLLVNGDCQRIHLK
FT                   TA"
FT   CDS_pept        complement(750989..751651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0592"
FT                   /product="potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70735"
FT                   /db_xref="GOA:E8MSJ1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ1"
FT                   /protein_id="BAJ70735.1"
FT                   /translation="MAAKPSGNKSVLVIGLGRFGGSVAATLDQMGQDVLAVDKNPELVA
FT                   RWSAHLPTIQADMTDVLAIEQIDASQFDTAVVAIGDSIEASVIITGNLLDAGVSDLWAK
FT                   SVSQEHARILQRIGARHIINAETDAGKRVGHLVAGNYLDYIEIDGPYTVVKVHTPLYAV
FT                   GRSIEDVQVHDKYGVTVVGLKAPGKEFQYGSKELVMHRNDELILMGKQDQIDHFIQG"
FT   CDS_pept        complement(751702..753168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0593"
FT                   /product="cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70736"
FT                   /db_xref="GOA:E8MSJ2"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ2"
FT                   /protein_id="BAJ70736.1"
FT                   /translation="MANDFDESSANEEASKGLSWWYSADVLSRDKSDKTAKRIRRISIT
FT                   DRLLRHPGRLSMVYFGALIIIVTGLLLLPISTSDIIFTNFPIAFFTAVSALSTCGIPVV
FT                   NTGEYWSMFGQVVVLFSIQFGGLGVMTFASMVALGVSRRLKVSQRMLTANELGTTKLSE
FT                   VKGVLTVVLGTSIIAEVLTFVLLLPDLFRVNHGNMGRTLWQALFYAVSAYNNTGFTPDA
FT                   TGLHVNRWGVGLPILISAFIGTLGFPVVLNLVQCARRRLSPKRWTLHTKLTLVTTAVLV
FT                   ATSLAWFLLVEWSNTGLFPADDPGMKMRRAMSAAVMPRSAGFDISWVPEVTNETKVFMS
FT                   ILMFIGAGSSSTAGGIRVTTFAVILLICRAAFTGHRDVTVFRRRIPRRIQMTAVSVTTA
FT                   CFALVMVGAMMLMFTTGCAFVDAVFEACSAFSLGGYSVGVASAGNPASLFILSAEMIVG
FT                   RLGPLTIAYSISRPMAPEPIRYPQENIIVG"
FT   CDS_pept        753415..754437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0594"
FT                   /product="kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70737"
FT                   /db_xref="GOA:E8MSJ3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ3"
FT                   /protein_id="BAJ70737.1"
FT                   /translation="MAKRNAVVVTHTRLRQTGTVVAEAVSQLRVAGFEVAIIDNTEAPD
FT                   FGVQPPCVSDDTEIVVVLGGDGTILRAAELVHCTQVPILGVNMGRVGFLAEFESFQIDE
FT                   AIRRVSTHDYSIDERMIAHVDVWLPGATKPIEDWALNDITLERADRGKMVELSIRVDDV
FT                   EMNSFGADGVIVSTPTGSTAYAFSAGGPVMWPNVKALQLIPLAAHALFARPLIIGSGST
FT                   FTIDILDDSMSEGWICCDGRRQRALPQGTRVMVRESRDTLRLARLSGVPFTNRLVSKFD
FT                   LPVVGWREHARNEASSQSLHHGHTFPAAAYAAGVAVAGDAGVAGTEPDKPGERDGKAGS
FT                   "
FT   CDS_pept        754437..756263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0595"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70738"
FT                   /db_xref="GOA:E8MSJ4"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ4"
FT                   /protein_id="BAJ70738.1"
FT                   /translation="MLEELDIRNLGPIREATIAPAAGMTAITGETGAGKSMLLSAIRLV
FT                   SGGAAESSRVSAGADEAWAQAIFALSDDAVASEHSGDTNDAGSGDADSGFTGAAAAVAK
FT                   AHDAGVDPEDGELFLSRTVRASGRSRAVLGGKSVPRSVLGAIAGELVTIHGQTDQLKIA
FT                   ASSRQREFLDRVAGDEAELAAYRKAWDALAAMDERLERLRSQESSARQQADYLRESIDR
FT                   INRIDPQPGEDEELKARRERIENAADIAQGVGSALGALDASQVDVDAADGASAVELINH
FT                   AVTSLRAIRVGGTFSEQADRLESINADLGDVVFALSQELGDEGSVEDLDQINGRIHELG
FT                   DLARRWGPTLADVLAWRDKAAFDLEDLDASPEKVAELESERQTQYDAALAAADVLSAAR
FT                   VAAAADLGARVTEELGSLAMLGASLEVRVTPRDKADDPLGPYGRDDIAFLFTPFEGSPQ
FT                   LPMGKSASGGELSRLMLALELVAADTRGGADQTFIFDEVDAGVGGKAAVELGKRLARLA
FT                   RSAQVIVVTHLAQVASWADAQFVVTKEPPDADDDDLGVVTTIAEVNGETRVHEIARMLS
FT                   GSESEASLDHARELLSDSRLTLPLAGAGAAGD"
FT   CDS_pept        756293..756940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0596"
FT                   /product="putative hydrolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70739"
FT                   /db_xref="GOA:E8MSJ5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ5"
FT                   /protein_id="BAJ70739.1"
FT                   /translation="MTKAAIFDLDGTLLDSMGVWDQVDIDFLNKRGIEVPPDYMTKVSA
FT                   MQFRQIAEYTIARFGLTDTPEELMQEWDDMASVAYSTTVEAKPGALDYLRDLKASGVKL
FT                   GVATSLPPHLREPALRHVGMFDLFNDIVSVDDANDVGKDQPDVYLLAAKRLGAAPVDCT
FT                   VFEDLLVGMKSAKSVGMKVWAMHDDSSASDWPEICHLADGVLFDFHDAPRVL"
FT   CDS_pept        757178..757552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0597"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70740"
FT                   /db_xref="GOA:E8MSJ6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ6"
FT                   /protein_id="BAJ70740.1"
FT                   /translation="MKLIISSVSGEPIYEQIKTQIRSAVLSGELKAGEALPSLRKLAKE
FT                   LRISVLTVTRAYNELADEGVVQNIQGKGTFVMDKGNELMQRQLETQIRESLAEASRGAK
FT                   AAGIPLDALDRMLEEEYRKE"
FT   CDS_pept        757574..758494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0598"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70741"
FT                   /db_xref="GOA:E8MSJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ7"
FT                   /protein_id="BAJ70741.1"
FT                   /translation="MTAISESDAMALQVTDVTKHYDSGFTLDDVTFDLPKGYIMGLIGP
FT                   NGAGKSTLIKLILNMIHRDAGSIHVLGLDNIANEEPVKEQLGVVFDFSYMHEQWQVKNI
FT                   ERIVAPLYPSWDGGCYHKYLDTFGLGGAQNGKKHIKDLSRGMQMKLMLAIALSHDAKLL
FT                   ILDEPTSGLDVLARDELMDILHAYIEDGEHSVLFSTHITADLERAADFITYITDGRLYY
FT                   TGPKDEFEESFRLVKGGPDELAQLPADVVLGSHTYATGFDALVRSDRLDAVASVVSGLV
FT                   VESASIDDIIRLTNAHDSNRDLSGR"
FT   CDS_pept        758567..759214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0599"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70742"
FT                   /db_xref="GOA:E8MSJ8"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ8"
FT                   /protein_id="BAJ70742.1"
FT                   /translation="MAYLCVGERTVFSLLLAPLFSVIFQGEAYGDGFGYRMGVIMTVFT
FT                   CAMWVLTMAVADLQNGYRLRGIIPASRKSQVAARYVVGLVISVLSIAMIVLIDGLQVLV
FT                   NPDWSFAGNLWVAPLGGFCTALMVALIVPTGYLWTKLGGLQVTMMVIYVVVLAVSILLS
FT                   ILPASVTRGLAHAANAIIAQRLWLVIAVLTTTVVAYGISYVIASRIFASREW"
FT   CDS_pept        759217..759930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70743"
FT                   /db_xref="GOA:E8MSJ9"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSJ9"
FT                   /protein_id="BAJ70743.1"
FT                   /translation="MSWKSVVKQCRFDCVGTGLFSVANMVFLLVFPVLSIVVSLVMIPT
FT                   HVDEHVASGLMGGCGGLASAMACMSALGPASSEESAGPSAMRGLIPVSRTAQVVGRYLF
FT                   LLVVGLLWALDVVICGGVFIVFGDIADMGWIGTLAAGAFIFALAIILGSVLLACAYRFT
FT                   FRKMMVASGVVLVGLYAVIALLARLPVDWQWLLLNITDFLAIWWHTALVLAVLCLLAYF
FT                   GSMLIAIRIYRAKEL"
FT   CDS_pept        complement(760006..762792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0601"
FT                   /product="putative calcium-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70744"
FT                   /db_xref="GOA:E8MSK0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK0"
FT                   /protein_id="BAJ70744.1"
FT                   /translation="MTTANGQTPAPFMQDAPAVISTLGTDAHQGLTSEQAAHNLNQYGP
FT                   NAFTKPKPESMLSRIVKTAADPMLIMLMIAAAITLGVNITRAMAGGHADILECVGIFFA
FT                   IALSVTITVVMEGRSAKAFEALNDINDDTTVTVVRDGEVTLVSQRDITIGDVLQISTGD
FT                   KLPADARLIESNDLTADESALTGESVPSAKATDAVFTDPKTPVADRTNMLYSGCFVTAG
FT                   NGRAVVTAVGDDTEFGKIARELRAANTGMTPLQEKLAKLGKVIAVVGSIVAALVFVLQV
FT                   ARFVASGTASFDTISEAFITSITLIVAAVPEGLPTIVAACLAVNIIKMSKQNALVKKMV
FT                   ACETIGCINVICSDKTGTLTQNRMTVIEAYNAPGRALEKPEQIRNRMLLENFCVNGTAD
FT                   VTFPGATEAEAGAMPEFIGNPTECALLVAAHKAGLDYRIRRERATVLHTYPFSSETKSM
FT                   TTVVRDGDGITVFAKGSPEKMLDLCAVDAKTRGEIEREIAKFQAQSCRVLGFAHRHISD
FT                   KDADTAALDYAADRAGLESGMMFDGFVAIVDPLREDVPGAVERCHKAGIELKMLTGDNI
FT                   VTATAIANELGILDERHIAVEARQIEEMSDEELSREIGRIRVIARSTPVIKMRVVNALK
FT                   AQGNVVAVTGDGINDAPAIKNADVGIAMGIAGTEVSKEASDIVMLDDSFATIVKAVHWG
FT                   RGIYENFQRFIQFQLTVNLSSVVVVLASLFSGLAAPFTALQLLWVNIIMDGPPALTLGM
FT                   EPIRDNLMDRRPTRRDAGIVSRGMLERIIVSGAFIAVVFMAQSWTNFMGGTAEQQSTIL
FT                   FTLFVVFQLFNAFNSRELGNASLFANLLRNKVMIGVFALMFALQVLVVQFGGAMFRTVP
FT                   LPIDMWLKIIAVGFGVVVLQEVIKTVKRAAAAIRARRTANESDSQQPHQPIALDLVD"
FT   CDS_pept        complement(763312..764802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0602"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70745"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK1"
FT                   /protein_id="BAJ70745.1"
FT                   /translation="MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVA
FT                   SLPGKSYQQIAAEVLGALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELF
FT                   NGPTSAFKDVALQILPRFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAI
FT                   TVFYPEGKVSQVQELQMTTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSH
FT                   VVLSSANSINVGRLVPQVVYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAK
FT                   LLGLPVKHLVVASDKNNVLFDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSE
FT                   GDTRLISMLMNDLNKWGTYEIPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVID
FT                   PHTACGYYLLEQMPRDPLTPRVLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHET
FT                   GTTAPAALRGLETADVRFKDVVAIDGMEDYVEKAAQAL"
FT   CDS_pept        765025..765726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0603"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70746"
FT                   /db_xref="GOA:E8MSK2"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK2"
FT                   /protein_id="BAJ70746.1"
FT                   /translation="MTASPLAQKATDAFNAPICETDPEIAELLDSELGRQRSGLEMIAS
FT                   ENFVPRAVLQCQGSVLTNKYAEGYPGRFYHAEAYGVNPETFRTDPEIIRQRTLDGAKIL
FT                   AERLLADDVKANGISVLTGGTDVHLVMVDLRNSEMDGQQGEDLLAACGITINRNTVPFD
FT                   PRPASVASGLRIGTSALATRGFGPKEYEEVADIIGTALAAGPSADVTALKARVDKLAED
FT                   FPLYPDLDQIH"
FT   CDS_pept        765839..767143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0604"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70747"
FT                   /db_xref="GOA:E8MSK3"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK3"
FT                   /protein_id="BAJ70747.1"
FT                   /translation="MFFMSDELSPEVFDAVCRQADQAARAQERLAQANTEAKNELLLAI
FT                   ADALDEHAADIEAANALDMLESKENGMDAGKLDRLLFDVPRVAAAAQGVRHVATLPDPV
FT                   GEIVRGYNLPNGLRLTQTRVPMGVIGMIYEARPNVTVDVASLCLKSGNAALLRGGHAAE
FT                   RTNAATLGVIAPVLEAHGFESALVQSVDQYGRAGATAMMEARGHIDVLVPRGGAGLIQA
FT                   VVRNSKVPVIETGAGNVHIYIDKSGDLAKAIPIIINAKTQRVGVCNAAEKLLVHKDVAA
FT                   EFLPQIAAALAEANVVLQTDTTSYGIISGAAIEGLDLNHAAEEDWDTEYLALKMGIKVV
FT                   SDLDAAIDHINTHSTGHTESIIAEDYAAIEEFTKRIDSAVVMVNASTRFTDGGVFGFGA
FT                   ELGISTQKMHARGPMGLREMTTTKWIGYGTGQVRA"
FT   CDS_pept        767140..767721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70748"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK4"
FT                   /protein_id="BAJ70748.1"
FT                   /translation="MNEDGNMNITADTANKASELRPDIDLNDPKLGLKIAAERLSIVRY
FT                   VFLVQIEDGIASAAQRASLEYADAVLIGWPETDSPEVADLDDAQLKIVREHMELMEGYI
FT                   GKYSQMEHDGDLDGMTDTLIRITERVAEVRRLYQPDFPLPTFAEIRRVVQDEWDEDMGK
FT                   IDPREDNPTAGEIEEETESADDAAGEGDQA"
FT   CDS_pept        767718..768503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0606"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70749"
FT                   /db_xref="GOA:E8MSK5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK5"
FT                   /protein_id="BAJ70749.1"
FT                   /translation="MSGVTDSHKTAASVQSEKSVESAEPAEIVAVTQGETERRMSDLSA
FT                   PAGASSHGKGRLSARGNWHTRLRVGIMGGTFDPIHNGHLVAASEVAWVYDLDEVIFVPT
FT                   GRPVFKLDKHVTNAEDRYLMTVIATASNPKFTVSRVDIDRPGVTYTIDTLRDIRAQHPD
FT                   AELFFITGADAVAEIMQWKDADLMWDLAHFVAVTRPGYSSPDGVTLPEGKVDTLEIPAL
FT                   AISSTDVRRRAEHDEPVWYLVPDGVVQYIGKHGLYSYED"
FT   CDS_pept        complement(768601..769803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0607"
FT                   /product="putative beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70750"
FT                   /db_xref="GOA:E8MSK6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK6"
FT                   /protein_id="BAJ70750.1"
FT                   /translation="MATICALAVVLAGVAAYGWHVGWFAKSTSNGNTTTPQTSQTSALP
FT                   RADVPSPKKNEPAAQAQRAVSAMTLEERVGQLVMVPLLAGSDPSSLASTIADEHIGSAI
FT                   LIGNWNTGADTVKTATAQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGT
FT                   MSADALRQSAGTWGSQLAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAE
FT                   HGIAVIEGLRDAQVGAAVKHYPGLGAVSGNTDFTTEGILDTTTTLGGAEAGAFDQAITK
FT                   TDPAMVMMSLATYQSIDPNNPAVFSSTIIDGHIRNALKYTGVVISDSMSAEALSSYDVS
FT                   QLGVKLVEAGGDMSCIGQTDYVKPIVDGLNERAKSDPAFASKVTAAATRVMALKIKMGL
FT                   A"
FT   CDS_pept        769976..773215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70751"
FT                   /db_xref="GOA:E8MSK7"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK7"
FT                   /protein_id="BAJ70751.1"
FT                   /translation="MSFNDPFSILFGNGGDSRRNNANNDDPIILDVEADGDGPARNTNA
FT                   GPSGSSRPPRGPANPRITRKPASGGSGGSRGSKILIGVVLALAIIVGLFFGLSRFITDL
FT                   MWYGQLGFQSVVWTQLGVKIGLWVAYALLMALTGFVSAWLAIRARPDSADGSTIRINGD
FT                   VVEVGKSVSSKTARRVAVVISLIVGVIFGSQFNANWSEILLMFNAQSFGTTDPQFGLDN
FT                   GFYVFVLPGLKLVLAAVAMLLGVGLVFSVVTHVLMGGIRITMPVNGRGLFSITKRCRRQ
FT                   LGIWLMLNMFAWAVRQMIGVFDQLTVQGSRITGASYTAVHANIPVTFIMAALTAILGVV
FT                   LGIWLMRSHTLEGQASIGVRASAALKAWRVPVTSIAVVVVVGLVLTVAWPVLLQRFRVN
FT                   PNAQEMESTYIQRNIDATRAAYGLDKLKTEQYKVTDKGEQGALAKEGDTTAQIRLLDPQ
FT                   VVSPTFKQLQQSKQYYTFADTLAVDKYEIDGVSQDTVIAARELALAGNDNRNWVNDHTV
FT                   YTHGYGVVAAYGNKVTADGQPEFFESGIPTQGKLTESEKYEPRIYFSPNTTEYSIVGAP
FT                   EGTQAWEFDYPTGSEGALTTFKGDGGPSVGNLFSRILYAIRFGSDQILFSDRVTSESQI
FT                   LYDRSPKERVAKVAPYLTLDGRVYPAVVDGRVKWIVDGYTTSDAYPYSQMTDLGSATKD
FT                   STTVSSATVSSLGSQKANYIRNSVKATVDAYDGSVDLYVWDQSDPVIKAWEKIFPGQYH
FT                   QLSDISGDLMSHMRYPESLFKVQRELLSKYHVTSANQYYSGEDFWQTPVDPTESQSQQD
FT                   QDILQPPYYLTLQTGGTKEPVFSLTSTYIPAGQSTREILTGFLSVDSDAGNEKGKIGSN
FT                   YGTIRLQELPKDSNVPGPGQAQNNFNANADVSKELNLLQSGDTQVVRGNLLTLPLGGGL
FT                   VYVQPVYVKSSGATSFPLLKKTLVAFGDQVGFADTLDEALDQVFGGDSGAAAGDAENVS
FT                   GDGSSGDQSSGISGDQSGSDTNGGQSGTTDGKSDSGSSSDRSPELQQALNDAAQAMKDS
FT                   QSAMKNGDWTAYGKAQKELEDALNKAIELDK"
FT   CDS_pept        773349..773846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0609"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70752"
FT                   /db_xref="GOA:E8MSK8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK8"
FT                   /protein_id="BAJ70752.1"
FT                   /translation="MPYTFRPAVESDVQAIADIYNASVMAGGATADLTPRTFDQRRAWV
FT                   ESHTPPYGVFVVESEDGSIIGFGALSVFYDRAGYDGVTDLAYYIDPAWQGRGVGTFMLD
FT                   RLLTEALARHMRKACGIIFADNAGSIALMHRFGFTQFGLMPAAATDSTGTMRDMSYWYL
FT                   DL"
FT   CDS_pept        774042..774641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0610"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70753"
FT                   /db_xref="GOA:E8MSK9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK9"
FT                   /protein_id="BAJ70753.1"
FT                   /translation="MASDFWLIAGLGNPGKKYEDTRHNMGFMTADVLAERWTVNFADHK
FT                   GLAMLGKSVMNLDGRTVKFFLAKPLTYMNDSGNAVASISAYYQIEPDHIVVIHDDMDLE
FT                   FGRIKVKAGGSAGGHNGIKSIDRSLGTPKYARVRMGVGHSKRGANAHDNTVNWVLGGFG
FT                   PDQRKQLPEFLADGADAAEDIIFHGLAKTQEKFNGR"
FT   CDS_pept        774631..778215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0611"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70754"
FT                   /db_xref="GOA:E8MSL0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL0"
FT                   /protein_id="BAJ70754.1"
FT                   /translation="MAGEATHPDLINGSLVGILSELEQDKTFLKLAAGDIEASDDVDNS
FT                   VLAGIPEGLRPALAAAIGQGVAGKPGKPVVLVVASGREAEETVGSLRSWYDGDPNDIAQ
FT                   LEAWETLPHERLSPRADTVASRMAVFRRLKHPSDTDSMFGPIRILVMPIRSLIQPVVQG
FT                   LGDVEPLVFTVGEDLPLDEAAKRLIENAYTRVDLVMDRGEFAVRGGILDVFPPTAPHPV
FT                   RIEFFGDEIDTIKEFHASDQRTYGDGLKTIWATACRELQLTDAVRTRAKALVGSIPNAE
FT                   DMLESIANAIPVEGMESLMPALVDHLEPVGSMLPKHAVILLSDPEKLRRSAEDLAKTAN
FT                   EFLAASWHVAASGHGAGAPISFDEASFLDYAETISSLEYSEHPVIRLTSFGVDTTLTGH
FT                   VQLDAQNPAEFRGDEAKASQGIEGLLDAGFHVTITAAAAGTLARLKRAINTTGIANFDV
FT                   IRSQAIDGFVDKAAKIALLTERDLTGRTSAVAVAKTPKRRRKAIDLVELKKGDYVVHEQ
FT                   HGIGRFIEMRQRIIGTGANKTTREYLVIEYAPSKRGAPADKLFIPTDQLDQVSKYIGAE
FT                   APKLNKLGGSDWAATKAKARKHVHEIADDLIKLYSARQRAKGFAFSPDTPWQKELEDAF
FT                   PYQETADQLTTIDEVKSDMEKPVPMDRLICGDVGFGKTEIALRAAFKAVQDGKQVAVLV
FT                   PTTLLVQQHYETFSERFEGFPVNVAAMSRFQTTKEINEAIEGLETGTVDVVIGTHKLLN
FT                   PKIKFKDLGLVIIDEEQRFGVEHKETLKALRTNVDVLSLSATPIPRTLEMAVTGIREMS
FT                   TLATPPEDRLPVLTYVGAYEDAQVTAAVRRELLRGGQVFYVHNRVQDISSIADKIHTLV
FT                   PEAHVGIAHGKMGEKQLDQIIRDFWHRDIDVLVCTTIIETGLDISNANTLIVDHADRFG
FT                   LSQLHQLRGRVGRGRERAYAYFLYDPSKPMTEQSHDRLATIAQNTALGSGFDVAMKDLE
FT                   LRGTGNLLGDEQSGHIEGVGFDLYVRMVSEAVEKYKEPEENVEPVAVSIDLPIEASIPI
FT                   EYIDSDKLRLEAYRKLASARNEADLKDLEEELTDRYGKPPVEFETLFDVARLKFKARKL
FT                   GISEILAQSNRVRIGRIDPPESIQMRMGRIYKGTQYRPVTHQLIVPTPFTGSLGQGPMS
FT                   SDQVVLWTNQLLDDLAWTPSSSKRQSRL"
FT   CDS_pept        778355..779302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0612"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70755"
FT                   /db_xref="GOA:E8MSL1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL1"
FT                   /protein_id="BAJ70755.1"
FT                   /translation="MTAMSETTTSRTNQSATTATLAGYEIPRLGMGTMALAIEGRPSNR
FT                   DQAIETIHAALDAGVRYLDTAWSYYLPSAPGTGEPEDMGYGEYLVRDALHSWHGPKDQV
FT                   LVATKTGWLRTLDGNGNYGWQADARPETMIANAKESARRLGVDTLDLLYSHCNDPQVPY
FT                   EDQMGALKQLVDEGVAKAVGISRIDNADIETARNILGDRLVAVQNQFSPVHRDPEHTLE
FT                   TCEKLGLAFVCWSPLGGFLDPFNEHLFDRFREVAKIHDCSYQRVTLAWELAQYQYLFTI
FT                   PSARNPQEIQDSFKASELKLSDSEIGYLNGKDVD"
FT   CDS_pept        779453..780751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0613"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70756"
FT                   /db_xref="GOA:E8MSL2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL2"
FT                   /protein_id="BAJ70756.1"
FT                   /translation="MAVIESVYARQILDSRGNPTVQVVLDTEDGAQGLGLVPSGASTGE
FT                   AEAWERRDGDKSVYGGKGVLNAVKAVNEVIAPKVIGMDAADQRALDDLMIELDGTPNKG
FT                   KLGANAILGVSLAALYASAESAGLPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQ
FT                   EYMISPYGFDTYSEALRAGVEVYHTLKNVLKKEGLNTGLGDEGGFAPKMKSNEDSLKYI
FT                   MDAISAAGYEPGKQIGICLDVASSEFYNKETGKYRFDGEERDSAYMLDYYENLINEYPI
FT                   VSIEDPFNEEGWEDWAAITARLGDRLQFVGDDLLVTNPARLQKAIDLGAANSLLVKLNQ
FT                   IGSVTETLDAIELATANGYTSMVSHRSGETPDTTISDLAVAKNTRQIKTGAPARGERVA
FT                   KYNRLLEIEEELGSTAQYAGYSAFKACKKYLAK"
FT   CDS_pept        780842..781453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70757"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL3"
FT                   /protein_id="BAJ70757.1"
FT                   /translation="MSKSSRTGKPGKTGKARVRKKGSAGPIAFFVSLFIIALGTIQLVS
FT                   TFHTYALNLAELNGLKREEASLIAKKQELENDIKRWDDKAYITAQARERLGFVFPGEQA
FT                   VRVLHPEAVTGSDSESQKTEDSSSSNKKVLPWYSELSYSLKKADEPVTDSESGKSDISG
FT                   SSDSSSNDSSKRSDKSDQNTQSDQNTQQNTQQNTGEGTQQ"
FT   CDS_pept        781450..782016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70758"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL4"
FT                   /protein_id="BAJ70758.1"
FT                   /translation="MTIDIAAKAKALVDTVLAEPANDHDIDLVQRQLGRYPRGMVAVGA
FT                   RCVCGRPLAVITRPVLPGGIPFPTTCYLTGPEAVKAASHVEAAGVMQQYNDMLASDEEL
FT                   KAAYEQAHNLYLAFRHELAGRLGDSEEHIEGTSAGGMPVRVKCLHALLAQSLVMGPGVN
FT                   PIGDLVLERVKDEFDPTVCRCTLDD"
FT   CDS_pept        782079..783080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0616"
FT                   /product="putative exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70759"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL5"
FT                   /protein_id="BAJ70759.1"
FT                   /translation="MSKESVTVAGIDCGTNSIRLKIARVDADGMHEVVPRILRVIRLGQ
FT                   DVDKTHRFADEALERAYVAAREFAGVIAEHPIDGLRFVATSATRDAENREEFEDEIERI
FT                   LGVRPEVIPGTEEADLSFLGATSVVNRDDLPAPYLVVDLGGGSTELVIGGDGVSAPTTQ
FT                   VQGAFSMNIGSVRMTERHLTNDPPTQTQIDEAVVDVDEHIDEAFRTVDAGKARTIIGVS
FT                   GTVTTMTALAMGLKEYDHTVVDGHRLSLEDAYAVDDKFLRMTRAERREYKTIHPGRIDV
FT                   VGGGAVVWSRVLARVSEAAKADHGEAIDSFVASEHGLLDGIVLDYGRRLLAQ"
FT   tRNA            783239..783320
FT                   /locus_tag="BLIF_tRNA21"
FT                   /product="tRNA-Leu"
FT   CDS_pept        783510..784079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70760"
FT                   /db_xref="GOA:E8MSL6"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL6"
FT                   /protein_id="BAJ70760.1"
FT                   /translation="MASRWTDVERVEQGALPTMLAQAVIAGTALTVGAIACSGFYLSMI
FT                   GNVAALLPWATIVILIAVAFTYIVGFALLWCAEALTLRANDKLKPWLYGVVGLIGYGVW
FT                   GMFVMSAMMNTLNQPLNGVVLSNGDVMALTVNYAVFGFIAFLLAQAYAPKIATKKGLTI
FT                   GLMVVQIVLAIIGIIVLVMMFSALSH"
FT   CDS_pept        784226..785686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0618"
FT                   /product="L-serine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70761"
FT                   /db_xref="GOA:E8MSL7"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL7"
FT                   /protein_id="BAJ70761.1"
FT                   /translation="MFSVLDMFTIGVGPSSSHTVGPMVAAHAFASSLQADHLVDRTARV
FT                   KITLYGSLALTGLGHGTDRAAMAGLEGNLPATVDTDHMMHIREICALDDTLNLAGLKRI
FT                   HFDYDRDVVFEQWKRMAAHPNGMRFQAFDAAASLVDEQVWYSIGGGFVRKGAPEDPMIG
FT                   IHERPPEGASFADADESSSTDFGVEAPYPFSSCTELVSLCREHHLSIAELVWANETASR
FT                   SGIQVRSDIDAIWRVMRACVDHGCTSAEPTLPGGLDVPRRAPKMYRRLASNSDVLRRDS
FT                   RRKDAVLESSDAAWVDLFALAVSEENAGGGRIVTAPTNGSAGIIPAVLHYYWHFVDNAN
FT                   EQGVVTFLLTAGAIGYLFKRNASISGAEVGCQGEVGSACSMAAAGLAAVVGGTPEQVEN
FT                   AAEIGIEHNLGLTCDPVGGLVQIPCIERNAMAANTAINAVRMAMLGDGSHIVTLDQAIE
FT                   TMKQTGEDMMAKYKETSKGGLAVNVVEC"
FT   CDS_pept        785828..786235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0619"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70762"
FT                   /db_xref="GOA:E8MSL8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL8"
FT                   /protein_id="BAJ70762.1"
FT                   /translation="MTDQMPQVNAEFGTTPVIEFPTPEAPKGLKVVELTEGDGPIVRRG
FT                   DTVTVNYHGVVWGKDTPFDSSFDRHQPASFGIGVGQVIKGWDQTVPGHNVGSRLVVSIP
FT                   PEYGYGSRGIPQAGIGGEDTLVFVIDIISTR"
FT   CDS_pept        786334..786813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0620"
FT                   /product="transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70763"
FT                   /db_xref="GOA:E8MSL9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSL9"
FT                   /protein_id="BAJ70763.1"
FT                   /translation="MAEDKVYLLTQEAYNKMKEELAHREGELREEIAHKIAVARAEGDL
FT                   SENGGYQAAREAQSKNEGRITELTVKLRDSKIIENAPEGTVGEGSVVTIELNGNEMTYV
FT                   LGSRDIVAGTDYDIMTPDSPIGKAIEGAKVGDVVSYTAPNGRELSVTVKAAKPLA"
FT   CDS_pept        complement(786868..787812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70764"
FT                   /db_xref="GOA:E8MSM0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM0"
FT                   /protein_id="BAJ70764.1"
FT                   /translation="MASTTGDSEKTMHHDAHNSATIAEDATIASKRQAAIEAREQALQA
FT                   KADAVRAKAQFKAEAIRAKAEEKARHKLAKAENRALKIEGIAPAEVERKIRLDVHGRPK
FT                   PLMRGWIHAIAAPLSLAAGIVLICLAHGASLKWACAVFMTASLILFTNSACYHLGDWSP
FT                   RVTDVLRRIDHVNIFLLIAGTYTPVSFALEPFWRNVIIISMWACTAIAIVIHVIWINAP
FT                   RWLYTVVYIIFGIYGLAYMVMFWNSPYAGPAVVVLLCAGGACYILGAIVYALRKPDPWP
FT                   RVFGFHEIFHCGTVAGYACHMVAIYMVIVSLWQ"
FT   CDS_pept        787937..788710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70765"
FT                   /db_xref="GOA:E8MSM1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM1"
FT                   /protein_id="BAJ70765.1"
FT                   /translation="MESEDENVAAIKGSAMVYCTECGFANEQGNAFCSQCGSPLEQPEA
FT                   NPAAPASPEPPAGRPGVDHTKAVVIVLIALICVVALVIGLFITHSMGLWGAQPQAQTSA
FT                   QSTGADALDSADDGTTDSSDAKSKAKKNTSDSAKDKNSDDSSKKSSTEKSKPSTPVITS
FT                   SQLSDIADSYSSSDVAVSAMVIDGTSADSSEDATIATTSQSGKQFMAADFYLPVYLAAQ
FT                   DNGDDNVKAQANAMMGSMDTAMPAIWWRLRISNCT"
FT   CDS_pept        788873..790360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0623"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70766"
FT                   /db_xref="GOA:E8MSM2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM2"
FT                   /protein_id="BAJ70766.1"
FT                   /translation="MADFSHILATRPDFDDEDREWLHHLVADWQVIADLSFADLLLLVQ
FT                   DGDGKYVVAEQCRPSTVMTLRAEDVVGNVMPDDMVGELDAAMLSSVVFRSTVLRTVGKA
FT                   TVCNVYAPVRHNGKTLGLVVRETNMATRESNGRYESESINAGKHLYEMIPRGQFPYKDS
FT                   VMSQRHIARVADGFIILTMDGVVRYAAPNAISCFRRLGLLTTMPGHYLSELGTQLLKEN
FT                   DPVPETLPLVLTGKAAVDSELNANRSAVSMRSLPLYDNNGRIGAILLCRDVTELRRREQ
FT                   ELQTKDATISEIHHRVKNNLQAVSALLRLQARKTKSDEVKKELQEAQRRVQTIAMVHEG
FT                   LSQTADEVVDFDKVIANLLRMAVDLATMKDQHIDINYMGKFGMMPAQDATPLSLVLTEL
FT                   ITNSVEHGFEGRKDGHITISVGRSGPNLNVVVEDDGSGLGSEEQGGLARSSGSGLGTQI
FT                   INTFVTNDFGGSVHWEPRREGGTRVVLDMKLRAAQDE"
FT   CDS_pept        complement(790433..790711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0624"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70767"
FT                   /db_xref="GOA:E8MSM3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM3"
FT                   /protein_id="BAJ70767.1"
FT                   /translation="MSSAFDWRAKAACRDKDPELFFPVGNTGAAYQQIEEAKAVCRTCK
FT                   VIDACLKCALDTNQDYGVWGGLSEDERRALKRRAMRARRSQAMQMQI"
FT   CDS_pept        complement(790825..792651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0625"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70768"
FT                   /db_xref="GOA:E8MSM4"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM4"
FT                   /protein_id="BAJ70768.1"
FT                   /translation="MTSQQNDSKRHSVHTASAVSRAKHRLGAPPLRARLTMFAAACPMI
FT                   AQALMMVILLLRGQWLFAAMIAPGIFACLVSLLLTLPSPPGPEKAPDPQQATIDVGITG
FT                   DADDRAADLRHAPSQPIESLLHFARLPWRAIVGRWLEPLDLAVPIGMTGSEPLMLDLNR
FT                   QGPHALVAGTTGSGKSVLLQSWCLALASMNGPEHLNFVFLDFKGGSAFRKLERLPHTVG
FT                   SVCDLDLAHAVRALRALEAELTRREQLSAAVHASDIRDMVNPPPRLIVVIDEFHALKDQ
FT                   LPDYVNRLVRIASLGRSLGMYLIACTQNPMGQVSADMKANMSVSICLRVRDRLQSCELL
FT                   GDGRAADLSPAMPGAAFCNDSEQVTAFRCATARDIDAVCRQIAFASRFVGSPPQPSLFT
FT                   APLPRHVKDRTVADHAPQRIRFGLADDGINLREATVSLTGGNIGVIGPQGRGKTTLLKT
FT                   LARHASMADGLAVRVSSPHRRVWSSQWLHGGRCTPYASSDAPPPPHIVWFVDDADELFD
FT                   PFRTDEQALSFTHALADESVSVVFAVSTIRPIRIPEHCNTRIVFPCGERTSDLMAGVPA
FT                   RLLDMMSHIDADNAGRAVLIEGTSACLVQCAS"
FT   CDS_pept        complement(792821..793726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70769"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM5"
FT                   /protein_id="BAJ70769.1"
FT                   /translation="MAALILSVFGAWQWVDSKLNRSDWLTDTPNTPASTWLILGSDERD
FT                   GSTDYGGVDNISGFRTDTILVLIKPKSGPSSLVSIPRDSLMNVDNQYMKINAVALIAGK
FT                   KALVSNVEQITGQKIDHVAQIKFGGLQNVVNALGGIELCYDEDVQDSYSGLNWKAGCHT
FT                   ADGSTALSFSRMRYADARGDFGRNERQRQVISAIVKKASSSETLTNPSKIVAVSNAAMS
FT                   ALTVDEKTNPYTLLTMALAFKSATGSNGISGSVYWSDPDYYVDGVGSSVLLDDAKNTEL
FT                   FNQLADGTYKAGTVGNLAEG"
FT   CDS_pept        793749..794069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70770"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM6"
FT                   /protein_id="BAJ70770.1"
FT                   /translation="MMRKARGRRAVTVFAVAAAGRPRWLNFVDTFAAGDEGRETGISDG
FT                   LRTALRDEPEDIRARDGGMLRGAAASGAVLRVARPVFGEKLGGVRLPLSATLALAVALA
FT                   FS"
FT   CDS_pept        794505..794804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0628"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70771"
FT                   /db_xref="GOA:E8MSM7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM7"
FT                   /protein_id="BAJ70771.1"
FT                   /translation="MWGVVDDSAEEPWHELWGLFRPDGDVSWQHKALCAQTDPEAFFPE
FT                   KGGSTRDAKRVCAKCEVREQCLKWAIDHDERFGIWGGMSERERRRYKREHRERA"
FT   CDS_pept        794848..797943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70772"
FT                   /db_xref="GOA:E8MSM8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM8"
FT                   /protein_id="BAJ70772.1"
FT                   /translation="MSPTGNSDIHEALADAMSSRPYTHRQDVDTGITAVITVEEDMRFL
FT                   RSTLRSVLTQNVLPGVVIIADATGRTSSRITTSFEVIPSPSGPVMEVPQSKHVTIHIVS
FT                   AKGARSFGDAVSRALDRADLDDAPRALWLLHDDSRPSDDSCLERLLEAWRNTPGASVLG
FT                   CKQCDWEGSHLHDVGMYAGHHAVHSLVVDGEPDQEQYDGRQDVFAVSLAGALVSMSQFT
FT                   RLRGINAWLTTYSESVDFCRRVCLSGGRVVVVPQAEISHRRARYEGIRTRGGEPLKDDH
FT                   TVNHAMTVHRSQQRYLYTDLAMSSWFIVWLWRLLRSFGMAISMMFGKKPYEAWVQLCLP
FT                   WLALADIAGNMKSRSLVARQSKVAASSLHVLFADSQQIKQFHDRRDAFQSQQGRVLLSP
FT                   LERAHLRTRTIYRWSAAVVMALVCFAAIAVMYWPVFRSIFSGGSLYSDVLLPTGASFTQ
FT                   LVQSATTPWVFGSGTGIPAPPTPWLLVLMLASLVTLGHVTAALAMILFVAAPLSALSFW
FT                   ALAGVFTRSDVVRVLGGLLWASTGIMFGWYAQANMPMLTVMVFLPAAFAFVFRAVGMYH
FT                   TEDPLKPRTSVQAAAIAALCFIPVVAAEPQLLFALIVVFLMFLLFVRRKRAMLLLIPVP
FT                   AAFAVAPTLVNAVRYADLGMWRQLFGDITVPTSSANGSPASLSLLEAAQRALGWRMGST
FT                   DYADLAVTVLFGVITLLALASLVLPFALRTSRLMWVVIVCGGALALVSSRVAITVDADG
FT                   VVAGSAQPGIAMMILGFLACVCLVAGGAVKRFQPLHASGSDPASKKDRLHVLIVSGRVV
FT                   LALILVCCIGIQCMYGIERHKDAGLGVSENGLPMVTTDYLEAGADHRVLAVSAETRNIV
FT                   NYAVMRTSRGDLIDSSPVQRARLLSGKHDAVDEQLAQACASLLSNPDEEAIAAISALGF
FT                   GGIYVVPETGDSLNDMPYEQLSANIAASNGTQSLVSTDSGSYYRLTLRSSASQQVDTSW
FT                   QQRAQHSVWRHAWLICLGVITALYCLVAMPRRRPSYGLEEQA"
FT   CDS_pept        797940..799481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70773"
FT                   /db_xref="GOA:E8MSM9"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM9"
FT                   /protein_id="BAJ70773.1"
FT                   /translation="MSNKTSGFKRAIGIVLDVITMLVLIALFVVLVMAPIPNIWVDKVA
FT                   ASDNAIDQTVSPTQSETYCPAPIGLADTGTYGDSAFQATVGNLSTQARYAAFGSVYSAT
FT                   VSAIGQKSSSDDVTLKDADSTDDSSVKTGAQKINQGARLINTRMLQAAAGTGTVGTIAS
FT                   WADDGDVRGISAASCVSTSLSQSFLLSDSTTGTTQQLIVSNLSTKPTTVDIAVWGSETA
FT                   GKMALSTQSTLSVPAEGESSMELSAAVDGQHGLFVTVSSKETPIASVVRTVTMDGLTPK
FT                   GSDFALPLPTASNASVAPSITAGDAVTAYLFAKADTSTGLSWITAKGLVPAKDATVTAD
FT                   KVTAIDLGEAPDGALGVMSTAEDAVSFSVKATRSGDSGQADFALVNAGEPSEFSGLALP
FT                   DGVKASITLANTSNARRTVTLRAYDDAGASVTSKEITLDANAAQTIEAGNLSGDHGTAV
FT                   VLMLEDSSKKVSWGARFSHDSLQDKDIAGLSVIDASTLMPATVHVWARNDSSIVK"
FT   CDS_pept        complement(799584..799946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70774"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN0"
FT                   /protein_id="BAJ70774.1"
FT                   /translation="MFGTRLPRYRTRTGMFDDMVAAQVRRLGQAWPELIRPLQFAVEDV
FT                   PPSDPTPWQTEPNMTSQCFPASHGIPARVVLYRMPLQTEAPTKLELQLAVRDELVARIA
FT                   ELYGRRPEEIDPDWGL"
FT   CDS_pept        800101..800907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0632"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70775"
FT                   /db_xref="GOA:E8MSN1"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN1"
FT                   /protein_id="BAJ70775.1"
FT                   /translation="MVVRSWSELDFDNVCSNAKVFGFDLDNTLASSKQPMKPAMIERFC
FT                   ALLDHTVVALISGGGMAVVTSQVLDVLTPNARRGNLHVMPTSGSRYYRWDGTQWALVYA
FT                   HDLSEATVAAVSESLERHARELGLWEQQVWGPRIENRGSQITFSALGQFAPVAAKQAWD
FT                   RDNTKKQALVEAVKADLPHMRVRAGGYTSVDVSECGIDKAYAVRKLTQTLGIRADEMVF
FT                   VGDRMTPTGNDYPAVEAGAIGVRVENPQDTVQLLDALLARFDTPAR"
FT   CDS_pept        complement(801240..801392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70776"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN2"
FT                   /protein_id="BAJ70776.1"
FT                   /translation="MEELRALHGRASTPYPRNAPATDLANGAVWARPLRRIDARDDGTG
FT                   TTNTR"
FT   CDS_pept        complement(801555..801941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0634"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70777"
FT                   /db_xref="GOA:E8MSN3"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN3"
FT                   /protein_id="BAJ70777.1"
FT                   /translation="MTQQSESQAMAHEATLFVMQMAGDSMINAGIHNGDLLIVDRSLAP
FT                   VPGDVVAAVMDDEIAIKRLVSRAGITILHAENPRYPDYMPSNGASPAIWGIVTDVIHPL
FT                   ISSSDRRTTASANTSTPTTLVPAC"
FT   CDS_pept        complement(802009..803085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0635"
FT                   /product="two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70778"
FT                   /db_xref="GOA:E8MSN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN4"
FT                   /protein_id="BAJ70778.1"
FT                   /translation="MMASKKQQQSRLDAMKPRVKPVDLFSSLKLELSALIVIATAIAFA
FT                   MCWFLLKFGWSGWIAMPLTLVVALGITYFFSRGITAPLRQMRDVAEAMADGDYTVRVDI
FT                   DQDRHDEVGKLARSFNEMAGELEHADKMRRDMIANVSHELRTPVSALQAMVENMADGVT
FT                   EPTPTNLESILTQTQRLSDLIAFLLDLSRMEAGAASLNIEKFNFADFLDETIEPLEIAD
FT                   GGHAHDIRVTVPADITMEGDQDRLRQLFTNIIANALKHSADGTTVLVDAHEDENQGTIV
FT                   TNVVNFGSQIAPSDRLDIFRRFVKGKTGPGTESGGTGLGLSIAHWAAQLHGGTVKVVDD
FT                   TRGADFEIILPKYHIAER"
FT   CDS_pept        complement(803082..803804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0636"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70779"
FT                   /db_xref="GOA:E8MSN5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN5"
FT                   /protein_id="BAJ70779.1"
FT                   /translation="MLNTTARQNTTPRTVLVVEDEPTLATAIAQRITAEGWTARVAGDG
FT                   ASAVQAASQLRPDLVIMDIMLPVMDGLEATKRIVAERPVPVLILTARDDEADKVIGLGA
FT                   GADDYMTKPFSMRELIARCKALLRRVERAKVIAKNSENEKLLDFGSMVIDPAQRIVTVN
FT                   GEQVHLTPTEFDLLATLARRPKSVLTREKLLEEVWDWVDASGTRTVDSHVKALRHKLGA
FT                   DTIRTVHGVGYAFEPPTA"
FT   CDS_pept        complement(803840..806053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0637"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70780"
FT                   /db_xref="GOA:E8MSN6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN6"
FT                   /protein_id="BAJ70780.1"
FT                   /translation="MPVAQGDLDATSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLA
FT                   KSVTILTQDGEYPMTHEYNGVFVVTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYR
FT                   YMPTVGDMDTYLFGEGRHEKLWETLGAHVLRYDDPMGGADGTPGEQVVGTAFSVWAPNA
FT                   HAVRVVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPM
FT                   ERQHEVPPNTASIVTESTYKWNDDAWMQHRRTTNPHDGPVSIYEVHAGSWRQGLTYRDL
FT                   AKQLVDYVKQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQ
FT                   AGIGVIMDWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFL
FT                   VANALFWLEDLHVDALRVDAVSSMLYLDYSREPGHWRPNIYGGRENLEAIDFLKEATAT
FT                   AYKNNPGVMVIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHH
FT                   NEITFSMVYAYSEHYVLPISHDEVVYGKGSLYGKMPGDDWQKLAGVRSMFAYQWAHPGK
FT                   KLSFMGNELAQWGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPA
FT                   GFQWLTSDDADHNTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDD
FT                   AKYGGSDIHNGTFEAVEGEYHSRPFSAKITVPALGVVFLKPED"
FT   CDS_pept        806270..806863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0638"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70781"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN7"
FT                   /protein_id="BAJ70781.1"
FT                   /translation="MSYKVGDMVVYPRHGAAKVEAITERTVKGVTREYLQLSVLSSDGL
FT                   VINVPVDNAKKVGVRDIVSASEVAKVFGILRTPIIEKEMNWSRRYKLNVEKIATGDVNK
FT                   IAEVVRDLAQRDVDEHGLSAGEKRMLTKARAILTSEIALSEKIDEAEAQRLLDVNLGYE
FT                   PAQPGDDKHHTAEPEEAAADTLARVEAEKKSKKK"
FT   CDS_pept        806987..807496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0639"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70782"
FT                   /db_xref="GOA:E8MSN8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN8"
FT                   /protein_id="BAJ70782.1"
FT                   /translation="MLIGQGFDAHRFAPAGSGRELWIAGLYWPVPDSCSEADAAKYEGI
FT                   EGDSDGDVAAHALIDALLAAARLGDIGSLFGVGADAHGAGMHGIDMLQEVVAHLASNGY
FT                   TPASASVAIIGNRPKIGTRRAEAEAALSAAVGCPVSVTATTTDHMGFTGRGEGIAAIAN
FT                   ALVEKI"
FT   CDS_pept        complement(807548..808381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0640"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70783"
FT                   /db_xref="GOA:E8MSN9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSN9"
FT                   /protein_id="BAJ70783.1"
FT                   /translation="MSTINFSYDPEWLDTLSAPFMTNAFIAGLCIALAAGVMGYFTIAR
FT                   RSTFAAHALAHIGLPGATGAVLLGLPVSLGMGVFALGGALVIGALGKRVSEREIATGTV
FT                   LAFATGLGLFFARLSSSASQQMQSILFGSILTITTGQIIGFAVFDVLLLALLAIIYRPL
FT                   LFSSLDEQVAQAKGVPIGLMNVAFMAIMAGVITIAVPAVGTLLIFALVITPAATANILA
FT                   GSPFKAMVIASVLCLVSIWAGLVLSAMFPAPPSFIIVTLSTLFWAIAKAVETMRK"
FT   CDS_pept        complement(808448..809338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0641"
FT                   /product="ABC transporter ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70784"
FT                   /db_xref="GOA:E8MSP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP0"
FT                   /protein_id="BAJ70784.1"
FT                   /translation="MSETSDCIVFSDAAIKRGDHIIWQHGTFAIPTGSVTAIVGTNGTG
FT                   KTTMMRAELGLLPLCHGSLTVLGKPAGEMNKRIGYVPQSYVANVDSNLTAEQSVLLGLT
FT                   GTRFGIHPITKAQKAKALKAMEFTGIADKARYRLSELSGGLRQRVAIAQALVCDPQLLM
FT                   LDEPLANLDLASQRATVHVLAKLNRELNMTIQVVAHDLNMLLPILTGAVYLLDGHPHYA
FT                   DMHKVLDSDLLTHLYGTQVQVVTTPQGDMFVTPTPDELQDQPQDMHTAAEVAQLHHHEH
FT                   GNATNGSAAISAENR"
FT   CDS_pept        complement(809511..810707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0642"
FT                   /product="ABC transporter substrate binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70785"
FT                   /db_xref="GOA:E8MSP1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP1"
FT                   /protein_id="BAJ70785.1"
FT                   /translation="MGTQITRLTRLAAAGLSAVLLFATTACAATSPAETEPDNKTSVPA
FT                   PTGPINVVASLNQWGSLAAELGGDDVEVTSIVNSTNVDAHDFEPKTSDVAKLSKAQIIV
FT                   ANGAGYDSWATKSMTKTTNIVSAASVMGAVEGDNPHLWFSKDARSSMATAITDAYIKAL
FT                   PSKKKAFQKRLKAWQADEKSLETWASEFTKSHSNLTYAATEPVVYYLMADLGFKDQTPK
FT                   GYTQSTASGGEPAPADLQSFQKLIEDKGVDVLVNNTQEASDATNMITGAAGRADVPVVD
FT                   VSEQMPKDADTLNAWINQLINTIIDAVDPSYGCEDATDGDTADSNANSDDSSAEGSATD
FT                   DANAQDSKASTGSSTDPKYIRQCKAAASSDSSQDSAKADAANGDSGDASGNDQTDSGK"
FT   CDS_pept        810811..811686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0643"
FT                   /product="methylenetetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70786"
FT                   /db_xref="GOA:E8MSP2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP2"
FT                   /protein_id="BAJ70786.1"
FT                   /translation="MSTKIDGKQIAAEIKTNLAERVNKLKAQGIQPGLGTLLVGEDPGS
FT                   MKYVAGKHADCQEVGITSVKKELPADASFDDIAAAVRELNEDPACTGFIVQLPLPKGIN
FT                   ENAIIDMIDPAKDADGMHPYNLGELVLHVRGDISTPLPCTPRGVLELLDAYDIDLNGKE
FT                   VCVLGRGITIGRTIGLMLTRNAVNATVTLCHTGTRDVADHMRRADVIVAAMGSAGFVTP
FT                   DKIKDGAVLVDVGVSRVYDEEAGRYRIKGDVDKACYDKASAYTPNPGGVGPMTRAMLLA
FT                   NVVEMAERHA"
FT   CDS_pept        811806..813281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0644"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70787"
FT                   /db_xref="GOA:E8MSP3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP3"
FT                   /protein_id="BAJ70787.1"
FT                   /translation="MAENNTEVTKVAINDIGTEEDFIKAVDSTIKNFDDGDLVEGTVVK
FT                   IDHDEVLLDIGYKTEGVIPSRELSIKKDVDPDEVVEVGDTIEALVVTKEDKEGRLILSK
FT                   KRAQYERAWGDIEKIKEADGVVEGTVIEAVKGGLIVDIGLRGFLPASLVEMRRVRDLSP
FT                   YIGQKIKAKILELDKNRNNVVLSRRQYLEETQSEVRETFLSQLKKGQIREGVVSSIVNF
FT                   GAFVDLGGVDGLIHVSELSWKHIDHPSEVVKVGDKVTVEVLDVDLDRERISLSLKATQE
FT                   DPWQRFARTHVPGQIVKGKVTKIVQFGVFISVEDGIEGLVHISELANRHVENPETVVKP
FT                   GETVFVKVIDVDLDRRRISLSLKQANDSVDPASEDFDPAIYGMPAEYDEQGNYKYPEGF
FT                   DPNTNEWIAGYEKQREEWESQYAAAHELWEEHKEFVAKELENAAESAAADGQGPKEEKP
FT                   VEETSNYSSAAPATGTLADSDQLAALRDQLLGK"
FT   CDS_pept        813455..814072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0645"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70788"
FT                   /db_xref="GOA:E8MSP4"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP4"
FT                   /protein_id="BAJ70788.1"
FT                   /translation="MGTMMRIGLTGGIAAGKSTVAARLKQLGALHIDYDALAHQIVEPG
FT                   GVALPQIVAEFGPDALLADGTMNRPWIADHVFGANAAPGARERLDAIEHPLIYAEAARL
FT                   EHEHPEAAIIIHDIPLLAEVIDDIPFAFDHIVTVEAPVCMRLDRMVEERGMSLEQAEAR
FT                   IRHQSSEEERRAIADIVIDSTHPLPEMLAQVGEIYAGWCAGR"
FT   CDS_pept        814084..816195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0646"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70789"
FT                   /db_xref="GOA:E8MSP5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP5"
FT                   /protein_id="BAJ70789.1"
FT                   /translation="MGFNIERADKPFVVKSPYKPSGDQPQAIAELAERIENGENDVVLM
FT                   GATGTGKTATTAWLIEKLQRPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYYDYYQ
FT                   PEAYIPQTDTYIEKDSNINDDVERLRHQATANLLTRRDCVVVATVSCIYGLGTPEEYAG
FT                   RMLFLKVGQEINRDDLLRQFVAMQYKRNDIAFTRGTFRVRGDTVEIIPVYEELAVRIEF
FT                   FGDEIDRISTLHPLTGDEIDEENEVHIFPASHYVAGPERMERALKTIREELDERLAELR
FT                   KQGKELEAQRLNMRTTYDLEMLTQVGVCSGVENYSRHFDGRAAGTPPHTLLDFFPDDFL
FT                   LVIDESHVTVPQIGAMYEGDASRKRTLVEHGFRLPSAMDNRPLKWPEFLQRVGQTVYLS
FT                   ATPGDYEMGLSDGVVEQIIRPTGLLDPKIDVRPVKGQIDDLLAEIKARVAKNERALVTT
FT                   LTKKMAEDLTDYLLERGIKVEYLHSDVDTLRRVELLRMLREGKIDVIVGINLLREGLDL
FT                   PEVSLVAILDADKEGFLRSYRSLIQTIGRAARNVSGTVIMYADETTEAMRQAIDETDRR
FT                   RAKQIAYNQEHGIDPKPLIKKISDVNDMLAKEDVDTQTLLEGGYRNAGKAGNTHLGVPV
FT                   LDPNEADKRHEEILKAGLPAQDLADLIRQLSEQMHTAAEQLQFELAARLRDEIRDLKKE
FT                   LRQMTEANK"
FT   CDS_pept        816364..817350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70790"
FT                   /db_xref="GOA:E8MSP6"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP6"
FT                   /protein_id="BAJ70790.1"
FT                   /translation="MAETPLAFEIITFVVLALFFIVDLFVIGRRPHVPSTKECVQHIAF
FT                   FVVMALIFGGCIWFFAGSKPAIEFYSGWLTEYSLSIDNLFVFVIIMSNFAVPKQIQKYV
FT                   LSIGITIALIFRGIFILIGAALISRFTWVFFLFGAFLIYTAVKLVLGGDEDEEYHENGI
FT                   IRNLRKIIKITDDYDGEKLRTTKNGVRYWTPMLIVFLTIGTTDVMFAFDSIPAIFGLTK
FT                   DPFLVFTSNVFALLGLQQLYFLLGALLDKLVYLPAGLSVVLGFIGVKLIMEALHGNTLP
FT                   FINGGEGVHWVPEVPTWLSLAVIVLAIGGASVASVIKMKSMESAEKA"
FT   CDS_pept        817518..818960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0648"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70791"
FT                   /db_xref="GOA:E8MSP7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP7"
FT                   /protein_id="BAJ70791.1"
FT                   /translation="MRKAKIVDTIGPSTEDYDNLLKLVEAGMDVARLNRSHGTPEDHLK
FT                   VYNNVRKASEATGRNVAALVDLQGPKIRCGWFKKNADGEDKVQLQLGQEFVITTDDVEG
FT                   DEHITSTTFKGLPGDCHPGDPILIDDGKVRLEVTKVEGNNVYTKVVVAGPVSSHKGINL
FT                   PGVAVSLPALTEKDEADLRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIIAK
FT                   IEKPQALENLEEIVKTFDGVMAARGDMAVECPLEEVPLATKRIIELARQYAKPVIVATE
FT                   VLGSMVNSPVPTRAEASDCANAILDGSDATMTSNETAVGKYPDVTVATMARISGYATDH
FT                   GFDRIPELKNLDMSSTGAVSSAAVDLADKLNAKAIVAYTQTGATVHRVSRERPAAPIYG
FT                   LTSNEHTYHWLALSWGTEAFLLKEDYHDKSRKDLMVYTDKVLKDAGKVADGDKIVILSS
FT                   AQGDHQPGRTDSIYVHTVGACD"
FT   CDS_pept        complement(819108..819707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0649"
FT                   /product="putative NTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70792"
FT                   /db_xref="GOA:E8MSP8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP8"
FT                   /protein_id="BAJ70792.1"
FT                   /translation="MSNETYRQFDPWRPSPVKEISRRQIVETHYFNVDHVSYESNQIGS
FT                   FERYFVQENNGDTVAVLAVTDDGMIPLVEQYRIANHRWTLEIPAGHANNPSERPTDVAK
FT                   RKLAEEAGFDATKLTQFTRFMNTPSYSTQHTAIFFATGLTPASRQEIGPETPRSDVRMV
FT                   SVDDAYEMVVNGTIVDAKTMVAILRLKSGTLDHLND"
FT   tRNA            819912..819985
FT                   /locus_tag="BLIF_tRNA22"
FT                   /product="tRNA-Leu"
FT   CDS_pept        820053..820838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0650"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70793"
FT                   /db_xref="GOA:E8MSP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSP9"
FT                   /protein_id="BAJ70793.1"
FT                   /translation="MAARKKSEEPSINIDEVLTDEELKAVANESEPAERKAKPEDGPRT
FT                   VVVAEDEAVNRMDLVAMLEDNGYEVVGQAANGEEAVELTRKYRPDVVCMDVKMPRMDGI
FT                   TAAGIICDENIAPVVMLTAFSQTDLVKKATGAGAMAYVTKPYEESKLLPTLEVAMGRFA
FT                   EINDLLDSVERSERKLKETTDQLKETEEKLKKAEDTLEERKLVDRAKGLLMDKADFSEQ
FT                   GAFRWIQKTSMDQRIPKKRLAQAIIAKYGDPKPSDSGER"
FT   CDS_pept        820899..823751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0651"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70794"
FT                   /db_xref="GOA:E8MSQ0"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ0"
FT                   /protein_id="BAJ70794.1"
FT                   /translation="MTVPTNETLLVVDGHSLAFRAFFALPVDNFSTSSGQATNAVWGFA
FT                   TMLAQVIDAEKPDHLGVAFDVKGGTFRNEMLPQYKGTREAAPEELLTQLPLIQRMLTAL
FT                   GVTYIEKPGFEGDDVIATLATMGDKAGYHTLVLSGDRDAFQLVDDNVTVLYPGHHFKDL
FT                   KHMTPQSIIDKYKVTPAQYPDLAALRGETADNIPGVPGVGDGFAAKWINQFGSLDGICE
FT                   HADEIGGKKGESLRANIDQVKLNRKVNALVRDVDLGVDIEDLTFGTVDVAQIDALFKEL
FT                   EFGPRTKSRVLKTFNTGAKASNTSGAGESTNNEQNEQDSSLDLNLPEPTSITAPEQFDE
FT                   WVKAHRVEVKVPGEIADFTVSDYGDGSQRHAICGDAVGHAWTVAAWGDERPGRATAQAI
FT                   AVATATSAAIVPLPITDTLRAQLARFLKSEHSRTIVHGYKELLHLLGAVDLDMDLPMFD
FT                   TKLAGYLAQPDFHADSLKQAAEHFLDIHFTETEQPSQGTLDFDDDQVEEDPNEHRLRDL
FT                   AIIRSLAVTLGPIIDEREQCWLMRAIELPVSRVLHGMEHTGAKVDSVRLVSMRDQFAAE
FT                   ARQAQEMAWEYAGTEINLQSPKQLQKVLFEDMGLKPTKRTKSGSYTTNAAALQDLYVKS
FT                   VDNERANGFLGALLRHREINKLKQIVQTLIDATNTSDERIHTTFEQTVAATGRLSSVDP
FT                   NLQNIPNRNAAGREIRGVFVPGEGYEALMSCDYSQVELRIMADLSDDEALIEAFRSGAD
FT                   FHKYVASMVYKLPVDQITGDQRSHVKAMSYGLAYGLSTYGLAQQLKIAPREAEALKNRY
FT                   FDTFGKVHDYLESLVANAREKGYTETIFGRRRYFPALHSTNRVAREAAERAALNAPIQG
FT                   SAADIMKIAMIRAEQTLAEAHVKSRIILQIHDELVVEIAPGEGDQVTELVRNAMEHAVD
FT                   LAVPLDVSCGIGSDWQLAAH"
FT   CDS_pept        823921..824841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0652"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70795"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ1"
FT                   /protein_id="BAJ70795.1"
FT                   /translation="MPNLKQVIDVLETLYPLRYAEEWDEPGLIVGDLSHDVHRIVFAAD
FT                   PTSAIIDKAIATGADLLITHHPLFFRSVHETSGLGFRGDIVRRLYQHGCGLWVGHTNAD
FT                   AAYRGVGQAAADYFGLIDQKPLVPIDDANASHPVGLGRVGRLPKPVALKDFAQRVFDEV
FT                   SDHGMTTALGIQVCGDSDTFVQYVAILPGSGDSLFNEVRATGADVYVTSDLRHHPVTDA
FT                   IEQARYEARMRSQGIMLGHGMAGESHVRPCFINTPHAAIESMWFNYAIDDVPAAIEQAT
FT                   GARPEVEWFHDTTDPWTLSITAHRD"
FT   CDS_pept        824887..825561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0653"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70796"
FT                   /db_xref="GOA:E8MSQ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ2"
FT                   /protein_id="BAJ70796.1"
FT                   /translation="MFGGSKQEQLEHRLDHKLNASSDGIDMDVPAKVISSETVYTGRIF
FT                   HVDDMRIALTDKQGKEHEIGRQVLRHAPCVVMLVHDMSTDRYLIEREYRAGSDMFAYGL
FT                   PAGLMDEGEDIMDAALRELAEETGVVPDRDTMGVDFVGDFYSSEGMTDELAHIMVLHLG
FT                   PFRREQRHFDADEHVESAWIPWSDLAATRITSSNSMIAIQHEALRRLIARNSDKDKPSL
FT                   FS"
FT   CDS_pept        825636..827756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0654"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70797"
FT                   /db_xref="GOA:E8MSQ3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ3"
FT                   /protein_id="BAJ70797.1"
FT                   /translation="MYPLGASYDGAGVNFALYSQVAQKVELCLFDEHDAETRIEMTEQN
FT                   SYVWHNYIPGLQPGQRYGYRVYGPYDPMHGLRCNPNKLLLDPYAKAIEGNIDGDESLFS
FT                   YWFKSPDDTSAMNDLDSAAHTMKSAVINPYFDWGNDQHPYISYHDSVIYEAHVRGMTNL
FT                   NMDVPPDIRGTYAGLAYPSVIEYLKKLGVTAIELMPIHQFVNDSFLQEKGLSNYWGYNT
FT                   IGFFAPHNAYSSSGERGEQVNEFKSMVKAYHHAGMEVILDVVYNHTAEGNHMGPTLSFK
FT                   GIDNASYYRLVEGDQQHYFDTTGTGNSLLMRSPHALQLITDSLRYWVTEMHVDGFRFDL
FT                   AATLARQFQEVDKLSAFFDIVEQDPIISRVKLIAEPWDLGSGGYQVGGFPSSWSEWNGR
FT                   YRDTVRDFWRSQPSTLPEFASRLMGSSDLYQVNGRRPVASVNFITAHDGFTMNDLVSYN
FT                   EKHNEANGEGNRDGESNNRSWNCGVEGPTNIPDVNDLRQRQMRNMFATLLFSQGIPMIC
FT                   GGDEVARTQQGNNNAYCQDNEISWTNWHLDKGRKELLAFVSKLIHLRLDHPVLHRRRFF
FT                   TGREPGDDSNTIPQVEWFDHTGSIMDMDDWQNTHAFSMMIYLNGSDIPEVDWYGNRMVD
FT                   NDFILIFNAHYEPIMFTLPDERYGRKWQLVVDTHNPNEPALSYEAGFMITAQSRSFLML
FT                   MSAKKPKKPMGL"
FT   CDS_pept        827894..828094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0655"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70798"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ4"
FT                   /protein_id="BAJ70798.1"
FT                   /translation="MLAGKRARLVEQLAEIQDSIDFVDAKQRFYDDVLSGATPYVSVLI
FT                   PSAALAKESEEPGELKGVERK"
FT   CDS_pept        828243..828728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0656"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70799"
FT                   /db_xref="GOA:E8MSQ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025868"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ5"
FT                   /protein_id="BAJ70799.1"
FT                   /translation="MSIGQVIKVVREERGLTQSQFAHELFVTQQALSRWEKGTAEPSID
FT                   MIRLISTRFEVPMARLMEMPDNGFCQSCAMPFYCPEDHGTEPDGTRNGDYCNYCYEDGV
FT                   FLQDYANSDELVAACAPMMAESCHISVEQAEDCMSALLPNLKRWRRQDEIDAVAEGK"
FT   CDS_pept        828732..829382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0657"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70800"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ6"
FT                   /protein_id="BAJ70800.1"
FT                   /translation="MAFDYKKEYKDLYQPKRMPAIVTVPAMRFVAVDGVGDPNEEGGDY
FT                   AKAMQLLYGISFTIKMNKKSNNPDEHIDGYFDYTVPPLEGLWSMEKGVPGVDYTRKTDF
FT                   YWTSMIRLPEFVTDEVFAWAKASFASKHPEVDINRAYLFDFDEGVVAQVMHKGPYDDEP
FT                   ATVTILDGYARSQGYGLDFSDARRHHEIYLSDPRRAKPENLKTIIRHPVVKVG"
FT   CDS_pept        complement(829552..830106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0658"
FT                   /product="glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70801"
FT                   /db_xref="GOA:E8MSQ7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ7"
FT                   /protein_id="BAJ70801.1"
FT                   /translation="MDDIRPRCGWCNLSNPVYVAYHDAEWAVPSHDDHHLFEMLVLETF
FT                   QAGLSWETILNKRKRFRQAFDGFDIERIRRYDENKIAELMNDPGIIRNRRKIVATVGNA
FT                   NAFRDIQTSYGSFDDYIWRFTGRHVIYETGMTTSPLSDAIAVDLKTYGMRFIGTTIVYA
FT                   YLQSIGVINAHEPGCFLHRER"
FT   tRNA            complement(830570..830646)
FT                   /locus_tag="BLIF_tRNA23"
FT                   /product="tRNA-Pro"
FT   CDS_pept        complement(830920..833991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0659"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70802"
FT                   /db_xref="GOA:E8MSQ8"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ8"
FT                   /protein_id="BAJ70802.1"
FT                   /translation="MTDVTHVDRASQAWLTDPTVFEVNRTPAHSSHKWYARDPQSGQWS
FT                   DLKQSLDGEWRVEVVQAADINLEEEPATAESFDDSSFERIQVPGHLQTAGLMNHKYVNV
FT                   QYPWDGHENPLEPNIPENNHVALYRRKFTVSAPVANAKQAGGSVSIVFHGMATAIYVWV
FT                   NGAFVGYGEDGFTPNEFDITELLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVE
FT                   LAARPHVHIENTQIEADWDPEAGTASLDAALTVLNAADAATVRATLKDADGNTVWQTTG
FT                   DAEAQTAISSGPLQGIAPWSAESPTLYELDVDVIDQAGDVIECTSQKVGFRRFRIEDGI
FT                   LTINGKRIVFKGADRHEFDAERGRAITEQDMIDDVVFCKRHNINSIRTSHYPNQERWYE
FT                   LCDEYGIYLIDEANLEAHGSWSLPGDVLTEDTIVPGSKREWEGACVDRVNSMMRRDYNH
FT                   PSVLIWSLGNESYVGDVFRAMYKHVHDIDPNRPVHYEGVTHNRDYDDVTDIETRMYSHA
FT                   DEIEKYLKDDPKKPYLSCEYMHAMGNSVGNMDEYTALERYPKYQGGFIWDFIDQAIYAT
FT                   QPDGTRSLRYGGDFGDRPSDYEFSGDGLLFADRKPSPKAQEVKQLYSNVHIDVTKDSVS
FT                   VKNDNLFTATGDYVFVLSVLADGKPVWQSTRRFDVPAGETRTFDVAWPVAAYRADAREL
FT                   VLQVSQRLAKATDWAESGYELAFGQTVVPADATATPDTKPADGTITVGRWNAGVRGAGR
FT                   EVLLSRTQGGMVSYTFAGNEFVLRRPAITTFRPLTDNDRGAGHGFERVQWLGAGRYARC
FT                   VDNVLEQIDDSTLKGTYTYELATAQRTKVTVSYTAHTDGRVNLHVEYPGEQGDLPTIPA
FT                   FGIEWTLPVQYTNLRFFGTGPAETYLDRKHAKLGVWSTNAFADHAPYLMPQETGNHEDV
FT                   RWAEITDDHGHGMRVSRADGAAPFAVSLLPYSSFMLEEAQHQDELPKPKHMFLRVLAAQ
FT                   MGVGGDDSWMSPVHPQYHIPADKPISLDVDLELI"
FT   CDS_pept        834322..835809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0660"
FT                   /product="galactoside transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70803"
FT                   /db_xref="GOA:E8MSQ9"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSQ9"
FT                   /protein_id="BAJ70803.1"
FT                   /translation="MSNENVADGDVRRKGGLGQRIAYACGNLGQAAFYNAMSTYFVTYV
FT                   TSCLFVSYSKALAAQMIAVITGLIVVIRIAEIFIDPLLGNLVDNTTTKWGRFRPWQFIG
FT                   GLVSSVLIVLIFSGMFGLVNVNTTLFIVLFIITFIVLDVFYSLRDISYWGMIPALSSDS
FT                   HERSTYTALGTFTGSIGYNGITVIVIPIVSYFTWTFTGAKGQGQAGWTSFGFIVALLGL
FT                   ITAWTVAFGTKESTSALRAKAQKNGNPFEAFKALFQNDQLLWVALSYLLYAIANVITTG
FT                   VMYYLFVFVLDEPAAFSITGIIPLIAGFIMAPLYPILNRWIPRRYLFTGGMVSMIIGYT
FT                   MLALFSSNLPVVIVALIFFYVPGQFIQMTAILSLTDSIEYGQLKNGRRNEAVTLSVRPM
FT                   LDKIGGAMSNGAVGAVALAAGMTGHATAADMTASNIATFKTFAFYVPLVLIILSLVVFW
FT                   FKVKIDEKMHAQIVEELEAKLASGEIVDDEAQAVIKN"
FT   CDS_pept        836281..836730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0661"
FT                   /product="truncated beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70804"
FT                   /db_xref="GOA:E8MSR0"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR0"
FT                   /protein_id="BAJ70804.1"
FT                   /translation="MTVAGPHVQVLASYAGEEADEWELDGMAAITRNTYGEGEAYFLGC
FT                   DLGVSDLTRFVGGWLAAQPQDGRQPEANLRSPASGVTSDVLHTVRQSDDAIFDFYLTRG
FT                   RSDVELRDIAGEPIVLFRAERGSDGGAYTVHRNGVFVTKRPNPSV"
FT   CDS_pept        837448..838620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70805"
FT                   /db_xref="GOA:E8MSR1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR1"
FT                   /protein_id="BAJ70805.1"
FT                   /translation="MGRHQRAETSGLISFLICAVVGAVSMNLYMEYAPAIWQLTQRRFM
FT                   VCSGIVAACGVISFIIGYARKSRSLNLKHGWFAPIRRIFEIVALSVVYASTIFLSSFAL
FT                   IGAANDMMGNAIFSGYISSVCAAFAGVVGYMTFVQAEMMNAKTIASLLPFFVISGVVTA
FT                   GMTTDDPYWYHNNFSQLGDRTTFAARMFNSTLILAGTCIIIVSYFAISELVTTERLQRL
FT                   WHDRTNRDPNRGYEIPHFMLRISILSFLLMVAGLAFIGIGVFRYTPHNLLHNICAKGLP
FT                   FVMLLLFVLLPWLAPRLSKAVMVASDLTALVCAAFWVNMMMGHNTLTNVEALAGLAFLG
FT                   WFIVFSRQIAAIEADRAAAQLLHAQAIEGGFEQPSSAPDQQIESRIAADR"
FT   CDS_pept        838647..839984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0663"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70806"
FT                   /db_xref="GOA:E8MSR2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR2"
FT                   /protein_id="BAJ70806.1"
FT                   /translation="MTERLTNLWPAPLAAQPLNATVTVPGSKSLSNRYLILAALGSKPV
FT                   TLIGLLRSRDTDLMMGALEALGVRCDVDSATDTTVTVTPPVSGRFHGNVNVFCGLAGTV
FT                   MRFVPGLALFADGPVNFDGDEQAYARPMKPVLDGLEQLGATVDYHGEVGRLPFTITPPA
FT                   TLPAAQAQVSIDSSGSSQFISGLLLISSKLPGGLHLAHTGEKTPSLPHIRMTVADVTGA
FT                   GGAVEADESARTWTVEPRAMQLSSKVTVEPDLSNAAPFLGAALIAGGTVRVPHWPETTT
FT                   QPGGLLPGYLEQMGAEVSFPTIGGVRYCEVTGDGTVRGLGTFDLTAAGEIAPSLAAILV
FT                   FADKSTDMVGIGHLRGHETNRLEALVNEIRRVGGAAEELPDGLRIEPVPAETLHGAVME
FT                   TYADHRMATFAAMLGLRIPDIEVINVATTRKTLPDFVGMWSGMLRQ"
FT   CDS_pept        complement(840230..841459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0664"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70807"
FT                   /db_xref="GOA:E8MSR3"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR3"
FT                   /protein_id="BAJ70807.1"
FT                   /translation="MAKTVLVINSGSSSIKYQLVDLESGEGLASGLVEKIGEPVYGHYK
FT                   HEYNGEKHELEEPIHDHEQGLKRVLGFFEEYGPNLSEAGIVAVGHRVVQGGSIFPKPAL
FT                   VTNKTINQVKDLAVLAPLHNGPEAKGAEVMRSLLPDVPQIFVFDSSFFFQLPKAASTYA
FT                   LNKEIADQYHIRRYGAHGTSHEYISSVVPDVVGKPAEGLKQIVLHIGNGASASAEVSGK
FT                   PVETSMGLTPLEGLMMGGRTGDIDPAVVFHLIRNAHMNVDELDALFNKRSGMMGMTGYG
FT                   DLREVHRLVSEGNEDAKLALDVYVHRIVSYIGNYTYQMGGCDVITFTAGVGENDDVVRK
FT                   MVCDKLAPFGVKLDEEKNATRSKEPRIISTPDSSVIIAVIPTNEELAIARKSAAIAEAG
FT                   TDTYGNTFAK"
FT   CDS_pept        complement(841594..843264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0665"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70808"
FT                   /db_xref="GOA:E8MSR4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR4"
FT                   /protein_id="BAJ70808.1"
FT                   /translation="MTVTRVYIASPEGANGRNVVAYGMLNALTSKYKTMVFRPAVSNHD
FT                   EFTPILLAASNAGLGVALSTGLDVHKVREDKDTARGDIVGAFNDAMDVSRADAALIVGT
FT                   DKSHVNDPTSYEFDANVAADLKAGVFLAVCTIDRWPHELDETVKLSIEGMEAAGNKVLG
FT                   IFVTGCEPRHAFSVKETLAKYGLPVWTLPQVPFTDESTKDLALETFRKNAPTDEVLAAL
FT                   DVDVTAPITPYAFQFGLLGKAKSNKKTIVLPEGEEDRIIKAADYLLEREIVNLIIVGNK
FT                   DAILARGKELGLNYLERARFQAMDDENVLKPMVAKLCELRAKKGMTEEQARKQLADASY
FT                   FGTMLVVLGYADGLVSGSVNSTANTVRPALQVIKTKPGQKLVSGAFLMCFKDHVAVFSD
FT                   CAINLNPDAEQLSEIALQSAETARAFGIDPKVGMLSYSTLGSGKGPDVDMVEEATKLLK
FT                   EKAPDLPVVGSIQFDAAWSPTVAATKAKGNDVAGHVNVFVFPDLCAGNIGYKAVQRSSG
FT                   ALAIGPVLQGLNKPVNDLSRGALVQDIINTIALTAIEAQ"
FT   tRNA            complement(843468..843543)
FT                   /locus_tag="BLIF_tRNA24"
FT                   /product="tRNA-Ala"
FT   tRNA            complement(843630..843705)
FT                   /locus_tag="BLIF_tRNA25"
FT                   /product="tRNA-Ala"
FT   CDS_pept        complement(843924..844622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70809"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR5"
FT                   /protein_id="BAJ70809.1"
FT                   /translation="MTNHVRSVFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAA
FT                   ALKRLYVDRRQEINHRFIVCSDLKRAHATAQAFADVLGGIEPVDDRRVRERSFGDWDGH
FT                   AVAELAERYPEDFRSWMESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFS
FT                   HGAWIAQTLQTLLGISAIDPTFSTVVSLRNAHWVRLVPMDNPDGTVRWRLLDYNHGPAI
FT                   ADTDEWERER"
FT   CDS_pept        complement(844755..845168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70810"
FT                   /db_xref="GOA:E8MSR6"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR6"
FT                   /protein_id="BAJ70810.1"
FT                   /translation="MPALQDSINAVRVAAEAADRIKATDIVAFDVADLLGITDIMMIAG
FT                   ASNERQVLAVAEEIEKDLFLKCSGRQPRSREGLTEGQWVLLDYGDFVIHVMHEESREFY
FT                   GLERLWRDCPAIDLELAHPETAEHAEDAAVTTA"
FT   CDS_pept        complement(845172..846554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0668"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70811"
FT                   /db_xref="GOA:E8MSR7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR7"
FT                   /protein_id="BAJ70811.1"
FT                   /translation="MALSAAIVLAAGEGTRMRSNKPKVLHAFAGKTFLNRVMDSVAALN
FT                   PDTLAVVVHFQAERVAEAARSYDEQVTIVNQDDIPGTGRAVQCAMAQLTEAGKVDGPVL
FT                   IAASDMPLLDSETLHRLVEFHTASGNGATVLTTILDDPTGYGRIIRDREGNVLRIVEQK
FT                   DANRSELAVQEVNTSVYVFEASVLTEAIAGLKSNNAQGEFYLTDALETAKAAGKVGAFA
FT                   APDPLTVEGVNDRVQLAALSKTYNRRVCERWMRDGVTILDPETTWIEDDVQIGRDATIL
FT                   PGSFLQGHTVVGEDAIVGPYTTLIDATVDEGAVVERSRVQESHIGARTNIGPWTYLRPG
FT                   NEFGEDAKAGAFVEMKKAHIGNGTKVPHLSYVGDAQLGDHTNIGGGTITANYDGVHKNR
FT                   TTIGSGCHVGAGNLFVAPVEVGDNVTTGAGSVVRHAVPSDTMVYSENTQHNVEGWKPAW
FT                   ER"
FT   tRNA            complement(846649..846719)
FT                   /locus_tag="BLIF_tRNA26"
FT                   /product="tRNA-Gln"
FT   CDS_pept        complement(846836..847867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0669"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70812"
FT                   /db_xref="GOA:E8MSR8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR8"
FT                   /protein_id="BAJ70812.1"
FT                   /translation="MGDMVSAILEGKPDKNLILVTGRIHPKLAEDVAEQLGIDVLETTA
FT                   YDFANGEMYVRYTESVRGADVFVLQSHYKPINKAIMEQLIMIDALKRASARSITAVCPL
FT                   LGYSRQDKKHRGREPISCRLVFDLLKTAGADRIMSVDLHAAQSQGFFDGPVDHLVAMPV
FT                   LVDYIRDRFQGHLDNVAVVSPDAGRIRVAEQWAQRLGGGPLAFVHKTRDITRPNQAVAN
FT                   RVVGDVAGKDCVLVDDLIDTAGTIAGACHVLQDAGAKSVTVVATHGVLSGPAIERLKNC
FT                   GAREVVLTDTVPIPEEKRWDGLTVLSIAPLLASAIRAVFEDGSVAELFDTYPEHHGQGF
FT                   LFA"
FT   CDS_pept        complement(847944..849818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0670"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70813"
FT                   /db_xref="GOA:E8MSR9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSR9"
FT                   /protein_id="BAJ70813.1"
FT                   /translation="MKRFVGLDGIKGLALIAIVLYHCMQQRLPGGFYGVDVFFTVSGFL
FT                   IAVSLIRSLAETGSLNLVRYIPKRAVRLYPALFLLIPVIVSVGWLFDHDILVSIRDQVI
FT                   TVLLGCYNWYAIAGGQSYFDQMNPQVFRHLWFIGVLMQFYVIVPFIVWLMWKLRQTKLP
FT                   SLIPLGLAAFSSIAMWVMYVPKGDPTRVYFGTDTHSMGLMLGVALAWWVTAPQLGHARQ
FT                   RAVPMPRTISSSASAAAHRAPLPRIPVEHRIWNAAAPVLAFLSLIALVTMAVIGKQDAF
FT                   AFRGGIILSSLLSVLLIAGTISDDSWMQSLMVFKPLASLGKYSYGIYLWHWPLWILSSA
FT                   LAPKIFKAVGPWPLIMTALLTAIAVMISWLMVEKPAATHSVISVVVPLRTNKKNHAARV
FT                   IAVDVILVLSLVGCAQGIAHAPAKTTMQIQLEQQAAQLERMQKTEHVLLRHAVPAPPKP
FT                   KHEMPTGDQITAIGDSVMLASSQGLSEVFPGIQTDASVSRSIMVAPELIGNALSAGSLR
FT                   QWVLIGLGTNSAITPDQLDQIRNMIGPDRVLVLVNAHGDRTWIPPTNQVLADYAAAHPD
FT                   NVVLVDWDATANANAQVLGSDGIHPSMDSDIYAKAVKQAIEQWIASGR"
FT   CDS_pept        complement(849994..851475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70814"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS0"
FT                   /protein_id="BAJ70814.1"
FT                   /translation="MRQGFDNEKYIELQAANIRKRIAQFGGKLYLEFGGKLFDDYHASR
FT                   VLPGFEPDTKFRMLESLVDDVEIVIAINANHIEKGKTRGDLGIPYDEDVLRLIDVFRSR
FT                   GFLVGSVVLTQYANQPAADAYRHRLEQLGVTCRLHYPIAGYPHDIERIVSDDGYGRNEY
FT                   IETSRPLVVVTAPGPGSGKLATCLSQLYHEHQRGIDAGYAKYETFPIWNLPLNHPVNIA
FT                   YEAATVDLDDANIIDPFHLEAYGETTVNYNRDVEAFPVLKAMMERIMGESPYQSPTDMG
FT                   VNMAGYAIVDDDACRDAARLEIVRRYFAAAVHLKRTGTGEEQVERLRSIMNRAGVTPDL
FT                   SPARAVALEKEAATGAPAGAMVLPDGHVVTGKTGDLLGAASALLMHALKAVTGVDETIP
FT                   VIDDAAIEPICRLKTEHLNSVNRRLHSDETLIALSITSATSPVAARVIDGLKQLQGCDA
FT                   FFSVIISSTDEALYRKLGINVCCEPKYERVSLYHR"
FT   CDS_pept        851560..852072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70815"
FT                   /db_xref="GOA:E8MSS1"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS1"
FT                   /protein_id="BAJ70815.1"
FT                   /translation="MGNPIRHREQLLPRNVEQGFAWLPKTRWSKRCRRRVRSKSMHGWL
FT                   CGDFPDRSLLGEIFLFPGLLSGVSVFCHVGVVVINFELAVGMENKRHRSPSLFGLKRGP
FT                   FRFNELVDSHKVFHQGCPRNAFLVKAFNEVVFSAASNVILNRERTLGVLGVKHDLAPVF
FT                   GEGFLKN"
FT   CDS_pept        complement(852098..853381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70816"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS2"
FT                   /protein_id="BAJ70816.1"
FT                   /translation="MAFENIEQLMPDTTETRLAFEEAQRTVADCADAAWRDISSGDVLT
FT                   ASISTVQEAADDAWKACEPTLNAAGETVRDGARNGAYLGGRFVLGVADVGENAYVGVQS
FT                   NIELLAEDEEAAVKTAQTHAVDDAANAWGDFMEADEQIREIGDYVETGGEIATEVALGA
FT                   VAVTASAPAALAAGAVLVLDEMGKSLEAGAEDGEISQEDIVGEVVAGTVTAATLLAGRG
FT                   LNNFLASKAAESGASSRILDDAGKAIYEGDRLLPNNEFAIDGVKCATDDLGQLYRVGDD
FT                   LVPNMSYEINGYKYVTDAMGRVESAEGFLQLKTHEGRLTIKDTIQSIGKGFEELFDQRG
FT                   HLIADRFNGSNGLENIVAMGGEVNQKPMQQSSKNAPMLWLMALKRFSRLSHFMRAGHSG
FT                   LARLLSRTLLTAKRRLRFFLTLQRKCNE"
FT   CDS_pept        complement(853382..854035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70817"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS3"
FT                   /protein_id="BAJ70817.1"
FT                   /translation="MLVSKAANLNESQIQELANLQRGVAAIYQNEWTEPVLCHIEPHER
FT                   GLEYSPTQSKHSAKDKVSSEELRYLNSCVLNPFKLDEPREYNFCDCVHKMDIPDSMKAR
FT                   LIEMAGTPLFSRKPLFEWCAYRYFNIGRILDDARDLSADSLKERLCSHLLSSWKFEDDS
FT                   SPESWGPIQYLFIQSMFNAHLNELRKRGTGIETTEKASALAEVSAVLSQTRPVI"
FT   CDS_pept        854187..854642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70818"
FT                   /db_xref="GOA:E8MSS4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS4"
FT                   /protein_id="BAJ70818.1"
FT                   /translation="MPNIGKDDHPKLWSLIFVLIIALTFCCFVMGQGLNSGTSVFLAGQ
FT                   GYGASLAGVLALVFSIAAALARLFVGPVIDNGKCSLVIIAGIAILIAGTALSAVVQGIP
FT                   SSQSAVCCKAWALAQQQQQPRPPQQASYRKNGSAKALDTTASDRLSP"
FT   CDS_pept        854807..855511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0676"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70819"
FT                   /db_xref="GOA:E8MSS5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS5"
FT                   /protein_id="BAJ70819.1"
FT                   /translation="METRLELDSKDGQAPSSTTVTTSETINSEKYPEGDQVSKRTLRDS
FT                   FNIFEPRALPGAIPQMIMCPTFGFGVFFAGLYGTTLGYTHAGLFYTISAVSMIIIRMIS
FT                   KHFMDTVPAIKTMTGAVACGILCCLMLLAAPYGEPVFLASGIFYGLATGISLPLNQSVA
FT                   VKNTPPERWGAANALFLLANDIGIGFASVIWGVINDSFGFQTSIVCVIVCLIASYASAW
FT                   IVYPARDKRWRH"
FT   CDS_pept        complement(855631..855825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0677"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70820"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS6"
FT                   /protein_id="BAJ70820.1"
FT                   /translation="MPNAGELTDEVVDSFLPWSDRVPESCKLDPAAAEKAKEMPDDFII
FT                   NIDPDAFDDEMANNAEEGL"
FT   CDS_pept        complement(855957..856334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0678"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70821"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS7"
FT                   /protein_id="BAJ70821.1"
FT                   /translation="MPRPRAPLIRPNREDRRRRRQGGVCGQRCARGKAQDRRHVQGRLQ
FT                   VRRHGAGRQEGRPRRGAPPAHGGLRGMGAGPASPSLAEAGAAPCAAVRCGVLALRHERA
FT                   RRRGTWSSRTTSPSRPSESSS"
FT   CDS_pept        complement(856502..857203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0679"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70822"
FT                   /db_xref="GOA:E8MRX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX4"
FT                   /protein_id="BAJ70822.1"
FT                   /translation="MSRSLTLTRSVLAGTLAEATPNQLDFIERWFTAELDSRERSKRLR
FT                   LLKQAGFPADKTLDGYDWTNLKMPADWGRAQLENLDFVAGCEDLVLYGPVGTGKSHLAI
FT                   AIGRLACERGVPVRFFTATGLLMRLRRAQQENRLDRELASIGKARLLIIDEFGYLPIDE
FT                   EGSRLLFQIISDSYETRSIIYTTNIEFSGWGRVLGDKNMAAALIDRTVHHGRLIRFEGR
FT                   SYRSEHALMTK"
FT   CDS_pept        complement(857284..858183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0680"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70823"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSS9"
FT                   /protein_id="BAJ70823.1"
FT                   /translation="MTKYSNAKGEVALTGVFSAFVAHYRLEVRFCNPYSGNEKGSVENA
FT                   VGFLRRNLMVPPMRAESYGQLSRLLLERCDGLARDSYCPRLLDVPVAEVFDEERAALMP
FT                   LPSTAFDPVRWESRTADKYGLVDIDSNRYLAGPDSARSKVLAAIRWDTVTLASPATGEL
FT                   LAEYPRQYGRSRNVEDPALVLPRLAVKPRAWRESSIRPDVPDDIRAWLDSMDEKTLRES
FT                   LKAIGDACRAAGFDPAMQACGEILRSNRDMGLHADSLTPIALRMRDGEWEYPGGIEEPD
FT                   LSGYDRFITGTDDGGEER"
FT   CDS_pept        complement(858245..859006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0681"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70824"
FT                   /db_xref="GOA:E8MRW8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW8"
FT                   /protein_id="BAJ70824.1"
FT                   /translation="MNTKTDEGLYEKARKLFISKASIDEFAGWATPRQVDAVHRLLDTE
FT                   LANRERAKHDRLLRRARFPVVKGLDGYDFTNVRLPDGYMLDELLGLGFIPRAQDLVFYG
FT                   KTGRGKTHLAIGLGMKAIDMGLGVRFHQTAELVLQLGKAKRDGTLETMLRDIGRADLII
FT                   LDEFGYVPFDIDGARLLYQIIAGSYERRSIIFTTNIEFSKWGTVFADDKLAAAIIDRIV
FT                   HHGRLLEFTGQSRRVSEALMFGRNTSAQPEK"
FT   CDS_pept        complement(859003..860181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0682"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70825"
FT                   /db_xref="GOA:E8MST1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST1"
FT                   /protein_id="BAJ70825.1"
FT                   /translation="MARLRREFAAERDEAFMDLVWHPGEAQADFGEVDVLLRGVVQRMH
FT                   HFVLDFPYSNVGLVQLMPGENAECTCLALRNLFEWLGGVPERIVFDNAAGVGHKGYGER
FT                   EPRLTHLFQAFQAHYGFDCSFCNPYSGHEKGAVESKVGMVRRKLFVPRPSVWSLENFNA
FT                   GLPDRCLELATKPHYRKDTEERGLFSEDRAALLPLPGKRFDVVTWRHMKADRYGVVTLE
FT                   GRHRYSADRANAGRGVIVGLRALEVEVLDSSGKHLATHPRAYGQASTNSEDPSMQLALL
FT                   CNKPASWPNSRVRDALPDPLREWLDRQDRQTRNEALQTLKRVDRESGWANAVEAMLSIL
FT                   ESTGGADRAGVTLLAARLAEGVAGIEYDDDRPDLSEYDIAFTADVGVQEGGR"
FT   CDS_pept        860218..860544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70826"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST2"
FT                   /protein_id="BAJ70826.1"
FT                   /translation="MLVPQPLPDPGRGMPLLAPVRAILREPLLDHGQIRVDHRRARLSH
FT                   RRHGRQILLREVLTHRRLADMCFPRDRRDGFPVPPQTTDRLYLGHADHNPFRSFLAEIQ
FT                   APSS"
FT   CDS_pept        complement(861345..861881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0684"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70827"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST3"
FT                   /protein_id="BAJ70827.1"
FT                   /translation="MRAPQPEPPIPGSFATPSLLAWIVNGKYVMSLPLYRIETDLKACG
FT                   ATISRQDMANWMMNVHARWLAKVHERMKVELLSHVRIHADETTVQVLKEPNREAKKKSR
FT                   MWLFCSARCNVPVYVFEYHETRRKGVAQEFLAGWSGTLTTDGCIASMFVGRVRQCFSAV
FT                   WADGFPRCRHRFPVM"
FT   CDS_pept        complement(862423..862740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0685"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70828"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST4"
FT                   /protein_id="BAJ70828.1"
FT                   /translation="MASDVFESYSAGTETKPQINQDAVRIMKELYGIDMEKTQYSKLIS
FT                   DIPAPDIAISMGCNVGCPFIGRAFDDNWGLEDPTGSEDQVFVEIIREIEKRILQLKQSL
FT                   I"
FT   CDS_pept        complement(862839..863189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70829"
FT                   /db_xref="GOA:E8MST5"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST5"
FT                   /protein_id="BAJ70829.1"
FT                   /translation="MFDSVTTIGLLLTLVMIFSFQGNTILEKPLHIVLIAVPLILQTFL
FT                   IFAIAYIACRVLKLPYKIAAPAGMICASNFFELAVAVAIALFGTTSPAALATTVGVLTE
FT                   VPVMLFLVKKRK"
FT   CDS_pept        complement(863688..865250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0687"
FT                   /product="GMP synthase/glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70830"
FT                   /db_xref="GOA:E8MST6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST6"
FT                   /protein_id="BAJ70830.1"
FT                   /translation="MANGPVLVVDFGAQYAQLIARRVREAGVYSELVPHSMPVDEILAK
FT                   DPKAIILSGGPASVFEPGAPTIDTKVFESGVPVLGICYGFQVMAYELGGKVDKAALGEY
FT                   GKTSATIDDAAGILADSPAEQTTWMSHGVAVEQAPAGFEVLAHTEGAPVAAMADESRKL
FT                   YGVQWHPEVKHSPLGQKLIENFLHRCAALPNDWDASSIIEDQVKKIREQVGDAEVICGL
FT                   SGGVDSAVAAALVHKAIGDQLTCVFVDHGLLRKGEVEQVKHDFVAATGIRLITVDAADD
FT                   FLDALAGVSEPERKRKIIGEKFIRTFEKAQRQVLEEAGARGKEVKFLVQGTLYPDVVES
FT                   GGGDGAANIKSHHNVGGLPEDIKFQLIEPLRTLFKDEVRAIGTELGLPDEIVWRQPFPG
FT                   PGLGIRIIGEITKERLDLLREADAIAREELSKAGLDRDIWQCPVVLLADVHSVGVQGDE
FT                   RTYGSPIVLRPVSSEDAMTADWSRVPYDVLATISTRITNECRQINRVVLDCTSKPPATI
FT                   EWE"
FT   CDS_pept        865696..868173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0688"
FT                   /product="xylulose-5-phosphate/fructose-6-phosphate
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70831"
FT                   /db_xref="GOA:E8MST7"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST7"
FT                   /protein_id="BAJ70831.1"
FT                   /translation="MTSPVIGTPWKKLNAPVSEEALEGVDKYWRVANYLSIGQIYLRSN
FT                   PLMKEPFTREDVKHRLVGHWGTTPGLNFLIGHINRFIADHGQNTVIIMGPGHGGPAGTS
FT                   QSYLDGTYTETFPKITKDEAGLQKFFRQFSYPGGIPSHFAPETPGSIHEGGELGYALSH
FT                   AYGAIMDNPSLFVPAIVGDGEAETGPLATGWQSNKLVNPRTDGIVLPILHLNGYKIANP
FT                   TILSRISDEELHEFFHGMGYEPYEFVAGFDDEDHMSIHRRFAELWETIWDEICDIKATA
FT                   QTDNVHRPFYPMLIFRTPKGWTCPKYIDGKKTEGSWRSHQVPLASARDTEAHFEVLKNW
FT                   LESYKPEELFDANGAVKDDVLAFMPKGELRIGANPNANGGVIRNDLKLPNLEDYEVKEV
FT                   AEYGHGWGQLEATRTLGAYTRDIIKNNPRDFRIFGPDETASNRLQASYEVTNKQWDAGY
FT                   ISDEVDEHMHVSGQVVEQLSEHQMEGFLEAYLLTGRHGIWSSYESFVHVIDSMLNQHAK
FT                   WLEATVREIPWRKPIASMNLLVSSHVWRQDHNGFSHQDPGVTSVLLNKCFHNDHVIGIY
FT                   FATDANMLLAIAEKCYKSTNKINAIIAGKQPAATWLTLDEARAELEKGAAAWDWASTAK
FT                   NNDEAEVVLAAAGDVPTQEIMAASDKLKELGVKFKVVNVADLLSLQSAKENDEALTDEE
FT                   FADIFTADKPVLFAYHSYAHDVRGLIYDRPNHDNFNVHGYEEEGSTTTPYDMVRVNRID
FT                   RYELTAEALRMIDADKYADKIDELEKFRDEAFQFAVDNGYDHPDYTDWVYSGVNTDKKG
FT                   AVTATAATAGDNE"
FT   CDS_pept        complement(868295..869116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0689"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70832"
FT                   /db_xref="GOA:E8MST8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST8"
FT                   /protein_id="BAJ70832.1"
FT                   /translation="MTTDTANADIRAVFFDIDGTLTSFTTHTVPDSTIEAIHRLQAAGV
FT                   KVLICTGRAPSQMHVVLDTMPVTFDGVVAFNGQYCFDDTGFFASQALDTADIEVILDWL
FT                   DRHPDVVCNFGEKDYVYFNQSNDLLRATWSKLGKTAPTRYFEDPRTRALDHETFQISPF
FT                   VGPELESELVGLCSNVRGVRWHPDFTDLIPADGGKPRGIQRFMAHYGITREQTMAFGDG
FT                   GNDTDMLAYAGIGVAMGNATAEPKAAADYITDDVDHDGVRNALLHFRVLRD"
FT   CDS_pept        869318..870298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0690"
FT                   /product="putative metal ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70833"
FT                   /db_xref="GOA:E8MST9"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:E8MST9"
FT                   /protein_id="BAJ70833.1"
FT                   /translation="MTAATQPATPAAPNNNEPVRVNHTARNVIITIVVVAIIAVAAFFG
FT                   YRAFAGANESSAKGSKGNPVKIGVVGATNPEWVKFKQDAEKAGIYVDIVDFQDYTSENP
FT                   ALDSGELDLNEFQHLLYLANYNVSNKKDLQPIGGTAIYPLGVYSTKVKDIKDLKQGDTV
FT                   TIPNDETNQARAIGVLKAAGLVTLKGDWTAFSTPAYIDEAKSKVKVTPLKAEQVATTLK
FT                   DPTIAAGVINNDYVADAGLDPKDAIYQDDAESEEARPYINVWVARKADVNNETYKKLVS
FT                   IYQQKDVLDALQENSGGTAVFADKFSASELQGFLSDIEKDAKAQQ"
FT   CDS_pept        870432..871637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0691"
FT                   /product="putative metal ABC transporter ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70834"
FT                   /db_xref="GOA:E8MSU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU0"
FT                   /protein_id="BAJ70834.1"
FT                   /translation="MSDPIITFDHVVKEFKTRGRGANIARAVDDVSLTIDRGDIFGIIG
FT                   YSGAGKSTLVRLINALERPTSGTVTVLGTDITSLSETKLRPIRQKIGMIFQQFNLFSTK
FT                   TVAQNIAYPLQLDHWRKDYQDRRVNELLEFVGLSEHANKYPSQLSGGQKQRVGIARALA
FT                   TNPEILLADEATSALDPETTTEVLALLKRVNEEFGITIVLITHQMNVVQQIAGRVAVMS
FT                   AGRVVESGDVYDVFAAPQQPVTKRFIATALSGLPEEDRVERLHHEWSGRIVTVLIRQKD
FT                   VSGTQGHELKASGQNISELIAKYGVESSLLYGGIDTVKGTAIGAITYEFNGPGWHVDEF
FT                   LRELAANSDVIDFGTAAKPVAYADAVAGHASYAEDRAHDPLAADTATAPAASAAAHEGA
FT                   NA"
FT   CDS_pept        871634..872320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0692"
FT                   /product="putative metal ABC transporter permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70835"
FT                   /db_xref="GOA:E8MSU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU1"
FT                   /protein_id="BAJ70835.1"
FT                   /translation="MIILANPRSDWNVLRPLLFESIGQTLTMVLVTLVIGGFLGLILGV
FT                   VLYGTRPGNLFENAVVYRILDIIVNIVRPIPFIIFLAAMQPLTIVVVGTSIGTVAAIFP
FT                   MVVMCTFATSRLVEQNLVPVDPGVIEAARSMGAGKLTIIRTVLIPEALAPLILAYAFLF
FT                   IGVLDMSAMAGYIGGGGLGNFAIAYGYQKFDQTVTWTAVIIMIVLVQVVQGIANAIAKR
FT                   LLKRQQ"
FT   CDS_pept        872409..873560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0693"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70836"
FT                   /db_xref="GOA:E8MSU2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU2"
FT                   /protein_id="BAJ70836.1"
FT                   /translation="MSEHIDIDHELITIRHYLHAHPERSFREFGTSIYLTDQLKAHGIE
FT                   ILHNPLETGVVGLIQGEAGPGPRIGLRADIDGLPIVEDSGLEFSSVNEGVMHGCGHDLH
FT                   MTGLLGAAFWLAEHRDKFAGSIKILFQPSEETGQGARAMIDAGLVDDVEAIIGTHNNPN
FT                   YAPGQLAIGVEPMMAGCVKFRVTLHAQGTHAGYPYKGTGPIEALASIILSLQTIVSRNV
FT                   TPFHPLVLSVTEVHGGHVWNVVPAEAGFQGTVRYFHKSDGNLVGRRFKEVVEHTAEAYG
FT                   ISADVVWDDFQDPLVSDPGLAKAVAADVNDYAQLEPIRQSMAGEDFCEFAKVTLPVFAF
FT                   VGSNGQEGCADWHSPHFVGLDESIPTFVNFYVNTALRVLNELK"
FT   CDS_pept        873909..875606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0694"
FT                   /product="NAD+ synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70837"
FT                   /db_xref="GOA:E8MSU3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU3"
FT                   /protein_id="BAJ70837.1"
FT                   /translation="MTQLRFALAQIDTCVGALDANAAKVLDYSRKAAAGNAQVVVFPEM
FT                   TLTGYPIEDLALRRTFRQAAWDKANELATQLNDDGLGDLFVVVGTVGTDRKTSKPRNRL
FT                   VVLHQGVVWAGYDKHFLPNYGVFDEFRIFSAGDRSVTLDVDGATIGVAICEDIWQDGGP
FT                   VADLATKNIDLLLTINGSPYEEGKTNTRFELAQRRAAEVNAPVIYLNQVGGQDDLVFDG
FT                   GSFVVDADGTLIERSPMFMENLTFWDFDSAAEHQAKAEIVPELDPDEEVYTACVLGLKD
FT                   YMAKNHFTGVTLGLSGGIDSALVAAMAADACGGENVWGISMPSMYSSDGSKDDAADLAS
FT                   NIGAHYEVQPIEPLFNAYQQQLDLDGVSAENLQARIRGVIVMASSNSRGLLAVATGNKS
FT                   ELACGYSTIYGDAVGGYAPIKDLLKTRVWEISRWRNKAAAAGVGIGGLKIVGNEDGNTG
FT                   IPLKDGVMIPVSSIEKAPSAELRPGQKDSDSLPEYALLDKVLAAYIEHAHGRADLLADG
FT                   FDQVTVDTVMRLVDRAEWKRRQYPLGPKVTALAFGRDRRLPVTNAFRE"
FT   CDS_pept        875659..875883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0695"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70838"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU4"
FT                   /protein_id="BAJ70838.1"
FT                   /translation="MTDDNKKQWYFNTVKKQAELGMVSPIEQRMGPYKTKEDAEHAWDI
FT                   VVDRNARWEEENRRWKNYGVKPAQARPED"
FT   CDS_pept        876149..878524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0696"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70839"
FT                   /db_xref="GOA:E8MSU5"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU5"
FT                   /protein_id="BAJ70839.1"
FT                   /translation="MTAVENAAVSQEELDAKAWAGFTEGNWQKDIDVRDFIQKNYTPYE
FT                   GDETFLAPATEKTKHLWKYLDDNYLAVERKQRVYDVDTHTPADVDAFPAGYIDSPEVDN
FT                   VVVGLQTDVPCKRAMMPNGGWRMVEQAIKEAGKEPDPEIKKIFTKYRKTHNDGVFGVYT
FT                   KQIKVARHNKILTGLPDAYGRGRIIGDYRRVALYGVNKLIAFKKRDKDSVPYRNDFTEP
FT                   EIEHWIRFREEHDEQIKALKKLINLGNEYGLDLSRPAQTAQEAVQWTYMGYLASIKSQD
FT                   GAAMSFGRNSAFLDCYIERDLQAGKITETDAQELIDNIVMKLRIVRFLRTKDYDSIFSG
FT                   DPYWATWSDAGFGDDGRSMVTKTSFRLLNTLTLEHLGPGPEPNITIFWDPKLPEAYKRF
FT                   CAKISIDTSAIQYESDKEIRSHWGDDAAIACCVSPMRVGKQMQFFAARVNSAKALLYAI
FT                   NGGRDEMTGMQVIDKGVIEPITPEADGTLDYEKVKNNYEKALEWLSETYVMALNIIHYM
FT                   HDKYAYESIEMALHDKEVYRTLGCGMSGLSIAADSLAAVKYAKVYPIYNKDAKTLEGHE
FT                   YEYVEGADDDLIVGYRTEGEFPVYGNDDDRADDIAKWVVSTVMGQVKRLPVYRGAVPTQ
FT                   SILTITSNVEYGKNTGSFPSGHAKGTPYAPGANPENGMDSHGMLPSMFSVGKIDYNDAL
FT                   DGISLTNTITPDGLGRDEDERIGNLVGILDAGNGHGLYHANINVLRKETMEDAVEHPEK
FT                   YPHLTVRVSGYAVNFVKLTKEQQLDVISRTFHQGAVVD"
FT   CDS_pept        878634..879515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0697"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70840"
FT                   /db_xref="GOA:E8MSU6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSU6"
FT                   /protein_id="BAJ70840.1"
FT                   /translation="MPATPTFRTTTRHMLKESKTYASQTLMGGLSGFESPIGLDRRDRL
FT                   SALKSGDIGFVHSWDINTSVDGPGTRMTVFMSGCPLRCQYCQNPDTWKMRDGKPVYLDA
FT                   MIKKVDRYKDLFKATHGGITFSGGESMMQPAFVSRVFHAAKEMGVHTCLDTSGFLNTNY
FT                   TDEMLEDIDLCLLDVKSGDEETYHKVTGGTLQPTIDFGQRLAKAGKKIWVRFVLVPGLT
FT                   DSEENVENVAKICESFGDAVEHIDVLGFHQLGRPKWHELRIPYPLENQKGPNAATRERV
FT                   TNQFKDHGFTVY"
FT   CDS_pept        879629..880216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ