(data stored in ACNUC7421 zone)

EMBL: AP010904

ID   AP010904; SV 1; circular; genomic DNA; STD; PRO; 5248049 BP.
XX
AC   AP010904;
XX
PR   Project:PRJDA32105;
XX
DT   12-JUN-2009 (Rel. 101, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Desulfovibrio magneticus RS-1 DNA, complete genome.
XX
KW   .
XX
OS   Desulfovibrio magneticus RS-1
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfovibrionales;
OC   Desulfovibrionaceae; Desulfovibrio.
XX
RN   [1]
RP   1-5248049
RA   Nakazawa H., Narita-Yamada S., Yashiro I., Jinno K., Aoki N., Tsuruyama A.,
RA   Arakaki A., Okamura Y., Tanikawa S., Fujita N., Takeyama H., Matsunaga T.;
RT   ;
RL   Submitted (03-OCT-2008) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Bioresource Information Center (NBIC),
RL   Department of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066,
RL   Japan URL    :http://www.bio.nite.go.jp/
XX
RN   [2]
RX   DOI; 10.1101/gr.088906.108.
RX   PUBMED; 19675025.
RA   Nakazawa H., Arakaki A., Narita-Yamada S., Yashiro I., Jinno K., Aoki N.,
RA   Tsuruyama A., Okamura Y., Tanikawa S., Fujita N., Takeyama H.,
RA   Matsunaga T.;
RT   "Whole genome sequence of Desulfovibrio magneticus strain RS-1 revealed
RT   common gene clusters in magnetotactic bacteria";
RL   Genome Res. 19(10):1801-1808(2009).
XX
DR   MD5; b995602c3265ddcb64cffef28aa7259e.
DR   BioSample; SAMD00060954.
DR   EnsemblGenomes-Gn; DMR_r00010.
DR   EnsemblGenomes-Gn; DMR_r00020.
DR   EnsemblGenomes-Gn; DMR_r00030.
DR   EnsemblGenomes-Gn; DMR_r00040.
DR   EnsemblGenomes-Gn; DMR_r00050.
DR   EnsemblGenomes-Gn; DMR_r00060.
DR   EnsemblGenomes-Gn; DMR_r00070.
DR   EnsemblGenomes-Gn; DMR_r00080.
DR   EnsemblGenomes-Gn; DMR_r00090.
DR   EnsemblGenomes-Gn; DMR_t00010.
DR   EnsemblGenomes-Gn; DMR_t00020.
DR   EnsemblGenomes-Gn; DMR_t00030.
DR   EnsemblGenomes-Gn; DMR_t00040.
DR   EnsemblGenomes-Gn; DMR_t00050.
DR   EnsemblGenomes-Gn; DMR_t00060.
DR   EnsemblGenomes-Gn; DMR_t00070.
DR   EnsemblGenomes-Gn; DMR_t00080.
DR   EnsemblGenomes-Gn; DMR_t00090.
DR   EnsemblGenomes-Gn; DMR_t00100.
DR   EnsemblGenomes-Gn; DMR_t00110.
DR   EnsemblGenomes-Gn; DMR_t00120.
DR   EnsemblGenomes-Gn; DMR_t00130.
DR   EnsemblGenomes-Gn; DMR_t00140.
DR   EnsemblGenomes-Gn; DMR_t00150.
DR   EnsemblGenomes-Gn; DMR_t00160.
DR   EnsemblGenomes-Gn; DMR_t00170.
DR   EnsemblGenomes-Gn; DMR_t00180.
DR   EnsemblGenomes-Gn; DMR_t00190.
DR   EnsemblGenomes-Gn; DMR_t00200.
DR   EnsemblGenomes-Gn; DMR_t00210.
DR   EnsemblGenomes-Gn; DMR_t00220.
DR   EnsemblGenomes-Gn; DMR_t00230.
DR   EnsemblGenomes-Gn; DMR_t00240.
DR   EnsemblGenomes-Gn; DMR_t00250.
DR   EnsemblGenomes-Gn; DMR_t00260.
DR   EnsemblGenomes-Gn; DMR_t00270.
DR   EnsemblGenomes-Gn; DMR_t00280.
DR   EnsemblGenomes-Gn; DMR_t00290.
DR   EnsemblGenomes-Gn; DMR_t00300.
DR   EnsemblGenomes-Gn; DMR_t00310.
DR   EnsemblGenomes-Gn; DMR_t00320.
DR   EnsemblGenomes-Gn; DMR_t00330.
DR   EnsemblGenomes-Gn; DMR_t00340.
DR   EnsemblGenomes-Gn; DMR_t00350.
DR   EnsemblGenomes-Gn; DMR_t00360.
DR   EnsemblGenomes-Gn; DMR_t00370.
DR   EnsemblGenomes-Gn; DMR_t00380.
DR   EnsemblGenomes-Gn; DMR_t00390.
DR   EnsemblGenomes-Gn; DMR_t00400.
DR   EnsemblGenomes-Gn; DMR_t00410.
DR   EnsemblGenomes-Gn; DMR_t00420.
DR   EnsemblGenomes-Gn; DMR_t00430.
DR   EnsemblGenomes-Gn; DMR_t00440.
DR   EnsemblGenomes-Gn; DMR_t00450.
DR   EnsemblGenomes-Gn; DMR_t00460.
DR   EnsemblGenomes-Gn; DMR_t00470.
DR   EnsemblGenomes-Gn; DMR_t00480.
DR   EnsemblGenomes-Gn; DMR_t00490.
DR   EnsemblGenomes-Gn; DMR_t00500.
DR   EnsemblGenomes-Gn; DMR_t00510.
DR   EnsemblGenomes-Gn; EBG00001239699.
DR   EnsemblGenomes-Gn; EBG00001239700.
DR   EnsemblGenomes-Gn; EBG00001239701.
DR   EnsemblGenomes-Gn; EBG00001239702.
DR   EnsemblGenomes-Gn; EBG00001239703.
DR   EnsemblGenomes-Gn; EBG00001239704.
DR   EnsemblGenomes-Gn; EBG00001239705.
DR   EnsemblGenomes-Gn; EBG00001239706.
DR   EnsemblGenomes-Gn; EBG00001239707.
DR   EnsemblGenomes-Gn; EBG00001239708.
DR   EnsemblGenomes-Gn; EBG00001239709.
DR   EnsemblGenomes-Gn; EBG00001239710.
DR   EnsemblGenomes-Gn; EBG00001239711.
DR   EnsemblGenomes-Gn; EBG00001239712.
DR   EnsemblGenomes-Gn; EBG00001239713.
DR   EnsemblGenomes-Gn; EBG00001239714.
DR   EnsemblGenomes-Gn; EBG00001239715.
DR   EnsemblGenomes-Gn; EBG00001239716.
DR   EnsemblGenomes-Gn; EBG00001239717.
DR   EnsemblGenomes-Gn; EBG00001239718.
DR   EnsemblGenomes-Gn; EBG00001239719.
DR   EnsemblGenomes-Gn; EBG00001239720.
DR   EnsemblGenomes-Gn; EBG00001239721.
DR   EnsemblGenomes-Gn; EBG00001239722.
DR   EnsemblGenomes-Gn; EBG00001239723.
DR   EnsemblGenomes-Gn; EBG00001239724.
DR   EnsemblGenomes-Gn; EBG00001239725.
DR   EnsemblGenomes-Gn; EBG00001239726.
DR   EnsemblGenomes-Gn; EBG00001239727.
DR   EnsemblGenomes-Gn; EBG00001239728.
DR   EnsemblGenomes-Gn; EBG00001239729.
DR   EnsemblGenomes-Gn; EBG00001239730.
DR   EnsemblGenomes-Gn; EBG00001239731.
DR   EnsemblGenomes-Gn; EBG00001239732.
DR   EnsemblGenomes-Gn; EBG00001239733.
DR   EnsemblGenomes-Gn; EBG00001239734.
DR   EnsemblGenomes-Gn; EBG00001239735.
DR   EnsemblGenomes-Gn; EBG00001239736.
DR   EnsemblGenomes-Gn; EBG00001239737.
DR   EnsemblGenomes-Gn; EBG00001239738.
DR   EnsemblGenomes-Gn; EBG00001239739.
DR   EnsemblGenomes-Gn; EBG00001239740.
DR   EnsemblGenomes-Gn; EBG00001239741.
DR   EnsemblGenomes-Gn; EBG00001239742.
DR   EnsemblGenomes-Gn; EBG00001239743.
DR   EnsemblGenomes-Gn; EBG00001239744.
DR   EnsemblGenomes-Gn; EBG00001239745.
DR   EnsemblGenomes-Gn; EBG00001239746.
DR   EnsemblGenomes-Gn; EBG00001239747.
DR   EnsemblGenomes-Gn; EBG00001239748.
DR   EnsemblGenomes-Gn; EBG00001239749.
DR   EnsemblGenomes-Gn; EBG00001239750.
DR   EnsemblGenomes-Gn; EBG00001239751.
DR   EnsemblGenomes-Gn; EBG00001239752.
DR   EnsemblGenomes-Gn; EBG00001239753.
DR   EnsemblGenomes-Gn; EBG00001239754.
DR   EnsemblGenomes-Gn; EBG00001239755.
DR   EnsemblGenomes-Gn; EBG00001239756.
DR   EnsemblGenomes-Gn; EBG00001239757.
DR   EnsemblGenomes-Gn; EBG00001239758.
DR   EnsemblGenomes-Gn; EBG00001239759.
DR   EnsemblGenomes-Gn; EBG00001239760.
DR   EnsemblGenomes-Gn; EBG00001239761.
DR   EnsemblGenomes-Gn; EBG00001239762.
DR   EnsemblGenomes-Gn; EBG00001239763.
DR   EnsemblGenomes-Gn; EBG00001239764.
DR   EnsemblGenomes-Gn; EBG00001239765.
DR   EnsemblGenomes-Gn; EBG00001239766.
DR   EnsemblGenomes-Gn; EBG00001239767.
DR   EnsemblGenomes-Gn; EBG00001239768.
DR   EnsemblGenomes-Gn; EBG00001239769.
DR   EnsemblGenomes-Gn; EBG00001239770.
DR   EnsemblGenomes-Gn; EBG00001239771.
DR   EnsemblGenomes-Gn; EBG00001239772.
DR   EnsemblGenomes-Gn; EBG00001239773.
DR   EnsemblGenomes-Gn; EBG00001239774.
DR   EnsemblGenomes-Gn; EBG00001239775.
DR   EnsemblGenomes-Gn; EBG00001239776.
DR   EnsemblGenomes-Gn; EBG00001239777.
DR   EnsemblGenomes-Gn; EBG00001239778.
DR   EnsemblGenomes-Gn; EBG00001239779.
DR   EnsemblGenomes-Gn; EBG00001239780.
DR   EnsemblGenomes-Gn; EBG00001239781.
DR   EnsemblGenomes-Gn; EBG00001239782.
DR   EnsemblGenomes-Gn; EBG00001239783.
DR   EnsemblGenomes-Gn; EBG00001239784.
DR   EnsemblGenomes-Gn; EBG00001239785.
DR   EnsemblGenomes-Gn; EBG00001239786.
DR   EnsemblGenomes-Gn; EBG00001239787.
DR   EnsemblGenomes-Gn; EBG00001239788.
DR   EnsemblGenomes-Gn; EBG00001239789.
DR   EnsemblGenomes-Gn; EBG00001239790.
DR   EnsemblGenomes-Gn; EBG00001239791.
DR   EnsemblGenomes-Gn; EBG00001239792.
DR   EnsemblGenomes-Gn; EBG00001239793.
DR   EnsemblGenomes-Gn; EBG00001239794.
DR   EnsemblGenomes-Gn; EBG00001239795.
DR   EnsemblGenomes-Tr; DMR_r00010-1.
DR   EnsemblGenomes-Tr; DMR_r00020-1.
DR   EnsemblGenomes-Tr; DMR_r00030-1.
DR   EnsemblGenomes-Tr; DMR_r00040-1.
DR   EnsemblGenomes-Tr; DMR_r00050-1.
DR   EnsemblGenomes-Tr; DMR_r00060-1.
DR   EnsemblGenomes-Tr; DMR_r00070-1.
DR   EnsemblGenomes-Tr; DMR_r00080-1.
DR   EnsemblGenomes-Tr; DMR_r00090-1.
DR   EnsemblGenomes-Tr; DMR_t00010-1.
DR   EnsemblGenomes-Tr; DMR_t00020-1.
DR   EnsemblGenomes-Tr; DMR_t00030-1.
DR   EnsemblGenomes-Tr; DMR_t00040-1.
DR   EnsemblGenomes-Tr; DMR_t00050-1.
DR   EnsemblGenomes-Tr; DMR_t00060-1.
DR   EnsemblGenomes-Tr; DMR_t00070-1.
DR   EnsemblGenomes-Tr; DMR_t00080-1.
DR   EnsemblGenomes-Tr; DMR_t00090-1.
DR   EnsemblGenomes-Tr; DMR_t00100-1.
DR   EnsemblGenomes-Tr; DMR_t00110-1.
DR   EnsemblGenomes-Tr; DMR_t00120-1.
DR   EnsemblGenomes-Tr; DMR_t00130-1.
DR   EnsemblGenomes-Tr; DMR_t00140-1.
DR   EnsemblGenomes-Tr; DMR_t00150-1.
DR   EnsemblGenomes-Tr; DMR_t00160-1.
DR   EnsemblGenomes-Tr; DMR_t00170-1.
DR   EnsemblGenomes-Tr; DMR_t00180-1.
DR   EnsemblGenomes-Tr; DMR_t00190-1.
DR   EnsemblGenomes-Tr; DMR_t00200-1.
DR   EnsemblGenomes-Tr; DMR_t00210-1.
DR   EnsemblGenomes-Tr; DMR_t00220-1.
DR   EnsemblGenomes-Tr; DMR_t00230-1.
DR   EnsemblGenomes-Tr; DMR_t00240-1.
DR   EnsemblGenomes-Tr; DMR_t00250-1.
DR   EnsemblGenomes-Tr; DMR_t00260-1.
DR   EnsemblGenomes-Tr; DMR_t00270-1.
DR   EnsemblGenomes-Tr; DMR_t00280-1.
DR   EnsemblGenomes-Tr; DMR_t00290-1.
DR   EnsemblGenomes-Tr; DMR_t00300-1.
DR   EnsemblGenomes-Tr; DMR_t00310-1.
DR   EnsemblGenomes-Tr; DMR_t00320-1.
DR   EnsemblGenomes-Tr; DMR_t00330-1.
DR   EnsemblGenomes-Tr; DMR_t00340-1.
DR   EnsemblGenomes-Tr; DMR_t00350-1.
DR   EnsemblGenomes-Tr; DMR_t00360-1.
DR   EnsemblGenomes-Tr; DMR_t00370-1.
DR   EnsemblGenomes-Tr; DMR_t00380-1.
DR   EnsemblGenomes-Tr; DMR_t00390-1.
DR   EnsemblGenomes-Tr; DMR_t00400-1.
DR   EnsemblGenomes-Tr; DMR_t00410-1.
DR   EnsemblGenomes-Tr; DMR_t00420-1.
DR   EnsemblGenomes-Tr; DMR_t00430-1.
DR   EnsemblGenomes-Tr; DMR_t00440-1.
DR   EnsemblGenomes-Tr; DMR_t00450-1.
DR   EnsemblGenomes-Tr; DMR_t00460-1.
DR   EnsemblGenomes-Tr; DMR_t00470-1.
DR   EnsemblGenomes-Tr; DMR_t00480-1.
DR   EnsemblGenomes-Tr; DMR_t00490-1.
DR   EnsemblGenomes-Tr; DMR_t00500-1.
DR   EnsemblGenomes-Tr; DMR_t00510-1.
DR   EnsemblGenomes-Tr; EBT00001585142.
DR   EnsemblGenomes-Tr; EBT00001585143.
DR   EnsemblGenomes-Tr; EBT00001585144.
DR   EnsemblGenomes-Tr; EBT00001585145.
DR   EnsemblGenomes-Tr; EBT00001585146.
DR   EnsemblGenomes-Tr; EBT00001585147.
DR   EnsemblGenomes-Tr; EBT00001585148.
DR   EnsemblGenomes-Tr; EBT00001585149.
DR   EnsemblGenomes-Tr; EBT00001585150.
DR   EnsemblGenomes-Tr; EBT00001585151.
DR   EnsemblGenomes-Tr; EBT00001585152.
DR   EnsemblGenomes-Tr; EBT00001585153.
DR   EnsemblGenomes-Tr; EBT00001585154.
DR   EnsemblGenomes-Tr; EBT00001585155.
DR   EnsemblGenomes-Tr; EBT00001585156.
DR   EnsemblGenomes-Tr; EBT00001585157.
DR   EnsemblGenomes-Tr; EBT00001585158.
DR   EnsemblGenomes-Tr; EBT00001585159.
DR   EnsemblGenomes-Tr; EBT00001585160.
DR   EnsemblGenomes-Tr; EBT00001585161.
DR   EnsemblGenomes-Tr; EBT00001585162.
DR   EnsemblGenomes-Tr; EBT00001585163.
DR   EnsemblGenomes-Tr; EBT00001585164.
DR   EnsemblGenomes-Tr; EBT00001585165.
DR   EnsemblGenomes-Tr; EBT00001585166.
DR   EnsemblGenomes-Tr; EBT00001585167.
DR   EnsemblGenomes-Tr; EBT00001585168.
DR   EnsemblGenomes-Tr; EBT00001585169.
DR   EnsemblGenomes-Tr; EBT00001585170.
DR   EnsemblGenomes-Tr; EBT00001585171.
DR   EnsemblGenomes-Tr; EBT00001585172.
DR   EnsemblGenomes-Tr; EBT00001585173.
DR   EnsemblGenomes-Tr; EBT00001585174.
DR   EnsemblGenomes-Tr; EBT00001585175.
DR   EnsemblGenomes-Tr; EBT00001585176.
DR   EnsemblGenomes-Tr; EBT00001585177.
DR   EnsemblGenomes-Tr; EBT00001585178.
DR   EnsemblGenomes-Tr; EBT00001585179.
DR   EnsemblGenomes-Tr; EBT00001585180.
DR   EnsemblGenomes-Tr; EBT00001585181.
DR   EnsemblGenomes-Tr; EBT00001585182.
DR   EnsemblGenomes-Tr; EBT00001585183.
DR   EnsemblGenomes-Tr; EBT00001585184.
DR   EnsemblGenomes-Tr; EBT00001585185.
DR   EnsemblGenomes-Tr; EBT00001585186.
DR   EnsemblGenomes-Tr; EBT00001585187.
DR   EnsemblGenomes-Tr; EBT00001585188.
DR   EnsemblGenomes-Tr; EBT00001585189.
DR   EnsemblGenomes-Tr; EBT00001585190.
DR   EnsemblGenomes-Tr; EBT00001585191.
DR   EnsemblGenomes-Tr; EBT00001585192.
DR   EnsemblGenomes-Tr; EBT00001585193.
DR   EnsemblGenomes-Tr; EBT00001585194.
DR   EnsemblGenomes-Tr; EBT00001585195.
DR   EnsemblGenomes-Tr; EBT00001585196.
DR   EnsemblGenomes-Tr; EBT00001585197.
DR   EnsemblGenomes-Tr; EBT00001585198.
DR   EnsemblGenomes-Tr; EBT00001585199.
DR   EnsemblGenomes-Tr; EBT00001585200.
DR   EnsemblGenomes-Tr; EBT00001585201.
DR   EnsemblGenomes-Tr; EBT00001585202.
DR   EnsemblGenomes-Tr; EBT00001585203.
DR   EnsemblGenomes-Tr; EBT00001585204.
DR   EnsemblGenomes-Tr; EBT00001585205.
DR   EnsemblGenomes-Tr; EBT00001585206.
DR   EnsemblGenomes-Tr; EBT00001585207.
DR   EnsemblGenomes-Tr; EBT00001585208.
DR   EnsemblGenomes-Tr; EBT00001585209.
DR   EnsemblGenomes-Tr; EBT00001585210.
DR   EnsemblGenomes-Tr; EBT00001585211.
DR   EnsemblGenomes-Tr; EBT00001585212.
DR   EnsemblGenomes-Tr; EBT00001585213.
DR   EnsemblGenomes-Tr; EBT00001585214.
DR   EnsemblGenomes-Tr; EBT00001585215.
DR   EnsemblGenomes-Tr; EBT00001585216.
DR   EnsemblGenomes-Tr; EBT00001585217.
DR   EnsemblGenomes-Tr; EBT00001585218.
DR   EnsemblGenomes-Tr; EBT00001585219.
DR   EnsemblGenomes-Tr; EBT00001585220.
DR   EnsemblGenomes-Tr; EBT00001585221.
DR   EnsemblGenomes-Tr; EBT00001585222.
DR   EnsemblGenomes-Tr; EBT00001585223.
DR   EnsemblGenomes-Tr; EBT00001585224.
DR   EnsemblGenomes-Tr; EBT00001585225.
DR   EnsemblGenomes-Tr; EBT00001585226.
DR   EnsemblGenomes-Tr; EBT00001585227.
DR   EnsemblGenomes-Tr; EBT00001585228.
DR   EnsemblGenomes-Tr; EBT00001585229.
DR   EnsemblGenomes-Tr; EBT00001585230.
DR   EnsemblGenomes-Tr; EBT00001585231.
DR   EnsemblGenomes-Tr; EBT00001585232.
DR   EnsemblGenomes-Tr; EBT00001585233.
DR   EnsemblGenomes-Tr; EBT00001585234.
DR   EnsemblGenomes-Tr; EBT00001585235.
DR   EnsemblGenomes-Tr; EBT00001585236.
DR   EnsemblGenomes-Tr; EBT00001585237.
DR   EnsemblGenomes-Tr; EBT00001585238.
DR   EuropePMC; PMC2765288; 19675025.
DR   EuropePMC; PMC2849247; 20139321.
DR   EuropePMC; PMC3934378; 24616719.
DR   EuropePMC; PMC4065386; 24915802.
DR   EuropePMC; PMC4097590; 24794567.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02276; Hammerhead_II.
DR   SILVA-LSU; AP010904.
DR   SILVA-SSU; AP010904.
DR   StrainInfo; 267846; 1.
XX
CC   "Arakaki, A., Tsuruyama, A., Okamura, Y., Takeyama, H. and
CC   Matsunaga, T. are at Department of Biotechnology, Tokyo University
CC   of Agriculture and Technology. The other authors are at NITE
CC   Bioresource Information Center (NBIC).
CC   Please visit our web site. URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE. The database
CC   contains genome sequence data, physical maps and the genomic and
CC   proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial strain and microbial genomic DNA clones used for the
CC   sequencing project are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5248049
FT                   /organism="Desulfovibrio magneticus RS-1"
FT                   /strain="RS-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:573370"
FT   CDS_pept        126..1466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="DMR_00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73492"
FT                   /db_xref="GOA:C4XT10"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT10"
FT                   /protein_id="BAH73492.1"
FT                   /translation="MTKAPATASGDGVLKNDFRQHLSRTCPEQDLRRWFDPLEIIPGEG
FT                   EPSCCVVFPHTYFAAWFDGSVKELFERQLAAYLGPGHTVRYRTRGMRAAAPAFAADAAV
FT                   VTDFPYGHRFTFETFLANEKNAFPLALAREVSRGGEVRYNPFLVCGPSGAGKTHLLRAM
FT                   ANAVAKSQPTSRIYFGSVADIQALYADARRPRPEIRAELSSHDWLFIDELTDVARAPDL
FT                   EPELIGMFNDFHDAGRQMVFSSRERAASCDFLDPTFRSRLEWGLMVHLKAPDLSIRARF
FT                   VEQVSKDKRLGLSREQVLTLAGRFEGFRRLEGVLLRLEAFRQHAGGELSEAEFSRHIRL
FT                   SEDKKAPELSPERVIAVCAEHFGIPARDIVGAGRKKELVFARQAAMTLCRSLLGLSYPA
FT                   LGKVFGGKDHSTVLYSIRKFQQILDVDQETKMLLRQLSKKCRQGGQA"
FT   CDS_pept        1834..3027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="DMR_00020"
FT                   /product="DNA polymerase III beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73493"
FT                   /db_xref="GOA:C4XT11"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT11"
FT                   /protein_id="BAH73493.1"
FT                   /translation="MQLTVFRNDIIDGLQKSSSIIPAKTGAAFLRTVWLEAAGSSLSIL
FT                   STDSSLEFTGHYAAKVAKEGLCGVQGKSFFELVRKLPPGEISLTLDEASGNLLIKQGSR
FT                   RYKLPVSDRNWFQPFAAFPNEGAVTWSGDFLQEIIERVAYCISDEDTMEAMACMYLRPV
FT                   ADSARIEVCGLNGHQFSLVGFLNDDIHAMLPPDGILIQKKYVAELKRWLTAEEVELAMG
FT                   QKRLFFRTTKRDEAAPEGQGSVETFSLPLSFYQYPDYNAFVSKLATDGVSTLAIDRLEC
FT                   IDALERVAIFNTDNNRCASFLFDGPGELSLKSQGQEAGEATETLECVFTGDLDKVAFPT
FT                   KDLTDILGHFESAKVSLTLTGAEGPCGIRGEDDTDSLVIIMPMKIVEETYYSEEDIA"
FT   CDS_pept        3024..5438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="DMR_00030"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73494"
FT                   /db_xref="GOA:C4XT12"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT12"
FT                   /protein_id="BAH73494.1"
FT                   /translation="MSQDKTPQAYDASSITVLEGLSAVRKRPAMYIGSTDIRGLHHLVY
FT                   EVVDNSIDESMAGYCDRIGITIHLDNSVTVSDNGRGIPVDIHPKEGRPAVEVVMTVLHA
FT                   GGKFDNDAYKVSGGLHGVGVSVVNALSEYLEVTVRRGGKKHHQRYERGAPVTALTVIGE
FT                   AENTGTTIRFLPDEEIFETSQFNHETLAKRFEELAYLNRKLELDFRDERTNERVTYRFD
FT                   GGLNRFVTDLNAGEQVIHEIIEGQGEIEGIMVDFALQYNANYKEEVLTFANNIRTREGG
FT                   THLQGFKTALTRAINTYIEKADIPKKFKQKLTGDDVREGLTAVISVKLPQPQFEGQTKT
FT                   KLGNSEVAGLVAKIVFEAVNVHFEENPKDAKSIVEKAVDAARAREAARKAKELVRRKGA
FT                   LSDHSLPGKLADCQSKKPEESELFIVEGDSAGGSAKQGRDPRFQAILPLRGKILNVERT
FT                   RTDKMLGNKEIRNLITAIGPTPAMGDEESEEKEAENLARLRYHKIVIMTDADVDGAHIR
FT                   TLLLTFFYRRYEKLILNGYVYIAQPPLYRVFKGDFERFIKDDEELSLFLMGRIGEDVSV
FT                   ASGETTFSGESLTNLIERIRFLEARVREAGSYGLPEELLVSLLSYPRLAASDFAGVDLP
FT                   DGLAEHLSAIGYTVATEVEELDEERRLYAVFVSPNQARHRIAVEFFSSRIYRRAHETYA
FT                   ELTTLCPTQPFAITRKEETREVGGFFELCRALMDDALKGINIQRYKGLGEMNPEQLWET
FT                   TMNPEKRSFLQVRIEDMDEADSIFSQLMGEKVENRRNFIERNALSVRELDI"
FT   CDS_pept        5459..7900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="DMR_00040"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73495"
FT                   /db_xref="GOA:C4XT13"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT13"
FT                   /protein_id="BAH73495.1"
FT                   /translation="MSDLIQIEEELKKSYLEYSLSVIIGRAIPDVRDGLKPVHRRILYA
FT                   MHDLSNTYNRPYKKSARVVGDVIGKYHPHGDQSVYDALVRMAQDFSMRDAIVDGQGNFG
FT                   SIDGDAAAAMRYTEVRMSRLAGEFLADIEKETVDFRPNYDNSLEEPAVLPTKVPNLLLN
FT                   GSSGIAVGMATNIPPHNLGELCDGLLHLLDTPSCPVTDIIGLVKGPDFPTGAAIYGGKG
FT                   LTEAYTTGRGTIKIRGRAEVEERKKDYVSVVIREIPYALNKSSLVEKIAALINDGRIEG
FT                   VSDLRDESDRKGIRIVLDLKKGVIPDIVINALYKYTPLETSFGINMLVVADNRPALLNI
FT                   KQVLEHFLTHRRDVILRRTRFDLRKSEERAHILEGLRIALDNIDEVVSIIRASKNAVEA
FT                   RERLMERFGLSERQAQAILDMRLQRLTNLERQKLIDEYNELIKLIEYLRSILENDEVLR
FT                   GVIRDEIKEIQDRYATPRKTEILEDLEGINILDLIPDEDVVITLSRRGYIKRTKIDNYQ
FT                   QQKRGGKGIAGVATAGDDFVQSFCATTNHQQLLLFTNLGRMFMLPVHQIPEGQRTAKGA
FT                   HIANLLPMDKEEFVATALSIREFSEERYFLFVTRKGMVKRTCTDLYKNCRSTGIIAVGL
FT                   KENDELLTVKEIDDETEVLLATQQGLSNRFHISGVRPTGRGAAGVKGIALKGNDRVAAG
FT                   VVITSVSRSEVLTVSANGYGKRTSIEHYPIRNRGGSGVINMRVTPKTGQVIGAVMVGDD
FT                   DELLLLTSANKIIRLSVSGISSVGRATQGVMLVRMDENDTVMGFDLVDPSDLDRCAPSG
FT                   E"
FT   CDS_pept        7879..8685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73496"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT14"
FT                   /protein_id="BAH73496.1"
FT                   /translation="MRALRRIACLVAICCLGLLLGAQAGCDGPREDGSARLLETARRAF
FT                   LDSQYLRAETAYEHYLQAYPTGADRLEAWRRLADIALDFRESPDKAATLLEAAVLEFAG
FT                   DPATTADLLTTAASLRFDRKAYARAAADCRGVVDLAGASDQRRLDCHLLLGRLELAQRN
FT                   DAQALARYEACRQSDLPRTESARCALAQAELLLRLERFKEAEPLLHEIFATANSAPALR
FT                   AQAGFALGQLKEASSDKAAAREIYKATRPLHPNPLVVDKRLELLDN"
FT   CDS_pept        8788..9663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73497"
FT                   /db_xref="GOA:C4XT15"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT15"
FT                   /protein_id="BAH73497.1"
FT                   /translation="MVLDLFRKKKPAKEDEAARRRNADILDLALAQRSKVHVQFDEADS
FT                   GLTGVTATVMAVAEAGVVLELGGVAALKDRFIGKSVTCFFRIVEREDRHREIFYNFTAP
FT                   ILRIRQLPERPPQVALAFPAALNGAQRRKSLRMRPDFNQFSHIALWKYEAAGGFDMAKP
FT                   TVAHSHFKTGLALIENISAGGLRFRLKRQHVKEQGLDPKKGERFIIFFTFNEKVPKLRE
FT                   EYWLVAKVNNIQPEPVSGELSLGLEFVANGVRQESGKVEWSKIEDNVIDDMAQRIYLWH
FT                   VSLYRDRGLS"
FT   CDS_pept        9691..10911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="DMR_00070"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73498"
FT                   /db_xref="GOA:C4XT16"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT16"
FT                   /protein_id="BAH73498.1"
FT                   /translation="MQVSHLDFTGYGGRRVHLGVTGSVAAYKALSLLRRVLATGASVSV
FT                   SLTEAAARFVTPLSFEALGADPVTTSLFDPASANFAHLAPAQTADLLAIVPATANTLAK
FT                   LAHGLADDLLSCQALAFDGPILCAPAMNPRLWAAAATQDNWKTLLNRGVIGVAPDCGSM
FT                   ACGESGQGRLADENAIFTTLLRALSPKDLAGKHVLVSLGPTREYFDAARFWSNPSTGRM
FT                   GACVAMAAWLRGAEVTVVAGPVSWWFPEEVRVIGVTSAAQMHEACLEVWPSSDYGVMAA
FT                   AVADFSPIPFEGGGKFKKEAAGERPPLEFTPTRDILAAMGGVKKPGQYLIGFCAETDNL
FT                   VDNARGKLTRKRCDAIIANPIGRSDAGFAAPSNEAVALDADGRQETWGNIPKTDMAMKI
FT                   WDFSIRS"
FT   CDS_pept        10941..11714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73499"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT17"
FT                   /protein_id="BAH73499.1"
FT                   /translation="MAGVRHFYLDPEAVSAVGDSAAPESTPVDDVARAASMNLVGQAAP
FT                   AVEQVETAAAGHPMAPSTPPAPKPREVNPNPIAAPAAASPAVSAGHRPPTSPQPYNEPQ
FT                   GSPAAVQAALPDNPDRWPLPWPTFFAKTPPTPRLVITYRELGLDMAGQSEPRRRDLWRR
FT                   LIAQAGLAGKGLVAFWPLALPQGGALTEMPLHFACGVARLHPELVAVFGEISDPARQEL
FT                   AARATSAVVVLPPPHALYNPDPEVWEHVIATLRRH"
FT   CDS_pept        11686..13014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00090"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73500"
FT                   /db_xref="GOA:C4XT18"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT18"
FT                   /protein_id="BAH73500.1"
FT                   /translation="MLSPRYVAIELKSFLLALFLICCASPSFAAYTVLEARLHSAISPA
FT                   QADMLDDAIAVAVAKPADLLLLSLDTPGGSVEVMRRMVGSILNAPMPVVVYVSPSGARA
FT                   ASAGVFLMAAATVAAMAPQTTIGAASPIGLGGIDLPKTSDLKIKNDLTSLLRGLADRRG
FT                   RNVNWYKKAVDEAATLTAPEAVAERVVDFVAVSPRDLLEQIGKRGVSTPTGTIRFDGAA
FT                   ATIVSYEPGLWHTLLSWLLDPSIAYVLLLLGVAGVFFELTTPGAVLPGVVGGIALILAL
FT                   YALSVLPTNAAGLLLLLAAGGLFLLELHITSFGLLSLAGVAALFLGSLLLFRFDGHSGL
FT                   PLSLILPTVGGVCALLLGAVWLLAKAQRQKPRLGLTALYGNTALVRRWSGRGGKVFVHG
FT                   EIWDARLADHENTTDFAPGEPVLVVGHEDFVLLVAPRPDNAAI"
FT   CDS_pept        13138..13998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73501"
FT                   /db_xref="GOA:C4XT19"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT19"
FT                   /protein_id="BAH73501.1"
FT                   /translation="MIGFLPLVGIVILLLIVSLRVLNEYERGVVFRLGRIIGPKGPGLI
FT                   ILLPVIDRMTKVSMRTFALDVPHQDVITRDNVSIKVNAVVYFRVADPIRAILEVEDYMY
FT                   ATSQISQTTLRSVCGGVELDEILAHRDKVNEQVQTILDAHTGPWGIKVANVELKYIDLP
FT                   QEMQRAMAKQAEAERERRAKIINAEGEFQASSRLAEAAQIIGQHPEAMQLRYLQTIREM
FT                   AAESQASTILPIPLDFIRTFFQGPSHAAAGTAHGQSADLTARPREGNGVDPVSPASLEA
FT                   KRDDA"
FT   CDS_pept        14062..15069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00110"
FT                   /product="putative UDP-glucuronate 5'-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73502"
FT                   /db_xref="GOA:C4XT20"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT20"
FT                   /protein_id="BAH73502.1"
FT                   /translation="MNILVTGAAGFIGFHLCRRFLSMGFHVTGLDNLNPYYSVALKKER
FT                   IALLSADAKFRFVKEDMGDRASMDRLFDAGGFNYVVNLAAQAGVRHSLKCPEDYINANI
FT                   IGYFNILENCRQHKVDHFVFASSSSVYGLNTKMPFSVHDNVDHPISLYAASKKSNELMA
FT                   HSYSYLFGLPCTGLRFFTVYGPWGRPDMALFLFTKAIIEGNPIQVFNHGQMERDFTYID
FT                   DIVEGVVRVTQNIPKPNPDWNPASPDPSSSVSPYKLYNIGNNNSVTLLQFIEAIEEALG
FT                   KEAIKEFLPLQPGDVPATCADIDDLIKDVGFKPATNIKTGIANFIAWYRDYYGQ"
FT   CDS_pept        15147..15437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73503"
FT                   /db_xref="InterPro:IPR027588"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT21"
FT                   /protein_id="BAH73503.1"
FT                   /translation="MEFKTTKRDLEAVFAKIQSQVEDATLPDEESVNRLARLARKMHQL
FT                   ADEDWMDEAEDFSHLAGQLLNAVKKGDVEGCVMLVESLDDAQSFCHRTFRD"
FT   CDS_pept        15519..16289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="DMR_00130"
FT                   /product="chromosome partitioning protein ParA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73504"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT22"
FT                   /protein_id="BAH73504.1"
FT                   /translation="MARVIVIANQKGGVGKTTTAVNLAASLAVMEKKVLLIDCDPQANA
FT                   SSGLSIYQDQISENLYSVLFDPENARKAFVGTELPFLTVLPSAPDLVAADIELVDKPGR
FT                   EFYMRRLVEAVQDEFDYILLDCPPSLGLVTLNALCAATEMLVPLQCEYYALEGIAQLLR
FT                   TYDQVRKRLNPRLRLLGVVLTMYDGRNKLNRHVKREVWKCFPKLYFQTLIPRNIRLSEA
FT                   PSYGKPALTHDVKSRGAEAYISLAQEVVRRQTAA"
FT   CDS_pept        complement(16365..16796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73505"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT23"
FT                   /protein_id="BAH73505.1"
FT                   /translation="MPRISPHFLELFDANGAPRGVLLSAELWERCKDQVLPPLTKALYV
FT                   LDPAARPEPEVRPEPLQEWETLLAYWDFTYPPAYDVHCDCCGAATDDWRADEPRKFRLR
FT                   NANLGGLVTFQCAGCKALVLKKHFKKHLTVECKPYVDKG"
FT   CDS_pept        16927..17853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="DMR_00150"
FT                   /product="chromosome partitioning protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73506"
FT                   /db_xref="GOA:C4XT24"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT24"
FT                   /protein_id="BAH73506.1"
FT                   /translation="MAQAQKGLGRGLEALLGGFGEADASPSEVRLLPLDDIRANPEQPR
FT                   RTFSEESLAELAASIREQGLLQPVLVRPVPGHGRHSHEIVAGERRWRAARQAGLTEIPA
FT                   LVREVDDETGFALALVENLQREDLNPMEEAAGYQLLVSRYGLSQEAVAAKVGKSRSAVA
FT                   NSLRLTTLDEAVRADLAAGKLTAGHARALLSLPEGELRDALWRRVVDNGISVREAEAAA
FT                   TYAKTHGHLPEAGAMADAPRKRGPKPVPDARLKGLEAVLTERAGVLVKTTGSADHGRLT
FT                   FHFSSRRELEGLLERFALSPAALGEDA"
FT   CDS_pept        17850..18896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00160"
FT                   /product="putative ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73507"
FT                   /db_xref="GOA:C4XT25"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT25"
FT                   /protein_id="BAH73507.1"
FT                   /translation="MNPAPGLLPDLARLAAALDAMAGKAVLVLGDAMLDHYLLGEVGRI
FT                   SPEAPVPVVKVARERHLAGGAGNVARNIAALGAKPLLVSATGDDDAGRMLGTLLERDGV
FT                   ESLLVRDRSRPTTIKTRIIAQNQQVVRVDRESDAPLADKARQGLMAALPALVAKADVVI
FT                   VSDYAKGVVGPDLMAALRAAVAACDRRPMILVDPKPANLACYTGVDLLTPNLKETLEMA
FT                   GSAAVSRETGPRRVLRAGLALFKTVRCRHLCVTLGPDGIALFRTPSDVAHIPTAARRVY
FT                   DVTGAGDSVMAALACGLAAGLDLLDACMLSNYCAGIAVSQVGAAAVSRDELAAALAEAA
FT                   VPEVERWL"
FT   CDS_pept        18940..19269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00170"
FT                   /product="anti-sigma factor antagonist family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73508"
FT                   /db_xref="GOA:C4XT26"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT26"
FT                   /protein_id="BAH73508.1"
FT                   /translation="MPTASSANPAWTLAKGDTPADIVLSGEIDFTATPAVRDRLLAAIE
FT                   DGPPEIVLHLAGLDYVDSSGLALFIEAKKRLAEAGRTIRIADISPQVAKIFHLTQLGEL
FT                   FGLPE"
FT   CDS_pept        19291..20061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00180"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73509"
FT                   /db_xref="GOA:C4XT27"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT27"
FT                   /protein_id="BAH73509.1"
FT                   /translation="MARKQDDLGVLVGLAVDLMRCAGRALRPWRPEKPYLRARTISHLA
FT                   WVGADSLAIVSVIAACVGIILSLQAAIQLEKVGAMSYVANLVGFSLVTELGPLLTCLIL
FT                   SGRAGAAFTAEIATMRISEEIDALAVMGIDPVRFLVWPKFVAMAVMAPLLTLWADAVGI
FT                   TAGGIFSSLALGLSGKVYFNQIAYFLGFKDLLSGLVKSAGFGVAITVISCWQGFLAREG
FT                   AADVGRRTTAAVVQSIFVMILLDLFFTALNYIFR"
FT   CDS_pept        20079..20906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00190"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73510"
FT                   /db_xref="GOA:C4XT28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT28"
FT                   /protein_id="BAH73510.1"
FT                   /translation="MSGRLESPDIALSDVSVGYGERTVLAGVTTVLPGGKVSVILGGSG
FT                   CGKSTLLRNIIGLVPIQGGRIVLGGHDMAEIAEAERLNVRRRMGVLFQDGALLGSLRLG
FT                   ENIALPLREHTELTDSLIEEIVRLKLKLVGLADFMDYFPSELSGGMRKRAGLARAMALD
FT                   PAVLLCDEPTSGLDPITAADMDQLILELRATFDMTIVVVTHDLESLYAIADHVVVLSAG
FT                   RMLFEGPLSKLAASDDPFIHQFLARQPSRESRILGGTWTSMVDSRRVSATGRG"
FT   CDS_pept        20908..21819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73511"
FT                   /db_xref="GOA:C4XT29"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT29"
FT                   /protein_id="BAH73511.1"
FT                   /translation="MLTAKASRSDYLKAAGALALGLVILGGFMVVLGGNWFWVKYDHYL
FT                   IRFTAIKDLSRGRPVKYAGLDVGRVEDITLDVNDPRYIGVTVAIHQGFPLFGGTVARIA
FT                   QKGLVGDYYVLLELRGQPGEKIVPGAAIPAITTMDVQELAAKAGEMLDDIRPKINEIAE
FT                   NISLLFTPENTESLKKALEGTPRLVEDLRLAANDFRRNWEALSAKGGKAAETLDASLKR
FT                   MDKVVTTVEGELTKTLATFRTQAEHVGGLTSDVRQGFNYDQEQLEEILRNLNRTSREVR
FT                   ELASRLRERPWELLRPPSGPAR"
FT   CDS_pept        21816..22451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73512"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT30"
FT                   /protein_id="BAH73512.1"
FT                   /translation="MKCLSLLGRVALTGLLAVSLAGCFGKPPPEQRYLRVALGETPCPG
FT                   SASQQHRLPIAFKPLKTMENLDRTSVMTAQNNVLTASLQYYWEGAPQDVVGAALRQGLE
FT                   CQSSAVTPVDYQPRVDRSAVLSGELTAFNVDYTDGGRFVVSLRLDLWSKDMGTRLSSGE
FT                   FNAYAPLTDFKGSTIAAAASDALGRVVPKVVVWMDQGLPKLEKAVERQ"
FT   CDS_pept        complement(22495..23118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00220"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73513"
FT                   /db_xref="GOA:C4XT31"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT31"
FT                   /protein_id="BAH73513.1"
FT                   /translation="MAQDDYHHGNLRQALLDAGEKLLETEGVAGLSMRALARATGVSHA
FT                   APYRHFADKADLLAALAARGFARLAETLVAVAAAHGHDPQREYLVACRRYMELGMDAPA
FT                   MYRLMFGQQQPGVGDQPELAQAGQAAYEALLGAMARGRAAGTLGEVDDEAKATAVWSMV
FT                   HGVTELAISGRLEPCAGDRLEILALGEQMCSLLLSGLAARERAT"
FT   CDS_pept        23167..24483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73514"
FT                   /db_xref="GOA:C4XT32"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT32"
FT                   /protein_id="BAH73514.1"
FT                   /translation="MKNYQGPEDEGGVMAENWLVLDALGAAGEVGEALRKAVQGEAASR
FT                   GVSCRFVSIPSSGLPSCRGCFSCWTKTPGQCCMADDGLGLSAAIAGSTSLVLLTPVVLG
FT                   GHAPGLRLAMERAVLPNLLPYFSKVDGRSRHPNRYPAVPALYGIGLTVERDPESAQLFC
FT                   SLVARNAANMRSPRHGAGVACRADGEAGAAAVVRSVLSDAVQPDARPRLIVALVGSPKP
FT                   RGGVSATLANHVQDWLTRHGAVVRPFSLAAARQDEEAFVALAEALGEADAAYLSFPVYA
FT                   DAIPGAAVEVLERLCAYRREIAPDRPQAFFAVANCGFPEPVNCDAPLAMCRLFARQAGF
FT                   AWLGGVGVGGGGMYEGRPLSSFGFLSTTARRALEAKAALLLSPPPPDLAQTGDILVPCP
FT                   LPDRVYQWMADRGWQKALAGKDAVRDALARPYAVPGASS"
FT   CDS_pept        complement(24575..25591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73515"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT33"
FT                   /protein_id="BAH73515.1"
FT                   /translation="MRIVTLHHMGFAAILRKLGHDVLTISGTASADVRLTEPLTASKFL
FT                   KVLAARGFKPDLVLWYDACQPPWVFGFERLPSVVIGYSVDQYMHPWHVPYSAAFDAVLV
FT                   AQKDYLPLFTNAATGRPAQWLPLFCDPAKDIDSGGERDIPVSFVGTLGGAANPGRKPFL
FT                   DAFKAAAPLFCKQGAYAPIFGRSRIVLNQSAAGELNFRLFEAMACGAAVLTEETGNGLT
FT                   ELFTPGTDVLTYPRGNAVQAAATANAALADPAALAALAAAGKRQVLANHTLVQRARHIL
FT                   ALAEELAAAGAPARRLAAISAVDRELRKAYAMLATDEHLPLPLEVREMFLRMAGGLP"
FT   CDS_pept        25697..27373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="DMR_00250"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73516"
FT                   /db_xref="GOA:C4XT34"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XT34"
FT                   /protein_id="BAH73516.1"
FT                   /translation="MRSSLFKSGLEKAPHRSLLYALGLTKEEMRRPLIGVVNSANEVVP
FT                   GHIHLNTIAEAVKAGIRLAGGTPMTFPVIGVCDGLAMNHAGMHFSLVSREIIADSIEIM
FT                   ASAHPFDALVCIPNCDKVVPGMLMAMLRLNIPAVIVSGGPMLAGTTSEGSFDLIDVFEA
FT                   VGKFKRGAINEDQLEELEENACPGCGSCSGMFTANSMNCLSESVGLGLPGNGTIPAVSA
FT                   KRVRLAKTAGMRVMDLLEKNIRPRDIVTAKSIENAVTMDMALGCSTNTVLHLPAVFAEA
FT                   GLPLTLDIFDAVSRKTPNLCKLSPAGKHYLDDLERAGGIPAVMSELAKRGLLHLDVMTA
FT                   TGKTLGENLTDLKARVKNFDVIRAKEPYANEGGIAILRGSLAPDGAVVKQSAVAPAMMR
FT                   HTGPARVFDSEEAANKAILGGEIKAGDVVVIRYEGPQGGPGMREMLSPTSNIMGMGLGE
FT                   TVALITDGRFSGGTRGAAIGHVSPEAAEGGPIALIRDGDRIEVDIPGRKLDVLVDAAEL
FT                   EARRASVVAPEKVIESPLLRRYASLVKSAAQGAVYKDPAAK"
FT   CDS_pept        27425..28171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73517"
FT                   /db_xref="GOA:C4XT35"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT35"
FT                   /protein_id="BAH73517.1"
FT                   /translation="MWDKETARRYDAWFQTGPGAFALGREMRLLERMTAAWPRRGQRLL
FT                   EIGCGTGVFLDALHQAGFDVTGLDASPHMLEEARVRLGAKADLHLGDAGHLPFDDKQFD
FT                   FAVLLTVLEFCPDPGLVLREAARVARKAVLVGFLNRASCYGLSCKLWPGTTGKLLRHAC
FT                   WFTPWGLSRLVRQNLGPRPLRMGSVLVGPKSTWREATPWRQLNSWMLPLPVGAVCACAV
FT                   SLTREPVVTPLPAFRAGVCAGCQPGF"
FT   CDS_pept        28246..29511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="DMR_00270"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73518"
FT                   /db_xref="GOA:C4XT36"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XT36"
FT                   /protein_id="BAH73518.1"
FT                   /translation="MDKIQKIKGFADLFPPDSTVFSFIEETARQVFSRYGYKELRVPVL
FT                   ERTELFCRSIGEETDVVQKEMYTFPDRKGRSLTLRPEATAGVMRALVEDGRASEGLAKY
FT                   FAYGPMFRYERPQKGRMRQFHQIDVEAVGSPDALLDAEVLLMLDQYLRALGLKNLVIEL
FT                   NSLGCKACRPIFLDTLREFLKGMHKEQLCEDCMRRKLSNPLRVLDCKVPQCKEFTADAP
FT                   KITDHLCPDCADHFAAVRRVLDGAGLAYTLNPRLVRGLDYYVRTTFEIVSGDIGSQSSV
FT                   AGGGRYDGLVHSIGGPDVPGVGFACGMERLALLIDKKAEPAPDFALVVLDAIGLERGLL
FT                   LAQELRAAGFSGEAPYAAKSAKSQMRAADKSGAAFCLVLGSDELAAGTVVVKNMRAGGQ
FT                   ETVSQDILPAHLRARLVAGQED"
FT   CDS_pept        29711..31489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="DMR_00280"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73519"
FT                   /db_xref="GOA:C4XT37"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT37"
FT                   /protein_id="BAH73519.1"
FT                   /translation="MGDWRRSHDCGALTASDVGSEVCLMGWAQFRRDHGGLIFIDLRDR
FT                   GGLTQVVFCPEASQAELERAHVLRTEYVLAVKGRVRARPEGMANPNMPTGEIEVEVHEF
FT                   KLLNTAATPPFPIEDRIDASEMLRLKYRYLDLRRPKLAANFILRNKAVQSIRRYLDELG
FT                   FLEVETPVLTKSTPEGARDFLVPSRVNNGSFYALPQSPQLFKQLLMMAGFDRYYQVVKC
FT                   FRDEDLRADRQPEFTQVDIEMSFVDEEQVMGMAETMVKTMFREAAGVVLPEVFPRMPFA
FT                   EAIRDYGLDKPDIRFGLKLVDVTSIVKNSGFQVFAKAELVKGIRVPGGAALSRKEIDDF
FT                   TEFVKIYGAKGLAWIKIKEDEWQSPFAKFLSDEEKKGLTDAFGLEVGDIVFFQAGASDM
FT                   VNNALGYLRLQLGERFEMIPEGSFAPVWITDFPLLEYDPEAKRWAARHHPFTSPQPGQL
FT                   GTLESAPGEALARAYDLVLNGSEIGGGSIRIHDRETQRAMFAVLGIDAQEAEDKFGFLL
FT                   RALEYGAPPHGGIAFGLDRLIMILAGAKSIRDVIAFPKTQKALCLMTEAPGEVSTNQLR
FT                   ELGIKLRTRDKDKEQS"
FT   CDS_pept        31493..32017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="DMR_00290"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73520"
FT                   /db_xref="GOA:C4XT38"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT38"
FT                   /protein_id="BAH73520.1"
FT                   /translation="MPLEILKYPHPVLAKKAEPVAEITDAIRELAAGMAEAMYANQGIG
FT                   LAAPQVGASIRLIVIDLSGPDKREALMTLVNPVITAASGEQEDEEGCLSVRSYRTKVRR
FT                   AANVTVTALDLAGQPLTIEADELLAVCLQHEVDHLDGVLFIDRISRLKRAMYDKRVKRW
FT                   AQTPPAEKTNS"
FT   CDS_pept        31978..32988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="DMR_00300"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73521"
FT                   /db_xref="GOA:C4XT39"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT39"
FT                   /protein_id="BAH73521.1"
FT                   /translation="MGTDAPSREDKLVAVFMGTPEFAATVLEHVLGSQDVTVAAVYTQP
FT                   DRPCGRGKKCLLGPVKKLALERGLPIHQPESFKDPAEVATLAAYKPDVLLVAAYGMILP
FT                   QAVLDVPALMPLNVHASLLPAWRGAAPIERSIAAGETLTGVTIMRMALALDAGPMVMQR
FT                   TLAVGINDTAGTIRAELADLGGRVLTHCLKRLRQGGVPLVEQDATRVTYAKKIDKAEAL
FT                   IDWNRPAAEVHNHIRSMTPNPGAFFFWKPAADKPALRIIAQPGKVGCPLPSGAKPGDIL
FT                   GLMDCQIGIACADAVYLVPAVIPAGKRPMNAQAFSCGYLGKCDEDAMAVCGPPGE"
FT   CDS_pept        33031..33939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00310"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73522"
FT                   /db_xref="GOA:C4XT40"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT40"
FT                   /protein_id="BAH73522.1"
FT                   /translation="MKMPPAAGGLRPPDPPNGEKGGRSIVERSEPSRKRLFIGLLCGTG
FT                   LAVCAVLAFVWAVPSIGLANIHPLAPWLLGLVCAAAIVLVLWATLGLAASVALGRPFLG
FT                   SDHLRGVMARVFLPLMTIFARLFHISKSRVRASFIKVNNEIVAARAGRYDAGQVLVLLP
FT                   HCLQSSRCARRLTYDINNCKRCGQCPVDGLIALSEAYGVHIAIATGGTIARRIVVQKRP
FT                   KLIVAVACERDLTSGIQDTYPIPVYGVLNDRPNGPCLDTQVALPHLEAALRFFLAGAEE
FT                   KPPLFEAFPGLSRFVPAGGAR"
FT   CDS_pept        33936..35369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="DMR_00320"
FT                   /product="rRNA (cytosine-C(5)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73523"
FT                   /db_xref="GOA:C4XT41"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT41"
FT                   /protein_id="BAH73523.1"
FT                   /translation="MTPPRPPRGPRPPRPHRPSPAARPGQTFHDGQPGQPSHPGALPPA
FT                   RRIALTVLGRVLPSPKSPGQDVQAALDVALADSTLDPRDRGLATELVYGYLRLCGRLDY
FT                   ILAQFLKNPTAVPLAVRRILGLAAYEILHCAKVPAYASVDWAVSAVRKAGGKGLSGMAN
FT                   AVLRRVAADPGAFEEPGFYRRDRPSEAVYLSRAFSCPEWIVSLWLGACGPDETRQHLAA
FT                   QAEPAPLGLRVNGARPEAQALFNALAALPGALYAVFPTIAVPTGTDFAAAGLNLPELLA
FT                   SGALSRQSAAAQDVLYRLDLPEWPEPIFDACAGRGGKTLLIAEAGKRVFAADMHAARLA
FT                   GLPREAARLGLPPIPAFRASATRMALGAPVGTILLDAPCSGLGVLSRRPDAKWRRQPED
FT                   LAGLTRLQGAMLEAAYANLAPGGRLVYITCTVNPAENEKAIDRLGSRRHDLILDVEASA
FT                   VPDPVLGETFYGAVLRKPG"
FT   CDS_pept        35573..36658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00330"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73524"
FT                   /db_xref="GOA:C4XT42"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT42"
FT                   /protein_id="BAH73524.1"
FT                   /translation="MTSQAPQLFTPLAIRDVTLRNRIVVSPMCQYSCRDGLANDWHLVH
FT                   LGSRAAGGAGLVFVEATAVMPEGRISPADLGLWSDAHTAGLAPVAAFIRRLGAVPGIQL
FT                   AHAGRKASCRPPWEGRSKIRPSEEGGWSCQAPSPLPFAPDEPAPQALDAAGIEAVKAAF
FT                   VQAARRAVAAGFAVVELHAAHGYLLHQFLSPLSNVRDDAYGGDLPGRMRLALETASTIR
FT                   EVIPGGMPLFTRISATDWMPGGWDLEQSVALARELAARGVDLIDVSSGGLVPDAVIPAA
FT                   PGYQVPFAAAVRERVGVATSAVGLITEPAQAEAVIASGQADLVQLGRAMLHDPYWALHA
FT                   AQTLGAQPDWPLPYGYAFHRR"
FT   CDS_pept        complement(36782..38845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00340"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73525"
FT                   /db_xref="GOA:C4XT43"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT43"
FT                   /protein_id="BAH73525.1"
FT                   /translation="MRIGITLKIIVLVVSSVIISSLAIVVAGRFAFETGFSKEYDDNIQ
FT                   AFQRVGADRLESLRTQFSHLARGQAVRPNVINGVSGPDKALLSRLGQDLVGVGQAGFVV
FT                   FADTAGTVLAAAGESADAVTALKERLADNAAGRETLGFTTVSGNRLPLMATAPVRKDGA
FT                   VIGCVAVGADLAAKNALVDSLKTMLGVEATLFSGPIRVSSTITNASGRVIGTSITDQDV
FT                   VSGVLGQGKVVIKRLTLFDKPYIAAYWPLADAAGKPMGIAFVGKDMGMLAASLAAVNRN
FT                   AGLSALAVVVALGLLGYLASKAFTKPILALAAFSGAVAAGRLNETLSVSSRDEAGDLAD
FT                   SLRRMVGTLRDKITEAEAATDTARQESERAKAAMEAAEEARRQGEAARREGILHAVAQM
FT                   GSVVSGVTEAATRLRAQIDQSRQGSEIQTRRVAETATAMEEMNATVLEVAQNASKAAGT
FT                   TDGARSQADRGAEIVSQAMARIEAVRQQALTLKADMGSLGEQATAIGHIIGVINDIADQ
FT                   TNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEKTMTATKEVGAAINGIQQGTSRNIG
FT                   NVERAVAVIGEATDKARESGEALGEIVGMVDSASDQVRAIATATEEQSSATEEISRSIE
FT                   EINVISAETSTSMAEAGQAVADLDGEAAALRRLMEDMETEARGTAKPKALGR"
FT   CDS_pept        complement(39173..39502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00350"
FT                   /product="putative small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73526"
FT                   /db_xref="GOA:C4XT44"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT44"
FT                   /protein_id="BAH73526.1"
FT                   /translation="MTTSMAWTYLIVGGLFEAGWPIGLKMAETPGRGLAGWLIATLCMA
FT                   ASMALLYLAQREISIGTAYAVWTGIGAAGAFACGLLLYGDPATFGRFAGVGLIISGVVV
FT                   LKLAH"
FT   CDS_pept        complement(39597..39839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73527"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT45"
FT                   /protein_id="BAH73527.1"
FT                   /translation="MPNKVRSVRVPSEIESIDLTSLVKECARHLRDLESASLLTTQGNS
FT                   EAAEALLRARQADLGRRVGRLVWEAGKRAQGRQGG"
FT   CDS_pept        39833..41119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73528"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT46"
FT                   /protein_id="BAH73528.1"
FT                   /translation="MAWPPPFGLGKSENGPPVNATRSPACPLRESATSGSVRPDTASMP
FT                   CMARKGEAMALTRGDKMIIAGAAALAVTVVLGLAVVKKPYLFGLGEKPAPADIPPAPAA
FT                   AAPEVPAGPPPITAPPAAIAKQAADAAAPAPAAAPMPAPTPSPAAVPATPTPVPAAPAA
FT                   PPAKTPPPQVAGDESLEKMFEELAGESGGNKTGKPGAPKAEAKPAAPVPAVPAAPVATT
FT                   PAEAIKAEALPEPQAAPAPGHAPAPGHAPAPAKTDPKAEAKAKAEQAKAEAKAKAEQAK
FT                   AEAKAKAEQAKAEAKATPAPKPVAPAAPTAPAAARPVAGGGNVIRVIAEEKPGEYVLVI
FT                   QTNKPPANFSRMFMTDPPRLVLDIDGAWNYNGPLSSSTGDAFIRQIRVGKHADKFRVVL
FT                   DMAPDATTRLRGAPTAERVPEGVALRIPK"
FT   CDS_pept        41150..42235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73529"
FT                   /db_xref="GOA:C4XT47"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT47"
FT                   /protein_id="BAH73529.1"
FT                   /translation="MKRFLSLTGRTVKWLLIAVLAVEVLSFAVITTSNWIIYGNLREGP
FT                   KAVYDPYTLFLMENGVWPTANCEVVPNHPELSRTIWFFGGSTMRASSAPYERSIPSLVA
FT                   KALNERDKPCVFNCMNFGVNSFNSLLEIKYLQKQFLEYIIRPNLVVFYDGANDANYFAV
FT                   QKDPYAHEGKERAQGVIESYYKSGVGLLKPLNAAYFASFTRELVQKFLYTATPLDPNSP
FT                   ELAKFIEQVVARYDFAERLSACYGAKFLLFLQPLYWVETAPPADTTVAAKEQELILGRK
FT                   TFPHVRGNFNTVYAALEKALAGKPYFVNLRDALNGRAAPAYTADGVHNTDTGREGIVAA
FT                   MLPHIRDRLPCNLAPEPGGHQ"
FT   CDS_pept        42232..43218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73530"
FT                   /db_xref="InterPro:IPR008325"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT48"
FT                   /protein_id="BAH73530.1"
FT                   /translation="MNRFAAAVLAGALLLAAAPAAQAQALKERSLSDPPPKTQTAPPPP
FT                   AQQGAPAGQTPPVPTSVGVQPAPTPAAQPQQGATAYQPQPAQPAPGQPGAPQYAPQQPY
FT                   QSGQPYQSGQPYQPAPAAAPGYQGAPQGQYAPPPASGEPAGGTMVNGQPIGTVAPPPPP
FT                   PPAKPGPYNRDEVNREVMGFFEGGSRGLAELVARAFKDLGQPVGFIKGNEGGGALVVGF
FT                   RYGVGTLYLKGQPPVPVYWQSPSVGLDLGVNAGKVFTLVYGMNRPDQIFQRFPGVDGSA
FT                   YVLGGFGMNYQRVGDITLAPIRVGVGLRLGANVGYQSYTREQTINPF"
FT   CDS_pept        complement(43418..44821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="DMR_00400"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73531"
FT                   /db_xref="GOA:C4XT49"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT49"
FT                   /protein_id="BAH73531.1"
FT                   /translation="MPARIEHDFLGEMTIANDVYYGIQTLRAVDNFPISGQPISSCPEL
FT                   IAALGYVKKAAALANMELGAIPAPIGQAICRACDDLIAGGLLDQFPVDCIQGGAGTSTN
FT                   MNANEVIANRALELMGHPKGDYAHCHPNNHVNCSQSTNDVYPTAFRLALHQTLGGLAQS
FT                   LEYLLAGFAAKGEEFADVIKMGRTQLQDAVPMTLGQEFSAYATTIGEDVCRLQEARSLL
FT                   LEINLGATAIGTGINSRPGYSRLSTEALRELTGLNLVTSPNLIEATWDTGAYVQLSGVL
FT                   KRIAVKLSKICNDLRLLSSGPRTGLGEINLPRMQPGSSIMPGKVNPVIPEVMNQVAFDI
FT                   IGKDVTITMAAESGQLELNVMEPVIAHCLFTGIARLSRTCRVLRDRCVDGITANRDHCR
FT                   SLVARSIGLVTALNPVIGYEMSAALAKEAMETGESVYELVLRKGVLTQEQLDELLLPEN
FT                   MMQPRFVQG"
FT   CDS_pept        complement(44974..46416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00410"
FT                   /product="fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73532"
FT                   /db_xref="GOA:C4XT50"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT50"
FT                   /protein_id="BAH73532.1"
FT                   /translation="MHKPLDPVAGHLDAILDSIEDGVFIADRDGYALKANAAYEQLTGM
FT                   AKAELIGKNVEELKREGLFNIAPITPEIVATGRPASSIQVTRDNRSMTIDGKPIRDPDG
FT                   KVSLVVLYARDITLMARMRERISRQQELIETYQHQMDFFIREGGGITSFIAENSAMKRL
FT                   MDLLRRVAATDAVALVLGETGVGKELFARMIHEASPRREKPFVKVDCASIPENLIESEL
FT                   FGYAPGAFTGAHPKGRVGFFEMAEGGTIFLDEIGEMPLPLQSKLLRVLQDRELTPVGSS
FT                   KSRKTNVRVIAATNRNLEAEAKVGTFRSDLFFRLRVAVLEIPPLRDRPDDILPLARMFL
FT                   QRFGSRYRKRTTLSLESERILAHYNWPGNVRELENLIEGLVITCDSGRIEADELPTAMR
FT                   VTECPLASDAPRPTGPATLAPPPMAAPEPDWERPYKEVIAAFERDYLEGAIEHFGSVGE
FT                   AAKRLGLDRTTIFRKLKKAAGE"
FT   CDS_pept        46755..47117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73533"
FT                   /db_xref="GOA:C4XT08"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT08"
FT                   /protein_id="BAH73533.1"
FT                   /translation="MNAEATTAKTRLTVKPLDNYTIEGTSECSACGRAVKMQLLIENDI
FT                   IVDAGGTVESCGYSRECMAALCATVKGMSVLDAQTVSSEDFQPLMTRVIEKLGCDNWCV
FT                   AALRIALRNYRLREAA"
FT   CDS_pept        47316..49769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="DMR_00430"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73534"
FT                   /db_xref="GOA:C4XT09"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C4XT09"
FT                   /protein_id="BAH73534.1"
FT                   /translation="MAKSAAPDFHQIESLGEDIKRYVLSILGNDLYPPDPFRYYSGLAY
FT                   AIRERLIKMWLATQASYYDSMSKRVYYLSMEFLPGRFLMNYITNMGMEDGCRQAAADLG
FT                   FGLDDLAEEERDAGLGNGGLGRLASCYMDSMATQRIPGYGYGILYDYGLFHQRIVNGWQ
FT                   EEEADNWRRHGSPWVIDRVEHLYEVKFYGRSEAYNDPQGVLRYRWAEADTVMAMPCDIL
FT                   IPGHGGKHVTNMRLWAAASSTGFSLRDFNQGDFLGAMQSKIHSENISKVLYPNDEPIQG
FT                   KELRLRQQYFLVAATLRDIIRRHKKSGPGFAEFPDQVAIQLNDTHPTIAVAELMRILVD
FT                   EEFLGWDEAWDICRRTFAYTNHTVLPEALETWPADLLGRVLPRHLEIIAEIDRRFLLEV
FT                   AVAHPGDQVRQNRLAIIDPASRRVRMAHLAIVGSHKVNGVARLHSDILREKVFPEFDAL
FT                   YPGKFTNVTNGITPRRWLLQANPALSRLITSRIGPDWTTDLDRLAELLPLADDPDFRKD
FT                   WRAAKRENKKRLARYVLRKSGMGINPDTLFDVQVKRMHEYKRQFLNVLHVVTLYNRLRR
FT                   DPALAVPPRTVLIGGKAAPGYFMAKRIIRLITAVAETVNADDAVRSRLRVVFLPNYCVS
FT                   QAEKVIPAADLSQQISTAGMEASGTGNMKFALNGALTIGTLDGANIEIMEAVGRENIFI
FT                   FGLTAKEVEATRAAGYDPGRRVAADAELAEALDMIGRGYFTPSEPDLFTPILDNLLRHG
FT                   DYYLVTADYRACLEAQDAVNALYLDPEAWTAASIRNTANMGFFSSDRAVLEYAKNIWNI
FT                   EPLGE"
FT   CDS_pept        complement(49921..50937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00440"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73535"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL8"
FT                   /protein_id="BAH73535.1"
FT                   /translation="MSSNNDAQHLSPQTLLRIIALQTEIVKIGHDLSCVMQYVADQLQD
FT                   LAQASGAIVELAEGGDMVYRAASGLAAPQLGLRLGRQGSLSGLCVDTGQVLVCQDCEND
FT                   PRVDRAACRKVGLRSMVVAPLFHQEAVVGALKVVSEAPGRFSDEHVRVLELMAELIAAS
FT                   MFYCAQYEVSELYRRATHDPLTGIGNRALFYDRLRQSLALAGRQSFAVAVFILDMDGLK
FT                   DINDTRGHRAGDAAIKEMARRVSAVSRQSDLAARLGGDEFGLIATALADAREAEAVAER
FT                   LDQALAAPFQFEETPLPLAASISWAAYPEDGAALDALVEQADQRMYARKRARKGSAR"
FT   CDS_pept        complement(51248..51718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73536"
FT                   /db_xref="GOA:C4XTL9"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL9"
FT                   /protein_id="BAH73536.1"
FT                   /translation="MRCNKCGGDNPDDRRFCQVCGHKLQSGRAGADDTAALEPGAQDGD
FT                   RATGRPASADGEARGDTAAWTPGLDAGEGRPRPQKPELAPDKASPDARPDSRLLDFQGW
FT                   KNPLFGLGPYFEACLYAGVLAVAVVVCLAVGVLWPLYPLLAVLALIAWLRRL"
FT   CDS_pept        51742..52005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73537"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM0"
FT                   /protein_id="BAH73537.1"
FT                   /translation="MTTSWGNIDGKGRTRHQNKGTPMETILTAYSVNPVCCNGCGACAA
FT                   MAPELFAMDETTEKPVLLLAEAPVDDVERAMAFCPHDCIEAD"
FT   CDS_pept        complement(52263..52520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00470"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73538"
FT                   /db_xref="GOA:C4XTM1"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM1"
FT                   /protein_id="BAH73538.1"
FT                   /translation="MNCDSGKRRGKRRVWGGRSDVRSVLYMAVLSAKKYNPVIRDFYNR
FT                   LKEAGKPHKVAAVASMRKLITILNAMVRSGQLWGQYAHAA"
FT   CDS_pept        complement(52560..53273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00480"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73539"
FT                   /db_xref="GOA:C4XTM2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM2"
FT                   /protein_id="BAH73539.1"
FT                   /translation="MKPEPLLGLRARITRLGTGGMYMAADCFIGIDVSKETLDVHTLPD
FT                   GNDFQFVNDPDGIKAICRKFSKFRPKLIIIEATGGLQIPVATALSLKKFPVVVINPRQA
FT                   RDFARAKGRLAKTDKIDAEILALFGKQMEPEVRPLKDEQAQEMSSLMSRRNQLIRMLVM
FT                   EKNRFTRAYGSVRADIEKNIDWLEERLSEIDTHLGTVVRASPIWRERDNLLRSVPGVGD
FT                   VLSRSLLSNLPELGT"
FT   CDS_pept        53488..54369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73540"
FT                   /db_xref="GOA:C4XTM3"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM3"
FT                   /protein_id="BAH73540.1"
FT                   /translation="MARRERLAVIEVLDRLGLLKYVLAASITLLAFGVTAGAFCYEQLQ
FT                   KRPPRLSKAGQAALERQLPPSPPAAYVHRAPVSRQARFAAGPDAGPSFSFYDISDRETP
FT                   QTLADKLANKRFRVSRGQGQTCNFAYPLAAAAGDKEAVAAYIRDLGRECCAAAANLPGQ
FT                   LSTYAFARNAEKNVAQPAGPISGSAVFSEVGGGLLTLNLRFSDHGEGYAASLRQHLSER
FT                   HGPPSPMGPSGEAWARDKGLVTLTRLGRGVQVTVYYAANIERHAAHTARLADRPAPQRQ
FT                   KPATGLAVAEAW"
FT   CDS_pept        complement(54533..55177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00500"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73541"
FT                   /db_xref="GOA:C4XTM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM4"
FT                   /protein_id="BAH73541.1"
FT                   /translation="MEESAKPQRTVLIVEDDPLSARVAEKILGRLGYGILGMARTGEEA
FT                   LDAARQAAPDVVLMDINLAGAMDGVEAAGALIAEFGVPVIFLTAAVDRDIMERVAGAGA
FT                   AGYIQKPAKLLDLKANLEMAITRRGRERPCPTDAAVSLYKSLLAGVLAACSRRLAAVDR
FT                   SGRILLAHPDDHLAGMAFTEAFPAEPPLPGPADTPLTDPTGQTLGWLRLLG"
FT   CDS_pept        complement(55241..55636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00510"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73542"
FT                   /db_xref="GOA:C4XTM5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM5"
FT                   /protein_id="BAH73542.1"
FT                   /translation="MLVSEAVRVLLVDDEESYVETLRKRLMRRGLEVNMAHSGEQALEA
FT                   LQGFPADVVLLDVKMPGMDGMETLSRIKAAHPAVEVIMLTGHANVDVAIRGMEQGAFDY
FT                   LMKPAEMDDLYYKIQDAHKKKQLADAK"
FT   CDS_pept        55848..56633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="DMR_00520"
FT                   /product="CysQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73543"
FT                   /db_xref="GOA:C4XTM6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM6"
FT                   /protein_id="BAH73543.1"
FT                   /translation="MRGLDREALMGLARLAGQAILECRAGGLDVTTKADGTPVTQADKR
FT                   AGEILVAGLAHIFPGLPVICEETANAPYEERRRYTRCFIVDPLDGTKEFAAGREDFCVC
FT                   LALVEDGRPVYGVIAAPVADRLYAGGPGIPSLRRESDGTEQVLRVRRPGAGETIIAMAS
FT                   RSHPSPGLADWLARFGEVRTINRGSALKFCALAQGDCHVYPRLGPTSEWDVAAGHALVL
FT                   GAGGVMTALDGSPFPYNKPEFLNGPFLAHSLDPADPRLG"
FT   CDS_pept        56791..57285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73544"
FT                   /db_xref="GOA:C4XTM7"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM7"
FT                   /protein_id="BAH73544.1"
FT                   /translation="MRDKALLFLTGRNGILLFNILILALSIFSLWIMAPMLLNALDNIP
FT                   DLENVSESLGVILIAYGVAIEERHSLMPIFKLYPKFYTEKQAYIDDICHAYGLFYLLLG
FT                   LFMEMCVACVKMPNAIIDTDHIEYLLFGVSAVFIVWNTGLMFRHCYLLYTAPEQYTPDV
FT                   H"
FT   CDS_pept        complement(57458..58495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aguA"
FT                   /locus_tag="DMR_00540"
FT                   /product="putative agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73545"
FT                   /db_xref="GOA:C4XTM8"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM8"
FT                   /protein_id="BAH73545.1"
FT                   /translation="MTTMWPAEFEAHRAVWLAWPGNASDWPGKFSPIAWVYGEMIRKLT
FT                   GAGERVRLLVRDAKQRVAAGRVLSAVGADLALIEWFERPMDRGWTRDFMPFFVRRGGGI
FT                   AAVDFGFTGWAKYPDHLLDDQVGPSVCRELGMTVIPAVHGGRRVVLEGGGMDGNGRGDV
FT                   LTTEECLLDPAVQVRNPGFGRADYEAVFREYLGAKNVIWLGQGIAGDDTHGHVDDLCRF
FT                   VSPDTVVLCREDDPSDDNYAALSENRERLQGLRLADGGALTVVDLPMPRPVVFRGQRLP
FT                   ASYANFLIADRVVLVPTFNDARDRLALGILAELFPGREVVGISAVDLVWGLGTIHCLSH
FT                   EEPAA"
FT   CDS_pept        complement(58811..60007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00550"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73546"
FT                   /db_xref="GOA:C4XTN1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN1"
FT                   /protein_id="BAH73546.1"
FT                   /translation="MKAHLDPARPEYGLTRSALRESGRHDILLFLLVSTIASTAGIQAW
FT                   QTLINNFAVESAHLGADAVGFVQSIREVPGFLSMLVIYVLLVLSEQRAASLSILVLGVG
FT                   LAATGYFPSFWGLTATTLIMSTGFHYYEPLNQSLTLQHFNTFEAPVVLSRIRAVGALAN
FT                   IGVGILIYFMADAMGYKGMFAVVGALVAMVGVWGLCKKPCETDVAPQKKKMYLRRKYWL
FT                   YYLLTFLEGSRRQIFIVFAVYLLVKKFDYSIQSITILFVINNAINYFLNPMIGRAINRF
FT                   GERQLLSIEYAGMIVVFLVYAYTNSHIIAGTMFVLDYLLFNFNVGVRTYYQKIAAPEDM
FT                   ASGMAMGFTINHIAAVVVPVLGGILWMVDYKIPFFIGVGLGVVSLVFTQLIRTPAKTA"
FT   CDS_pept        complement(60004..61914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00560"
FT                   /product="asparagine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73547"
FT                   /db_xref="GOA:C4XTN2"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN2"
FT                   /protein_id="BAH73547.1"
FT                   /translation="MCGIAGFVWPAGQTPPPAEERRALLSAMTGAMAHRGPDGEGLLID
FT                   GPAALGHRRLSIIDLAAGSQPMEDAEGRAVVTFNGEIYNYRELKARFAARGFRFRTNSD
FT                   TEVILAAWLLDGPAGLDALEGMFAFALWDRDSRTLFAARDRFGKKPLAYTIQNGVFAFA
FT                   SELTALEKLPFLRLETPIGALMRFAAYEYIPTPETIYKDVFKLRPGHYLLWRDGQLTTA
FT                   PYWDMPLPGPEPKESEEELCEKLRLLLAQSVKRRLVADVPLGVFLSGGVDSSAVAALTA
FT                   GMVSRVKTFSIGFSEASYDESRYARMVAGRFATDHHERILSADACGSLLPEIVSRFDEP
FT                   MADPSIVPTYLLSQVTRENVTVALGGDGPDELFYGYEYFPAFHLAAGYDRLPPFVRKRL
FT                   IEPLAKMLPHSSGYINPRFVADTFLAGATAPQWLRVQTWLSAFSAESQAHLWREARPGM
FT                   LAPERLFAPTRELFEGFPADDPLARVGYVFARQYMLDYILVKVDRCSMMHSLEARAPFL
FT                   DRDLAEFVCRLPSRYKLRGAKRKYLLKKAVADLLPKDILGRGKRGFLIPVADWLRGQLR
FT                   PQVDELLGQRHLRDQGIFNPAEVGRLVTEHATKAADHRKKLWTLLVLQLWLAKHKPTII
FT                   P"
FT   CDS_pept        complement(61915..63150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00570"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73548"
FT                   /db_xref="GOA:C4XTN3"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN3"
FT                   /protein_id="BAH73548.1"
FT                   /translation="MSLPKTAYILLWYPLPSETFIFREVENAKAAGMPFCVHALYGEAR
FT                   KHLSPQMAAVAPTVARLGARSIPRILADMAWWAVRRPIETAAILATIPWRRWSCLEVAG
FT                   ENVFAMCAGFSLARKFLADGIEHIHAGWANGPATAAWVASRLSGIPFSFSARAGDIYPP
FT                   DGALAEKMRAAAAIHTNNKANIAHLHATAPDAAAKIRQIYNSLTLTGRDVSPVHLEPPY
FT                   RLLAVGRFCRTKGFDVLIDACALLARRGFPFQLTLVGAGLPLPTALIRRRIRIHGLRAR
FT                   VFLPGFVSHDRMSELYAATDIFIMPSVVHPSGDRDGIPNVIMEALAHRIPVVATDVCGI
FT                   PEVVEDGVTGRLVAQRDPEAIADAVMALAADRESALAMAEEGKKRVAAMFDPETNTRAI
FT                   LDFFGSLPRRRF"
FT   CDS_pept        63375..64337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="DMR_00580"
FT                   /product="chemotaxis protein CheV"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73549"
FT                   /db_xref="GOA:C4XTN4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN4"
FT                   /protein_id="BAH73549.1"
FT                   /translation="MAQTNILLEAGTNELEIIEFYIDEATEPGAKPYRAYYGVNVAKVL
FT                   EIIRLPKVTGMPQTPHPCVIGTFNLRSRVIPLIDLSMWLGKPMARDENTKVIVSEFNKV
FT                   INAFMVSGVTRIHRLSWSEVEPPSGYVAQFAANNFTGVVKFPDHIVLILDMEQIIWDLN
FT                   PALAMKTDRQRAEAAIPEPERSAYKTLVVDDSNSIRRLIATYLEKDGFEVIQDVNGQNA
FT                   WDRLAEWREAATKGGKPLTSSVNLVVTDIEMPSMDGHTLCKKIKDDPVLKQLPVVLFSS
FT                   LINDQLYHKGLSVGADDQVTKPEVGTLAERARKLIEASR"
FT   CDS_pept        64394..65119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73550"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN5"
FT                   /protein_id="BAH73550.1"
FT                   /translation="MFQGRSPSMHMLLVARRGQARDRIVAELTRLGAACDVAETPGELL
FT                   RAARCRRYNGVLFDVPTLVREKQFDKRVLQRLAEIYPSARLKYDPGTDTVFALGADAGP
FT                   PSRDGLSVFTAACRDFLPRSLRRGERVEANLPAVLWRAPPAGDGGEKTCTVNVSYLGCF
FT                   LFTTASWEIGQDAWVVFPDVSDVPVRTRVAWHEAWALRRSVPGVGLAFLEMPEVLFTEL
FT                   GQLGCEADEMDIACPGKAL"
FT   tRNA            65133..65222
FT                   /locus_tag="DMR_t00010"
FT                   /product="tRNA-Ser (TGA)"
FT   CDS_pept        65276..65932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00600"
FT                   /product="putative carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73551"
FT                   /db_xref="GOA:C4XTN6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN6"
FT                   /protein_id="BAH73551.1"
FT                   /translation="MKDIPRFLAGFKNFQRTYFCDGSTFFADLKRGQTPKVLVIACSDS
FT                   RVDPAILTGCEPGDMFVVRNVANLVPPYEKTPGNHGVSAAVEYAVRVLGVEHVIVLGHS
FT                   CCGGIQALMHPQKEKLGEFIAPWVRIAEPALREVNEKLSDKDFHLRQHACEKAAVLVSL
FT                   ENLLTFPWVFERVMRGEMHLHGWYFDLERGELLSYLPETGSFEPLVARCETKPAP"
FT   CDS_pept        66000..66986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73552"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN7"
FT                   /protein_id="BAH73552.1"
FT                   /translation="MAPLRPKPSASARRQPRPGPLPAMKRAIATLVVGEACRKRFAAHA
FT                   AESVRAYAKSHGLALVVLDKPIDDSPRGRARSPAWQKCLLFDVPKLRACDQVLWLDADI
FT                   AVAPGAPDVFDGVPPGTLGAVEQFSSPTPADYATAQAATRRRLAAIGASLADDDTPQAF
FT                   YRHYGFEDGPDAVVQTGVMVLTPESHGPAMAAAYAEDRRPDSRSMLYEMRPLSYHLLQN
FT                   GPVAWLDPRFNALWATSLANHYPFLMDPAFLAACRDRPDILARLKAGCVAAALARAHFL
FT                   HFAGAAEDMAFLSKKRDDASGGRGPDAPGPPKWVKGQAGLALKRRRR"
FT   CDS_pept        66996..67550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73553"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN8"
FT                   /protein_id="BAH73553.1"
FT                   /translation="MRLPEEPMKLSVLFIILCCLALPALSRAGVVLEGDACRQVFDNPK
FT                   AEQIACQTGFRLDPVTRSRLESNSFGFVSDLACSAVITAKRSEVVARLHAKGDVALPPQ
FT                   EVRCNLVSGGDPVPVRFHLAPVVRIDASGRAVDARLGIRDLTGIPEPLATAVAEFLNSD
FT                   PGLRRSIVSAANEILPNLPRK"
FT   CDS_pept        complement(67608..69011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73554"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN9"
FT                   /protein_id="BAH73554.1"
FT                   /translation="MNIAPDNALSLGRRMACVCILTLAFFTAWASPPFAATIIPIERFK
FT                   KSNEPAVAFAKNSIDFYGLRIKETKENVVVSYKGKQIEDIPAFKLFRKEPYLNDAYVVD
FT                   DYPRQGLRTLFVPTYSGGANCCVVDLIVTKTESGLVVAVVDAGSGHGIAPDAVKNGKEL
FT                   AVSSICAKGTDLDAVDADAFGWCTATAPRPDTCLVFADDTWRFAKPGEKPALYETLLHK
FT                   ELADATDPGKKPRYGEPLDKEVLYANAVNILFYAIMAGKSDTESSDVLHRALPDLDATQ
FT                   RSNFIANVKATIVRCNALTSKTIGLDPTSSVPTSSAPATPHRDNASAGGRFTRTPCGAV
FT                   ADAVNKLEWFVGPDVDMTFDQARDWAKSLAACGKGWGLPSIAQLATLHDPRLTAGTGFY
FT                   AGGKHWPAHIDPLFSGIGGGSWVWSREEPNAATAKAYNFNQGTETRTGKPGQGLTVRAF
FT                   AVRALTPAQ"
FT   CDS_pept        complement(69150..70031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="DMR_00640"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73555"
FT                   /db_xref="GOA:C4XTP0"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XTP0"
FT                   /protein_id="BAH73555.1"
FT                   /translation="MAGDNMLKLGIPKGSLQDATIALFEKSGWKIRMHHRNYFPEINDP
FT                   EITCSMCRAQEMSRYVESGTLDCGLTGKDWILENESDVVVVADLVYSKVSNRPARWVLA
FT                   VAADSPYKRPEDLAGKKIATELCNFTKQYFSGAGIPVEVEFSWGATEAKVVEGLADAIV
FT                   EVTETGTTIKAHGLRIISDLLSTNTQLIANKKAWEDPFKRRKIEILNMMLQGALRAEGL
FT                   VGLKMNVPEEKMPAIMALLPSLTAPTVANLYNKDWLSVEIVVTEGIVRDLIPKLHDLGA
FT                   EGIIEYALNKVI"
FT   CDS_pept        complement(70031..70405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="DMR_00650"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73556"
FT                   /db_xref="GOA:C4XTP1"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP1"
FT                   /protein_id="BAH73556.1"
FT                   /translation="MKRPDFAKCGGLVPAIAQEACSGEVLMLAYMNEEAYDKTLATGEV
FT                   HYFSRSRQKIWHKGGTSGHVQKVHSVRLDCDADTILVLVEQIGGAACHEGYKSCFFTEI
FT                   TSDGERTCSPKVFDPKEVYK"
FT   CDS_pept        complement(70487..70918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73557"
FT                   /db_xref="GOA:C4XTP2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP2"
FT                   /protein_id="BAH73557.1"
FT                   /translation="MRVFFDTSVLVAAMVKSHPMHQRAFPWYLKSRRGEIEMAVAAHGL
FT                   AETYACLTTYPSRPRISPVAAMALLRESIVRTSTVVSLDGRDYLEALDMVSDKGRSGGS
FT                   VYDALHVIAAEKNGADLVLSFNRKHFEPLMRPGQRFTEP"
FT   CDS_pept        complement(70915..71178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73558"
FT                   /db_xref="GOA:C4XTP3"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP3"
FT                   /protein_id="BAH73558.1"
FT                   /translation="METTLDEQGRVVIPQDVLHDLGLAPGARLIVEERDCTIVIRSADH
FT                   DNGLVEEDGVLLFGGETLGEVDDLVERVRNDRARDIAGLSKR"
FT   CDS_pept        complement(71371..72426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73559"
FT                   /db_xref="GOA:C4XTP4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XTP4"
FT                   /protein_id="BAH73559.1"
FT                   /translation="MTNLIDLTFHELESLIVSLGEPPYRARQVWQWLWQKRCREIAGMT
FT                   DVSKALRARLEEVAEIRWPVVEMVRESRDGTVKFLLALDDGERVECVLIPEKDHYTACL
FT                   STQVGCAMGCGFCATGMLGFRRNMTPGEMLGQVLVGRQYLTDKGVELGLRNLVFMGMGE
FT                   PLLNYENLLKTLEALHHPQGLDFSGRRITVSTAGVARHLLDLGRTGLCSLAISLHAPTQ
FT                   AQRERIMPGAARLELDKLMDLLAQYPLKPRERLTFEYLLLAGVNDADADARELVRLLSR
FT                   VKAKVNLIVFNATPGLPYSPPDEARVLAFQDILKSKGLTATLRKSKGSDIAAACGQLRA
FT                   ECDGEGEGEGK"
FT   CDS_pept        complement(72825..74180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00690"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73560"
FT                   /db_xref="GOA:C4XHQ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHQ4"
FT                   /protein_id="BAH73560.1"
FT                   /translation="MGLGRQGDQQGTMYLAWDEIPRSRGHVFYDRLQQILRKAGFDGFA
FT                   EKLCKPFYSDKGRPSIPPGRYFRMHLVGYFEGIDSERGIEWRCADSLSLRNFLQLSPKE
FT                   SVPDHSSLSRTRSRLPLATHQEVFTWVLKLLSKDGLVLGGRIGVDASTMEANAALKTIV
FT                   RRDTSESYRKMLLRMAKESGIDSPIDEDLARMDRKRVGKTLSNKDWRSPVDPEAKIAKM
FT                   KDGRTHLAYKPEHAVDLDTGAVVAAEVHEADKGDTSTLQTTLKAAQESLRRVTSTPPCP
FT                   DDPAELVADKGYFSRDVLKVLDGGPWRTRIAEPKRNGLNSWRGDQEARRAVYNNRIRIS
FT                   SMVGKAMGKQRTELVERSFEHTLDRCGGMRRVWLRGRENIRKRYLVHVAGFNLGLLMRV
FT                   KTGHGTPRGWASAWLALIWPDQHPSMAYLAIVMVVKGRCCGIIPIAIICGGE"
FT   CDS_pept        complement(74421..75743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73561"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP6"
FT                   /protein_id="BAH73561.1"
FT                   /translation="MAQPFKDATAICKTIMRNGYDAYVINAVLQEKALDKAAPELDVAT
FT                   DAPLAEIQKLFPQSEAYAEDGAFARLQSGDTILYLYPADTADASHPEESVARLTSRLIA
FT                   RLTAKGLLPPHQACPYMPHQVEDHDGFADLSSGEVRLNGIPDEAIRQNYLRAVRALRFS
FT                   ANYNIPVEPNTFMAILRASRRIMDYVSVKDIMDEWRKVEAENMADFVERLYDTMILHWF
FT                   LPEVATLARIKITSDDGVEYTLFEQTLAVMRHYPEELPYDWYGTLACLFHDVGKLHTAQ
FT                   YAGGDLHFYQHHQVGAKVTRKILSRLGFPPDETDLVCNLVRGHMHFHFMLTDRGIRRFR
FT                   ALDQYPRLIEMARADIKSVGGTYKEFNHNMKMLERTETPEEMLEPLLNGAQIMQLLSLK
FT                   PGPAVGLIRDALLKAQISGDVASREDAERFVRAYWDKQGLH"
FT   CDS_pept        complement(75779..77074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="DMR_00710"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73562"
FT                   /db_xref="GOA:C4XTP7"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP7"
FT                   /protein_id="BAH73562.1"
FT                   /translation="MTPPDLVVADAAVPGRDGRWTLVCAAGQVLELSPHDPAARFPEAR
FT                   VIEAKGQLLLPAMTDAHTHLREPGQEWKEDIASGLAAAAGGGFSNILCMANTDPVNDNE
FT                   SVTRLMLRRASEAWPHGPRLFPVGALTMGLAGKQLAPMEELLAAGCVAFSNDGEPVADT
FT                   ELFRHALEYAADLAPVIDHCEDPYMAKGAGANEGVMSARLGLRGQPDVAEALQVARDIL
FT                   LAEYLNAPVHLAHVSCRRAVELIADAKRRGAPVTAETCPHYLTMTDAALFGYDTMAKVN
FT                   PPLRTDDDRLALIQALREGVIDILATDHAPHAAHEKETPFEDAKNGITGLDTALGSLWE
FT                   LVRLGQLSAEDIAQRFAWRPAEIFRLPHCRFAPGDPADFCLFDPEQSWVVTPETLRSKG
FT                   KNTPLLGQSLTGRVTLTAVNGHVVYELARAGA"
FT   CDS_pept        complement(77071..78012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="DMR_00720"
FT                   /product="aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73563"
FT                   /db_xref="GOA:C4XTP8"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP8"
FT                   /protein_id="BAH73563.1"
FT                   /translation="MNWPHKDLLDVSQLSREDVDVVMRTAASFREINARPVKKVPTLKG
FT                   KSVVLFFAEPSTRTKTSFDIAGKRLSADTFGLAKSGSSLQKGETLKDTVLTLQAMNPDA
FT                   IVMRHSSSGAADFVARRVSCAVINAGDGWHAHPTQALLDLFTLREVWGDDLVGKTVTIL
FT                   GDVAHSRVARSNIRLLTMLGVTVRLCAPRTLLPKDARALGAKVFHELEPALDSADAVMC
FT                   LRLQLERQEAGLLPDLREYARRFCLTKARLKNAAPDVKVLHPGPINRGVEIASDLADAG
FT                   NSLILDQVASGVAVRMAILYLHITRKEKGETA"
FT   CDS_pept        complement(78117..78998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiK"
FT                   /locus_tag="DMR_00730"
FT                   /product="putative sirohydrochlorin cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73564"
FT                   /db_xref="GOA:C4XTP9"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTP9"
FT                   /protein_id="BAH73564.1"
FT                   /translation="MGFAHCRAYGRLRPGRPGRRHGVAPVTEPCGIILAAHGSRHPGAM
FT                   AALDAFRQSVAAAHPGAVVAVARTVGRKHGNAAAFGGARQVLDVLGELTAAGCARVAVQ
FT                   SLHVVPGGEYHELLAGLGRWLADDAGRTAVSVGAPLLADLADVDRAAAAIDEGLAAGRQ
FT                   PGEAAVLMGHGAPPPGAGFYEALRERLTQRDPLLFFGAMPREKGAASLELDTIVAALAA
FT                   KGVTKALLLPFFTVAGAHACSDLAGEQPDSWRGRLEAAGITCRARLAGLLQIEAFAAIW
FT                   REHLARAMARLS"
FT   CDS_pept        complement(78920..79792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00740"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73565"
FT                   /db_xref="GOA:C4XTQ0"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ0"
FT                   /protein_id="BAH73565.1"
FT                   /translation="MTARLIFSGLADLFRRPSTSLSVILGVFATVFLCGLLALAQVGLD
FT                   GALAKGQGVLRFQVYWKPGADAALTARQMDWMRALPGVIEAKAFTPEAAMAVMRGSLGG
FT                   AAEPLLPGAANPLPYTLLLGFAPPEHDDGFAKQTLERLTAVDGVAEVRYNPAAIDAARS
FT                   LGLLGAQAVLPLGAILALLVGLVVGNTVRLTLLRRREEFEIMRLVGAAESVIALPLVAG
FT                   AAAMGFVGAGLAATALAFLWSAVAGQLAAAPLWLSLAAPPGWLWVSLIAAPTAVSALAG
FT                   LAAAMESRP"
FT   CDS_pept        complement(79789..80484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00750"
FT                   /product="putative cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73566"
FT                   /db_xref="GOA:C4XTQ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ1"
FT                   /protein_id="BAH73566.1"
FT                   /translation="MIEVQGLRHCFGRREVLRDLTFSLEKGGFAFLTGPSGAGKSTLLR
FT                   ILHGSLPLQEGRAVAAGHDLAGLRPSKLHQLRRDVAMVFQDFKILPERSVADNVALPLV
FT                   VRGTPAARIKRRVSSALTALRLTELANRPCAELAGGEQQRVAIARAVVAGPRLMLADEP
FT                   TGNLDWDLSLRLLDILRQFSAHGTAILMATHNQALVAAAPDARIIRLERAAPDAGTDAA
FT                   QAAAPEAAS"
FT   CDS_pept        complement(80481..82109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="DMR_00760"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73567"
FT                   /db_xref="GOA:C4XTQ2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ2"
FT                   /protein_id="BAH73567.1"
FT                   /translation="MIEVLRIKNLALIDDLELEFGPGLNVLSGETGAGKSFIISAVNFL
FT                   TGEKMHTDLVRAGRDKAVVEALFVLGDEELILRRELVADTGRSRVYVGDALASRETLAA
FT                   LRPKLLLHVSQHGQGRLLQPAFQAALLDGFLPDPALLTEKNRLARELGEVAAAIRDLDA
FT                   KAAGLEEKRQFLEFQHAEIAKVNPLPGEEDELVARKAALAESRKAAQALGRALECIERQ
FT                   PPVLDALADLHRELLHAGEIHEEFTADAEAVAAFRHHLKDLAVRLRRRPAKAADDDGEG
FT                   IEKRLFELATLRRKLKRSLAEIVDLGRDIKENLDFLDDCGLKRKQLARDEAAGMAALAQ
FT                   ALAALGAARREAAARLSAALEDILRGLGFSKDVRVIFDFTPVVAYTPVACDGEPLTEDR
FT                   ARVLWRPNPGQPPQPLDKIASGGELSRFLLALMSLSAEPGGPTLIFDEIDAGIGGLTLT
FT                   SVGSHIKKLAATSQILLISHWPQLASLADRHFQVQKSVEDGQTVTRCLRLDADGVAAEL
FT                   ARMAGGGEAGAEMARRLLENGDTPA"
FT   CDS_pept        complement(82121..82963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00770"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73568"
FT                   /db_xref="GOA:C4XTQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ3"
FT                   /protein_id="BAH73568.1"
FT                   /translation="MLNPVRLLRRLLPANGLLAVGLCIVGAVSVAALLAPWLAPYDPLA
FT                   LDVDAILRPPGGAHLLGTDALGRDVFSRLLYGGRVSLWVGFVAVGISVAIGLFLGLCSG
FT                   YFGGLIDEAIMRGVDVMLCFPSFFLILAVIAFLSPSLTNIMIVIGLTSWMGVTRLVRAE
FT                   TLALRSRDFVLAARVSGMGAPGILFYHILPNAAAPVLVSATLGVAGAILTESSLSFLGL
FT                   GVLPPTPSWGNMLMEGKEVLEVAPWLSIFPGLAILVTVLGYNLIGESLRDILDPRLRQ"
FT   CDS_pept        complement(82956..83954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00780"
FT                   /product="putative peptide ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73569"
FT                   /db_xref="GOA:C4XTQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ4"
FT                   /protein_id="BAH73569.1"
FT                   /translation="MLALAKRLLLKTLWVAVVFLGITCVSFAVIHLAPGSPTDMETTLN
FT                   PLATAETRARLQALYGLDRPLHVQYLDWLGKLARLDFGNSLSGDRRPVWDRIKERLPLT
FT                   ISMNVASLILTLAVAIPIGVASARHQGGLFDRAATVFVFIGFAMPGFWLALLLMLYFGI
FT                   HLGWLPISGLTSMDYARLGPWDKIVDLARHLALPIFIYTFGSLAGMSRFMRSAMLEVLR
FT                   QDYILTARAKGLSEFTVIYKHALRNALLPVITILGLSVPGLIGGSVIIESIFALPGLGQ
FT                   LFYQSVMARDYPLIMGNLVLGAVLTLAGNLLADAGYALADPRIRLGGKGDA"
FT   tRNA            84112..84187
FT                   /locus_tag="DMR_t00020"
FT                   /product="tRNA-Ala (GGC)"
FT   CDS_pept        84614..86311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73570"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ5"
FT                   /protein_id="BAH73570.1"
FT                   /translation="MHRIVKAHLDSFVKKFSLESDDEASQFEKFVNYSIVTTKIGTQYD
FT                   IDDITTSTSDDGCDGIAVIINEEVVVSEEDVRSFFITERRNHDVEIVFIQAKRSESYDL
FT                   GDFLKFKESILRFLTSEPYAATDDVQQEARKMFDVIIENVPKLRNGKPSAYIRYVGTGM
FT                   YQCPSSLETAKSDFVRQLDDVGFFKETDIQILGRDELTSLWVGTYSGAKAKLEMLSNAP
FT                   LRTIDGINEAYLAVVKAADFVNELLVNENGDLRLQVFEENVRSFLGNENAVNRSIAETL
FT                   QNPRSASRFPVLNNGITIVSPDVQVQGTTLHLKNYQIVNGCQTSNVLFENRDYLTNEVM
FT                   VNLKVVETTNEDIFSELVRATNSQTTIEETQFVSLKPIVKKIEQYFNTYETTESRLYLE
FT                   RRERQYVGSEIPAIRIFSVHTVTRCVAAMFCQRPDLSFKYPKKMYLELSDTIFMDNNKE
FT                   ILYYAACLTLYRLHLLVSNRTIPQSMKRFKWHILLIVRILLSSKEPIRLNSSKVEDVSQ
FT                   KMISIFSLHNETATEIFKKAVDVIESFGSITNDRLKGQLIIQEMLSKT"
FT   CDS_pept        86470..87204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73571"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ6"
FT                   /protein_id="BAH73571.1"
FT                   /translation="MEFTFYGDLIGMKSIYSNDPMKAYQTLNEFYNTCFNIIPDQKINN
FT                   CDMQTYMFSDSILLTGNNIVNDLPTIQKLYLRLLSKSTIMLRGAIVSGKLNFDPRIERS
FT                   SFKKMLPIGTELVRAISLEGQYKGARLIIENKLAEELLDEARDWKTISGYVNNLTGDNY
FT                   IPKNDFRRRIIPVPEGGAYEYLYFWELDNVNSLQNLFHKDIEDKLSEIEKYMDTNKARH
FT                   YSETLNLLKRSLNRKKYTETRL"
FT   CDS_pept        87260..88108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00810"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73572"
FT                   /db_xref="GOA:C4XTQ7"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ7"
FT                   /protein_id="BAH73572.1"
FT                   /translation="MNSSKKTEIDLGIALLKSIVSMGIFSFVFDIAMLPTNLNKDIYIL
FT                   ISFFVKTFSFVFTGLWLVHKNKFHAAIICASIIAIEAFWLRGTLSLIYAGTMPVSSIKN
FT                   VIYGLFSGIILSFLAIQYKDRIERSRLVKFIDKKFFRKNYLKKISTQLNESYAILLLTS
FT                   EPMMACNQKLIQQLHEECEQDPLYKNFQHAVKCTAFSIITDPKENTLEYIKELESEIVK
FT                   HSEIVHEALKKYDVGGDFWSTLKIKSNKEYYNRTLYAFYFEHYLRAQHVLLSYWTKYHD
FT                   K"
FT   CDS_pept        complement(88418..88990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73573"
FT                   /db_xref="GOA:C4XTQ8"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ8"
FT                   /protein_id="BAH73573.1"
FT                   /translation="MFNKKLWSEAVDIAKDQARHGKVHYSDLQKATETIYNDLLLLEQG
FT                   PVFETNPIPEPSTQAALPAPSAGIFKHERVGDFVTCAECGEQMKSISIAHLKKHGINSR
FT                   EEYMQKHGVLKKDMIGNIKREVLKGEENPLTVLGHIMREYKVARDDVNEFIAEHGFTDL
FT                   KDLMKKAKVAGVLPFEFFQDKQARNLL"
FT   CDS_pept        89267..89542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73574"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTQ9"
FT                   /protein_id="BAH73574.1"
FT                   /translation="MPPRDSPGAPGYLLLETIGGDMNSKNIDLLEAKDDVYNSFRLIEN
FT                   IFKIMDTSSPEVYGNLTSLYSEVGMALCHNFRNKLGDIFGNYFIDR"
FT   CDS_pept        90225..90398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73575"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR0"
FT                   /protein_id="BAH73575.1"
FT                   /translation="MHIMPAKRRRKPEPRPRNEFKKSHYIKDLIKKFALANILLNPLNL
FT                   LENFNLLIISVS"
FT   CDS_pept        90447..91265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73576"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR1"
FT                   /protein_id="BAH73576.1"
FT                   /translation="MMDIKDDGLIMPADMDSIIAALGALESKINKQTDTEDVIQARLRL
FT                   ESGKYLNQAKSIIKKQGLKWEIEVSKIIPKKPDGTPVIKKTTRAERMKVASLNNIDKYL
FT                   FLGWGKLVKISELIKGNDVEVFLKDLGFNQADIKNFDYSEFSMAIDAKVVHSLLKKNNI
FT                   NISMDLILKSLRKGVIFEDKLLKELSGKARPDLVLKSLIHFDVVNPKTSQVKSPLAVSS
FT                   EIEEVMEKLITLMGKALKTNTVPKHIPGFMYEDLAHYNSILYKLSLPAEE"
FT   CDS_pept        91274..92149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73577"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR2"
FT                   /protein_id="BAH73577.1"
FT                   /translation="MRIYQSSITAASLRLLKKLKPDIKIHVLRSYLVDGPGTFEILSTN
FT                   PGNIKSLALDSGTFSITENTHKHHIDVLNYADFLEDCSSFYNFYFGFDPEHGDEGTESS
FT                   IENQRILEAKGFTPIPVIQNLQLEVDYYTSQASKYPFVAIGSTRKKNIDDLVKATNILH
FT                   SANIKVHWFGIGSFAKLTKAPVWSSDCSSFAQWIKNGRLIYFDEVNGKEVSFATREYSK
FT                   NGEPNKDYVRLHPLCEDYEEWLHGRLGLSLEDVIHHGDMKLAVNSYYFYELEQKLTKEQ
FT                   MAKGYIYDCE"
FT   CDS_pept        92177..93283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73578"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR3"
FT                   /protein_id="BAH73578.1"
FT                   /translation="MVIPCETSPELRFYNYLSPRPRWGNSKVIRNIGKKEEIINIAAYI
FT                   QMPNHRKQYLSFDLDYECAASVWMDEGLPEPTLIVINNENSHAHLHYELTVPLLLPIRG
FT                   RKATYSSKAKRYYDSVVLGLCLRMNGDMGFNGSNIKNPFYQYIEKKQAEITNVPFTSKW
FT                   KVHWANYTYDLNELNEYGLDIKNIAVRPEIDPTSRNQTLFDSCRKHAYKIVKQYKDEKI
FT                   FHQAVEIICNQFYEMYLKDIVKDHPYTLKEVASVARSISEWTWRHKNDPSFPNLSKNRG
FT                   VMGLTRTFQEKGSPEHLQEIRECEQKGAYYTHRVRRAKTISKITEAVNYLTSNGIQVDY
FT                   KEIVRMTGLSLSRVYGYKDLIDSLDIKI"
FT   CDS_pept        complement(94236..94445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73579"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR4"
FT                   /protein_id="BAH73579.1"
FT                   /translation="MGKAPKTQEKGFYGEVSQVQSMYRTGGRSTAGRKDGSILPLKQIK
FT                   EKGPHRMKTFMQNILCSSQKHAPI"
FT   CDS_pept        94652..95032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73580"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR5"
FT                   /protein_id="BAH73580.1"
FT                   /translation="MGVKNETNGENQDQQSKKKLESKYDPKLLRQFVKEGLDATQIMQK
FT                   MSIRHKQTLKQYILKLISTDRVLYEVKDLYIKDSKRPRVNQAGFLRINLNAHDLGDIEV
FT                   NEGDEYSVEVNGNQIILTKIHP"
FT   CDS_pept        95399..95956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00900"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73581"
FT                   /db_xref="GOA:C4XTR6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR6"
FT                   /protein_id="BAH73581.1"
FT                   /translation="MKVEPIIDMKHIKCIKKLLITNKRDRLLFIMAINTGLRVQDILAL
FT                   KVSSVKTSNTGDRVCLKEKKTGKENVFIVNKEIKSALDDYFGAVEVHDDDYLFKSRKGQ
FT                   NSPLTTYAVTKMVQRWCDEIGLKINAGAHTLRKTWCYQQRTYFKVSWALLASRMQHSSP
FT                   SITRRYLGIQEEEVEDILLNTI"
FT   CDS_pept        96071..97195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00910"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73582"
FT                   /db_xref="GOA:C4XTR7"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR7"
FT                   /protein_id="BAH73582.1"
FT                   /translation="MGVYQRDGRWLVYWNENGKRRDKSFGSGDNGKYQAEVFDAAVKNA
FT                   KANNQTVPDPSLVQTYQAPVINVSQISYEPVIPVAVVETGSITFGKLAQKYLEHLSASG
FT                   KTEKHILTIANLLKTCFFNLLDKNKCVDNMTYVNDILPFIKHFQGVSNITGKPRSQITV
FT                   NRYCDYVDAIFNFGIENELSKTNPMSKRKRSKERPRDVQLNIEDMKKIMDKAEPHLKWA
FT                   MEVCFNLGTRPGESELLSLKWSNVDFTKATVHIYATKTKTFRTVPIKVSFLEKLKAMRE
FT                   YSTSEYIVEYNGHQIKSLKGSFRTACELAGINYPVRMYDLRHLFATTLLSNNADLAAVS
FT                   KLMGHATVKMTADTYYHYLEGEKERAVSMLPDIV"
FT   CDS_pept        97408..97629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73583"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR8"
FT                   /protein_id="BAH73583.1"
FT                   /translation="MAGLLALPPKNDHISVGYSQKEALAANYLTRKSNDFSYICGMAFK
FT                   RSWVRFPPAPPRRMPRGYREIGDPFFFA"
FT   CDS_pept        97798..98232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73584"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTR9"
FT                   /protein_id="BAH73584.1"
FT                   /translation="MRGCIRKETTVAWAVFKRSPPPILDFWTFRVQPMKIFWPHFSPAV
FT                   LLADPARESAAGTGLWSHGCRDFTGGGWFSWSCPIRPTRPPARTPPGFARQGGFLGRST
FT                   GTGAFVPPGLVPLQGGPPRVKVRFTLGLAHRQAMRTNKSQ"
FT   CDS_pept        98675..98896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73585"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS0"
FT                   /protein_id="BAH73585.1"
FT                   /translation="MLQPLTILGKQDHFDPKDILTAPIDAIVCYCGNVTKGQVLDAISD
FT                   GAKTLAEIKESTGACTSASCKELSPRRR"
FT   CDS_pept        complement(99041..99238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73586"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS1"
FT                   /protein_id="BAH73586.1"
FT                   /translation="MSQALEKPYVHPRRATLERDQARGTKAPGQGERPRKGAYRANPGG
FT                   VRAGGEVGRTGQVQESNGAE"
FT   CDS_pept        complement(99558..99962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73587"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS2"
FT                   /protein_id="BAH73587.1"
FT                   /translation="MFADEDFFWDALQKSKCPKWPWPQPGDRTRKTKRPRQIPVAVVLA
FT                   PAITAAQSSPPLSLEVQGKRPKEHLPLALQFFPGMHCKCPNVQNRIYHIEIMDINQIRG
FT                   VLGVPIGANLCFTSPPTAKKKGPDGTGRGQ"
FT   CDS_pept        complement(100000..100359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73588"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS3"
FT                   /protein_id="BAH73588.1"
FT                   /translation="MITTSYYAQEKKIKNPVAISQQKYRWGTKSREYKKLAPPMYLVDY
FT                   WKKGSITVEQYTEEYYRVVLSKLNPQEVLDEIIRIFGDDATLLCFEKAGEFCHRRLVAE
FT                   WIEKGTGVEVPELQF"
FT   CDS_pept        complement(100613..100804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73589"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS4"
FT                   /protein_id="BAH73589.1"
FT                   /translation="MGESQMPRAQLKSQESICSTESAFDADSEKLLVDYRGLTGQYLSP
FT                   EIFQWPTRAKSEKTTRPW"
FT   CDS_pept        101040..102860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73590"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS5"
FT                   /protein_id="BAH73590.1"
FT                   /translation="MVSSFKSSLLGNGQGLCSSAVKVDDAQSFGSCPKTCPPQSIVSGH
FT                   QRSGKVKQQTSPPWPAQCLDPQADPARTCPVGAEAAFTEVMPISQPEGVALPNAANVVN
FT                   VFGNFNVGLTAPSQGLRPIFAYPLTDLGNAQKFYRVYNKFFMYDHESAQWVGWDNDKKR
FT                   WLTGRLARQLMMRFVMKLVDELYRQAKSLRPLRTRNGEEVTPEEALAWAKATSQNSRKK
FT                   AVLEMVRDLPKVRVAKAELDSDPYLLGVANGVLDLRTGTLIENRPELRITRYASAAYRP
FT                   DAEAPIFQGFMRQICLGRQDLVDFLQEVFGYALSGLIKEHAFFILVGTGANGKSTLVEI
FT                   FLYLLGEYGIGMPGHAFLKSNSRAIRNDIARWPGIRLGTIAEANDGMSFDESLLKRSVA
FT                   GDVMTARFIGKEYFDFHPVAKFFLSVNTLPKITGADNGIYRRLVVIPFDGDFQATMDRD
FT                   LPEKLKAEIDGILAWAVQGFLRWQARGHLVKPDCVVEACKAYRAEMDTVQSFLDECCIL
FT                   DPNVSTPLGVLYEAYKNWAKGAVVDPANLHLFGTLMGQKGFKKVKSGTWRWKGVALKAA
FT                   PTVVKPSPFGMTTPPPSAVASASSFAGMPQ"
FT   CDS_pept        102922..103686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73591"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS6"
FT                   /protein_id="BAH73591.1"
FT                   /translation="MTTPLNQASLGLAKEYSLTQAEYHALVRGFKIAMKFNPPSLVLQN
FT                   SNLMAFTEDRMAFIQADYHSSEKDPLVKPLVTMAFVPDKAVIKEAKAIRGEGNVRISFK
FT                   AEHCHIHGDHTDASFPAIPVPDGAYFAMPPISWFGAKLSEYDSKDFGKYIGKIGKGKEA
FT                   VHLAVYGDQLEQVWVNGASGPYTFTAGMAERLASRIPSLVLKSQVAFRFIGHKQTLQIG
FT                   TLNDQYVLRATTPIDMGVDLVVTEVLDVVSAS"
FT   CDS_pept        103739..105061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73592"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS7"
FT                   /protein_id="BAH73592.1"
FT                   /translation="MIMSKYVHVASKPQGKGFDYDRAIMPKNKLCLYSIIGGMQQYDFN
FT                   THTLHDELMSIQEYTERYVRPIDGEIFIDSGGYSIIQGAVHPKAVPRFVQCYNAMLDMK
FT                   AGAFDKVFSLDIPWSKVFTEMNTKQKIMELNDYALSTARDILLANAEALERFSFVWHFK
FT                   MPAQYAIWDHLFAKHGLNQIIRHRAIGGMVALRGITGIKFSPFIGMAYRCLLDYLDAGR
FT                   FDLDFTLHFLGLYLPYDRFEMTILDGLFARYLGGEAQAVTTYDSINPLQVTRAKTDIPL
FT                   FEFTGSGLTVYNNLTDAPAGILDHVYGEPELIGHVQEEIARRQSGARLQQASSLGPLNI
FT                   YSHQQVNHFFEYVVAAHGLAEVFFQEWSLTKINGHYAGVLGTLAKSYPALFTKHTCGAI
FT                   MRNVAITYEFHRWYVDDRSRAGLESLILSNIRKIGFPGRLA"
FT   CDS_pept        105119..106057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73593"
FT                   /db_xref="GOA:C4XTS8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS8"
FT                   /protein_id="BAH73593.1"
FT                   /translation="MVKIVARKCTITRSQEFEKKTLATHALNVGVLCGHGCLYCSTPAI
FT                   LRTQSKLFPEYDGSAFKAFAAGAAAVDPTTPDRLGPELAALKPTDTVMLSTLTDAWSPE
FT                   AQEFDLGRRCLEKLLRESKARVRILTKNAAVVNELDLLAEFRERVILGLSITAPLSKAK
FT                   VAEVLEPRASSIQERLGALQAAHEAKVPIFGMLCPCMPGVADRPDDLDEMLDMIKPFAP
FT                   EAIWAEPVNARGPGLRLCQEALADADFIAIANEVRFIRGQREHLDYTARLIGNLNVAAA
FT                   GVGLKSLLKILVYQDGEGFRGDGSSVIWLKG"
FT   CDS_pept        complement(106143..106361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73594"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTS9"
FT                   /protein_id="BAH73594.1"
FT                   /translation="MSWIVAFDNYIDLRRSPKKKMRRAEPEATSFFKGCTANFSGMHFK
FT                   CPNVQTLPEAPESIINRLTSEARHTGF"
FT   CDS_pept        106461..106868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73595"
FT                   /db_xref="GOA:C4XTT0"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT0"
FT                   /protein_id="BAH73595.1"
FT                   /translation="MDDYLQSALEIVKAQASARPMTEDEIISMVRSVANGIAAVSSGQL
FT                   VASEAESAAPAMDPKKAIKEASITCLECGKSFKVITKKHLATHGLTTEEYKAKYGYKKT
FT                   QPLACKSLARDRRNKMKDMKLWERRTKAKTE"
FT   CDS_pept        complement(106874..107104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73596"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT1"
FT                   /protein_id="BAH73596.1"
FT                   /translation="MSERDLDQETRPIHLSVSDHEKEGVGNRREGKKRARSSDDNYGEG
FT                   HQHASYEKAPVRGGAPGLRGSRIRRGGIEWK"
FT   CDS_pept        107273..107497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73597"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT2"
FT                   /protein_id="BAH73597.1"
FT                   /translation="MKQQQFDSLTLKDEIINAFRPIEQIFKIMDKSSPEVSGDVTRPYG
FT                   EVGLVLCENFRSKLEEILSSISQGASNDA"
FT   CDS_pept        107487..107876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73598"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT3"
FT                   /protein_id="BAH73598.1"
FT                   /translation="MTPDKDWNVVFEYSRAQAIADGVLVDVTDAARGVGFKVHTVVTAT
FT                   LYHGYVVPPAGLDGSFGQSAAGRLHDVLTLALFAARASKGTDRVYFKVDFLMAPGKTET
FT                   VDIIAHIGPGDTPAPVLTIMMPGDD"
FT   CDS_pept        108405..109349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73599"
FT                   /db_xref="GOA:C4XTT4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT4"
FT                   /protein_id="BAH73599.1"
FT                   /translation="MIMGKVQEFQRSVGVTKSEEFNKKQLATHAINGGLICGHGCAYCS
FT                   TPSLLRTHALFRDMGISSFQYFAEGGSVVDPWTAIRVGRQIGSLTENDMVMISTITDCW
FT                   SPEAQKHNLGRKILEQVLINSKCKVRVLTKNAAVQNDFDIIKQFGDRIRIGLSITSPIS
FT                   KENIIKLIEPNASLMSERIDAMKKAHSLGIKTFGMICPVLPGIGNDPESYKQMLSAVLE
FT                   CDPEAIWTEPLNPRGPGITRCMEILDKNNHSNIAAHFDIIRNSTLHMDYVENLINMATN
FT                   IAKEMNCIDKLKILVYSNGDGYRVDDQAVIWLK"
FT   CDS_pept        109391..111334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73600"
FT                   /db_xref="GOA:C4XTT5"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT5"
FT                   /protein_id="BAH73600.1"
FT                   /translation="MALSISMETTMIMQSNEATKFSSDIDGQLESDSQKKKITSVNIRS
FT                   VLPDAPVSIHCTLPITVVFSSGKSLIRRIDIKTDKADFISPCPLFISKRGIDLVSQKET
FT                   VELAWVRDDQWKFIEVDRSYICKHTKIVDLADYGFPITSDSAKEITSYLRWYEKINAQH
FT                   IPVTINTSQMGWNKEEHCFLLGNDCIVPTSEIDLNEIFDHYEPQVSRPYRFRAVDAGER
FT                   QLAHSFHTKGTYEKCVEGINTIFAFPIVLFTFYASITAPFLKIFDCKNFMYEISAPTST
FT                   GKTAALEIAASNWGDPHESSGGFFRTWKSTSTAIERILQSVNGIPIILDDTKNAPGYDK
FT                   CGKSCTPLVVQTIYMISTGIGKSRGTLSGTDANASYSTIVMSSGESPSIDLTSDGGSRG
FT                   RIISLWGYPFKKQSPEIRSYISNLKTIFRNNYGHVARRLVSFIMNHKSDWPCWAEAYKE
FT                   VCFELASKENVNAVQCRVSESVAAIATAIPLIHAALPELRRDIDLKSLIGTINELAHQE
FT                   AVLEDNGSRFIQILSDYIADDTSKLLTKFKVERNQQVASRDIEIYSDHDGSDWNFIGIS
FT                   SELFKTLVKENQLNKSEVLRTLLAKKLIDVNNSSKGSQKQVVISGGATGTFKKNLYCIK
FT                   KSAFSPNEIDFA"
FT   CDS_pept        111664..112071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73601"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT6"
FT                   /protein_id="BAH73601.1"
FT                   /translation="MYYEKILRLYNLPESNFNLISKQIDLDTSGKTSHLTSIPQNDLKS
FT                   STKNITVSEKIEVDSIENINPGHDIEMTSSINSVDCFKCNYLENNGNYTPSDDLVCGFT
FT                   NKKLTSTDTQCDNFEPKTELQNEPEIDDYTG"
FT   CDS_pept        112379..112693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73602"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT7"
FT                   /protein_id="BAH73602.1"
FT                   /translation="MIFIAHRSISRLLSNESSVRHLKNRKSFSCFYPYILIDIKNYTLC
FT                   IYKICIDYNLSIRKIKFGHGSREASASRKSGLNVLATKKSKNKESHEKEDDHFLLNQNP
FT                   "
FT   CDS_pept        113274..113561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73603"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT8"
FT                   /protein_id="BAH73603.1"
FT                   /translation="MFNYLGITEYRTARCRLLVYLLLSSTFLDTLKKAPLQIAPSWGFR
FT                   GRTHAQVPVDPKNARIRVLRPIHVSDMIRTNIYELKYTVNRLLGVFYENF"
FT   CDS_pept        113664..114026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73604"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTT9"
FT                   /protein_id="BAH73604.1"
FT                   /translation="MSKKEDQPAKGMKLESKYNPTLLRECIKNNNSASEIMEKLGITHK
FT                   QTLKQYVLKLMSDDRNFYEVKGMYVKSSTRPKVNKNNEIKLYLKNLGLEELQLVEGDEF
FT                   TVMVENGSIVLTKIEH"
FT   CDS_pept        complement(114120..114359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73605"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU0"
FT                   /protein_id="BAH73605.1"
FT                   /translation="MANFLQCSISFARLVKPYIQNRGMARRPKANGLILLESKDFLWPP
FT                   APMYVSTTNRTLAYDSISVFSCSKLLKKHQNLAE"
FT   CDS_pept        114358..114915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01140"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73606"
FT                   /db_xref="GOA:C4XTU1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU1"
FT                   /protein_id="BAH73606.1"
FT                   /translation="MKVEPIIDLKNIKSIKKLLSNNPRDRLLFIMGINSGLRVQDILSL
FT                   KISDVKSCKIGDRIAVKEKKTGKENVFIMNKEIFAALQDHFTSIELVDNHFLYKSRKGK
FT                   NYPLTTYAVTQMVQRWCDAVNLSGNYGAHTLRKTWCYHQRKTFGVSWEVLAKRLNHSSP
FT                   SITRRYLGVQEEEVEEILLNTI"
FT   CDS_pept        114965..116200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01160"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73607"
FT                   /db_xref="GOA:C4XTU2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU2"
FT                   /protein_id="BAH73607.1"
FT                   /translation="MLTLRVFNFLKGVLMGVYQRDGRFMVYWNENGKRHDKSFGRGDDA
FT                   RLRAEAFDLAIMQAKEKGRPALEVEIVTVGVPGVVQSQAETAAVAPVGAVEANVAPVAP
FT                   LAAPVVSVSPAAAPSKGLTFGQLSMMYLDHLRVSGRTEKHIASLENLLKRMFFDILGKD
FT                   TPVAGMTYLKDIVPFIRQMQGVSQQTGKPRSQASVNRYCDYVDAIFNFGMEMELISKSP
FT                   MKGRKKAKEQPRDVQIGIDDLKRIMDHAESHIRWAMEVCFNLGTRPGPSELFALRWEHV
FT                   DFDAGTVRIYATKTKTFRTVPVTESFLIRLREMRDQSQSGFIVEYEGKPLTTIRRSFNT
FT                   ACEKAGITVDVRMYDLRHLFATTMLANGADLAAVSKLMGHSTVKMTADVYYHYLEGEKE
FT                   KAVGKLPSLARV"
FT   CDS_pept        116338..117372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73608"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU3"
FT                   /protein_id="BAH73608.1"
FT                   /translation="MCDQSGGRMKMPSRLNPDASSSRKMLELYSLLLFSGRKYTLTTLA
FT                   ERLQCSKTTIDRLISEIELFDQVERGKEGRERWYQINRLRKNKKVMIMCEQIQQLSLCK
FT                   DFAATVLPSELKEDIESTVAQAAEFISDDCIKQLAMQPLGRSLARGSIDYTPFQGIIKI
FT                   LIQSISKKILCEVNYRSLSSPSPKIFLVAPMRLLTYNNAMYVENWRIKREADCNNLQSM
FT                   VLSVQRIESVNPTLEKHSFKDMPGKDNENFGLIKSASEKVTLVFDKSVSNYVTERTWSS
FT                   DQTFKFLPTGGVEMSLTANSLEEVVAWILSFGDKTEVVEPAHLRTMVRNRLLKSLEKYG
FT                   FSSS"
FT   CDS_pept        117559..117732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73609"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU4"
FT                   /protein_id="BAH73609.1"
FT                   /translation="MTRKNNSLDDETVVKLNKLFGLPESAEDAKQICTGDEISQEFFGD
FT                   NNSSSDIRKRNS"
FT   CDS_pept        117933..118364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73610"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU5"
FT                   /protein_id="BAH73610.1"
FT                   /translation="MDFEVQCESCGHVEKMRVDRFEMSDNLESVDIDVEDISCLAHFKK
FT                   LLFLGSAQCVIAGGEGQATVVDICRFKLDKMVSQNPELESSSFHYSWAYFGNCEICSCS
FT                   MYIKLNKFYGYHAGVYCTVECENALFSADPYEIVRRLGG"
FT   CDS_pept        118412..118675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73611"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU6"
FT                   /protein_id="BAH73611.1"
FT                   /translation="MATIDWSAFLKGRFKDATGIDSKVRFPAGRDIKIEGDIDNVRIWL
FT                   SREAVTANMQGDSAAFEAWALVLKSWCGVKNVAIDWESPPPP"
FT   CDS_pept        118773..119405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73612"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU7"
FT                   /protein_id="BAH73612.1"
FT                   /translation="MPDAAISEALFLKSDKLVLNIAGSKSSQAAPNDNSEAALEWLIVR
FT                   SDKFKKQFKLEHLERQLPVGLFDGTVSDESRVFCGRKSAIDLFGTDLERQFWIFELKQR
FT                   QNNKMGVVSELFFYAFLIRDVLRERIMMPDGPSLRFSGGVRRAIMNCKSVKACFLAPEF
FT                   HPLLCGGIILDLLNSATTKIDWPVSFQMIKISDFGDVIGPEFDACVH"
FT   CDS_pept        119393..120640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73613"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU8"
FT                   /protein_id="BAH73613.1"
FT                   /translation="MCTLKLVIHRAAHEIGGNCIELTSSTGQSLLLDAGRPLDAPVGVT
FT                   EGLVPTTLDTSASVEGLLLSHPHQDHYGLLGVLPAAWPVYAGAACEKLVKLTGRIFGVT
FT                   PPQHFNSWKSGVPFAIGPFTITPYLIDHSAFDAYMLLIEAHGKRLLYSGDFRMHGRKGK
FT                   LVRDIMANPPENLDALIMEGTNLGSDKPSCSEVELENRFVDLFRNTKGRVFVSWSAQNI
FT                   DRTVTLYRACLQSNRVLVIDLYTAEVLEVLAKFGRLPRPGWRNLKVVVTSSFARVYRNA
FT                   GREDFVARMAKFGIAADKLAATPSKWVIMTRPSLIRDYEFKGVMPTQEDSWCWSMWSGY
FT                   LSKDDGQKVKSWFDSGQSQPYHIHTSGHASTDDLQKFAQVMNPRVLIPIHGLAWDSEAS
FT                   GFPPILRLADGQYSYI"
FT   CDS_pept        complement(121474..122493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01230"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73614"
FT                   /db_xref="GOA:C4XTU9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTU9"
FT                   /protein_id="BAH73614.1"
FT                   /translation="MAIITTVGLDLAKRYFQVHGVDKQGKVVLKKQLSREGVLSFFVNL
FT                   PPCLVGMEACGGSHYWAREIGKFGHTVRQISPQFVKPYVKSNKNDANDAEAICEAVSRP
FT                   SMRFVTTKSIEQQDIQALHRIRDRLVGNRTALANQTRGLLLELGIAMPQGIRHLRTMLP
FT                   IIIEDMDNNQTLLEKDYLSDLYSELVELDAKVAAYDAKLAAICKQSAECMRLLKVPGIG
FT                   PLSATAIVAAVGQAKEFKNGREFSAWLGLVPRQNSSGGKTKLQGISKRGDIYLRTLLIH
FT                   GARAVAYRGSSGNDARSQWLRAICDRRGMNRAVVARANKTARIVWAVLAKGEAYKEAA"
FT   CDS_pept        122649..122807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73615"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV0"
FT                   /protein_id="BAH73615.1"
FT                   /translation="MPQELANGVAWVGILPGAVGLPGPAPCRPLDQMSPYAPPICRQPS
FT                   ESMQLIL"
FT   CDS_pept        122866..123114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73616"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV1"
FT                   /protein_id="BAH73616.1"
FT                   /translation="MSTSPPASKTDPDAGKVLGTGRMSHRGHGFYPSLLVLLGLPRPQP
FT                   HPAAGPDTPWNRGRSTRPFLGRSPGTGGIGLPGPALG"
FT   CDS_pept        complement(123434..124966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73617"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV2"
FT                   /protein_id="BAH73617.1"
FT                   /translation="MKIVKSMTLLALALLGAVTPTLAEQNVALKDPCPIKIENWRGKPF
FT                   YEILFMNRKDDGRGVGYYYNSLGKEFEATDEVMDARFRALNADTLKKEYGSDGILFNGP
FT                   RRLVTNGITGMAWDGCKERVITTIPLRVLGIFETPDLSKAVSGTLPAYEVLVSKRSNTF
FT                   SFNAGETVYELITPEGAVYTMFSLSLKKDTNNTIENLPTLGKRLTLPQGWQFRSRKLDK
FT                   DMMLTSTADSDPPNTIVLDELDGNYQYNAGASANAEQKSYVAGAFAPQTSTAEPKVLRD
FT                   GEGAKSIRIDNLHKVRFAEIFLAHRDAKTGKMVAECYNTSLAPNAVPASKDTAPQGWAK
FT                   GLNFNKMKNKFGVLGASFNGPKLWMPDWIETLNGVVRDFNGRNVPWVGRLDMGDNAGGV
FT                   SESTPYKPVTIARGDIGWYKGTTALLLDDAEGNTWIMKGFQVGLKPAYTFEQFVAAGQS
FT                   QFKKLPPGWKFRIKVLDKDLTERPEGGVATIMVDEFFNVYDKTGPGMSNYKP"
FT   CDS_pept        complement(125040..126062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73618"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV3"
FT                   /protein_id="BAH73618.1"
FT                   /translation="MRRLIMKFSFRHLLLVNALLVHSAVYAAEPVTVDNFVRAESDMTI
FT                   ARYAKQGAFGKFLHIRQPTPIDKQDVIRMNRDTLYSAGVFDLTEQVTIIKPDSKGRFQS
FT                   MMVINEDHSILPVEHGAGEFTLTRERVGTRYAIVLFRTFVDANDPQDIKAANAMQDKIA
FT                   VRQKNTGTFEIPDWDEASLKKVRDAINVLAETRTSAKGMFGDKAKLNPISHLLGTAFGW
FT                   GGNPEEAAVYDNVVPTKNDGMTPYRITVKDVPVDGFWSITVYNKAGFMEKNDQNVYSYN
FT                   NVTAMKNADGSITINFGGGLKAINNLPISPGWNYIVRMYQPKQEVINGSWSFPIAQPSE
FT                   "
FT   CDS_pept        126559..126918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73619"
FT                   /db_xref="GOA:C4XTV4"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV4"
FT                   /protein_id="BAH73619.1"
FT                   /translation="MPCESVIWCAKSANGLRFKNCEALSAKIHVHIFVSAPPEIAPVEI
FT                   MRRIKGRTSSKIFEEFPMVKKRYWGRHFWARGYFCVTAGELTKEMIQEYLAHHFERDPN
FT                   DTFEVEQPAAKPAGQ"
FT   CDS_pept        complement(127005..127199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73620"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV5"
FT                   /protein_id="BAH73620.1"
FT                   /translation="MGGFSVSSVLTWDTTAVIGYTFWEHGTFWAGYRAVGDNYTSNGKN
FT                   AFKFDAVLHGPIIGLAFTF"
FT   CDS_pept        complement(127358..128713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01300"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73621"
FT                   /db_xref="GOA:C4XPR0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XPR0"
FT                   /protein_id="BAH73621.1"
FT                   /translation="MGLGRQGDQQGTMYLAWDEIPRSRGHAFYDRLQQTLRKAAFDGFA
FT                   EKLCKPFYSDKGRPSIPPGRYFRMHLVGYFEGIDSERGIEWRCADSLSLRDFLQLSPKE
FT                   SVPDHSSLSRTRSRLPLATHQEVFTWVLKVLSKDGLVLGGRIGVDASTMEANAALKTIV
FT                   RRDTGESYRKMLLRMAKESGIDSPTDEDLARMDRKRVGKTLSNKDWQSQVDPEAKIAKM
FT                   KDGRTHLAYKPEHAVDLDTGAVVAVEVHEADKGDTSTLQKTLKAAQESLRRVTSTPPCP
FT                   DDPAELVADKGYFSRDVLKDLDGGPWRTRIAEPKRNGLNSWRGDHEARRAVYNNRIRIS
FT                   SMVGKAMGKQRTELVERSFEHTLDRSGGMRRVWLRGRENIQKRYLLHVAGFNLGLLMRV
FT                   KTGHGTPRGWASAWLALIWPNQHPSMAYLAIVMVVEGRCCGIMPIAVICGGE"
FT   CDS_pept        complement(129892..130776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01320"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73622"
FT                   /db_xref="GOA:C4XTV7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV7"
FT                   /protein_id="BAH73622.1"
FT                   /translation="MQMPKIVELLGKFQITDGGATESRLTGVRFFKDTQPVPRRPMLYN
FT                   PGICIVAQGHKIGYLGGHTFRYDADNYLVTSVAMPFECETFASQDDPLLGLYIDIDMAQ
FT                   LHDLIGQMALQEEVGKLGENDFPLGIGPSTMDEDMRDAVIKLLKALWTETEAKILAPGL
FT                   VREIYYRALRGTQAPVLYSLARGNGSFAQVGRTIKMMQSNYSKKLEIEDLATTANMSVS
FT                   AFHKAFKEITCDSPLQYLKKIRLSRARDLIVQQKAKAYMAASEVGYESPSQFSREFKRY
FT                   FGHSPADLMREVR"
FT   CDS_pept        130771..132132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01310"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73623"
FT                   /db_xref="GOA:C4XTV8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV8"
FT                   /protein_id="BAH73623.1"
FT                   /translation="MHGLRQCLLILDTIHGKNSTGMRSLKRNRHHFERIRCSRQVFAAV
FT                   DTAEQKTKHLEIRMNFEFQNPTRLIFGAGSLFRIGEAASRLGKKALLVTGGGSVKRSGV
FT                   FDRTVATLKAAGVSIAECSGIEPNPRITSVVRGAEIARQEACDMVIALGGGSTMDASKV
FT                   IAAAVLYDGNPWDMILHGQEKWHIPSEALPLITIPTLAATGSEMNNGAVITNEETKVKS
FT                   FLVADCLFPRIAIVDPELTVSVPKDQTAFGVCDLITHVTEAYCNGIDGTPLQDRFAEGV
FT                   ILAAMEWGPKAIADGNDLEARTQVQWAALVALNGWVHAGTNPMYPVHMLEHTVSAYHDV
FT                   THAAGLAVINPAWMRFAARANSAKFVQFAERVFGLKAKSTTDLDCALEGIDRFEAFLRA
FT                   IGCPTRFSELGIGSELFETYAKDTLKIIHDADGKLPGRPAMSEADIVEVFKAAV"
FT   CDS_pept        132186..133235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73624"
FT                   /db_xref="GOA:C4XTV9"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTV9"
FT                   /protein_id="BAH73624.1"
FT                   /translation="MRMLTQWCMVVFIMGMLTAVGSTAFAQTKPRDADNFYKSKTVDVQ
FT                   KVTFDNQYKMKVAGNLFTPKNLDTNKKYPAIIVGHPMGAVKEQSANLYATKMAEQGFVT
FT                   LSLDLSFWGESEGQPRNAVSPDIYAEDFSAAVDYLGTRPFIDRERIGVIGICGSGSFAI
FT                   SAAKIDPRLKAIATVSMYDMGAANRNALRHSMTLEQRKRVLEEAAEQRYVEFTGGETKY
FT                   TSGTVHEITEKSHPIEIEFYEFYRTPRGEVTPEGSSPKLTTHPTLTSNVKFMNFYPFND
FT                   IETISPRPMLFIAGENAHSIEFSEEAYKLAAEPKELVIVKGAGHVDLYDRVGLIPWDKL
FT                   NTFFNKSLQ"
FT   CDS_pept        133359..134600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01340"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73625"
FT                   /db_xref="GOA:C4XTW0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW0"
FT                   /protein_id="BAH73625.1"
FT                   /translation="MMLHQIMSIKRVTDFMCSQQALFYNRTANWSAVFSLFVGVTSLVA
FT                   AEFIPISLLTPIARDLAITEGMAGQTVTVVGIFAVLTSLLLAPLTKGVNRRHILLAFSS
FT                   MLLVSNILVAVAPNYPIMLIGRGLLGICVGGFWSMSAAVTLQLVPINYVPRALSIIYAG
FT                   VAGATIISLPVASYFGHLLGWRNVFYLEALLGGVGLVWQFVSLPSLSSDKSNDFRGMLR
FT                   LFRQDWVLLGILATIFSFGGYNVFFTYLRPFLELDLFLRPNTLSIVLGVFGVANCVGTF
FT                   AAGLLFNRQFRSCMILLQGVLAVVAVLLYLTDGFLRASIPLVVLWGFLWGFMPVGWSSW
FT                   ITRTLADRAEMAGGLSVASIQFSIGGAAAIGGFIFDRSGIQGIFLAAAGFLVIASILIK
FT                   VSFSLYAKDTGRLA"
FT   CDS_pept        134678..135079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73626"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW1"
FT                   /protein_id="BAH73626.1"
FT                   /translation="MNITRIGSQASFKGPSDWFSGEVRIDPLFLKAIEPSRMTGGSVTF
FT                   EPGARTAWHTHPVGQRLIVIAGLGLVQREGGPIKEIRPGDVVWFEPGEKHWHGAASTTS
FT                   MTHIALQEEQDGVAVEWLEKVTDDQYNAK"
FT   CDS_pept        complement(135287..135850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73627"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW2"
FT                   /protein_id="BAH73627.1"
FT                   /translation="MPAHRVTFGPVGDTGQDQEDQPPPAKSQPMRLNWPVPAALSQAGS
FT                   VKTTAGEKWGKKFFRGCTPKVQMSKMGGDRLKIPQATVVSFLMQPRIKYGNYFWQERKR
FT                   RRGRRPLEKNSSDRGMVSWSNRWAGKWFCPGTYPPNPSVGARWRLGKEKGVTDFSVTPW
FT                   HASWWSWRESNPRPLECHASSPLK"
FT   CDS_pept        complement(135872..136492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01370"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73628"
FT                   /db_xref="GOA:C4XTW3"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW3"
FT                   /protein_id="BAH73628.1"
FT                   /translation="MDYGRINHFWQSINLLVAPILLTLLILFKDHMSPWMWLMAIHLPI
FT                   LMIHEIEEYVLAPEGFKEFINKRSPLGTGNDPDYPLDEAYVFQVNILIAWPLIILGTFL
FT                   ANVAPWVGMSMIWFQIIINNVMHTVGFQQGKPTYNPGLLTNCLIIVPYCVYVIYEAFGF
FT                   FRWYDWGMSLLLGVGITLLLMKKTFGRLAAYKAVTNTTDKQTT"
FT   CDS_pept        136567..137019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73629"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW4"
FT                   /protein_id="BAH73629.1"
FT                   /translation="MDISSVPPKINERQVMKVPRAANHFLHERALTRGLTRKQPERVAG
FT                   DRFLPAPVGFPGPAPPSPPVRRPGHPLESRGRPPSWAVPLGLGDWSPRAWFRSRVAPLG
FT                   PKPDFPGSAFYLARLVSWANPVLPSTASNTVRAIFRLSKANPFGTK"
FT   CDS_pept        137084..139174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01390"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73630"
FT                   /db_xref="GOA:C4XTW5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW5"
FT                   /protein_id="BAH73630.1"
FT                   /translation="MRINISFKLVVLVMASVLISGTSALIASYYSVGQGFEKTFSEVIN
FT                   SDMKVTQDLIDRLNTGYKGLAQAQSVRPNVINGVATADHTLLKKLGQDLMKSGQTDFIV
FT                   FVDNNGKVLARGHDDTFGDSIAEQECVIKALSGLSCSTFEPGKVVKVSLRASSPVQKDG
FT                   IIIGAVIVGMNISKNDAFVDSLKKLLDAESTIFYGNVRESTTIIVDGKRAAGTTLDNKS
FT                   VIERVMERKEPYLTKITLFNRPYMAAYWPFFNNDGKPVGMFFLGKDMSVVKDQQMVAFL
FT                   NILYVCLVAMAFLAMAGYLASKKFTNPVLRLATFARKVESGDYTANLDVEVNDEIGDLA
FT                   KSMENMVEALKGKIAEAEAALCKAAEETEKARLAMTDAEAAKAEAERAKAEGMFQAAHQ
FT                   LEGIVEVVTSASEELSAQIEQSSRGSEEQSHRASETAAAMEEMNASVLEVAKNASRAAG
FT                   TADKAKHKAEDGSQVVTQVVKGIGEVQASALELKTDMTALGKQAEEIGQILNVISDIAD
FT                   QTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMTATKEVGDAIRGIQEGARKNI
FT                   SNVDHAVIKIDIATGLAGKSGEALNEIVSLVDLTTDQVRSIATASEQQSAASEEINRSI
FT                   EDVNRISSETSDAMRQSAQAVGELAHQAQVLKSLIDQMKDEGGGTEAPASKIGARTKLA
FT                   LK"
FT   CDS_pept        139192..139353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73631"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW6"
FT                   /protein_id="BAH73631.1"
FT                   /translation="MLRSVKADLLLALAFFLWEYSIVREILDCVAEVGLSLCVSMHHLP
FT                   ARRTQYET"
FT   CDS_pept        139343..139768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73632"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW7"
FT                   /protein_id="BAH73632.1"
FT                   /translation="MKLKVAFGFFFALILTSSIAWAGGKIPTLIGKWSVESSGGMMLNA
FT                   EKEGKETHWTAGQKVLKGLMDITTQEDRFVSGTYTSARGSEKFIAMITPDGKYMYASDT
FT                   DGFFDCKITNKDTLEIVYRHVKATDSVVAIGIAKRQK"
FT   CDS_pept        139784..140200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73633"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW8"
FT                   /protein_id="BAH73633.1"
FT                   /translation="MSGFSDVTGVAHAPGSPLFHGPILSPGRRPGHPLYSRPTPPSWAV
FT                   PLVLEPFPPGPSSLQGGPPRVKVRFPRGLGPSPDNAHIFLSELAELFPACLNSKQFFRS
FT                   HLKKALDSVGPRAYMLVVSLVKVVSNPSGGDANG"
FT   CDS_pept        complement(140599..140934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73634"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTW9"
FT                   /protein_id="BAH73634.1"
FT                   /translation="MPIAKGQKIEAKYDGEKLYGLIKAGSNEAQIMAELGIQSKPTLKN
FT                   HLLKLMQEKKEYLEIAGASTRTRSSSPVYRGRKIVLTANMLAGIEFEEGQKFRIEKNDA
FT                   GLMLIPV"
FT   CDS_pept        complement(141004..141213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73635"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX0"
FT                   /protein_id="BAH73635.1"
FT                   /translation="MPKTITTSTTKTPFLSPTNNPKNNDWQPSCTASQAQTPINQNYGA
FT                   LNSLRVKFPQNDHHYFPATHFNRF"
FT   CDS_pept        141452..141679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73636"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX1"
FT                   /protein_id="BAH73636.1"
FT                   /translation="MSVPTDAESNDKTLELAEEIIQRFRPIEQLFDVMGAADVGVQAVF
FT                   VRRWADIGTQLAVSFREYLDQIVATSRKND"
FT   CDS_pept        141720..141917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73637"
FT                   /db_xref="GOA:C4XTX2"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX2"
FT                   /protein_id="BAH73637.1"
FT                   /translation="MMLFEFIAGIALGAAAGGVIKMIAHGGGAIVGRDNVRNAIRKEEK
FT                   NVRSRFKDLKVTKGDPKFYE"
FT   CDS_pept        141948..142325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73638"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX3"
FT                   /protein_id="BAH73638.1"
FT                   /translation="MDDWPIIFSYTRAQAIADGVLIDVTAQAAEVGFKVHTVVTDHLYG
FT                   DYIVPPAGLEGEGQSIEGRLHDLLFRTLLAAKAIRDSDRAEFGVLFLMAPGHWDTAHVV
FT                   AVIGPGDQGEPVMTIMLPEDD"
FT   CDS_pept        complement(142322..142510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73639"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX4"
FT                   /protein_id="BAH73639.1"
FT                   /translation="MLKIPGFDFSIFHHASNSEDFNAKESHLADYYLETPRSNFIVISY
FT                   RIRACHFQAILQVSLSN"
FT   CDS_pept        142684..143691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73640"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX5"
FT                   /protein_id="BAH73640.1"
FT                   /translation="MNTITQADDVGRFKTIAFWHWEYTRRNRLYKLYSNKIESFRNGLI
FT                   GAGGLHQDITVVPLGGIFDKYLYKQEGEQSINHLLKWFLIRGLDREKGMLFLRYRLLFH
FT                   GFNKKFKRYFKPCHIGIDSSEQLDKLLSGNLPCFEIKDLVDLIAILPQELKLKLTLDYS
FT                   KARIKILGPWFAEMVSVENTGQNNIKIEMDQVFKFSDDVILDREDQRTISGMANVLAFL
FT                   NRLFVNGCKQENPLVTDYMLQLIYRFCLAGKHIKSSSIMRLAMLWLWDQAHKQNEDNPA
FT                   QFDDVYPLLKSKIEQAGVSGKVWEQIVTRRKRVRGYYDVTDYCIKNRTIISLNQ"
FT   CDS_pept        complement(144180..144365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73641"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX6"
FT                   /protein_id="BAH73641.1"
FT                   /translation="MHLHWCYKYFNTRVESLVMSPRTFRHDSRTLLVFRSNRLDDHHAP
FT                   LPIIKGILPVGQTMLS"
FT   CDS_pept        144367..144906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73642"
FT                   /db_xref="GOA:C4XTX7"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX7"
FT                   /protein_id="BAH73642.1"
FT                   /translation="MQTDSLLKSILDNYPGINPDAALVMLEKLLIGQNMIKTSLLLSGG
FT                   VPSGSPAQAGSGNQPDGVKSPAGVDPKMAIQEDYVQCCECGAKMKMLGDAHLAKHGLNK
FT                   TSYLLKYGYAPKTALVSGELSKKRKESAKDNKLGHQKTEDAPSAVDTPAAESEQLKATP
FT                   KESGQEKGGKTDFSLA"
FT   CDS_pept        145804..147159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01520"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73643"
FT                   /db_xref="GOA:C4XRR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XRR2"
FT                   /protein_id="BAH73643.1"
FT                   /translation="MGLGRQGDQQGTMYLAWDEIPRSRGHAFYDRLQQTLRKAAFDGFA
FT                   EKLCKPFYSDKGRPSIPPGRYFRMHLVGYFEGIDSERGIEWRCADSLSLRDFLQLSPKE
FT                   SVPDHSSLSRTRSRLPLATHQEVFTWVLKLLSKDALVLGGRIGVDASTMEANAALKTIV
FT                   RRDTGESYRKMLLRMAKESGIDSPTDEDLARMDRKRVGKTLSNKDWQSQVDPEAKIAKM
FT                   KDGRTHLAYKPEHAVDLDTGAVVAVEVHEADKGDTSTLQKTLKAAQESLRRVTSTPPCP
FT                   DDPAELVADKGYFSRDVLKDLDGGPWRTRIAEPKRNGLNSWRGDHEARRAVYNNRIRIS
FT                   SMVGKAMGKQRTELVERSFEHTLDRSGGMRRVWLRGRENIQKRYLLHVAGFNLGLLMRV
FT                   KTGHGTPRGWASAWLALIWPNQHPSMAYLAIVMVVEGRCCGIMPIAVICGGE"
FT   CDS_pept        complement(147250..148944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73644"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTX9"
FT                   /protein_id="BAH73644.1"
FT                   /translation="MKALIISIINALTMIAAVAAIAANSPLNLQKLSTDSEGPIITAFS
FT                   MPMTSTSLTIQVALSATDNTGVSSYCISESNDSGSCSWSATPPASYTFASPGYKLLYAF
FT                   ARDAANNVSGSATAYSIIVTGTSPFNIVQALSDGAQGTTIAFAGFGMITGKLGAQSFFP
FT                   PGKVADYWGFQYLRDNDPDNMGHNTSFLTRVSCNILYILNDTQIASLKNLAQNQVDNIN
FT                   LYAWKRYPLMQAFRRLIDGAKPTGATGLNLTAVKAASRELYLLDGQISYERAITYANIY
FT                   RSLSTSQKAYIDAMVGKGFNSWPDKSEVDVRTKLQGLPSDVVVAMMTYAGDLYSWYAGS
FT                   VDSDVYFCPERHGTYFGSFYMKDAPAIGHPGYSIDEQMTATIGKVLCDSSFGYISDAGA
FT                   AKMNALTSVQKLNLYANPSENIVLARTRISEALRSLIVDTAPSEATLAQVKATVDNFSA
FT                   IYGMLDGENNFHYATTFAQLNCNIAANYFTTAQKAAMTSLRKQYMTVTYPDGTTADYSS
FT                   LNKYYLYGQEIPEGTQNLAVYTSDNATNGFFSFGSASASLPSLLLLQ"
FT   CDS_pept        complement(148993..150018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73645"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY0"
FT                   /protein_id="BAH73645.1"
FT                   /translation="MSDYFGFQYMRDIDSGDKGHNTSFLTKIADNTLTILSDSQRAQLV
FT                   ALAREQEAGIRQFAEKRFPLIHAFRRNLEGNIPAGSKGLDRDAVKRASADLYELDGALA
FT                   YGRAKVMGRILCELNAPQRNALARLKFGDSRSWPEVGSPLDKRSMSHVNHVAVMTYASE
FT                   MFAWHAGSLDADIYFCPERHGMYFGGFGLKTAPAMGKPNFSISTGLTADRGESFLSMLT
FT                   GTQQKFITDTVNEQRQLLHDIVRIRREIATQLRDFERCGSANWEKVRALSRKYGEIDGE
FT                   ISYLYATTFASIAKTLTNQQKASLSRLRPSNPSDPKGPFLYSEPIPMPRIDNTDFLFGV
FT                   R"
FT   CDS_pept        151155..151850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="DMR_01550"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73646"
FT                   /db_xref="GOA:C4XTY1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY1"
FT                   /protein_id="BAH73646.1"
FT                   /translation="MNSLLLIDDDMELCELLGDYLHGEGFDTESVHNPMVGVTRAVSGQ
FT                   HDLVVLDVMMPELNGFEVLRRIRAASQIPVLMLTARGEDVDRIVGLEIGADDYLPKPFN
FT                   SRELVARIRAILRRTETGEPTPSKAGESISISDVVINVGGRSVLCNGKPLDLTSIEYSI
FT                   LEVLMRMAGKVVSREELAEKAMGRKHSAYERSLDVHICSLRKKLGTHSLYGERIKTVRN
FT                   MGYLYVLST"
FT   CDS_pept        151881..153617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="DMR_01560"
FT                   /product="sensor protein CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73647"
FT                   /db_xref="GOA:C4XTY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY2"
FT                   /protein_id="BAH73647.1"
FT                   /translation="MKVRSRSLYVKIFLWFWLMMVLVGTILFIAAVQGQLARNQETSRT
FT                   QAEERRSQLSDMLSFYGETSIRLVDQAGPQALEVYGEQLARTAGVRPFFFIEPDRAWVQ
FT                   GQAPPDVLELARRAWLSGKTEYAEHQDEFLLAKPLRDAVKGMYVVVGKTQLDPAGGAPA
FT                   PRRPRPEAVEACAGANPGDACSFYSRHGLEHGQCREWTDPRLICVPEILALGGGTPNVP
FT                   PLHSSAIGDIPGSREPLAQVAPSRETKSGDARKATHWLRSLTPWSEGSLDSYSDRLGKV
FT                   LAIVFIVSGASCGLLSWRITRPLRRLRLVAQRLAAGDLTVRVDHALNQRGDEIADLGLD
FT                   IDRMASRIEGLVKTQKRLLRDISHELRSPLARLNVALELARQSAGPSAVTYLDRMERES
FT                   SRLNELIGQLLTLARLEGEQPNITYEEFDFVELLKEIARDVGFEANSQGRWIGTEICGA
FT                   LRITANRELLRQAIENVVRNAIRHTAPQTGVIVRLAKESESGRAVAALEVQDHGQGVPE
FT                   EELTNIFLPFYRVASDTTDTKGGAGVGLAISDRAVRLHGGRISAMNACDGGLIVRMILP
FT                   LN"
FT   CDS_pept        154102..158052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01570"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73648"
FT                   /db_xref="GOA:C4XTY3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY3"
FT                   /protein_id="BAH73648.1"
FT                   /translation="MQDIQSEELLQKFSGLPYDVDLDRDELLHEIFEATVRQFSEKIAV
FT                   ESGSIEVTYHELNRRANQLAHYLRDIGVGHEDRVALLLPKTEFVYVAMLAVLKAGAAYV
FT                   PLDQAYPPDRVGFILDDCAAKLCITDAALFEALGQEVRGTPVFLADRDGPGLSGQPDTP
FT                   LSREQTGLGRQSLCYVIYTSGTTGRPKGCLIEHRNICSLVRSEAKVYGIHAEDRVFQCA
FT                   STAFDASLEEIWMAFLHGATLVAGTKEIMRTGPMLGQALSQRGVTVLSCVPTLLSMIEG
FT                   DIDTMRILIVGGEACPKDLAARWHRPTRTIFNSYGPTETTVAATYGVLVPNRPVTIGQA
FT                   LPNYRCYILDEKLDPVPPGAEGELFIGGPGVARGYLNRDDLTRDRFITTERVTGEPVRL
FT                   YRTGDLARFTEDGDIDYLGRADDQVKVRGYRIELTEIEAVLMQCPGVQCAAVTMWRETG
FT                   ALAAYVVTRQGTSLNLGFMRETVAKRLPPYMMPATLDVIAELPLLTSGKVNRKALPAPV
FT                   DPFEDRDREVTAPRSQVERDVAGVWEEVFKRKGLSVTDDFFLDLGGHSLFAAVMVSKLR
FT                   HVPGFAGVSVGDVYQHPTIESLATIRDQDTTAPKPAPGQAFHEIPPSRHFACACAQLLA
FT                   VVVLAGVYAWQWLGPFFTSAYLILDHWELGPSLLAGLLVYAVSYPLLLAVVVLAKWLFL
FT                   GRIKAGQHPLWGWYYFRFWFVRQLSRAVAVKYLAGSPLLCLYYRLLGARVGKDVFFGTA
FT                   GLMTFDLLTVGDGTSIGYDSSVDGSWVEDGLLHLAPVTIGKNCFVGNRSVLGPSAVMQD
FT                   NSGLADLSMLPEGGVIPSGSLYSGTPAVSAGTFEDVSPPRTWSFGYGLLFVLGVFLFPL
FT                   LVEGAIFPGLMFMEILDNIDQYYWWTLYAPVVGISFIVLICFEIAFFKWLFLPRIKEGR
FT                   YPLRGWFYWRKWFLTQLMQVSLEILGTLYSTLYLKPWFFVLGARLGKGSEISTVRHVNP
FT                   EFLVAGKACFLADDVMIGAPSVRGGSISIGYVHVGDRTFVGNSALVPGGMVLGDGALIG
FT                   CLSTTPVVNPVPTGTSWFGSPAIHLPRRQEAERFSEKQTYSPPWHLVLLRYIIEFFRVT
FT                   LPLTLFVLLATMIMNVVDMYQDWLPLWLQIASLPFLYLAAGVVALLLVVGLKWLVVGRY
FT                   RESNHPLWCGFVWRTELVTGVYENFGTLFLLELLRGTPFIRWPMRMLGMRVGPRCYIDS
FT                   TWFTEFDLVEIGEEAALNEDANLQTHLFEDRVMKVGKVVIGKRCAVGMKATVLYNTCLE
FT                   DNVSLGDLSLLMKGETLPQGTKWQGAPARRVG"
FT   CDS_pept        158171..158881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01580"
FT                   /product="4'-phosphopantetheinyl transferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73649"
FT                   /db_xref="GOA:C4XTY4"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY4"
FT                   /protein_id="BAH73649.1"
FT                   /translation="MGLETHAKSYALIWSMSGRLILVWAQAREPWPDGCMVAALNQLPP
FT                   WMGREMARWRNPMDRQTRVLGRLLVRLALETLGVANGDLAGWRLDQFGRPYLSGCAADC
FT                   SVSHSGGLVAAAVSLPGRVGVDVEVLAPLPIEALDAAFCPEEMSDIRSAENQSRRALEL
FT                   WTGKEATLKADGRGMSLDPSLIDARGESIRLGEEVWRIFHPELTPGWLCALVTNQLTPV
FT                   VNIISTDLAVLLGG"
FT   CDS_pept        159239..159607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73650"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY5"
FT                   /protein_id="BAH73650.1"
FT                   /translation="MTPFSLPKRQRAPTLGFGGYVPGQNHLPAHLLDQETIPRSLEFFS
FT                   RGRPPSASFAPVKNNPLLYAWLHKKINHGRLGGFQAIPPILDFWTFRVHPLKIFWPRFL
FT                   RAETLADPARERAAATGL"
FT   CDS_pept        complement(159955..160299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73651"
FT                   /db_xref="GOA:C4XTY6"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY6"
FT                   /protein_id="BAH73651.1"
FT                   /translation="MLAFRALLGLFIICVSVYTSVVISKHGWNLFTVFFGDMFAMNWAG
FT                   QFNTDFTCFLTLSGLWLAWRHKFTPMGILFGVLGFFGGIMVLAPFLLYISIKDKGNISK
FT                   MLLGNRQIQD"
FT   CDS_pept        160391..161206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01610"
FT                   /product="Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73652"
FT                   /db_xref="GOA:C4XTY7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY7"
FT                   /protein_id="BAH73652.1"
FT                   /translation="MNKLAVEPAEPRTVGDLIRFWRNTKKISQMDLALEVDVSTRHLSF
FT                   VETGKSRPSRKLVFKIAESLKMPFRHRNALLALAGYSSEFAEESFNGEGMGIVRQALQR
FT                   FLSAHDPYPAFVIDGEYNILMKNFGYERMAKSIIGEDAFSRHNNAYLLTFSCDGFCNHI
FT                   ESWPAVGRFMLDRLMNEAIMTKNSKVYSLYQQCLSMFSDVEEGAEQQVADLPVLSITLK
FT                   CDGMLCKFFTLITTLGTPLDSTSQELRIESLCPADEATKKMFLPEGIRD"
FT   CDS_pept        161672..164755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01620"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73653"
FT                   /db_xref="GOA:C4XTY8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY8"
FT                   /protein_id="BAH73653.1"
FT                   /translation="MVSDESKTSQQLLAELDAARARISQLEHVVGSVENKWNNTLINAP
FT                   QIVISLDPSGKIIFANNHYFDLTGWNREELLGRNWFDTCIPEVVRDEIRGIFNSSMTRM
FT                   HDHDYSTYENDILRRNGECLTVAWFNVLTLDSQGLPLDVTCMGVDVTERRRSEIALKES
FT                   EQRFRNLFENAPLAYQSLDENGRFLDVNRKWLESLGYEDKVQVLGKWFGDFLAPDYKDH
FT                   FDINFPMFKQACVIDGVEFEMLRMDGGRITVSFNGRVQADREGNFIRTHCIFTDITERR
FT                   RAEDKLHVTAERLRLANKATNDVIWDWDVTQDTQQWNEAGTAVFGWTEIVARPVSAHWW
FT                   VDRVHPDDRERVNDSFFSVVNNPEIDVWHDEYRFMKADGTYADVIDRGYLLRDGQGKPI
FT                   RMIGAMQDITERKQAEASLNSIKWLVDKEVRPALAPEASEYGDLVQLNNSRVILNAVGS
FT                   DILANMVQDYMEILSTSSAVYEINGDYAFGIFASGWCKTMDQASRRLCGCTTNAEALAS
FT                   GKWLCHESCWSEASLTAIETRQPADIACTGGIRLYAVPIKSGDAIVGAVNFGYGTPPRD
FT                   RKVIAELAALYQVDPDELWKLSMEYEHRPDFIIDTAKQRLKTTARLIGEMVSRSMVEQD
FT                   LQKATHLAETANRAKSEFLANMSHEIRTPLNGVLGMLQLLETTDQTDEQKEYLFGAISS
FT                   TKRLTRLLSDILDISRIEAGRMEIVEVEFNIKKTRDSIKELFNPEAKGKGLRLEFGRDE
FT                   DLPLVLVGDEARLRQILFNLVGNAIKFTEKGEIRIDASLLPSSSDSHVRVLVTVRDTGI
FT                   GIPEEHLKGIFEPFVQAEASYTRRFQGAGLGLSIVRRLVKLMGGDISIDSTVGEGTTVY
FT                   LSLPFKLPKTEQKSVEIASDDPSPVHVSSRILVAEDDTISLITAKRMLEKSGYSVSAAK
FT                   NGQEALQRLTEESFDLILMDVQMPIMDGVEATKAIRGASNLGAKSSVPIVAMTAYAMTG
FT                   DKETFLAAGMDDYISKPVDKAALAEVIERVLSLKRNTQ"
FT   CDS_pept        165040..165399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73654"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTY9"
FT                   /protein_id="BAH73654.1"
FT                   /translation="MRNLWFGTSPSASKTDPARESAAGIGLLSHRGWEITGACWSPGPA
FT                   PSSPPVAGLDTPCMRALAPLPGPFPWSWPLCPPVPPPLQGGLPRLNVRFHLGLGHRQEM
FT                   RTKISANLLTFFSTA"
FT   CDS_pept        complement(165469..165630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73655"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTZ0"
FT                   /protein_id="BAH73655.1"
FT                   /translation="MNVELVFATHAACQISFFTGLQVLYCEENSPTIDSPNGIASARVA
FT                   HNLHKGHA"
FT   CDS_pept        complement(165924..166259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTZ1"
FT                   /protein_id="BAH73656.1"
FT                   /translation="MPIAKGQKIEAKYDGEKLYGLIKAGSNEAQIMAELGIQSKPTLKN
FT                   HLLKLMNEKKEYLEIAGSSTRTRSSSPVYRGRKIVLTANMLAGIEFEEGQKFRIEKNDA
FT                   GLMLIPV"
FT   CDS_pept        complement(166409..167764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01660"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73657"
FT                   /db_xref="GOA:C4XPR0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XPR0"
FT                   /protein_id="BAH73657.1"
FT                   /translation="MGLGRQGDQQGTMYLAWDEIPRSRGHAFYDRLQQTLRKAAFDGFA
FT                   EKLCKPFYSDKGRPSIPPGRYFRMHLVGYFEGIDSERGIEWRCADSLSLRDFLQLSPKE
FT                   SVPDHSSLSRTRSRLPLATHQEVFTWVLKVLSKDGLVLGGRIGVDASTMEANAALKTIV
FT                   RRDTGESYRKMLLRMAKESGIDSPTDEDLARMDRKRVGKTLSNKDWQSQVDPEAKIAKM
FT                   KDGRTHLAYKPEHAVDLDTGAVVAVEVHEADKGDTSTLQKTLKAAQESLRRVTSTPPCP
FT                   DDPAELVADKGYFSRDVLKDLDGGPWRTRIAEPKRNGLNSWRGDHEARRAVYNNRIRIS
FT                   SMVGKAMGKQRTELVERSFEHTLDRSGGMRRVWLRGRENIQKRYLLHVAGFNLGLLMRV
FT                   KTGHGTPRGWASAWLALIWPNQHPSMAYLAIVMVVEGRCCGIMPIAVICGGE"
FT   CDS_pept        168216..171134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01670"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73658"
FT                   /db_xref="GOA:C4XTZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTZ3"
FT                   /protein_id="BAH73658.1"
FT                   /translation="MVACMNNWLTVALFAGAVCFSMVGFLYCFLYAKYRSASLMLWGIA
FT                   WLSHALRNVTILVNTTYGPIVFLAIMEQMLVACTGSLLLLGSLYYVGKSPRRWFFAAVG
FT                   GAVLWPVAAVVFAVPQPWFFIPNYFFFGSSQIYNGLVLIRKSRGESIGGRIAGCAMILW
FT                   GLHHFDYPFLRPMAWFAPWGFLIGAVLGLLAAVAIMMAYMEALQAELSRSEKRFRSLFH
FT                   GNKAPFLLIEPFSGQIMDASAGAVGFYGYSLEELKGMNISQINMLAPEELASVRTLALS
FT                   GYKQQFIFPHKLKNGDVKTVEVISTPVESGEKELLFSIVQDVTARQQALEDLGESRERL
FT                   RAVVENAAAAIYLADKSGRFVEVNAAAERQTGYAREELLAMSIPDVDASSSMEGAAVVQ
FT                   AVMQSATGMTFESHHRRKDGTIYPVEVRAVMLELHGVPHALGIVSDLTSRKEAERKLAE
FT                   ANRTLAAVLDGIPALVNVVDVSTREVLFMNRALKEALGRDGVGGVCHDVFRGKSCVCEN
FT                   CHLERMSVNTEGEAGVSVWEDRNPISGRWQLNHDRLLPWFDGKTVRVQISLDIGQRKQA
FT                   EEALRQSKEEAESANKAKSVFLANMSHEIRTPLNGILGMLQLLKTTDPNDEQKEYLLGA
FT                   IRSTNRLTRLLSDILDVSRIEAGRMQIVEAEFDIKMVRDSISELFDMEARGKGLLLEFR
FT                   WNDNLPLRLIGDEVRLRQILFNLVGNAIKFTEKGTIRIDACLLPRASDSSVRVLVTVGD
FT                   TGIGISEEHLKDIFEPFVQAEGSYTRRFQGAGLGLSIVRRLVKLLDGDISIDSTPGEGS
FT                   TFYLSLPFKLPATSQKTEELIAYGASPPGRVPRRILLAEDDALSSLTCKRMLEKSGYSV
FT                   AAANDGQKALQLLTEQDFDLILMDVQMPVMDGVEATKAIRGSSILGVKSSIPIVAMTAY
FT                   AMSGDKEKFLASGMDDYIAKPVDKEALVEVVERVLRMKEKVQ"
FT   CDS_pept        complement(172075..173895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73659"
FT                   /db_xref="GOA:C4XTZ4"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTZ4"
FT                   /protein_id="BAH73659.1"
FT                   /translation="MGVYFLVLAGVFILSFFPVAVIFALMLLVVPGLLILSAGSVLFYS
FT                   LLLSPLLLPCRTKTGCLALTLFTLVFFFSAILSPSLIGRSQLASLTVNDVSPDLDALKE
FT                   GRIRSIALGTTDNRILAGGPNLPAVRCDQTCQQLLFNKEVDVVVMEHLKINSLAPTPDK
FT                   STTYRIERRSECPNLYPQRYASPLAESVAMRIAAGECLVAEEGEDREVVDARVSVLEIG
FT                   HLTGPFVEARGNRANSFFSDARTIKICAVTRGDDASRPLVRRIEALGEVPSMPLTVGNT
FT                   KIHGLGLGRGLVTVNETGMRDILKKDLGFTLAPVPDSLDKVELAKSVLAATQGNDKQIT
FT                   IEQIRLIEDAAKKMGKQGPTRENVELARRLIRDPRIASSSALKDIFCPNAYALHDLLPD
FT                   ILDRLARADPARDRDILFALNYVIRHLMPLDLLKEHKERILEIVGNALGPAPPQSGKDG
FT                   PPVAVHHNPADWASRAWAVDGLISRLGDMGSEALPLLREFVRHKQSEEVVRWAAVSLCR
FT                   MGPPLAVAAIPDLEQAFVDLRESGKSDQNEAVAKALIRLGDKEGLRRLVEQTITFKKNF
FT                   DNTLELEAGFSASECWPVFHFMRCQIEPPD"
FT   CDS_pept        174649..174933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01690"
FT                   /product="RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73660"
FT                   /db_xref="GOA:C4XTZ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTZ5"
FT                   /protein_id="BAH73660.1"
FT                   /translation="MSKKLYVGNLSFNSTEDDIRTQFSNYGEVISVNLITDRETGRLRG
FT                   FGFVEMDDEGARAAIAGMDGQDFGGRNLKVNEAEDKPRSGGGNRGGSRW"
FT   CDS_pept        175352..175744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73661"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL4"
FT                   /protein_id="BAH73661.1"
FT                   /translation="MTIFTAIRATALALVLCLSAMSAQAAEMPGKWIRYGKNTVNANQQ
FT                   PTITLLNPLADADEAKVAAMIKDANGPIPLVIAIQFSQPAVSFYTVNARGADPGQAVAA
FT                   ARKASEMYKAIQQFLKSSETYLDLGE"
FT   CDS_pept        175792..176397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73662"
FT                   /db_xref="GOA:C4XTL5"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL5"
FT                   /protein_id="BAH73662.1"
FT                   /translation="MKPIMKRLRVFLWVAAWVLCFPGPAQANAGVPMIFLTLPGMALAL
FT                   VPVMFLEMQVLAKGLGLTRRVAFKVSAWANLLTTVVGVPLTWAILTVLEGVTGGDRAYG
FT                   IDTPAKKLLAVTWQAPWLIPYEADHNLYWMVPAAMMWLLVPTFFMSWWLEYLAAARMLR
FT                   DADRARLQSAMFRANLLSYAFLELCALGWLLFEIVFVV"
FT   CDS_pept        176474..176698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73663"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL6"
FT                   /protein_id="BAH73663.1"
FT                   /translation="MPEKAVFPCLGHRRERSTNFPLNFLHFSPPTGMRHEYFESSSKKA
FT                   LDSGWSRAYMLVVSLVKVVSNPNGGDAIG"
FT   CDS_pept        177054..178427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01730"
FT                   /product="putative potassium uptake system membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73664"
FT                   /db_xref="GOA:C4XTL7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTL7"
FT                   /protein_id="BAH73664.1"
FT                   /translation="MWLKKIYTPLALPIHFFAAAIFLGAGLLCQPISCVGEPVSFLDAL
FT                   FTATSAACVTGLTVVDTGTAYNRFGQTVILALIQLGGLGIMTFSTLIFYLWRRRVSLAD
FT                   HIAVGQSLLHDASFHLGRFLVRMAAVTVFIEAVGALSLYAFDPVGFAPFSAVFHSVSAF
FT                   CNAGFGLRPDNLVAYAGNPGVNGVIMWLIVSGGLGFAVLIEGYRVVKDRLVILVTAPGR
FT                   RPLALSWQARTIFGVSAFLIFAGAAMIYCGEFLGGRYGELSLLDKAMAALFQSVTCRTA
FT                   GFNTIDIGRMADASLVIMILLMFIGGSPGSCAGGIKTTTFRVLVAFGRAKMFGRKQSVV
FT                   GRYAVDDDTVDRAVTLTIFALGLVLASVLLMCFTEGAVAPHVEAGGRFLEILFEVVSAF
FT                   GTVGLTTGITTSLTPAGKLVIIMLMFVGRLGPILFLSVLQGFEEPRRYRWPEQGMMIG"
FT   CDS_pept        178475..179128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01740"
FT                   /product="putative potassium transport systems NAD-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73665"
FT                   /db_xref="GOA:C4XTM9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTM9"
FT                   /protein_id="BAH73665.1"
FT                   /translation="MVEERICIIGLGKFGFHLGRCLVELGREVLGVDGDEDKVKNAQNV
FT                   FTQVYQLDARDKKALEQIHVDEMSHVVVSVGHSMEASILISLYLKELGVPQVWVKAIST
FT                   DHEKLLHKIGVDNVFIPERFAAKNMAHQLASPGLIEYLPMDKDVALKEIGIDDWAGRTL
FT                   RQLDLTNKHQVQVIARKRVGEDHYSFIPRADEELRQGDKLVIVGREDRLTRLRP"
FT   CDS_pept        179287..180483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01750"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73666"
FT                   /db_xref="GOA:C4XTN0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:C4XTN0"
FT                   /protein_id="BAH73666.1"
FT                   /translation="MRFVDEAWIVVRSGKGGRGAVSFRREKFIPRGGPDGGDGGEGGDV
FT                   VFRANPDLLTLYDLRLRRIYEAKNGQGGMGRQKCGKAADDLYIDVPVGTQLFELPPLPA
FT                   PDSFDDEPEEPVQTWVPEQAMDIAVDDEADEAPAIESEAPDDEPTFLVDMTEPGQTFIA
FT                   CRGGRGGKGNLHFASSTMRTPRFAQPGEPGEERRIKLVLKVLADVGIIGLPNAGKSTFI
FT                   AAVSRARPKIAPYPFTTLTPNLGVIEHDDACRRLVLADIPGLIEGAHLGQGLGHRFLRH
FT                   VERTRVLLHVVSAEDASAEGVFEAFGVVDEELRKFDPALAERPQIRVVNKIDLLTPEEL
FT                   AERKAAAKAAGEKLFFMSALTGEGVEAVVEALWEAAAPEAPEAEEDAWPDASGGPEEI"
FT   CDS_pept        complement(180534..181727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73667"
FT                   /db_xref="GOA:C4XG87"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG87"
FT                   /protein_id="BAH73667.1"
FT                   /translation="MQRKPLTLRNNEERRLRAGHLWVFSNEVDTKKTPLTAFAPGEEAL
FT                   VTASRGRPLGVATVNPGSLICARLIDRDPEAVLDADFFRARLREALALRQRLYPTPHYR
FT                   LLFSEGDHLPGLVLDRFGDVVVGQCNTAGMDARKALILEALLAELSPRAVIWRNDSASR
FT                   DLEGLPRTVEVAYGDAPDHLDVEEDGARFAVPALGGQKTGWFYDMRENRSKLCRLVAGR
FT                   TVLDLFAYAGAFGVRAALAGAAKVVCLDSSETACAMAAENAARNGVADRVTVVRADAAD
FT                   YLEAAAAEGRTFDVVSLDPPALVKRKKDLEAGLKAYERFNRLAMDVVADGGLLMTCSCS
FT                   QHVDAYELRRAALRAAAGRNLRAQILDQGRQGPDHPGHPAMAETEYLKSFLLRLVRP"
FT   CDS_pept        181872..182981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01770"
FT                   /product="putative ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73668"
FT                   /db_xref="GOA:C4XG88"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG88"
FT                   /protein_id="BAH73668.1"
FT                   /translation="MRLVAWLTLCCALMAWGCGRDEPILIGYSGPLTGGRADLGVQGRN
FT                   GATLAVEDVNARGGIAGRPLKLVACDDGATPESAVEADAQLIKAGVSAIVGHMTSAQTL
FT                   AALPQAAAAGLVMLSPTTATPELSGKKDLFFRVIPTNVAWGLALAHHAAGAGRPAVCLV
FT                   GDSDNLSYVQSFLDAFDQGYDEAGGHVACRRMFSSREGVDWAALVDAATKNGVGAVVAA
FT                   ASAKDVAALARAMDAAGKRLPILCPTWPYTREILTMGGRSVDGIVFAASYTEDNPRPRF
FT                   QDFMRRYQERFGWPANFAAVYAYEAVEVLATALGRTGGRTAGLPEALLALGQQEGLMSS
FT                   FAFDAYGDVHRQTFLVTIRDGRFSALEGD"
FT   CDS_pept        182985..184973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73669"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG89"
FT                   /protein_id="BAH73669.1"
FT                   /translation="MRTSPLSRVVGRSLLMRLVAPGLALLALLATATAGLQWRAMERDN
FT                   VRLAKTLAAFVSAYLDNAYGSLEVFARRLPDTQGAASGEALGELLLFSPTMRRLLWIDA
FT                   AGMVAETAPPGQAGADFPLQFDRLRGERLMLSRPLPSPVDGRLCVYIGVRGPKGTILAG
FT                   ELDLGGLAQQLPSMAGMPDARVMACDAYGNLIVHPESRQVAEQANIGDTPLFLAAKAGR
FT                   HRVVYAQGGRLWLGTAGKAEPGDWQVLLAVPVWELVAPALYPTGLLFVFMAGAFVLTSG
FT                   LLRKELRERVEEPLARFAASLPKSVDETEGSAPFAELSVFEGAFDEMAKALVKNERLFR
FT                   SSFEQAAVGMGHAAPDGAWLRVNDRLCGLAGRGRAELLAGSLDGLADGEDREALRAGMA
FT                   TALAGGAATFAREASVIRPDGLALRCALTVNLVRDEAGEPEYFLCVGEDVTDRCRAGEA
FT                   LRQSLEDKELLLREVHHRVKNNLQVISSLFFLQAEVTNNAEAREVLLESRARVASMALV
FT                   HEGLYRTGDFGRIELSDYVSRLTHQLESSIGGRDGVRFLLCLEPSHLSIEKAAPLGLLL
FT                   NELLTNAIKHAYAPGEAGEVRVCLSRTPEGFRVMVADGGPGLPEGFAVEACQTLGMQLV
FT                   ANLTRQLRGMLVAENQGGATFTLTFPV"
FT   CDS_pept        complement(184984..186201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01790"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73670"
FT                   /db_xref="GOA:C4XG90"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG90"
FT                   /protein_id="BAH73670.1"
FT                   /translation="MSETAAEKAPRGVRLVITFVGRRNAGKSSLINAVTGQDVAIVSDF
FT                   AGTTTDPVAKPYELLPLGPVTLYDTAGLDDEGELGALRIAATRKVLWRTDIAVVAVDAA
FT                   GGLGDPERRIIEEVRRLEIPFLVVFNKTDLAAPSPADRQWCREQGIAVVTACAADGTGA
FT                   TAVKEAIMALAPAESLREPVLCGDLFAPGETVVCVVPIDLAAPKGRLILPQVQVLREVL
FT                   DNDGIAVTVKDRELEAALGNLRQPPAVVITDSQVILKMSGDVPDEVPLTTFSTLFARYK
FT                   GDLTTLAAGAAAIDNLRDGDVVLMAEACSHHVQSDDIGRVKIPRWISQYTGRDLTFEMH
FT                   AGHDFPDDLERYALVVHCGSCMFGRMEMLRRIRECTRRGVPVTNYGVAISKVQGVLDRV
FT                   LAPVMR"
FT   CDS_pept        complement(186194..187189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73671"
FT                   /db_xref="GOA:C4XG91"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG91"
FT                   /protein_id="BAH73671.1"
FT                   /translation="MQQAEIAKLLAGADDPGLFSAAAALTRENFGDEVYLRGVVEFSNH
FT                   CRNNCRYCGLRVANTAVHRYRLSVEDVIACAGLARELSIGTIVIQSGDDFHYTRDDIAR
FT                   IVVEAKARADVAVTLSLGDRADDELLFWREHGADRYLLKVETFDEALYAQSRPGLTLAD
FT                   RLARLETLRRAGYEVGSGVITDLPGMTPEILANDLVRLAELDLDMVAVGPFVPHPATPY
FT                   GDAPAGSILTAFRAMAVLRLLSPLANIPSTSALNALRDGAREQGLTLGANVVMPSLTPE
FT                   TVSPDYAIYPGKNAFRADARSRVEAAREAIRRVGKIPSTAVGGSKRRRHV"
FT   CDS_pept        complement(187340..187936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73672"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG92"
FT                   /protein_id="BAH73672.1"
FT                   /translation="MEMEREKPWAATGLAEVGLAGRVAGSDRLFFHAALYSNFARDRAM
FT                   ADALEAALRRPGFERLEVVSLDPVARPPYWDEFRQILRQDMPAAAMQREFSVSAAFLDA
FT                   LASRHPHKVRLYVTVALPLAPILLLDDVVIVGHYAHSPAPAPLGHWLVIPADVASLMEL
FT                   AEEGAQPESLDPADVGAYRLICDCLAARLASRRLA"
FT   CDS_pept        complement(188125..188721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73673"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG93"
FT                   /protein_id="BAH73673.1"
FT                   /translation="MSEQAFDVSLNAPVFAEDAKVGRVANVVVDPSHGRATFLVVREDA
FT                   LPNTLRLVSEKHIAASGPDGVRLSCPPAKFAAMREYVLTEYYSPEYFLHMAEKEHCKLP
FT                   MAPSSWTVERPATPAGSVALAGHEAVEATDGKVGKLDGVHLEAHTGRVIYLILRQGHLW
FT                   GAREVAIPAGLVAGYEDGVIKLSVDKAAIAALPAL"
FT   CDS_pept        188857..190269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls"
FT                   /locus_tag="DMR_01830"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73674"
FT                   /db_xref="GOA:C4XG94"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030840"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG94"
FT                   /protein_id="BAH73674.1"
FT                   /translation="MLFLILLCCHLIGAASAARALFTARSSQGAMAWVMAMITFPYLAV
FT                   PLYWIFGRNRFQGYVASRRAGDKAVDAMAPKLHAVQAFPDPHAPGLPGLFPVLERLAEL
FT                   PFTAGNHVRLLIDGQATFEAIFAAIDAAEHYVLVQFFIIRDDDIGRALQKRLIAKARAG
FT                   LAVYLLYDEIGSHSLNAAYLDELKKAGVQASPFNTTLGWRNRLQLNFRNHRKIVVTDGV
FT                   AAFVGGHNVGDEYLGKSPRLGHWRDTHVRLDGPAVALVQLSFLEDWYWATRQTPALRWE
FT                   LAPAPGGDMPVLVLPTGPADDIESCDLFFFQAISAAQKRLWIVSPYFVPDREIISALQL
FT                   AVLRGVDVRVMLPHKADHHMVYLASFSYLADLETLGVKFYRYQNGFLHQKIILVDDVMA
FT                   SVGTANCDNRSFRLNFELTLAVAHKGFIADVEAMLREDFQHCLRATADDYADRSFFFKT
FT                   GVMVSRLFSPIL"
FT   CDS_pept        complement(190532..190837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73675"
FT                   /db_xref="GOA:C4XG95"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG95"
FT                   /protein_id="BAH73675.1"
FT                   /translation="MREAELEATLAQSLGAEAARAALDALIAAWGGCRLDIPNGTSSRK
FT                   RRRDAEIRRRHRDGADLFALRDQYGLSDRHLRRILYPAPGRPLRPGVVRGQSEVVS"
FT   CDS_pept        190975..191796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73676"
FT                   /db_xref="GOA:C4XG96"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG96"
FT                   /protein_id="BAH73676.1"
FT                   /translation="MMRDACPAAASPESGFRTEEDHFFWKALVELAAAQEASQGELAAF
FT                   AGASQGYVSKILAGKQAPKPALRRRLAAFFGLSYEDMLAFGRQRLDAAAYPAEEGASRR
FT                   CQVREPAYGGSEATGRGGEALRAWLRDLHAREDRQSAYTEVPLREATASMGGGSTETGD
FT                   RTLSYLSFRTDWIRSKGNPEYMTAIRAFGDSMEPTIADGSVVLIDEGRRQFVKNKVYYL
FT                   RYNGQMYIKRLIDAGGRLGIASDADANVLLVSDADDFEIIGRCIWTARELD"
FT   CDS_pept        complement(191891..193930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01860"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73677"
FT                   /db_xref="GOA:C4XG97"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG97"
FT                   /protein_id="BAH73677.1"
FT                   /translation="MRLSLRAKFFAPTFVLVVVGMAALVMVNDRAVKSAFTKVEGQTMA
FT                   LLGQSLAKDVAGSVADNLKLLSSFAKAPALARAAQGQGGEAASELLTSLVKGMTGVDYA
FT                   NVFDASGLCLASTNPAAVGKVNVADRDYFAAVMTAGKADVVSKALVSRTTGKAAVVLAQ
FT                   PIRDAAGKLVGLVNAGMDLESLTADLTSLKVGETGYAFILDAQGMALAHPDKKQLMKDD
FT                   LGRSEAGKRVLGVAVSAVLEYEDASGRHLVAVARDAKTGWFVAVEAPVAEFGAYADAAT
FT                   RQNAIIALIVTVAILAAILVLLRVAVLGKLRQCVDFAAAVAKGDLDRRIAIASGDELQT
FT                   LGEALGAMGASIKANLAEAQAKSREAEAQAAQVAKALEDVKTAQTKAEEAKTQGLLLAA
FT                   DQLQGVMEALDGVAAELSREISTVAASVEEQERRTAETATAMEEMNATVLEVAKNAAEA
FT                   STKADAARSQAMDGRAVVERSIAAIGRVDAASRQVKAGMDELGAKAQAIGAIMNVISDI
FT                   ADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMTATKEVGASIGAIQAGARD
FT                   SMAKVDESTAAVAHATELAGESEAALARIVALVDETSSQVQGIATAAEEQSATSEEISR
FT                   AEEAVSRLSSEIAQGMRESAGVVTSVSRQVEALEQLVATFRSNS"
FT   CDS_pept        complement(194271..194696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="DMR_01870"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73678"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG98"
FT                   /protein_id="BAH73678.1"
FT                   /translation="MKNILFLCTGNSCRSQMAEGFARALRGDVLTAYSAGVEKHGMNPR
FT                   AVAVMAEAGVDISGQSSKLVSELPDVAFDYVVTLCGSAHDLCPFFPGPVKKVHVGFEDP
FT                   PALAAGAASEEEALSHYRRVRDAIRDFVAGLPENLGE"
FT   CDS_pept        complement(194984..195469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="DMR_01880"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73679"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C4XG99"
FT                   /protein_id="BAH73679.1"
FT                   /translation="MPGHPVDKEDFMRVLFICVHNSARSQMAEAFLRQMAGDGVTVESA
FT                   GLDPTVINPLVVAVMAEEGLDLSEKKTRKVFDLFRDGKLYDAVITVCEESLEGKCPVFP
FT                   GVARRLHLPFPDPATVTGTEEERLEAVRGIRDAIKARMAVLARELAGEAARPLGDRA"
FT   CDS_pept        196071..197252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01890"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73680"
FT                   /db_xref="GOA:C4XGA0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA0"
FT                   /protein_id="BAH73680.1"
FT                   /translation="MAVREQVYGFFIPSVTLIGIGAAKAIPEKIKALGGSKPLIVTDKG
FT                   VVKVGICKQVTDLLDAAGMKYHVYDETIPNPTDENVHKGVEVYKANGCDSLITLGGGSS
FT                   HDCGKGVGLVVTNGGKIHDYEGVDKSSKSFMPYLAVNTTAGTASEMTRFCIITDLSRHV
FT                   KMAIVDWRVTPHIAINDPVLMVGMPPALTAATGMDALTHAVEAFVSTIANPMTDACAIE
FT                   AFKLIFKYLRKAVANGQDMEAREGMCFAEYLAGMAFNNASLGHVHAMAHQLGGFYDLPH
FT                   GECNAILLPHVEKFNLIAKAEKFAAMAEIMGENIAGLSTRDAAELALKAIRQLSADVGI
FT                   PSGLIELGKKYGKDVKASDIPTMTGNAQKDACGFTNPRCPTDKDVSDIYTAAL"
FT   CDS_pept        197719..198279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrC"
FT                   /locus_tag="DMR_01900"
FT                   /product="heterodisulfide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73681"
FT                   /db_xref="GOA:C4XGA1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA1"
FT                   /protein_id="BAH73681.1"
FT                   /translation="MNIINLTRDYDEDFVHRVEEESGQNVSLCYQCGNCTAGCPYTFAY
FT                   DIPVSQIMRLVQAGQKKTVLSSKSIWLCATCESCTTRCPNMIDVACVMDVLRHMARREG
FT                   LAAVPQVKTFWDSFLDSVRAHGRVFELGLLINYVTKTGRFWTDMDLGPKILPKGKLAFK
FT                   PHDIQGKEHVARIFERFERESNS"
FT   CDS_pept        198276..199157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrB"
FT                   /locus_tag="DMR_01910"
FT                   /product="heterodisulfide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73682"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA2"
FT                   /protein_id="BAH73682.1"
FT                   /translation="MSEAIAYYPGCSGLGTSKEYDTSTRAVCAALGLSLVDIPDWSCCG
FT                   SSPAHTKDHVLSAALAARNLQLVSDMGLKAAATPCPSCLTNLRTANHRCEAAPFKAKVD
FT                   KLLDDPYAGGVNAVSVLQALVEMVGLDAVKSATRTPLKGLKVACYYGCIMNRPPELMAF
FT                   DDCENPMAMDNILAAMGAEVVPFPLKVECCGASYGIPRPDVVAKLSGKLLDAAVSVGAD
FT                   MVAVACPLCQMNLDLRQGQVNRAGGTNYRMPVPYFTQLMAVALNIADEDIGFGKLCVDP
FT                   RPVLSKALAVAD"
FT   CDS_pept        199177..201135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrA"
FT                   /locus_tag="DMR_01920"
FT                   /product="heterodisulfide reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73683"
FT                   /db_xref="GOA:C4XGA3"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA3"
FT                   /protein_id="BAH73683.1"
FT                   /translation="MRIGVFVCHCGSNIEGTVDTATVAKASLDFPEVVYATDTMYACSE
FT                   PGQDGIIQAIKDKNLTGVVVASCTPRMHEPTFRKAVERAGLNRFMFEMANIREHVSWIG
FT                   RDREANTNKSVDLVRIAVEKLRRDAPLIPSKFSVNKRVMVIGGGVAGIQAALDCADGGL
FT                   EVVLVERESSIGGKMAKLDKTFPTVDCSSCILGPKMVDVAQHPNITLHAYAEVDSIGGY
FT                   VGNFQVQVKKRATYVDWELCTGCGACMEKCPSKKNPDAFNEKIGPCTSINIPFPQAIPK
FT                   KAVIDPSTCRQFVKGKCGVCAKVCPTKAIRYDMTDEIVTEDVGAIVAATGYDLFDISKV
FT                   TEYGGGRYPDVITGLQYERLLSASGPTGGHIKRPSDGKEPKNVVFIQCVGSRDKSLDRP
FT                   YCSGFCCMYTAKQTILTKDHIPDSQSYVFYMDIRSPGKMYDEFTRRAMEEYGARYIRGR
FT                   VAMVYPKGDKMIVRGADTLAGTQVEIEADLVVLAAGAEAAKGAPQLAEKLRISYDKYGF
FT                   FMESHPKLKPVETNTAGVYLAGSCQGPKDIPQSVGQGSAAAAKVLALFSKDMLESDPQI
FT                   SRVDIKRCVGCGKCIMTCPFKAIKEVEFRGQKKAEVIETVCQGCGICTSTCPQGAIQLS
FT                   HFTDNQILAEVNALCQS"
FT   CDS_pept        201123..201608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01930"
FT                   /product="methyl-viologen-reducing hydrogenase delta
FT                   subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73684"
FT                   /db_xref="GOA:C4XGA4"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA4"
FT                   /protein_id="BAH73684.1"
FT                   /translation="MPVLTGKELRIVGFLCNWCSYGGADTAGVGRFNQPTDLRIIRVPC
FT                   SGRIDPLFIAKTLINGADGVLVSGCHPRDCHYAEGNFYARRRLEVLKRFLPILGIDPAR
FT                   FDYTWVSASEGQRWQKVVTVFTEQIHALGPATRHENVSPELLAKVASAIQGGNRVAA"
FT   CDS_pept        201595..202566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01940"
FT                   /product="iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73685"
FT                   /db_xref="GOA:C4XGA5"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA5"
FT                   /protein_id="BAH73685.1"
FT                   /translation="MSRLDALKTRIKEALPGLECVIGWQKGYDALHNTPLFIRGEADVD
FT                   KLEWGALNVHNPAVYLPSFAGKKVGVVVKGCDSRSVVELLQEKLIDRDNVVIFSAGCDG
FT                   VVDIAKVRAKLAAAGLNAGNAEKVAVDGKTVTVTAAGKAVSMPMAEVAADKCLRCQFPN
FT                   AVLADAFVGDPAPQVQAAPAADADLAALDAMSVPERMAFWRYHMDRCIRCYACRNACPM
FT                   CVCRDHCIAQSREPHWLSQEDSVTEKLMFQVVHAMHLAGRCTECGECQRACPMDIPVLA
FT                   LKKHLNRTIHDLFNYQAGVDVAAIPPLLQFKLEEDNIKERSW"
FT   CDS_pept        202566..203612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01950"
FT                   /product="iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73686"
FT                   /db_xref="GOA:C4XGA6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA6"
FT                   /protein_id="BAH73686.1"
FT                   /translation="MAAVKYIPREKLPEWLKALAAQSRVLVPVEEGGSVVFRQYDPARA
FT                   PVFGSDATAPPKGAVFPASQELFSYAYGKEGEDHAPTLKLDPKTEAQPTVVFGSKPCGA
FT                   RGFLIFDRVYMGKKFPDPYYIAAREATVFVTMACATVENTCFCHWVGSGPADAAGSDVL
FT                   LTPVEGGYTVEAVSEKGAKFLDNPALTDGAAKAAEAEAVKKASRDALGEAPDIASSPAA
FT                   LLALFDDQEFWRDQSDKCVSCGACTYLCPTCYCFSITDEGTGTAGRRMRSWDACMHFQF
FT                   TLEASGHNPRPTKAHRLKNRVGHKFSYYPTLHDGLIACCGCGRCVKSCPVSVDIREIVQ
FT                   NAVAKAKG"
FT   CDS_pept        203623..204459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01960"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73687"
FT                   /db_xref="GOA:C4XGA7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA7"
FT                   /protein_id="BAH73687.1"
FT                   /translation="MTDPFNPYLPEVATILETVQETHNIMTFRVRFDDEAKMKAFTFEP
FT                   GQVGQLSAPGIGESTFVINSPPTRMDYLQFSVMRAGEVTAKLHTLTAGDKIGVRAPLGN
FT                   SFPVADMKGKDIVFVGGGIGMAPLRTLFLYMLDNRADFGKIRLLYGARSPLDMAFSAEL
FT                   PEWTGRSDIETTLTIDREAEGWQHKVGLIPNVLLEMAPAADNCVAITCGPPIMIKFTLE
FT                   ALKKLGFADEQIVTTLEKRMKCGIGICGRCNIGTSYVCVDGPVYTYAQLKQLPNEL"
FT   CDS_pept        204571..205062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73688"
FT                   /db_xref="GOA:C4XGA8"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA8"
FT                   /protein_id="BAH73688.1"
FT                   /translation="MARFFSASDIVGTAIEIERRGRNVYSKAAAAATNPDVKSFLEFFA
FT                   GEEARHQAIFEAMAGRIAKIEVPAGSDEEEYMDYVQALLDSHALFCGGAPEKDLANASD
FT                   AIAAIELAARFEKDTILYFREMMDLLPPAESGIVKQCLDEERGHLRQLTKMLATLRRSA
FT                   "
FT   CDS_pept        205177..206019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73689"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGA9"
FT                   /protein_id="BAH73689.1"
FT                   /translation="MYHDVFGFDAMPLASPLDSAPGTRAAEALEQGLSARLLGLVLASD
FT                   LFAARTGSPRQSRQNVPVAACWPGAAIAVSGEALDQDDLDAFLGCLLLALRSPLRGSAR
FT                   FSLRDLARLIRPKARRFDVRRLERSLWRLAACRLNVEEAGGGYALQMRLLDAVLCDRRA
FT                   GLCAVDVGPRVLAACGDPERMERLIAARAPLADGFARWLAGFLSYGPAALRLDFAALRR
FT                   LSGLSRQPMAAFRVRAVAALQDFLDLGAIAAIESAGPDRLIVTRPAARGEEPACLLLS"
FT   CDS_pept        206041..207477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_01990"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73690"
FT                   /db_xref="GOA:C4XGB0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB0"
FT                   /protein_id="BAH73690.1"
FT                   /translation="MMSAAAGEDEKSWDASQKAPQRLRLDRLVPGPARTLPLRRLTLDV
FT                   LRDGRESFMTPSRLRTPLPRRSPEPMAADVLPHPPSLEDLIGIEHSKLGFYQELRQKVE
FT                   ELQDAHQESELRRQEIAAILDGITDVMMVLTKDLRIISVNHVFHELFDVPRPEGQHCYK
FT                   LFRASASPCPECPAHRSFRSNAVCRCMGTFKIHGVSRRFEMVASPIHNPDSPESRILIF
FT                   KRDVTLENEYQAKYYQAEKMATIGMLAAGVAHEINNPLTAVYGLAEGIRRRLPAIRQAV
FT                   DDDLYGDVAEYTETILMECRRCRDIVRSMLSFSRPHTLAFSPVCLNEVVTDTLNILKSR
FT                   LEDRAAAGLRLTVNLHQGLPTVPGDEAQLKQVLLNILVNSMDAIEGEGEITITTHPEND
FT                   NTVNLSVEDTGRGIPPDNMDKLFNPFFTTKPVGQGLGIGLSTCYSIVREHHGVIEVASE
FT                   VGIGTHFTVKLPLDSGHPSE"
FT   CDS_pept        207470..208801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02000"
FT                   /product="NtrC family two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73691"
FT                   /db_xref="GOA:C4XGB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB1"
FT                   /protein_id="BAH73691.1"
FT                   /translation="MNSAYSVLVVDDEPSIGKLLLKELTTPARAVHVAASAREARELLA
FT                   KNEYEVAVLDIRLPDANGLDLMVELRQRQEDLETILITGHGAIDTAVEAMKLGAFDYVT
FT                   KPFNLAELELLIERAYQRTYLRRENRRLRHFQGQTPPVQLVGNSPAIKQVRYLIEKVAP
FT                   TEVPVLITGESGAGKEVAAHLIQTLSKRADKPFFIKNCATLQKELARSELFGHLRGSFT
FT                   GAVENSEGFMAFANKGTLFLDEIGELPIEVQAALLRVLENKTYRRVGEKEERRVDIRLI
FT                   FATNRELVREVAEGRFHEALFHRINVFNIEMPSLRERREDIPLLVEFFLSRLTAGQAPF
FT                   RISDRAMKCLTSYDWPGNVRELRNVMERSIILSENSLITEHALPREFLEPARAEEEILT
FT                   LEAKEKEHIAKVLNFYDNNRSLAAEALGICRKTLYRKIRQYNLF"
FT   CDS_pept        209032..209358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73692"
FT                   /db_xref="InterPro:IPR010486"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB2"
FT                   /protein_id="BAH73692.1"
FT                   /translation="MHTLRACALALVLCLAAAAPALAKKQQQPQNIDFGAVTCKEFIAE
FT                   IAAGDEESAGIILMWIDGYLSGVSGDAVLNWKNLEAFSGSLMEACAKKPGKKVLDVAKD
FT                   IGIN"
FT   CDS_pept        209422..210618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02020"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73693"
FT                   /db_xref="GOA:C4XGB3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB3"
FT                   /protein_id="BAH73693.1"
FT                   /translation="MNAPAAFLRHLFASTLATATALVAAILLLASLGFYFVELRDTPGR
FT                   TLFDALWWAMTTLSTVGYGDIVPTTVPGRLIGMGIMGAGIGIMAALTGNLASALIERRN
FT                   RKRLGLLPVKTAGHSIVLGYNAHAPGLVKALAAAAPPTRGPAVALVAPLTPEAFAELAA
FT                   DLDLEERLTFCRGNPAQETVVARAAPAAARAAYILSQDGLSPEEADQQTLLTALTFRGL
FT                   APKVQLYAEALLETNRKHLARAGVDVTLVRGDLAERALETMGEHPALWHFLERLLGTSG
FT                   HRAMRARAMSHDEKALRWSALVGHALAAGDGLPVAVFRLRRDITIKELLDADSALDQFI
FT                   LEMFAAYGQEGRLGRQGPAVAVNPGDGLDLADFDGLILLETQAPPAKAHAPAGDGEQP"
FT   CDS_pept        210615..211142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73694"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB4"
FT                   /protein_id="BAH73694.1"
FT                   /translation="MNGEALKKAALFAGLSDDERDRLMPAFAPLSLAAGQAVIVEGQPG
FT                   DDMFLLTSGRVRVSKAMLLKGIVAPGLDGTAAEKTLVELSDAQSPFFGEMALLDRDIRS
FT                   ATVTCLTDCRFLRIDRDAFFACLQAHPALGVKLLTALAKRLAGLVRKNNVEVVKLTTAL
FT                   ALVLSRRGAERR"
FT   CDS_pept        complement(211213..212466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73695"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB5"
FT                   /protein_id="BAH73695.1"
FT                   /translation="MTAPFAVLWDHAHVWGLLLCRGLAALGAPCRPVTCAAVAGGALAA
FT                   DPPKALLVPGGFSRPKFAALGEAGQRAVRDYVAGGGTYFGVCGGCGLALSHEAGLGLCD
FT                   WTRRPFADRLEHLASGHVRLRGDAASPYLPAGLPEDFQAPVWWPAGFVPPPGASDGDGA
FT                   AVVAAYAGPGEDFMLADIALGAMPGALLGACQERFGLTLAPAFLDGGACVIAGAFGHGR
FT                   YVLSHAHLETPDSPQANAWLAHLLGIFDPDGEIGGRLVPAWHPAKEARRFADVHLEAAR
FT                   RDIESVIAAGIEARLLMRRSDWLLGWRPGMPGFSLSNLSALLAGASALPPTEAAVAYWR
FT                   QTGPDFAQRAAAFARRLEVFFPAQRLEITLSLVERRAGADPGLAAERRELFGASPGGGG
FT                   LCGELAATLDALLLRLLS"
FT   CDS_pept        212700..215366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="DMR_02050"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73696"
FT                   /db_xref="GOA:C4XGB6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB6"
FT                   /protein_id="BAH73696.1"
FT                   /translation="MTSEALSKGYEPADVEAKWIAYWQDEKTFTPDPDGPGEPYSIVIP
FT                   PPNVTGALHMGHALNITIQDILCRYHRQLGRKVLWVPGTDHAGIATQNVVERSLAAAGT
FT                   SREELGREAFIERVWKWREEYGGKILNQISRLGASVDWSRERFTMDEGLSKAVREVFVR
FT                   LYEDGLIYQGDYIINWCPRCHTALADLEVEYAPHIGKLYHIRYPVEGTDQFVTVATTRP
FT                   ETLLGDTAVAVHPEDERYKDVVGKFAILPLVGRRIPIIADAYVEREFGTGCLKVTPAHD
FT                   MNDFELGRKHGLDVIAVQDAAGRINENAPEKYRGLDRLAARKAVVEDLKELTLLDDIRD
FT                   YEHNVGECYRCRTVIEPFVSKQWFVKTGPLAKVARKAVEDGRTIILPDQWTKTYYDWLD
FT                   NIRDWCVSRQIWWGHRIPAWTCDSCGELIVSRETPTACPACGGSRLTQDPDVLDTWFSS
FT                   ALWPFTTMGWPDQTKELATFYPTSVLSTAFDILFFWVARMMMMGLHFMDEVPFRHVYIH
FT                   ALVRDAEGRKMSKSLGNGIDPLAMMERYGTDALRFTLAAFAAMGRDIKLAEERIEGYRH
FT                   FINKLWNAARFALMHVADGAPEMELSQAAKAGLCHAMILSRLERLKGTVSRAIEGYQFN
FT                   EAAQELYGFFWREFCDWYLEMAKVDLGGEDEFKKGAAKRVLLTVLSETLTLMHPIVPFV
FT                   TQEIWSKLPGMAEPNLAKVPYPPLRTELISDEAEAAMELLRSVVVGVRNIRAELNINPG
FT                   VKLTALVHAEDAAQAASLTANAAMISFLAKLERFEAGPDVAAPKASASAACGSCALFVP
FT                   LSGAVDFDVEFLRLSKEEVKTVKELTVVEKKLGNEDFVSRAPAEVVAKEREKQDALSER
FT                   LARLRELKDRIRKLMAE"
FT   CDS_pept        215821..217020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73697"
FT                   /db_xref="GOA:C4XGB7"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB7"
FT                   /protein_id="BAH73697.1"
FT                   /translation="MSTQRVFSVWTITITAVVTFVISGIGGSLFNEYLKRPKPEVVVTS
FT                   IGFTGGQQYIDIGEELVILTRDNPWSESFERYQTYSSLEKSYENMLRMKKMLEAGIENV
FT                   KSWTSHNLGGSRQQLSLDEILKTPLCNLEIIGSLLIGSIIREEVSSPPISLERLRATEL
FT                   VTNIDNDGDRWMIYLKRQVTNFPYKRCKTKHALNMVECLARSFACGSVANIAHFMNEYQ
FT                   TIAYRDLDGLNRTISGVEKVLLPKSHISLSALVYNSGSTALTVNPYMGLKFEHEDLNGT
FT                   ETILAVSKRLNNGHATGERDEGNDSEGTSVYVEPFLPKKAEGDYLFVPPNSEVRFELES
FT                   VEAIGGEHGKRIKDLFSANALRCKLIAQTDNGGLLVSSSVIFGRSVSKAQKDSLANVLR
FT                   "
FT   CDS_pept        complement(217121..219526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02070"
FT                   /product="putative response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73698"
FT                   /db_xref="GOA:C4XGB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB8"
FT                   /protein_id="BAH73698.1"
FT                   /translation="MTQPRILIVDKDQASANALARLLGEHGYEAVGPAASCREALETVD
FT                   RLRPDIAVLELLLTGACDGLDAAKLLREGHGIPVILLAPGGEPGLAARLKKSPPCCCLP
FT                   LPIDSQALIVAIESSLARKRAEEALRQSEARSRAIFAASPTPLCLVDGHNAIADVNPAA
FT                   TRLFGHCADALRGQPAQDFFAARDAATLLSVIDAAANGEAGHVRLSGLRPEGGVFPAAV
FT                   AASPLPDAAGVGQVLLEVRPCQIQGARPDVPEIDLGLSAEGFCVIDAEDRLRFLNASAA
FT                   RMFGLPGLPEPGTPLSDALPQELAASLVRDASRVIAWNEPVKKETTFAIGGQDKTLLVS
FT                   LFPMGLDESRRLAGGIVTDITDRKQLESQLAHMAFHDPLTGLPNRSLCLDRIRQALERS
FT                   KRRDNYQYAVIFLDLDRFKIVNDSLGHHVGDRLLESVARRLRDCVRSLDTVARLGGDEF
FT                   VVVLEETGSYREVVRIIKRIRDAMSEVFPLSGHDVHVSASMGIVVSPAIYEKPEELLRN
FT                   ANIALHRAKDEGRNRFKVFNTRMLEDAIRLMDLESDLRAALKRGEFYLDYQPILALRDR
FT                   RVTGFEALVRWRRPGKGIAPPGEFIPVCEDTGLIVPLGLWVLTEACRTMASWQARFPET
FT                   AGMSMSVNLSAKQLSQPSLVEDVERILRDTGMDPRALKLEITETVIMDNPEVSILRLKR
FT                   LKALGVRLSVDDFGTGYSSLSYLQRFPIDTLKVDRAFVSDLDTSENRKIVGAVVALAHS
FT                   LGLDVVAEGVELETQSDVLTGFACEAGQGFLFSRPVCKEDVERMLREA"
FT   CDS_pept        complement(219756..220259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73699"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGB9"
FT                   /protein_id="BAH73699.1"
FT                   /translation="MFLPRALVLCLALTVLAVAPARGAGQSLSLGAYKELRNDYVKVTD
FT                   IKERERTEERYMDAGGKVTLQKVPYKEVLVTAELAQKPPSNMETMFGGESNQPFLRICM
FT                   TPFDSAGKALDDTCQAFKFQSFVRGNVGTTTFRLEPGTARYEFRMVQPQGDKGSAIKLW
FT                   VPTK"
FT   CDS_pept        complement(220281..220670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73700"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC0"
FT                   /protein_id="BAH73700.1"
FT                   /translation="MFVADLMTSQLRCLKETDSLADAVAAMQELFIRHIPVLDADGRLA
FT                   GLVTQRDVLALEHKKDPGTPLRDIMRSDVATVAPDTPLRTAAETMIFHKYGCLPVVAAG
FT                   NLVGIITETDFLKLAIFPIAPRREG"
FT   CDS_pept        complement(220741..222918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02100"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73701"
FT                   /db_xref="GOA:C4XGC1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC1"
FT                   /protein_id="BAH73701.1"
FT                   /translation="MASANSCLSGDDVSASHQKLACRGEAAVDNGLNGRPPRLLIVEDE
FT                   RVVALDLKNILRRLGYTLAGVTASGVEAVELCESLRPDLVLMDIFLGGEMDGVEAACVI
FT                   QTECDIPVIYLTSHTDQVTLQRAKRTAPYGYVLKPVDENWLRTAVEVALFKHHTEQELR
FT                   RSEKRYRELFSAMLNAFLLLRHCPGSSQGQDDFEILGANPAFERATSLSNDEIVGHTLR
FT                   QTLPGIEPFWIDTLAAVAATGRPVRFENYLSDLNMYFLAQAYSPQPGQVAVALEDVTER
FT                   KRGEERLRYRTFHDALTGLPNRALCLDRIARAIERAKRRSNYIYALLFLDLDRFKLVND
FT                   SLGHLVGDGLLRRVADRLRREVRQLDTVARVGGDEFVVLLEEIASPGDALRIVKAVRER
FT                   LRVPFVVDGRQIYVTASLGVVLGPADYERPEELLQNAAIAMNAARSAGCGRVRVFDWSM
FT                   RERAERVMDLETNLREGLVRDEFVLHYQPILDLATRRLRGVEALVRWRRVDGELVPPGE
FT                   FIPAAEQSGLIIPLGAVVLTEACRALARWRAGSLGDSPFFMAVNLSARQFTQPDLVKQV
FT                   VTALRREAMAPADLKLEITESVLMEHPESAMLKLRGLRELGVSIGIDDFGTGYSSLSYL
FT                   QRFPIDTLKVDRAFVSGMEEQGNRVIVRSVVSLAHNLGYDVVAEGIETAAQLDDLSRLG
FT                   CDMGQGFLFARPMEESGIVALLDRQDPPALT"
FT   CDS_pept        complement(223030..223641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="DMR_02110"
FT                   /product="flavoprotein WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73702"
FT                   /db_xref="GOA:C4XGC2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR037513"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XGC2"
FT                   /protein_id="BAH73702.1"
FT                   /translation="MNVLIVYYSLYGHVAAMAQAVAEGVHQVPGMTATLRRVPETLSEE
FT                   VIGKMGATEAQKALSHVPACTLEELEDADAIVFGTPTRFGNMCGQMRQFLDATGQIWMR
FT                   GGLVGKPGGVFCSTATQHGGQETTLMSFIQTLLHHGMIVVGLPYSFAGQMRLDEVTGGS
FT                   PYGATTIAGGDGSRMPSENELDAARFQGRHIADVTRRLRA"
FT   CDS_pept        223806..226355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02120"
FT                   /product="putative secretion ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73703"
FT                   /db_xref="GOA:C4XGC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC3"
FT                   /protein_id="BAH73703.1"
FT                   /translation="MQTALTCLKAVADAYGLTFDPAAAADRLGLGAAEPDLDVLLALAS
FT                   GAGLTARVEQLDVPAMAALGRFPLLCVLSNGNSVVVLGVRDTSEGLVARVADPLAQTPG
FT                   SFEVDQESFEKSHGGVTVVAIPTLARAGLRALALIGRHHGLPLAHETLAAQHGFDAAEP
FT                   TPTELCAVAAASGLKAELRRLAPAELPLLAGAYPVLLFMRDGAALVAAGCRQEDGRAVL
FT                   DVVDPTRLPPSRDPLPVADLAGRWDGQTLLLKRKRRLTDENQPFGLTWFVPEILRCRKE
FT                   FTDAAVAAFMLYALALAMPIYFQIVIDKVLTHKGLATLQVLSFGMLCALAFEAGFSYLR
FT                   GIVLLHAAARIDVRVAARTFARLTALPLRFFGHSRVGVLIQHMQQADKIREFLSGKLFF
FT                   TLLDGAALVVFIPVLFLYSVPLTFLVLALSLALGLLLAVIIPFFRKRLAALYAAEGERQ
FT                   SYLVETIRGMETVKALSLEPSRRRGWEDAAARAVAMRFGVGKIGNAATAGVGFLEKVMI
FT                   LCIPWIGVSLVFDGSLSVGALIAFQMLAGRVTQPLVQFVSLLQEYQEKALAVDMLAAIM
FT                   NEPPERAGSGEGLRPTLVGEVVLDHVTFRYGQTADAPAALSGVSARFAAGAMIGVAGRS
FT                   GSGKSTLARLLQGLYLPTDGSLRLDGHDLRELDLAHVRRQIGVVLQESFLFTGTVRDNI
FT                   AMARPTAALEEVVWAARLAGAEEFIRRLPRGYDTPLEENGSNLSGGQRQRLAIARALLA
FT                   NPRILILDEATSALDAESEAIVQDNMARIGRQRTTIVISHRLSMLAGADAILVLDAGRA
FT                   VDFAPHAELLKRCAVYRDLWNSQNRHVAAGGGTPQVR"
FT   CDS_pept        226442..227755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gid"
FT                   /locus_tag="DMR_02130"
FT                   /product="Gid protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73704"
FT                   /db_xref="GOA:C4XGC4"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC4"
FT                   /protein_id="BAH73704.1"
FT                   /translation="MAIGIIGGGLAGCECALALARAGVASTIFECKPALYSPAHVLPGL
FT                   AELVCSNSLRSDEPVTAVGLLKVEMAELGSAVIAAARETAVPAGKALAVDRDRFSENMT
FT                   ARIEAEPLVTLVRREIMGLSDPALAGFEAVVVAAGPLASDRMAASLLETIGGEGLYFYD
FT                   AIAPIVTTESVDMDKAFWASRWQDGEGDYLNCPMDKDEYLAFWNALLTARKVPSREFEK
FT                   EIHFEGCLPIEAMAERGERTLTFGPMKPVGLTDPRTGRWPYAVVQLRPENVARSTMNLV
FT                   GFQTKLVYGEQERVFRMIPALHAAEFTRLGSIHRNTFVNAPKVLNERLELVARPGVYLA
FT                   GQITGVEGYVESAACGLWLGTQLGARLARGEELPPPPVVTALGALLNHLRTPAKKFQPS
FT                   NVNFGLTPPLEEKMKKANRKMAYPERARKAWGEWFVRP"
FT   CDS_pept        complement(227794..228351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73705"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC5"
FT                   /protein_id="BAH73705.1"
FT                   /translation="MSDAAYQVDLASVTPITASLKAVPLAEAPDDLFQMMMAAKQDMLE
FT                   QRYSTPPDTSKNPAYAPYATVTVNGKVVAKIDNHGFVETSNAMGGQCADAIKAADDRSG
FT                   GASGPQLAQARAEEIAKALGGKVNKASTAMTQRAFEATPQPKATVNEAALRADPEYAQI
FT                   AQLRQAHAAFLAQHMDEEQATA"
FT   CDS_pept        228452..229654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73706"
FT                   /db_xref="GOA:C4XGC6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC6"
FT                   /protein_id="BAH73706.1"
FT                   /translation="MQHFDFIIAGAGIVGLTTAYEIVHRAPSARVAVVEKEDAPGRHAS
FT                   GRNSGVLHCGLYYGSDTLKAQVCAVGGRAMKDFADAHGIPWRNTGKVLVATEPDQLPAV
FT                   ERLMQNAADNAIRAERIDNKTLLALEPAAPPHAVAAIHCPDTSVIDAKAVLETLRRLLA
FT                   EGGVRFYFQRRVLGPAADGSLQTTSGPIRGGFLFNCCGAYADVLAKACNFARQYVLVPF
FT                   KGIYWKLSPQKNHLVRGNIYPVPDPAMPFLGVHFTRGISGEVYVGPTAIPALGRENYGL
FT                   VSGAKWGEAATILGRLARLYLADRSNFRLLAHTEIRKYSKRFFHQCARRLFPGLEMDDL
FT                   VPTTKAGIRPQLVSVAAKRLEMDYILEGDGNSLHVLNAISPAFTGSFAFARMIVDRSGA
FT                   L"
FT   CDS_pept        229743..230276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="DMR_02160"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73707"
FT                   /db_xref="GOA:C4XGC7"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC7"
FT                   /protein_id="BAH73707.1"
FT                   /translation="MKKGRPAVFFDRDGVLNHDAGYVHTPEAFVWTDEAVAAVRHVNDA
FT                   GWLAFVVTNQSGIARGYYGPGNVARLHRWMQDELGRHGAHIDAYYYCPHHVDGLIAELA
FT                   VECSCRKPQPGMLLAAMDDWGVDRERSLLIGDKPSDLEAARRAGIRGYLFQGGSLLRLV
FT                   REAIEAAGPPVGES"
FT   CDS_pept        complement(230293..231162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="DMR_02170"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73708"
FT                   /db_xref="GOA:C4XGC8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC8"
FT                   /protein_id="BAH73708.1"
FT                   /translation="MSVVRFSPTWLTEDNSYRVRAWAEACFFPETADDLVAALRQSVGV
FT                   RVVLLGHGCNVLLSRDHYDSSFHFIATSRLEPALVVAGDSLLAGAGARLRDVCRLAARC
FT                   GLSGLERLWDIPGSIGGAAHMNAGAYGASFYDVVESVDVYDPGAGQRAVLSREQCRPAY
FT                   RMTAFQGTDTVILGVALQLTPADPAAVLAEMGRIGKLRRSRLPYDFPSAGSVFRRPDGA
FT                   PPVGQIVEEAGLKGFRIGGAQISPRHAGIIVNAGGATGADILAVIEVMRRAAWQRYGVE
FT                   LVLEQVVV"
FT   CDS_pept        complement(231280..231870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73709"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGC9"
FT                   /protein_id="BAH73709.1"
FT                   /translation="MEEREITISERVLGLVRRMPAFADLSDGQIIALFADKGLRYREYR
FT                   PGETIIREGDHDSWVYYLISGQARVLAQEAQVARLADYGDIFGEMGPLRGRPRNASVVA
FT                   DSPVSCLAIDLSILDRLPPDERRAASRLFEELITDVVHDRLSRANLDAAALRRDLAMAA
FT                   SALAGVNARVRDLERRILELTRENQELRRQCGR"
FT   CDS_pept        complement(232069..232431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73710"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD0"
FT                   /protein_id="BAH73710.1"
FT                   /translation="MAADGGRMAATTPDHGANPMSEEVFADGILGVGFGKGAVRIDFFA
FT                   LSADAADAKGQPAKERRQRIVMTTEGFIEAYAMLSGVMEKLQAQGLVRRQGPGAAAPDK
FT                   DGKDQTPASGSPSPNF"
FT   CDS_pept        232545..233234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02200"
FT                   /product="Asp/Glu racemase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73711"
FT                   /db_xref="GOA:C4XGD1"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD1"
FT                   /protein_id="BAH73711.1"
FT                   /translation="MKTLGLLGGTSWTSTVEYYRFLNEEVAVRLGGLHSARLVLASIDF
FT                   AELEQAMRADDRSGAEAILAGAARQLERAGADGVMLCSNLIHRYHDAVAQAIGVPILHI
FT                   GDAVAAAVKNAGYAAVALLGARPLMEEAFYRDRIREKGGVTVLTPDQPDREYINAAIFE
FT                   RMCRNVYTDEDRTRFIAILEGLKARGAQCALLCCTELPILLPQGPLPLLSSTLVHSRYG
FT                   TDWALST"
FT   CDS_pept        complement(233245..234696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02210"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73712"
FT                   /db_xref="GOA:C4XGD2"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD2"
FT                   /protein_id="BAH73712.1"
FT                   /translation="MGGVMWRARGVNRRAAGRSAVFPRKRDKDATPAASGAAPPGPPPA
FT                   RFAAFQPDALEIVATPTPVRYRLTLYLLLAFCLAALAFACLAEVDRIVVAPGKLVSARK
FT                   NITVAPLETATVREVYVSAGKSVTRGDALIALDPAFAEAGLAERDKDRAALSAKVWRLR
FT                   CEVSGLCAQPPDAPPSAAPPAELALERDVLNARRREFAAKVDALTQRQRELSAKLTTNA
FT                   AEAAKHKKQIALAKDLERMYGDIYSQGASSKVEYMKAQSSRIEAEGQLARLQNEAGELR
FT                   ESLARAEAEKRDFVENWKAGAAKELADASRELSGAEERQKKAERLRDLVVLRAPESGTV
FT                   LDVAARSAGAVAQAGETLLTIVPAGEELVVEAEAAAQDIGLLRPGDPVRVKFEAFPYQR
FT                   HGVAEARLATISPDALEKTTPEGQRLFYRVRATLGAVRLTAVPPDFRLIPGLSLTAEIR
FT                   VGSRRIITYLLYPLLKTFDESLREP"
FT   CDS_pept        complement(234787..236052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="DMR_02220"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73713"
FT                   /db_xref="GOA:C4XGD3"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD3"
FT                   /protein_id="BAH73713.1"
FT                   /translation="MTLSADLFAKAQTLIPGGVNSPVRACRSVGCDPLFIASAAGSKMT
FT                   TVEGREMLDYVMSWGPMLLGHKDPDVTAAIRSAVEAGVSYGAPCPGEVALAEAVVDAVP
FT                   GIDMVRMVNSGTEATMSAVRLARGYTGKSMIVKFEGCYHGHSDAFLAAAGSGLATFCIP
FT                   GTPGVPADTVRHTLLAPYNDLDAVKALFETRPDIAAVIVEPVAGNMGLVLPKPGFLEGL
FT                   RELTAAHGALLIFDEVITGFRLAYGGAQSVFGIDPDLTCLGKIIGGGLPVGAYGGKRHI
FT                   MERIAPCGDVYQAGTLSGNPLAMAAGLATLTKLKASDYDALAERTKALAEEMAAILRDK
FT                   GAPVTLTRIASLFTLFFCDGPVTNFDEAKKGDAARYASFYNQMREAGVILAPSAYECAF
FT                   TSFAHSEDDYARTLDAVRSVKF"
FT   CDS_pept        complement(236049..236501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73714"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD4"
FT                   /protein_id="BAH73714.1"
FT                   /translation="MTITRAAPVLMVDDVARTVAFYRDVLGFAFLAGVTEAGRETVVDW
FT                   PPPGPLVFAMIESGQARLMFETRSSMAADLPRFAEAKRGGSLILYLECDDLDALYERLS
FT                   EHAPFLKAPHATFYGTRECSIEDPNGYVLTFAQRLEKTSPTPETAP"
FT   CDS_pept        236998..237423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73715"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD5"
FT                   /protein_id="BAH73715.1"
FT                   /translation="MRVFTVVFALLLSVAAAQASTHKNISISNLSNKQRIAATVTAYTP
FT                   DPRENGGKGKKSGTAIGTRIRPGIVAVSRDLLKSGWNFGDKVHIEGLGVFTIEDTMHQR
FT                   HRRTIDVAVPDRKEAEKIGKRRAIVVTLLEGRPEAEA"
FT   CDS_pept        complement(237485..239530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02250"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73716"
FT                   /db_xref="GOA:C4XGD6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD6"
FT                   /protein_id="BAH73716.1"
FT                   /translation="MRLRWKFFLILLGFALVPMLVLTHVNRRHVERLGQSIAAEGNAVI
FT                   SEVVKNELRQTAEDFSLVIRRSKSALDFSLSMTVAETERLLFAPPLPRQDQGGHETPSV
FT                   GVHVPMGVRPDTVALSRLAGLAPTAGLLRHELDNTVLFVAVSLEDGISVAFPAREGLPP
FT                   DYDPRQRPWYKAAKAAFDPKRPTAQEVVWNDPAVDPATGRLTLTLSRAVVGPGGRFVGV
FT                   ASLDVPLERVLQEQEIASQWSQAMRAYLAAPVRDPATGKRVLYVWARRDDDATARDWKS
FT                   AVNFEPLTSSDAAGFDAMLAAMERDASGTAELPLNGVPSFWAYARLMRGASLVIVVPTS
FT                   MLDPMAEQSRREILAATDQIVRLSGAVMAAALFAVALAAFFSTKAFVRPMVRMIEAWKR
FT                   LGVGDFTVRLDERLSDERQALVDAFNETVPVLADHVRLQRSLELAQEVQQNLLPAAPPV
FT                   LDGLDVAGTSISCDETGGDYFDYRVVSRGGAVCLDTAVGDVTGHGVPSALLMATARALL
FT                   LATEDSETPAGRVRRANRLLCRDVGDSGRFMTLLAMEIRPGEGIARYVRAGHDPALCYD
FT                   PARGVFEEWPGTGIPLGIDPDYAYTEYTMPFTAPGVVLVLGTDGIWEARNEAGDMYGKA
FT                   RFREVVAGASGLSAAGIVAAVLDDLVGFRGSRRQEDDVTLVVVKRL"
FT   CDS_pept        239837..240550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="DMR_02260"
FT                   /product="putative rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73717"
FT                   /db_xref="GOA:C4XGD7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD7"
FT                   /protein_id="BAH73717.1"
FT                   /translation="MALRLLAALVAAFFLAGCASKAPVPGPSSREPATLRPYTIKGVTY
FT                   VPLRSAKGYREEGIASWYGPGFHGKRTSNGEVYDQYQLTCAHKLLPMQTKVRVTNLENG
FT                   RSMTLRVNDRGPFVAGRIIDLSQAGARELGVHARGTARVRVEVEGDAPGAGPGGELPGP
FT                   FYVQVGAFALRGNAERLFARLQAAGYAGSRIQTREIDGALLHLVHAGTFPTSAVADEAR
FT                   FRLGERFTGAFIIAQ"
FT   CDS_pept        complement(240983..241285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02270"
FT                   /product="HU_IHF family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73718"
FT                   /db_xref="GOA:C4XGD8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD8"
FT                   /protein_id="BAH73718.1"
FT                   /translation="MNGKTLTKADIVDYIYEKTERNRAEVKVLVDHLLELMKQSIKRDN
FT                   SLLVSGFGKFESYDKKARKGRNPQTNASIMLPPRKVVVFRLSRKFRAELNPDEVL"
FT   CDS_pept        complement(241370..241792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02280"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73719"
FT                   /db_xref="GOA:C4XGD9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGD9"
FT                   /protein_id="BAH73719.1"
FT                   /translation="MDAADCIFCKIVKGEIPCAKLYEDELTLAFLDIAPVAPGHALVIP
FT                   KAHHPDLFALPVELGAALLAAQQRVGRAVMAAMGATGLNVQQNNAQSAGQMVFHAHYHL
FT                   IPRREGDGLALWPGTPYPAAAAVAAVAEAVRAALAK"
FT   CDS_pept        241906..243000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73720"
FT                   /db_xref="GOA:C4XGE0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE0"
FT                   /protein_id="BAH73720.1"
FT                   /translation="MASTHIVRHLRQNVISGGSPRGRFFRHPEPPRERTRVWPVYISFQ
FT                   GCPGRCVFCAQSVQAGAPPVSLGETLAAMEGGLAQAARDGRGPYELAFYGGVFTALPEP
FT                   WPRRFLEAALRFRRAGLIGRIRCSTRPDACPPGLLAELAGLGLDLVEIGAQTFDDAVLI
FT                   ASGRGHDAQATRRAARAVRAAGLDLGLQLLPGLPRHDPAALARDVAETCALAPSLVRIH
FT                   PCLVVEGTALADLYRAGRHVPWPLEATIDALAEALVPLWRAGVAVARLGLAPQPELEAA
FT                   IIAGPRHPALGDRARARALLALVREEAAALGGAPAGLFAPRRFAGQLLGHAGELAPAYA
FT                   ALGLPRELLRFTRDEVFFLAAKAV"
FT   CDS_pept        243076..243585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73721"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE1"
FT                   /protein_id="BAH73721.1"
FT                   /translation="MKRFFAPLACLVCLALAAPAAAETPNMRQSINYFMNYFNEAVVQA
FT                   IQIKEQEDRDGLTEKRPYTDEFVFYQDLKARIEKSLGLALNLCDLYYIYNKTTYCFTKD
FT                   EKNYLFDRLDNIMDALQKIKDTPYVGGDVALENKSGAAARQLAAFNERVDKLRAFVKSS
FT                   LVVFQR"
FT   CDS_pept        243588..244742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02310"
FT                   /product="amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73722"
FT                   /db_xref="GOA:C4XGE2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE2"
FT                   /protein_id="BAH73722.1"
FT                   /translation="MRPPPTPRAVRAARALTMVPGDAPLDDAALILAGRRILDVGPARR
FT                   VLAGFHGPVDDLGDVVLVPGLVNAHAHLELSHLRGQAPPPAGFCAWAGWLFAAARDTAP
FT                   PDVLAAAVAEVAGTGTAAVIDVAGRAGAAVARALRAAGLSGLVCREILGRRAGVSLDLP
FT                   PQLADAAGDGVAATVCGHALYSTAPELLRRARAVCREHGTPFSLHLAEHAGEMELFTTG
FT                   RGEFAAMLAGRLLPKGWQPPGRSPVAEAAAQGLLGPDTLAVHVVSLAPGDLDILARSEV
FT                   TACLCPRSNVRIGVGVADAPALAAAGVRLALGTDSLASNDDLNLWNEARALFTAHPELP
FT                   GRAVLEALTVNPARLLGRDDLGRLAPGSVGGWAVLPADLAQRLA"
FT   CDS_pept        244936..246183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73723"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE3"
FT                   /protein_id="BAH73723.1"
FT                   /translation="MSPNTDDNYAVARHPIYRIDGDVFGYELLYRTVGGPNAASFPSDA
FT                   EATLSVLANGIHAISQDIDPKKKIFINFSKEILESGHHKFLDPGRFVIEILEHVTCDAA
FT                   FVELVRGIQEAGFVLALDDYVGDPSFDPILPYVTYIKVDFLALAGDSAKLGAVVDRCLA
FT                   LGKTVLAEKVETEADVAWCRDRGVPLAQGYFYSRPKIVTAKILEPNQAVKLNLLAEVSQ
FT                   PELDVRRVREIIGSDVSLTYKLLRYVNTASFYRGQPIESVDFAVTRLGRNALSSWVAVN
FT                   MLATIGDSARDRELAFASAVRGRFLALADGRRLPGRATCHDGQSICLTGLLSLLDAMLG
FT                   MPMVQALAGISIDERTRVALLGGESSCTPCLALAGCYDAGGESARAALRAYGLAPDDAS
FT                   AAYFEALAWAADMFRP"
FT   CDS_pept        complement(246194..246646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02330"
FT                   /product="putative Rrf2 family DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73724"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE4"
FT                   /protein_id="BAH73724.1"
FT                   /translation="MAVTQKCQYALRALLELALREGTGAAPAGEIADRQAIPKRFLEVI
FT                   LNQLRQGGFVASQRGKEGGFYLARPASEVTVGAVIRFMDGPISPVDCHRERPGHDCPLQ
FT                   GGCVFRGLWDEARDALERVYDTRSLADLVAEDRRIRQAAKTADYVI"
FT   CDS_pept        complement(246761..247198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73725"
FT                   /db_xref="GOA:C4XGE5"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE5"
FT                   /protein_id="BAH73725.1"
FT                   /translation="MAVIHSVCVSRKKGERKSAVERVSLVVDHGIEGDAHAGSPRQVSL
FT                   LSLDALNRMRQKLDWLAPGDFAENLNVDGLETLDIAVGRRIRVGADVVLEVTAIGKACH
FT                   DAGCAIKKAAGTCVMPREGVFAKVLVGGDVTAGDVVAVVEE"
FT   CDS_pept        247352..247921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02350"
FT                   /product="isochorismatase hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73726"
FT                   /db_xref="GOA:C4XGE6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE6"
FT                   /protein_id="BAH73726.1"
FT                   /translation="MPTSSQTEQPSALLLIDIQNDYFQGGAMALAEPEAAGRNAAALLA
FT                   RFRAAGGPVFHIRHEAARPGATFFLPGTPGADIHACVAALPGEAVILKHWPNSFRDTGL
FT                   GAALDACGAKRLVVAGMMTHMCVDATVRAAFDLGYAVTVAADACATRELAYGGRTVAPA
FT                   DVQAAFLAALGAVYAEVVATAAVAVS"
FT   CDS_pept        complement(248384..248668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73727"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE7"
FT                   /protein_id="BAH73727.1"
FT                   /translation="MAKSIELRGFMELSELFRERGWNTPHEVAVSGTMTGPELLALLDV
FT                   GRERVEVIFVNGKATSPEAATVAAGDRVALAPPGVPGPYRVLLGFKKMG"
FT   CDS_pept        complement(248841..250568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02370"
FT                   /product="putative tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73728"
FT                   /db_xref="GOA:C4XGE8"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE8"
FT                   /protein_id="BAH73728.1"
FT                   /translation="MPKFIRIDMGAKAVKIEECPEKYAGLAGRGLTSIFVADEVKPTCH
FT                   PLGKNNKLIFAPGYLTGTSAANSGRLSCGAKSPLTGGIKESNTGGTFAQRMSKMDIKAL
FT                   VFEGLPEGDGFYVVKVTMDGATIEEAPAEIIGMGNYEAIKVLQAKYGPKVGVAIIGPAG
FT                   EMRLTAANISFADPQSNIRSAGRGGLGAVMGAKKIKAVVIDDTGAPGVTIANPEAFKDA
FT                   SKRFTNALTTHPVTGQALPKYGTNILINILNEAGGLPTKNFRTGRNEWANNVGGETMAA
FT                   VIESRKGKTTHGCHAGCIIRCSQHYNDKDEKYLTSGFEYETIWALGANACVDDLDAIAY
FT                   ADREFDDVGVDSIETAVTVGVAMEAGIIPWGDAKAMLNLILEIRKGTPLGRILGSGAGA
FT                   LGQMYGLSRVPTVKNQAIPAYDPRAVKGVGLTYATTPMGADHTAGYAVATNILKVGGFV
FT                   DPLGKEGQVELSRNLQIATAAVDSTGMCLFIAFAILDIADGFNALVEMINARYNLSLTG
FT                   DDVVALGKTILKAERGFNERAGFTKAHDRLPEFFEEPCAPHNVTWDFTDEEIDEVFNF"
FT   CDS_pept        250933..252321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02380"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73729"
FT                   /db_xref="GOA:C4XGE9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGE9"
FT                   /protein_id="BAH73729.1"
FT                   /translation="MSHLGQNAPSSKARDKIRPQCRSFPLGLTFCRAAGYFRKRYPESA
FT                   RASPGAAGRHAARGRAADRRFRPASRAAAPGRAPRSLMRISKFAIPEIIFGRGSIVHLA
FT                   SCAKRVGARRVLFVSDSGLAKAGWVDRIQEILRDNGLEWVYFDAVNSNPRDHQIHEGAD
FT                   IYVRERADVIIAVGGGSPMDAAKGIGTIVGNGGSISDYEGANRIMRPLPPMIFLPTTAG
FT                   SSSDISQFCIITDVARQVKMSIISRSLVPNVSIIDPLVLLTKSEELIISSAVDAFAHAV
FT                   ESYLSLLSSPFTEHQALKAIRLIAHNIRPALENRSIEALENLSIASTCAGMSFSNAGLG
FT                   IGHSLAHSLGGMFDVLHGLVHPILLPPVMRFNLAVSVDKLANIGRILCGPRMCSNEYLA
FT                   QAGIAWLEHFFADLRVPVRLRDILPDSSCLETIAKAAVNDACTLTNPRPASWESLLGVC
FT                   QEAW"
FT   CDS_pept        252321..253535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02390"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73730"
FT                   /db_xref="GOA:C4XGF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF0"
FT                   /protein_id="BAH73730.1"
FT                   /translation="MPGKGPSLEDLIGIEHSKLGFFQELRQTIEALKDANTQSAQRRRE
FT                   IAAILDGITDIMMVLTSDLRILSVNHVFRQTFPDVPRPEGMFCHQIFRGEDVPCPGCPA
FT                   SASFAAGDICRETAIFKIGGKNVQFEMVASPINRPDAPDRHILVFKRDVSREKEYQAKF
FT                   YQAEKMATIGMLATGVAHEVNNPLTAIFGFAEGLRRRLPALKEKVDPRVMEDVEDYVAT
FT                   ILRECRRCQDIVTTLLTFSRQKTVSFSAVSLNAVVNDTLKLLRSHLKQRNQAKITVRVD
FT                   LSENLPMVHGDEHQIKQVMLNLLVNAMDAITGPGRIIITTYQSSKGAVCLSVEDSGCGV
FT                   PPENVDKLFEPFFTTKRSGKGIGIGLSTCMSIVKKHQGDITLKSTPGQGATFTVSLPVN
FT                   PEKTT"
FT   CDS_pept        253532..254860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02400"
FT                   /product="NtrC family two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73731"
FT                   /db_xref="GOA:C4XGF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF1"
FT                   /protein_id="BAH73731.1"
FT                   /translation="MTSPYSVLVVDDEPSIGKLLKKELSTPSRLVSTAETAHQAREALR
FT                   RNTYEVAVLDLRLPDADGLDVLVELRQHSPDIEVIIITGHGNIDSAVEAMKLGAYDYIT
FT                   KPFNLEELELVVERAYQRACLRFENRQLRHAQKQAQPQQIVGNSAPVKQIRFLIDKVAP
FT                   TDVPVLITGESGAGKEVAATAIQARSKRAEKPYVIKNCATLQKELARSELFGYVKGSFT
FT                   GATENREGLMTFANKGTLFLDEIGELPLEVQASLLRTLENKTYRRVGDKDERTADIRLI
FT                   FATNRNLAKEVEAGRFHEALYHRINVFNIELPPLRERKEDIPLLVEYFLGRIEGGGAYR
FT                   VSDKAMGCLINYHWPGNIRELRNVIERGVILSEAGVITENALPRELSVKAEGESDFLSL
FT                   DAVEREHIAKVLACFGNNRTLAATALGISRKTLYRKIREYNIM"
FT   CDS_pept        254960..257023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02410"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73732"
FT                   /db_xref="GOA:C4XGF2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF2"
FT                   /protein_id="BAH73732.1"
FT                   /translation="MISSIDVVTLAICLGIVNLLQFVAFFIQYRIDPARPGPGCWTVAS
FT                   ALGCVGFVVNFLRDFPSIQTASIVAYNLSLIGGQLLVYVGILRFLGRRERRGPLLTLAA
FT                   LAAAAALTFTTVHDDIVARRVCGSVLYALLCFASSRALLRYNTPDIAVGARTVAALFTA
FT                   NGLALAAVPALPPLGLPQLSPPLPMTLTFLVLLVAGPLGSIGLIVLGNQKLAAENRKSH
FT                   ESVRTSKLFLQSVLDSLTAHIALIDADGGILLVNKAWRDFARQNGLDPELVSEGTNYLC
FT                   ACDNAACRNEPEADSFAAGIRKVLSGELKQFAMEYPCHAPHERRWFVGRVTPFPGDGPP
FT                   RVVVAHEDITVRKLMEIALAESNRKLEALSATDPLTGIANRRRFDEAFAGEYARHARTG
FT                   APLSLVMLDIDYFKNFNDAYGHAQGDACLAAVARAMAGCLQRPGDLAARYGGEEFICLL
FT                   PDTSPRGTRTVAESIREAVAALAIPHARSSAAAVVTVSIGALTAACPPDADPGDLFRQV
FT                   DALLYKAKENGRNRVEAGGDAPAAQSGGPDKGIVRLFWDEAFESGNPAIDRQHQLLITK
FT                   ANDLLLLTTQSADCETLAAAVDDALLHVAEHFRDEERALREVGFDGLEEHAAEHERLLQ
FT                   QGLALARECNEGVSPADAIIRFIVHDLVMVHMLAVDVLYHHCFEEPAGPNLA"
FT   CDS_pept        258343..258828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02420"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73733"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF3"
FT                   /protein_id="BAH73733.1"
FT                   /translation="MERPITRFLALAALAILAVWTPSNLAAGSTPAGAPRYVGSAVCAG
FT                   CHPGQYERYRQYSKKAHSSRGIKLMAKGLTPEELASCYGCHTTGYGKPGGFTDFTATPE
FT                   LADAGCEVCHGPGAEHVATSDPAAIKGKLTVADCAPCHDDPRVRSFGYKPLLQAGAH"
FT   CDS_pept        258762..260717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02430"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73734"
FT                   /db_xref="GOA:C4XGF4"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF4"
FT                   /protein_id="BAH73734.1"
FT                   /translation="MPRRSPSALLWLQAPAPGRSPLTSHLMKAAPAPAARRRTAMRRPI
FT                   RSIRVKALALVSLIAALALGGLFWANAAWQRQAAFSRIRQVGAAEAELVRLIVDEPMRV
FT                   GDNAATTAQFAKIASGGSRLSVALADYRGQVTYATDAASLRRPLAEAMPGPALAGLLRE
FT                   ALEQGRDGDGLETAGGRTGYATVRAVKNAPECHHCHGASREVLGALVTVADVSPDMAAL
FT                   ADNQLRTGFLSLAGLAGLVAGLLLFMKRAIIDRLAFLAGVSRQIADGDMEACRAVADRN
FT                   ARRRARNAADEITVLGESLCDLVDNLRAKIAEADDKTREAACQADRAGVCLAEAEAARE
FT                   AAASARREGSTAAARTLEAVVDHLSEASVALAEAVARADSGARTQKDAAQETCAAIGVM
FT                   QTVAAEAVATAGKAAAVSGQARDRAGLGAEAVRELSVCIEGLRDLAETLRRDILALGRE
FT                   AEGIGAVITVISDIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMTATKD
FT                   VERAVTGIQAGARDHVGSVQKAVAAIGAASELAGRSGEALSGIVGLVADATRQVGAIAD
FT                   SCQEQSGIIDEIGRALEGISAISQETAEAMATADAAVSRLADQAERLTHLTDDMLAEET
FT                   SAASAAPGTCSGRDLG"
FT   CDS_pept        complement(260849..261838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02440"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73735"
FT                   /db_xref="GOA:C4XGF5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF5"
FT                   /protein_id="BAH73735.1"
FT                   /translation="MESIDASVIVPTCDRPEELREALSSLAGQTHGNFEVVVVNDGGGD
FT                   VSGLVAEATASLGGRPVRLAPRGKCSGPAAARNRGLAVARGAVVFYLDDDDVFFPNHVA
FT                   VHMAAHAAAPEASAVYSDARRGVVSRDASGRESVAWSVPHSREFDPDALLVANYIPVLC
FT                   LSHRRERLTQAGRFEQALPCLEDWDFFIRLARLGPFVHLPEATAAYFERGLGTSVQERS
FT                   GTEFIETLLRVYARADALYPHDKARLDRVWQGRLAHIAAMAEATARRCEAAGDWSGAAM
FT                   AWENAARHAPTPERYLALARVRKRLGQGQKALVAMQLAAACRDLVGGK"
FT   CDS_pept        262561..263076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02450"
FT                   /product="respiratory-chain NADH dehydrogenase 24 kDa
FT                   subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73736"
FT                   /db_xref="GOA:C4XGF6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF6"
FT                   /protein_id="BAH73736.1"
FT                   /translation="MQTSTCQAIGECRMPEHAVLPQPLYREVVQFIDALPQKEGHLVTV
FT                   LHKAQSVFGYLPIEVQQFVADHMEVPLAQVYGVVSFYTFFTMVPKGKHPISICMGTACF
FT                   VKGADKVVNAFKEQLKIDIGDVTPDGKFSIDTLRCVGGCALAPIVMVGEKVYGNVTPGQ
FT                   VKKILADF"
FT   CDS_pept        263114..263494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02460"
FT                   /product="putative NAD-reducing hydrogenase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73737"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF7"
FT                   /protein_id="BAH73737.1"
FT                   /translation="MSTIASLDALRARREDILARQKARNGKIVINVSLATCSIAAGGKV
FT                   ALEAMQDEVALNGIANVEFMQSGCMTFCYAEPTVEITLPGKAPVVFGGVDEAKARELVT
FT                   EYVMKGEPVEGIIPVTYERVVL"
FT   CDS_pept        263514..264986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="DMR_02470"
FT                   /product="NADH-quinone oxidoreductase chain F"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73738"
FT                   /db_xref="GOA:C4XGF8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF8"
FT                   /protein_id="BAH73738.1"
FT                   /translation="MAATTDIKQLRIATRNCGFIDPESLDDYIAVRGYEALAKALTMTP
FT                   AEVVEIIKVAGLRGRGGGGFPTGVKWGIALSNAADQKYIVCNADEGDPGAFMDRAVLEG
FT                   DPHSVVEAMAIGGYAIGATLGAVYIRAEYPLAIKRLRKAIDDARAMGLLGKNIFGSGFD
FT                   FDIEIKYGAGAFVCGEETALIKSMEGHRGEPVSKPPFPAQSGYWAKPTIVNNVETFANV
FT                   PAIIIKGADWFAGIGTATSKGTKVFALAGKIVNVGLIEVPMGTTLREVIFDIGGGCPDG
FT                   KEFKAVQTGGPSGGALANKDLDVAIDYESLIARKSMMGSGGMVVMDEDDCMVSVAKFFL
FT                   DFTMDETCGKCTPCRIGSKRLYEILDKITKGHGTKADLARLKSLSDNIKDTALCGLGQT
FT                   MPNPILSTMDTFGHEYEAHVTQKKCPAHVCTAMLTYTINPAKCTGCTLCTKVCPVECIS
FT                   GTKKQPHVIDASKCIKCGACYDKCKFDSIIKM"
FT   CDS_pept        265005..266762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02480"
FT                   /product="Fe hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73739"
FT                   /db_xref="GOA:C4XGF9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGF9"
FT                   /protein_id="BAH73739.1"
FT                   /translation="MSMLTVHIDGKTTTIPAGGTILDAARKLDIDIPTLCYLNLEDLKV
FT                   NNKAASCRICVVEVEGRRNLAPACATPATDGMVVKSNTLRVLNARKTVLELLLSDHPKD
FT                   CLVCAKSGECELQDLAEKFGIRESPYDGGEMSHYRKDVSPSIIRDMDKCIMCRRCETMC
FT                   NDIQTCGVLSGVNRGFTAVVAPAFEMNLADTVCTNCGQCVAVCPVGALVENDNSWDVVD
FT                   ALADPDKVVIVQTAPAVRAALGEDLGIAPGTSVTGKMAAALRRLGFDHIFDTDFAADLT
FT                   IMEEGSEFLDRLTRYLGGDQTAKLPILTSCCPGWVKFFEHNFQDMLDVPSTAKSPQQMF
FT                   GAIAKTYYADMLGIPRDKLVVVSVMPCLAKKYERARPEFSVDGNPDVDIVISTRELARL
FT                   IKRMNIDFASLPDEDFDAPLGESTGAAPIFGVTGGVIEAALRTAYELATGETLQKVDFE
FT                   DVRGMDGVKVATVQVGPHELRIGIAHGLGNARKLLNRVREGETFHAIEVMACPGGCIGG
FT                   GGQPYHHGDIELLKLRTQVLYAEDAGKPLRKSHQNPYIIELYEKFLGKPLSEKSHHLLH
FT                   THYFKRQRL"
FT   CDS_pept        267384..268895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02490"
FT                   /product="putative aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73740"
FT                   /db_xref="GOA:C4XGG0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG0"
FT                   /protein_id="BAH73740.1"
FT                   /translation="MLPKPPQRGSPTGWSGDRPAALVAFRGACSMRQDTDALGATALPE
FT                   GSLYGVHTARALANFPVSGQSVAPELLSAFAWVKAACALANQDAGHLDAARTSAIVAAC
FT                   REIAAGRHTEQFPVDALQGGAGTSTNMNVNEVVANRALQLMGRQPGDHEFLSPLGHVNL
FT                   HQSTNDTYPTALRVAALTLLKDLETAASRLQDALQAKEAAFAHVVKVGRTELMDAVPMT
FT                   LGMTFGAFAEAVARDRWRIFKCRERIKQVPLGGTAVGTGLGAPRAFIFKAAEHLRHLTG
FT                   LPVSRAENLVDATANADCFVEVSGILSAFAANLLKIASDLRLLASGPHTGIGEIRLPAL
FT                   QAGSSIMPGKVNPVIPECVGQAALTVMGNHQTVTLVAGLGQLEINQYLPLLAHKLLESI
FT                   RLLRDASTLFADKCVAGIEADETRCRELVEKSQALATVLVPALGYETVARLMAEAQAAG
FT                   RSLAAHLDAVGLLPQAEAATLLAPKRMRKLGFEEEDYKSLRRPGA"
FT   CDS_pept        complement(269083..270243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02500"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73741"
FT                   /db_xref="GOA:C4XGG1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG1"
FT                   /protein_id="BAH73741.1"
FT                   /translation="MYHVLRASILAAVAILALVVAPLADPAQALAKEQPAKSQAKPAAK
FT                   KSAKAETAPKAKKQAKAAKAAAPSKAPHPAKAALTDSPAQKPRRAKKGELPAKNDIENE
FT                   EGDIGACAVGSPLTVKSAILWNMNTGEVLYEQNPDVQIPPASLTKVLTLYILFDAIRQG
FT                   RLRPWDVIEVSPRAATQGGSNMRLRPGEQVKVTDLIKGIAVASANDACMAIADNLENGN
FT                   AEAFVALMNDTAKRLGMTNSVFFNPNGLPADGQVTTARDMLKLAAAYLEQFPKSLTIHS
FT                   MQFFTHNNRQRHNANSLLGRYEGVDGLKTGFVCASGYNIVATAMRGDTRLIAVVLGSRN
FT                   PRVRERETAKLLDKGFKMVQAKKAAGPTPVAAATPPATPAQAVGQP"
FT   CDS_pept        270583..272094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02510"
FT                   /product="putative sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73742"
FT                   /db_xref="GOA:C4XGG2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG2"
FT                   /protein_id="BAH73742.1"
FT                   /translation="MADTHDFPDIQERLLALEEAFADRNGYRFKKALSELRRSIKMRAN
FT                   AVALAQAEILDSRKEIERNRKQCVDLQAKLKTVVDRFEGSFTAFEKFRKAIRVVELMRG
FT                   HEDLPAVLDRIKDLFGLRAVSLLLDAGEYAPFEPPGARLAEAGALRAKLAELMPKGAGP
FT                   GPFMGSIRAVPDPEFFFGQGFCAERKVLLLGSCFIYPLRDKFSPQKLVGILSFFDSNPD
FT                   RYTSEKGSEFATHFADILGYTIVDVTDRKKAERLREDVERMTRHDLKSPLTAVLTLPQL
FT                   LRRDGNLTERQNDMLSLMQHAGYRMLNMINQSLDLYRMERGVYELSPQMVDILPILDNI
FT                   SGELRGVIEASDLALDVVVRGRPRQDGDAFAVRGEEMLLYTMLSNLIKNALEASPPGQR
FT                   VAVTLAEGRTLDVAVHNAGAVPASVRQRFFTKFATAGKKDGTGLGAYGAKLIAETHGAK
FT                   IAMATSEQKGTTVTVSFPKPRTPANAQTNTNTNTKAKMPPAAGRG"
FT   CDS_pept        272152..272589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73743"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG3"
FT                   /protein_id="BAH73743.1"
FT                   /translation="MVAAWRGQEGSMFARCVMALALALAVPATAALAQSQAAYNAAACA
FT                   ALKKADAELNAVYTAVLKKNADDKNFIDKLKVAQRAWVAFRDAEMAARYPARDKGEYGS
FT                   AFDLCWCNGLAALTQQRTEQLKPWRDGIPEGDVCTGSYPVR"
FT   CDS_pept        complement(272624..272995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73744"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG4"
FT                   /protein_id="BAH73744.1"
FT                   /translation="MPDPTPPPRVTSPDAEPVRASQAAPPIQGQGSGPLPGAQSGADGS
FT                   ATSGREFGDSGFAQSRQTAVLTSLAGAVSTAAATGAAPPDGTAAGNAAASARTLRAYDR
FT                   AGASTSATVAPGAMFTARA"
FT   CDS_pept        273141..274199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="DMR_02540"
FT                   /product="cobalamin biosynthesis protein CbiG"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73745"
FT                   /db_xref="GOA:C4XGG5"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG5"
FT                   /protein_id="BAH73745.1"
FT                   /translation="MAYAFSMNASTPGDVAVYAVTAKGLALGRALARELPATLYAPARL
FT                   ADGGAVPFASLSELVAETFHQRRAHVFLCACGIAVRAVAPHLRGKAVDPAVVCLDDAAT
FT                   FAVSLLSGHLGGANDLARRLAGLTGAVPVVTTATDAAGAPAIELLARDAGLFLDNPVAT
FT                   RRVNAALAAGEPVAVFDPLGAFTPPEAAARHFVWLADPAGAGPDEPLVVVDWRAGPETP
FT                   TRLYLRPRVLAAGIGCRKGASAEAILELVDAACRQYRLAPAAIGQVASIEAKRHEPGLL
FT                   EAARRLGAGIVFFSADELSGISVPHPSAMAAKHMGVESVCEAAAILAANRGRLVAPKTK
FT                   NAVATLALALAR"
FT   CDS_pept        274100..274945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiH"
FT                   /locus_tag="DMR_02550"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73746"
FT                   /db_xref="GOA:C4XGG6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG6"
FT                   /protein_id="BAH73746.1"
FT                   /translation="MRSGGDSGGKPGQARGPEDQKRRGDAGPGPGALTVVGLGPGDAAL
FT                   LAPMAEAALAEAGVVVGYGPYVDLVSPALLAGKDVVATGMTGEVARCRAALEAAAAGRR
FT                   VVLVSSGDAGVYGMAGLALEMLDAMGLPQALDFSVVPGIPAVCAAAALLGAPLTHDFAV
FT                   ISLSDLLTPLPVIEARLEAAFAADFVVAIYNPRSRKRSGHLAEALARAARHRDPQTPVG
FT                   MVKNAFRPAQEIRLTSLAQADPDWADMLTLVVVGSTSSRLAAGRFLTPRGYAGKYALEG
FT                   "
FT   CDS_pept        275065..275451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02560"
FT                   /product="cytochrome c3"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73747"
FT                   /db_xref="GOA:C4XGG7"
FT                   /db_xref="InterPro:IPR002322"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG7"
FT                   /protein_id="BAH73747.1"
FT                   /translation="MRKALVSCLMCASLVGFVGLPMVHAVDAPADGEIKAPEGMPATQS
FT                   PVKFSHKGHAKIDCKACHHKGEATQKCSSAGCHDSLDPKDKTSDKSFYRAFHDMKSEKS
FT                   CMGCHKKEAKGPTKCPECHPKKGA"
FT   CDS_pept        275531..277762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73748"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG8"
FT                   /protein_id="BAH73748.1"
FT                   /translation="MASDKPLPDTDDDIIDLTDLVEEGGAGNGAADDGVDMSFEQELDD
FT                   LFGDSEPLPAKAPPAAAAPADAAGEDDLFDLAGFEVDDAPKAAAASDGEDDLIDLAGFE
FT                   AEDAAPKATAAAADDDAIDLSNFGLDDDADDPLAGLGDDKPAPPAATPAMSADEDDALD
FT                   LVGLGLDDDAAPDAATPDLSDVSFEDLGPGDAAKAAAADSLDDIDFGDLDAAPAETAAS
FT                   APDGDESMDLADLDFETATPEADVTGEPEAVAAVLADIDGDEAPKAVSDADIDALLAEP
FT                   GDDEPLPDLLGTLPDVPEDDDTLAAFDAAPDKPAPRDSLPEADDLTDFADLPDVDELPA
FT                   EAIPLAVAAAAAVGAAAMPAVVARAQAGPSVGGIDLGALDNLIDSSKAPAVEAETPAPD
FT                   KALAGRIAALEAAAADLAGRLDALPPPPDENALAVALAGRLESALTLRVESLLAKYEPA
FT                   PDASSLKDDILAEVRASLEDHRAALLAELPPPAAAPSGDLDAALERLRESLARLEALGQ
FT                   GRHTQFEDFARSMETSLAELRRELPDPEDFVTAKRLAEALDGLGETLAASLDGRFEATA
FT                   EAARQEVQTLAASLDERLADLAETARQAAVAEIHNLDARFDALAETAVATARQEAYTLA
FT                   QALEPRLAGLENERIDPVALAATLRQNLLADVAPASALDNLAAAVDAAAQDARDALNGL
FT                   GGRVTPGDLDAALNTLRANLLAELETAVPKAAAAVIREEIAVLLQEFAG"
FT   CDS_pept        complement(278258..278770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73749"
FT                   /db_xref="GOA:C4XGG9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGG9"
FT                   /protein_id="BAH73749.1"
FT                   /translation="MPCSIDSVCPWRKVFLPLGAKRPAPGIVRRPARGLPIGNKTGDLR
FT                   RAGPGPPAAPITRLRPLRETTMLRNIPAVLAVLALALAIGGCSAKSAKPAKQTYINIDQ
FT                   VFAAYDANGDGKITKEEFTAKFQQKQKADTAWKKIDKSSNGFVERTLNDDEPLRVWNDV
FT                   ESQNEPY"
FT   CDS_pept        complement(278760..281015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73750"
FT                   /db_xref="GOA:C4XGH0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH0"
FT                   /protein_id="BAH73750.1"
FT                   /translation="MDRALCIHGHFYQPPREDPWLGRILPEGSAAPAVHWNERICRESY
FT                   APMARARRQDGAGRIVELFNCYSHMSFNAGPTLMSWMARSAPDTYARILEADRESLARL
FT                   GHGNALAQIYHHVIMPLATERDKRLEVAWAVDDFKARFGRDPEGMWLSETAVDTPTLEA
FT                   LAQAGIRFTILAPSQATAISDNGRDWRGVDAGSLDIRRPYAVRLPSGREIAVFFYHGPL
FT                   SQAVAFENLLADGEHFFRRLSESAGGGLLSLATDGETYGHHFKFGEMALAYALDKAKSG
FT                   RDGLTLTNFAAYLAANPPKAYAKIREASAWSCAHGVERWRSDCGCTAGDHPGYNQRWRA
FT                   PLRNALDLLKSRLDSHYDAKAGALFKAPEAALDAYGQVLAGTQSKEGFERLHMAPSADA
FT                   VRRGAAWKLLSMQAWGLASFASCAWFFDEISRLEPVNAMTFALRAVELARATGMADPEP
FT                   EILTILAQARSNEPAMGSGADIWETMARPRRETPKTLITQALVTLALENRLPLGGEEAA
FT                   ATWPGVAVTVRLENAPAGAPRPGAAAIVYRHETAADRYELTYTPAPTANPFAACAAIRP
FT                   ATGGVEEGFAFEAVGLPVNKRQALADAFSRHHAEVFHAENLAAAAVARSLVTERQEAQN
FT                   TLTLAPLVLHLWPGLLWLEVFEPPLPPKKRELLHLFLKHTGDGSPVKAALEARIAVEAA
FT                   RLIELPDPDWRLLARLTRHAAELGLHPDWWAAQNALWQRRPFTGPARELAEALGFAV"
FT   CDS_pept        complement(281020..282501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73751"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH1"
FT                   /protein_id="BAH73751.1"
FT                   /translation="MATLAARLFGLALLALAAWLSLAASPAEAAKPPEFRGIPFGAPLA
FT                   DVPGLVPVLDAGPVALFRREAEKPAFGEDCPTTVRYGFSRGKFFFVRMHLAGCEELGHI
FT                   IAAYEAKYGRPAREGAPGWTRLVWRQPTLAVSLSHDAREGTTDIDYVYLPDLSHDERDT
FT                   WQSLDDVRAHGPIGFRGIRFGRDIESLPEMAEAYREGAAVYYRRAGERLELGETRLGDI
FT                   LYGFYQGKFFAVLMRADAGVDFEALRQAYAAKYGAPRAIAATLEEELVWSWPAAQIALS
FT                   RDTAAGGLAIRYADAARLAQVVAAETAAGAPPSLSGGLRIFSKGDPPRSFRGAAFGSPE
FT                   TALPTGEFLFTHRGRRYLRRADERLNLGDIPLISVVYAYDAGKLAGVALTIAPSGSDPK
FT                   ADYERVLAAYSAKYGPPVTRPEPDGATMHLWSWPGLSLALVRPAKGPLEVHYVDASLLR
FT                   RREAALAERALDALDRKTFAPPPRGENRIENPGQE"
FT   CDS_pept        complement(282505..283758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73752"
FT                   /db_xref="GOA:C4XGH2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH2"
FT                   /protein_id="BAH73752.1"
FT                   /translation="MATPCSLSPGSRVVLCRLPVPHLQPQGRTGMRFPLFPAKIALAVC
FT                   LPAVAALVLGLFAVSRLDGLAARSKTLETARLPRADLAVAVERRLLLAAQAIRGYALSG
FT                   DRDALERAKKDLGQAADALHAAREAASRPGMESLAAEAQKIGFLLDTYKKAAESAAAAN
FT                   ELVTRDRADLAAAQEAYAAAVAGYIEFKTAQWDKELAAKYPQPEPLRLHAKRLKTAQAV
FT                   QDAGRDVRLAAEAAKAERDPGRLSQALTRYDEAEALLREIKAGSDEENKRLAPVFAALA
FT                   TCRQAAGALLSDWEGLKSTGRQIIEAERAALAAGADLGGATLAEAAADASGLADAVRAS
FT                   RLLLGGAAWGICLVGIVFGLAVAFLLGGPVRRCAFFARDLAVGRMTGNLPVSGHDETAV
FT                   LAQSLREMARRIGKRLAR"
FT   CDS_pept        complement(283836..284597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="DMR_02620"
FT                   /product="phosphate import ATP-binding protein PstB"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73753"
FT                   /db_xref="GOA:C4XGH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH3"
FT                   /protein_id="BAH73753.1"
FT                   /translation="MSDTVKMASRALNFYYGRFKALQDINLVVYANQVTALIGPSGCGK
FT                   STYLRCLNRMNDLIAGARVEGELTLDGQDIYAPDLDVVELRRRVGMVFQKPNPFPKTIF
FT                   ENVAYGLRVGGIRDNTYISEQVEKSLRGAALFEEVKDRLHDSALGLSGGQQQRLCIARA
FT                   LAIEPEVILMDEPASALDPIATQKIEELIHELKKRFTIIIVTHSMQQAARVSDRTAFFY
FT                   MGRLIEEDATETIFTRPAQKQTEDYITGRFG"
FT   CDS_pept        complement(284644..286110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02630"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73754"
FT                   /db_xref="GOA:C4XGH4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH4"
FT                   /protein_id="BAH73754.1"
FT                   /translation="MAGSAALGLRAAAVCVGVAALALGLSSLVPTTATPGQRLAANAGI
FT                   LALAGAVFWFFTRRLSRSLAEVVDVARAIGDGDYRRRLHLLPGGEFSVLAGAVNQMARG
FT                   IEANIATIVAQKTQLQAILDGMREAVMVLDAAGRVRVANPALARLAPIAANPLGRRPIE
FT                   VIPSPELQLACDRLLAADPAGPEAESAAEAVTLEARFGPGRVYEVSLVRLPGRDGAEAG
FT                   AVLVFHDVSETRKLSRVRRDFAANVTHELRTPLTSIKGYAETLLGAAPELAAEKRRFLE
FT                   VILKNANHMSKMVDDILNLARLEDGQGPAPDARAEAGAALADAVRECEPLAQARALELV
FT                   RALPEAGLAVACDQGQLAQVWRNLLENAIRFSPESGRIELAAAPDPDRGLVRCSVLDQG
FT                   PGIPPEERERVFERFYRVERHRSKTPGSTGLGLAIVRHIVERHGGRVWVERGRGEMAGA
FT                   AFHFTLPMAQPPKAEASAETAAPGPRTQAS"
FT   CDS_pept        complement(286114..286797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02640"
FT                   /product="OmpR family two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73755"
FT                   /db_xref="GOA:C4XGH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH5"
FT                   /protein_id="BAH73755.1"
FT                   /translation="MSKDSILIVEDDEDIVELLAFNLQSAGFAAETARDGYEGLAKARR
FT                   NPPAAVILDLMLPGLDGFEVCKELKRDPKTASAPIIMLTARGEEVDRIVGLELGADDYV
FT                   VKPFSPRELVLRLRSVLKRHAPEPEKRQVLARDGLSVDMAAHRVSLDGAEVALTATEFK
FT                   LLAELFQSAGRVLTRDRLLNSVWGYEFEGYARTVDTHVRRLRQKLGHFADMIETVRGVG
FT                   YRFKE"
FT   CDS_pept        286971..288293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73756"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH6"
FT                   /protein_id="BAH73756.1"
FT                   /translation="MGLGFHTSKISCVGRLDAKGMGRMADRLRKAAGVMLALVLALFGV
FT                   AEAQDHSPVVLGMTAGFSGPTRSMAVELYRGALACLESRSVLSAPGLRKVVLQAADDGY
FT                   EPGPAIENTVRFLTRDKALALFSQLGTPTVSRVLPVLRAYADQGARLFFPVTGLEASRT
FT                   APYVRYVYNLRASYRQEIDALVGAFVARGATRVAICHQADAFGRSGWDGARRALSRRNL
FT                   PLCGEATFARIATVADDMAAQAKVLSACNPQAILLVGPAPACAAAIRDFRQAGLDAAIG
FT                   VVSFAGGELLLRQLAAEGARLGVDLEHDVLFSQVVPDWRDDTLPAAHDYRQALADLGDR
FT                   QPPPGGWDTPASQAGSSVGFEGYLNARLFLAVLDAMADPDDRQGLDAAAAAIDQIDIGI
FT                   GRPVTLTGPNHQALDMVYLNTAKDGRLVPLTASLAVAETED"
FT   CDS_pept        288297..290768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02660"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73757"
FT                   /db_xref="GOA:C4XGH7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH7"
FT                   /protein_id="BAH73757.1"
FT                   /translation="MSRLFRKTLLAIVLVFGVSANATALLSAWLLHRHLTDEYVTKGRA
FT                   IAMAIAAASPDALVGGDAASVQAMIDEFLRIEGVGYVFVADRMGRIAAHTFLPAMPATV
FT                   PQVTVSHQEAISIDDAVIPDRGDFIQVTAPILAGEAGQVSVGMDKAGIWRVMREAVIRQ
FT                   EVLMLAMFAVAVVIFYALVSGIARPLAALAEYAVKIRDHDFSATPPPASDDEVGVLARA
FT                   MGSMAGQLSVLVSNLKQAVADTTRELNDSLAHIQAIIDNLADGLLVVDDAGRATLHNPA
FT                   LLAMFGLTGTDPAGRWVRDAFPPAMAALAASCLSDKACPETEVALSGGGTGKVVATSFR
FT                   LPGQARTAVILLVRDVTVEKEVDRMKTEFISTVSHELRTPLTSVLGFAKIIRRKFLELV
FT                   VPALPPGDARVARGAGQIRENLDIIVAEGERLTELVDDVLDIAKMESGRCEWDMEPVSL
FT                   AAVADHAVKAAAPLAARKGLALTADIASDLPAVMADRDRLVQVLLNLIGNAVKFTTSGW
FT                   VRLSAVAVDGEVRVAVADSGAGIAAKDLETIFEKFKQAGDTLTEKPKGTGLGLPICRQI
FT                   VERHGGRIWAESVPGQGSVFRFILPALAGQAAKTAEAACPARAAPATRGDASRVLVVDD
FT                   DAAVRRYLETVLAEGGYAVATASGGVEALRLAAAWKPGCITMDLHMPGMDGREAIRRLR
FT                   AEPATRDIPVMVLTVASSRERAASGADAVLAKPVDEEALLAAVRNLLEGPGEDDARPCL
FT                   IYADDGGRRLSRRFLLCPGEVTSVGEEPGLWQALDKGFCGTVFVPASRGHDLDLGKLSA
FT                   YPGVCVIIIPD"
FT   CDS_pept        290997..291335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73758"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH8"
FT                   /protein_id="BAH73758.1"
FT                   /translation="MPIYEYKCTKCGKEFEVLQRSFDVDEAPCEHCGAPGKRFMSNTSF
FT                   VLKGTGWYVTDYKANGGCSASGNAANGSNGSAKPADAPAAEAAAPASPCASGGCSSCPS
FT                   ASASSADA"
FT   CDS_pept        complement(291654..294254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02680"
FT                   /product="aminotransferase CobD/cobyrinic acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73759"
FT                   /db_xref="GOA:C4XGH9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGH9"
FT                   /protein_id="BAH73759.1"
FT                   /translation="MKEKAFPHGGNLRALAAEAGRDPSEILDASASINPLGPPPWLRDV
FT                   LSAAVADLVHYPDPDCTALLEAASARYGAPASHFVAGNGTSQLLFALPRCTGLARAVIP
FT                   SPAYTDYAVACHKSGMDVRRLPGSEFDGFAPQLDRIEAVLRSPSLVVIASPANPTGVVT
FT                   DATAIIELAGRHPQSLFLVDEAFADFVPGFTSLAGEDRPHNVAVLLSLTKSFAIPGLRL
FT                   GLLAASPDLADWVRRTLAPWSVGTLPQAVGLRALADRTFLEDTRAALPGLRQRLAEGLA
FT                   GLGLTVFPSQANFLLARLSLSGPNAPEVCRRLLTEHGVALRDCTNFSGLSDRYLRLAVR
FT                   PEAETDRILDALAAVLAACPMPASRPRPKTPALMVQGTTSSAGKSVLTAGLCRLLARAG
FT                   YKVAPFKSQNMSLNSGVTADGLEMGRAQIVQARACRLAPDARMNPILLKPTSDLGSQVI
FT                   VLGKPVGTMRVADYIAYKPTAFAAAREAYDALAGQADVMVLEGAGSPAEVNLKAHDIVN
FT                   MAMARHAGASVLLAADIDRGGAYAGLLGTMECLPEAERALVAGYVLNRFRGDATLLAPA
FT                   NDYLAQRTGQGVLAVVPFLSDLGLPDEDSVTFKDGQSLPDTPPADPTLLDIAVIDLPHL
FT                   SNATDCDALAVEPDTRLRRVREAGKLGRPDAVLLPGSKNTLADLAWLQDSGLAAALTTL
FT                   AAAGTTEIVGICAGLQMLGETVADPLGLESDRGHTAGLGLLPLTTRLAAEKTLTATDAV
FT                   HTPSKLPLHGYEIHHGITIIQGDAAALDIIAARADGQPLAYARKDAPIWGAYLHGLFDA
FT                   DAFRRQFLNTLRQRRGQEPITRLTPYDIDPALDRLADVLEERLGLATVRRLLGL"
FT   CDS_pept        complement(294255..295352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73760"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI0"
FT                   /protein_id="BAH73760.1"
FT                   /translation="MTAKEAAAMRFATAAFGIILACCLLCPANAPAAQAAPPKFALALA
FT                   ASAAGRLDDALAAVEQSAKSLGAAYKELFRATPAMVPEDRGRLLQSYAVKDGTVAFRDL
FT                   QGPCGPDPAAKAPCQSLYFYDGENFSDNLFRELAALGSLAPAMAAGYGALPYSWVYLTT
FT                   PDQGFAIYPTLPLVEAVNNYKPTDKDFYTAADFAAKACGWQSPYLDLAGDGMMVTVSCP
FT                   VYDGETLLAVSSRDVTISQLSGRVMADLAAIPGARAFLMNRRGKAIAVSDPRLAAAIDA
FT                   INAKAEEAVVYFRADRGLAAMGLEKAEDSPDDGLNAIGEAVIERAETEKKWPMAFVSGK
FT                   DMVLAARLRATGWHLVLVMPQKAVN"
FT   CDS_pept        complement(295349..295801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02700"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73761"
FT                   /db_xref="GOA:C4XGI1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI1"
FT                   /protein_id="BAH73761.1"
FT                   /translation="MTDAPAPQPAASAAPDARPYDLTNPQVLLAWQRNHLANERTFLAW
FT                   CRTGLALFGFSFVIERFDFFIRQLQNVPMFEGMAHKHLHTETVTLSTFGVGVLVMVVAV
FT                   WRFWYIRRCINTGAKTFSPIPDIVFTVAVVGMILGLFSVFWHLIMQ"
FT   CDS_pept        complement(295967..297607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="DMR_02710"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73762"
FT                   /db_xref="GOA:C4XGI2"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XGI2"
FT                   /protein_id="BAH73762.1"
FT                   /translation="MAAKEILFDSKAREKLKRGVDKLANAVKVTLGPKGRNVVIEKSFG
FT                   SPIITKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIFTEGV
FT                   KLVAAGRNPMAIKRGIDKAVASVVAELETLAKPTRDQKEIAQVGTISANSDATIGNIIA
FT                   EAMNKVGKEGVITVEEAKGMETTLDVVEGMQFDRGYLSPYFITDPERMVCELDEPLILI
FT                   NEKKITAMKDLLPVLEQVAKMSRPLLIVAEDIEGEALATLVVNKLRGTLQVCAVKAPGF
FT                   GDRRKAMLEDIATLTGGQCVSEDLGIKLENMTLADLGKAKRVIVDKENSTIVDGAGDGD
FT                   KIKARVKQIRAQIEETTSSYDKEKLQERLAKIVGGVAVINVGAATETEMKEKKARVEDA
FT                   LNATRAAVEEGIVPGGGVALVRCVKSLTGIKAVDDDEQSGIEIVRRAIEEPLRQISGNA
FT                   GFEGSIVVAKVRDGKDGFGFNAATGEYEDLIKAGVIDPKKVTRIALQNSSSVAGLLLTT
FT                   EAAIAEKPEPKKDMPPMPGGGMGGMGGMY"
FT   CDS_pept        complement(297664..297954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="DMR_02720"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73763"
FT                   /db_xref="GOA:C4XGI3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XGI3"
FT                   /protein_id="BAH73763.1"
FT                   /translation="MKLKPLGDRVLVKRLEQEEVTKGGIIIPDSAKEKPMKGEVIAVGP
FT                   GKLAEDGKHLKMHVEKGDLVLFNKYAGTEIKVDDEDFLVMREDDILAVIEA"
FT   CDS_pept        298405..300324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02730"
FT                   /product="Ech hydrogenase subunit EchA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73764"
FT                   /db_xref="GOA:C4XGI4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI4"
FT                   /protein_id="BAH73764.1"
FT                   /translation="MLDTLVFVTVLLPFLVAAVLLVLREQNVRKVILVATAGVLILASL
FT                   AMLRGGAFIMSPAPLWGSLVTLGDFLILAVVLLVGLKRKNQIIVWLTVAQIVGLIWFDF
FT                   FMIQDHGATPAFFADDLSLVMVLVVSIVGSLIAVYGIGYMKEHEEHLHLTTSKQPQFFF
FT                   FIVLFLGAMNGLVLANNMLWMYFFWECTTLCSFMLIGHDDTEIARKNAERALWMNVLGG
FT                   TAFLFGVMLLYKVTGTLSLQEILARGPEFAVAGGAILVPMFLLVFAGMTKAAQAPFQSW
FT                   LTGAMVAPTPVSALLHSSTMVKAGVYIIVRLAPIYAGTYFSNFVALFGGFVFLATACLA
FT                   AGQSNGKKILAYSTISNLALIIACAGINTPAAITAAILLILFHAISKALMFLCVGAIEQ
FT                   KIGSRDIEDMRGLFARMPRTALVAVIGILTMMLPPFGMLMAKWMAIESAHGQFLLMIML
FT                   ALGSGVTVLFWCRWAGLMLATPFAKAAPEAQDSTIRGPLYLLAGLAVVLSFFSPLVYNG
FT                   LVAPVVAMYYKTAPYVLRFGNFESSTGVFLVYPLFILLGLGFFFALRQTRKITAAQAVG
FT                   PYMCGEQTAVDGKPGFLGPLGQNVTAVSGNYYLEQFFGEAMLSKWINVIALAVLVIMLF
FT                   GGAL"
FT   CDS_pept        300324..301172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02740"
FT                   /product="Ech hydrogenase subunit EchB"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73765"
FT                   /db_xref="GOA:C4XGI5"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI5"
FT                   /protein_id="BAH73765.1"
FT                   /translation="MTKILLAVLALVAAPILGALITGVDRRITAWLQSRYGPPILQPLY
FT                   DVLKLLGKQPMLVNTWQALCAYVYLVGAALSVVLLFTGSDLLLIFFVLTIGAVFLVMGA
FT                   LASPSPYSQIGGQRELLQMLAYEPLLILVFASIAMVTGSFKVSAVFELSRPMLYDLPLM
FT                   FIVLGYALTIKLRKSPFDISASAHAHQELVRGVYTEYSGPYLAMIEIAHWYEVILVLGI
FT                   CALFWSTSFVGMIVLVALTYMAEIIVDNVTARLTWRVMLKSAVGMGLVLTVVNLLWLYA
FT                   Q"
FT   CDS_pept        301203..301646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02750"
FT                   /product="Ech hydrogenase subunit EchC"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73766"
FT                   /db_xref="GOA:C4XGI6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI6"
FT                   /protein_id="BAH73766.1"
FT                   /translation="MLGNLINQGRIKSPWVVHFDCGSCNGCDIEVLACLTPLYDIERFG
FT                   ILNIGNPKHADVLLVTGTVNQRNKHVLKNIYDQMPTPKAVIAIGACGCSGGVFREAYNV
FT                   VGGVDKVIPVDVYVPGCPARPEAIIDGVVAALEKVKKLLGMTA"
FT   CDS_pept        301703..302068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02760"
FT                   /product="putative Ech hydrogenase subunit EchD"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73767"
FT                   /db_xref="GOA:C4XGI7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR012179"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI7"
FT                   /protein_id="BAH73767.1"
FT                   /translation="MLETIPLSLDQVAAVAKECFDDGWRQVTMSAVDCGEAGFEILYHY
FT                   DKDLVMKHYRLSIPKETVVPSISPVYFCALLIENEIRDQFGICFSDIVLDFGGALYLEA
FT                   EVRAMPFCKVSVAEKQS"
FT   CDS_pept        302081..303157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02770"
FT                   /product="Ech hydrogenase subunit EchE"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73768"
FT                   /db_xref="GOA:C4XGI8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI8"
FT                   /protein_id="BAH73768.1"
FT                   /translation="MARTILPFGPQHPVLPEPLHLKLTIEDEIVVEALPTLGYVHRGLE
FT                   KLCEVRDFNQMIQIVERVCGICSCLHALCYCEGVEQIMGVEVPRRAKYLRTIWGELHRV
FT                   HSHLLWLGLFADAFGFESLFMQFWRVRERIMDIMEATCGNRVVVSVNVIGGVRRDLTPE
FT                   QCKWIEEQVAIAEKEIRQLTSTILNDYTVKKRCCGKGVLSKDQAYQLGAVGPMLRGSGW
FT                   AQDARQTGYAAFGELGFEPIVEFDGDCYARSAVRFRETLQSLDLVRLAIARLPEGEIAA
FT                   KVKGKPQGETVTRVEQPRGELLYYLKADGSKHMDRVRIRTPTFANIPPLLAMLPGCELA
FT                   DVPVIVLSIDPCISCTER"
FT   CDS_pept        303175..303537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02780"
FT                   /product="Ech hydrogenase subunit EchF"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73769"
FT                   /db_xref="GOA:C4XGI9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGI9"
FT                   /protein_id="BAH73769.1"
FT                   /translation="MFNMTKNVVANLFSKSSTRLYPFAVRGHFEGFRGTLNINIDECIF
FT                   CRTCMIKCPSQCIAVDNKAGTWTCEAMSCVYCGVCVDVCPTGCLSMSKEHRPVATEKQT
FT                   MAYQGVPKKKKKEAAE"
FT   CDS_pept        303632..305341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73770"
FT                   /db_xref="GOA:C4XGJ0"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ0"
FT                   /protein_id="BAH73770.1"
FT                   /translation="MRDIPAAHWCGRAIAWASCAVFLLFLLLHLGIHGYWALTDTTPPD
FT                   VVEPRAYANVLGDLEPRLSVVAREIPGLPYAVGIDAEGWRRTGPPSRTPAPLRILCLGD
FT                   SFTYGVGVADREAYPALLETYLRKRFPARGVSVVNAGVPFYDIFDELSYYREKGRLLRP
FT                   DLVIVQFYANDLEAMAGSFFREDLKVRQGGRYNPFDQGLGREKVERVLISWFETHLSWL
FT                   MDGLRNRSSSGGPSPAASGPFKAYHLQATPEEKRHLNDKAALLDAASLPAMERFWDNYR
FT                   EALLELRDAVRGDGAQLLLVLAPDVLQMRENKNAPGAALVEACRAAGIPVLDMTTVLRS
FT                   MSGDNPDLFYLTPKNNHPNVHGHTVMAKLLAESLGFDPAGRQRVEPAAAAFAYADPIVR
FT                   VLRFSPEGIAAERQEPMTVVPVRSDNLAFFDVTMEGGNHISGLRPDLRFKPTGELVVRI
FT                   DADMPLDMVSVTLFRRVFPPVNGFVQLSWSRDGTRYEQLQFVSDSAGDGAAGFENGRLS
FT                   EIDLRQAPCARLYLRLVVHNEACVFGETSDPPWRRFEIVGYPSQALYPRSHR"
FT   CDS_pept        complement(305320..306183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="DMR_02800"
FT                   /product="putative DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73771"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ1"
FT                   /protein_id="BAH73771.1"
FT                   /translation="MLAATDSLPYGVAPRQAQVLAGLDSLARAMPQALILEGGTADERA
FT                   AMAMWLAARLNCGAHQPPCGVCPVCIQIRDFVFKDLLYFDGGLETIKVADMREVRALVG
FT                   EPPRGAGWRVVILAQAQALTDEAANALLKAMEEPRPGNAFVLLTPQRERLFPTLVSRSF
FT                   VLTLAWPDASRPLPAGGEDDPWPIIDALYAFWRSGRGWFTGVKGRPSRLIAERVLTELA
FT                   RELAACLAGRTDTPLAGRLAACGEPDVPRRLDLLLAECQEALVAQVNPAVVLDRLATRV
FT                   YLWLRG"
FT   CDS_pept        complement(306692..308383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02810"
FT                   /product="sulfate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73772"
FT                   /db_xref="GOA:C4XGJ2"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ2"
FT                   /protein_id="BAH73772.1"
FT                   /translation="MQRHAQNLLVHHRRAGELRQESAGFPSHALRQDQLLGLELLLTGA
FT                   LYPLTGYLSREAVQSILETLRLPTGELVPMPASLDIPAELGRGLSPGDKLALRDPEGFM
FT                   LAVLTVADAWPDDPARHALALFGARTLAEHPAAAEYAATLHPWRVAGEVEGVALPQHPD
FT                   FTDLRLSPAALLEGFARRGWRAVLACQFAGILTEPDRAAFEAAAAAAGARLLLLHTVGD
FT                   AMTGGPGHFAAVRCARLTAAALPKNAAQLALLPMPSLAAGPRQALFEALVQVNLGASHV
FT                   LARPGYADPFPGNGSRYYPEQAAPELLRAHAAEAGYTVVEAPAMAYAPSQGRFLPAASL
FT                   APGEAAPTLDQENIRRRLAFDQDIPASTLLPDVAAELRRAFPPRSRQGLALFMTGLSGA
FT                   GKSTLAKLLYVALMELASRPVSLLDGDIVRRHLSSELTFSKQHRNLNIARIGFVASEIA
FT                   KNGGIAICAPIAPYAAGRQAARDLVAPHGGFIEIHVATPLAVCEQRDRKGLYAKARAGL
FT                   VTGVTGLDDPYEVPENPEIRLDTTDIDPSEAAQEVLLYLEREGYLG"
FT   CDS_pept        complement(308419..309009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73773"
FT                   /db_xref="GOA:C4XGJ3"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ3"
FT                   /protein_id="BAH73773.1"
FT                   /translation="MSRHSPTAIWREICLDSASTSKPHHDAKEHPMYDNASPSPRRRVA
FT                   SIAVAALVCLNLAALAALGLAVERGRAELAAVSDRLAALALADETATRDEPAALAEALA
FT                   ALDRKIDALAAASGHDAKTAAALAADVKTLSGRVEALAAKAQASRETAAAAKASPSKPQ
FT                   AQAAKPAAPKAGPKPNYAPMPAYGSGYAAWPVY"
FT   CDS_pept        complement(309006..309509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02830"
FT                   /product="putative chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73774"
FT                   /db_xref="GOA:C4XGJ4"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ4"
FT                   /protein_id="BAH73774.1"
FT                   /translation="MQGLLERFPDHQTAFLNVAQGILVNKPTLAHTVLGSCVSVTFFAP
FT                   RQGLSAIFHALLPRAADYRLHSPGDTPYKFVDMAIRTLVARMARRGVACSEIECKVFGG
FT                   ASALFAEEISVGRKNVETAFATLSDLGLRVAASNVGGMAGRKIVFSTSTGEIFVRMLNN
FT                   GAAK"
FT   CDS_pept        complement(309494..309955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02840"
FT                   /product="putative chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73775"
FT                   /db_xref="GOA:C4XGJ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ5"
FT                   /protein_id="BAH73775.1"
FT                   /translation="MPRALIVDDSRYQRHLIIQALGSLFTAEEAANGKEAIARFAAAQA
FT                   AGTPFDLVVMDILMPVLSGHEGLAGIRRLEESAGIPEEQRVPAVMLSSLDDPANMLRAQ
FT                   FESGAQAYVTKPFEPATLLETLASLGLVDNPLGDLDEAGPEGPSPCKAF"
FT   CDS_pept        complement(309975..311630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02850"
FT                   /product="putative chemotaxis protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73776"
FT                   /db_xref="GOA:C4XGJ6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ6"
FT                   /protein_id="BAH73776.1"
FT                   /translation="MADDDTLYELFAESCLEQLRGIETAILDLESAPAGELAGRVDAIF
FT                   RAAHTIKGDAGAIGAANLAALAHGAESVLELMRRDGRPADRQFVGELLGAFDDMRAMAE
FT                   NARNDASRDIAERLARLAALVQNTPSAAEQPAESGAEPEAEPEAEVDTDKAPGPAWADE
FT                   RIRKLAIPALELDVLVDRVGELGIAQARLSGLALRRADLELRGVAEEVERLSALLRDQV
FT                   LGLRLLPIKVSFPKYRRLVRDACASLGKDAALVMEGENTKLDKAVIEQLNAPCIHLLRN
FT                   AVDHGVEPAEVRAALGKPRQGTVTLSARQEGSDVVIAVRDDGGGIDGRKLWAKAVAAGR
FT                   IDAGRPFDPAAALELIFLPGLSTAEAVSDVSGRGVGMDAVREAIAALRGRLDVQSAPGA
FT                   GSTFTIRLPVSLAIIDCLEVRCAGEAYYLHLDYVEECLELPATAALAGTTGIMELRGLP
FT                   MPLLSLRRFFDLDRVEAHTPHVVTVRRDGGRAGLVVDAVIGRKQAVLKHLGRALGRVEG
FT                   VLGGTVTEAGDMALVLDVPGLLAAAKRQHDADNH"
FT   CDS_pept        complement(311720..313351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02860"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73777"
FT                   /db_xref="GOA:C4XGJ7"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ7"
FT                   /protein_id="BAH73777.1"
FT                   /translation="MSLTAKRVVVIGWDGATFDVAKPLMAQGRMPHLAALLARGVHAPL
FT                   CSTVPPVTPVAWTSFATGASPGRHGVCDALTLDPRTHEVRFVSAAQRRLPPIWRILSDR
FT                   GRPAGAANVPVTWPPDPVDGFVIPGMFTPSHVEDFTYPPEIRREVEAKFGTCRESPMLD
FT                   PDPAKYLANLLAGVDARCELTLWLMARRQLDYFCSVFMESDRVQHFFWGYRDPAHPRHA
FT                   ELGQAIEQVYERLDLALGRIVAAAGPDAAVAIVSDHGAGPLKRAIFLNRWLMDQGLLVL
FT                   SGDLARTLAGRRPPSGLRRLVAAAAKAVLPASVVEARRKARSAEHARINNLFSSIVDWE
FT                   RSACVSEGIAGGIFFNEAVVSPADRPALVARLKEGLAAIVDPETGAYPFSAVYAREELY
FT                   QGEGTPNAPDVVTLCGPGYQVLVPHEIALYAQDAPTGLFAGHKWSGRHEQYGVFALAGP
FT                   GIAAGVELADAAMPDVTPTLLHALGEAPTESMDGRVLAGAFTAETLAARPVAGAVAGAA
FT                   ATAPAAPDDAAAAAALAEELSDLGYM"
FT   CDS_pept        complement(313342..314823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02870"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73778"
FT                   /db_xref="GOA:C4XGJ8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ8"
FT                   /protein_id="BAH73778.1"
FT                   /translation="MAAPHVPPASDRRSLGRNFLALAVSRGLQALSGFFVLLAAARLLP
FT                   VDDFGRLGAVSALAGAAAALTYFGVQQVMIREMACFPATSGAVVGRAILLRAALAVAAG
FT                   LGLALAGVWSGYDGPLFGLLALAYALELCRSFGMLGCAVFQAHERMGFETPLAALSGLV
FT                   SIIAVGLALFLGYGVPGVLAGLLAAAALHAALAWRVAARLTTPSFAPDFPALRAMFLAS
FT                   SVVGLGVFFQQNLFRAGTLSLSWWADLPAVADFQAPHEFLLKLEIVPQALMLAVFPALA
FT                   RLAPTDFDTARRLFRLVFRHTLQGMALPACLLAVYAEPACQLLFGGKYAGAAPVMRLLA
FT                   LALPLLALDMLVNNLLVAIGRQRYALYYAGAALVLAFAANAFLVPRYGTMGAAGAALGS
FT                   YAWLLVFSLRFAARHGYTPLALGPALRTACAVAACLGAASLLRGSPVLGAAAATLAYGA
FT                   VILGLKGATRRDLAELRQIRQAGRDAARAKESPCP"
FT   CDS_pept        complement(314833..316767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02880"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73779"
FT                   /db_xref="GOA:C4XGJ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGJ9"
FT                   /protein_id="BAH73779.1"
FT                   /translation="MQHIVLALALNGLIFAGAGLGPMALLAPRLGALAVLALAPAAGYA
FT                   LYSTALTWWLLQEGTAGEAAWPLAGLLLAVSAACLAACRATIGPRLAAVSGKRLLAGLA
FT                   GLVLCLGFLLSPLAVGKKGYDVFRGNASDSFIYMFIARYFDEHPRAWAFEQTPEAVEAA
FT                   GPMLVPAQSMLSIRWTSGAMLTAAARLGGLGIVEYQYAFTLTSFVLLFAALLPFLAAMG
FT                   LSAPAASLSALALSTGYYAQMVLDIRAFSQINVLPLVALLALALSLPAPAGRRETLGRL
FT                   VLLAGCYLAAFVNYTEIFPMIVGASASYLVLRRALGRLPRAECAVHVAGFLIGMAATWP
FT                   VRFLWGHMLAQIQFTQGAPQLWSEAYFSWLYHNLPSGLFGLPLLEYGFSRLPGWGFCDL
FT                   PGWLVSVLGLGLCALFALGGLRAAADPDRRAPLCALTFSLASLAAFALFWLRGAPWVAG
FT                   KGLSYFYPMTAAVALYAALARPAGKPALPRPVAMAAVVLAGVFLAGQLVAAGLRPAYAA
FT                   LNIDYPRYVRNHGRYRVIDGNIAGLKDALARAGARQLAVCSADPWKWSFLGLSLDGPFQ
FT                   VVAPLALAAPDGPGAAEVFVALDRAPGGPPPELAGYRLAENATSVLYRMPREVWAGLLS
FT                   TLTCNTTPY"
FT   CDS_pept        complement(316778..317893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73780"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK0"
FT                   /protein_id="BAH73780.1"
FT                   /translation="MWSGMIWCKGRPRSGTSSRLGAGAVAPQSETACRHGMTDMKTLFG
FT                   LAAALLLAAALPASAETISFQGKAYCPIRYDINWPFSAKSKKAPTQGSGITANVYEMPK
FT                   EAVEEKSAADLGSDMRRLRIISAPVQIGQHVVEDQVLITYELPLENLMAEKQLVSRAEL
FT                   NGLEHAMSVVQFQLATIQNRQRELENMAGNQAVAVNEVANNARDIENLLLQRDFLEEKL
FT                   ELARQRYDNSVLLSQSKFGKEVDLKNLPRRGYVRAPGDGYILWLNSSLVPGMAFSKQAP
FT                   LVTIGKLDPIIVRASVHEIAMQKLKAGDPATVIFNAWPGEKFQTTISKVDYVAQPAMLQ
FT                   QPSFYLIELTLPNPDLRIKEGMRCDVVVDLH"
FT   CDS_pept        317971..318837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02900"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73781"
FT                   /db_xref="GOA:C4XGK1"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK1"
FT                   /protein_id="BAH73781.1"
FT                   /translation="MPACALPRSLAPLMLLAAAWMLVSCARPTAPPPAASSSKNPAAAS
FT                   AAAPARRAVLGYGDELLVAVWRHDDLKTAVRVDEAGRIQLPLAGEVTAGGRSVSELRAD
FT                   LTRAYAKYLVDPQVTVTAQSLRSQTALVLGEVKSQGVVSVDHDIVLFEAIARAGGFTDN
FT                   AGKSTVVLFRGMDTDKPQAYILDMKLGTGLGKGTAGFDRYLEGGDVLYVPKSTWANIDE
FT                   FLGHLNAVVNAFINAERLVIFLPQLRDAINDLSQGPVNQVNTVIQQSQPVAGEYLSNRQ
FT                   GGVTTVQ"
FT   CDS_pept        318839..321028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02910"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73782"
FT                   /db_xref="GOA:C4XGK2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK2"
FT                   /protein_id="BAH73782.1"
FT                   /translation="MELRLLLALLWRRRRLMLLVFGLVAGGLTLLTLVCETQYVASAKV
FT                   YLYHSSTKASLLSRVNLDSAMMGSASLTDAERATYEDLATIVPVLRPLLDELHLTRKRK
FT                   SLQLVEMVPLVRWAVDTWLPRFGRRPMTYEELTNKSIVHILFPRPYLKAAMMDDADILE
FT                   FSSSAESMELAMALANAAARSFMAREADMRHGECRELAAAAAAELPRAREDYEKALAEL
FT                   GKLRQREKIVDLTAEGEKLVERFYSLSNERDSNRLLLLKAQGMLANVKGQMAKRPEFRK
FT                   SGESIQRSSLIDSLKLTLRDLYMDLAVAKTRMTAEHPQVKEIEGKIEEAKRLIKGEAQK
FT                   VFGSETISTDPTFTFLNERAAEYTAQAAGLESQDAAYGSLLDALEGRIMAFPERAAAEA
FT                   LLKVRVAAGELFLSNLNQLHRAAVAGQALDLSIAHLVEAATPPGRLDDYMRPKLSLMLA
FT                   LGIVLGGFLALTAALLAAYLDSSLSPAGAAVLGAPVAGTLPRRSGLPRAQAVRRLRDAL
FT                   FPVSGRPPKVLVVADALPGPTQAMDVALELGAALARSGRSVVLVDADLTRPSLHARLGL
FT                   PLGPGLAEAVAGKVFRDAVILPGPESGLFALPAGQGALSPEAAEGLLDAPAVAGLLDGL
FT                   GRRFDVVLVATAPAGASGDACSLARHADAVLACLRPWVDDAAAVARATADLAAAAGRAP
FT                   RLVLVGAPDDEPSPRDVWADLLRRARHKRAAAPTA"
FT   CDS_pept        320971..323919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02920"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73783"
FT                   /db_xref="GOA:C4XGK3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK3"
FT                   /protein_id="BAH73783.1"
FT                   /translation="MGRPAAPGAAQAGGRADGLGPVRPGATLQKAVCAADGHHVARLWP
FT                   GPASPEPGRRTGLLHSWPGVIDPLAVKHLTENLRRPWPFLLFLLALAPRLHELGGPSVA
FT                   FYDELTTLMRAMEPSVADVVAGAAWQYPPFIDFQPPLHYVVVHLMLWFFGHSDFFARLP
FT                   SALAGAACAPLLFLIGRRLGGTACGLFAGAALAGCLYHVDVSQQVRLYALFGFFFLGAS
FT                   LFLLRALSGGHRRDWLMVGWFGAAAFYTSYLSAGFLAFAVLATGLTLAWPEGDEAPPRR
FT                   RTLAGLVVACSLILVAFAPWWLATSGLRQYLLGAGAPHLASLGASLEAAFAAFASHYAA
FT                   FLGRPAYPWLLAGPALAGLLLGLVDPARRRGAVLVGLLFVCVFGLAWGRATTAHHFQVR
FT                   YVLPCLFAALLAAGLGVSVLLARLSARRAVHILALLLGLGLAAPNIPAAPFFYRRDDSR
FT                   LKTLAAALDEAAAPRAALILWRESDPWTRPYFEAFTRWYLPGRFLPSLPHGGPDGRSAR
FT                   EALVLVPTSGDASARPLPETATPVAVLAGVGVHRLPLINASPNLPPVAFSAGFRPDTAF
FT                   GEMAASRNLRATGEGLVLADRGRAGEATYVFTPLPGQTVVLASLAMDARITDYPDDDTP
FT                   TGRAFVLVGPDADSLIPYDPAAPPPPSKSLTVRLILSPGFEREPVAVTRLEAHLTVSGD
FT                   PGLPGAGAAQRAARLAANTPVAPCPAGTAYPGQYVLDPSGSVCPWTVALSPGRPAVLGN
FT                   AGQEAFSPEGLTLAGNPGGAILALGGASVPLPLSGPACLRAFLQPGGEGEAVLAPLFTA
FT                   EGFDPGAADVGATTVRLQNDPALSCPDAKPCFVAYAATTGYPAKSLELTWFPRLFGDAE
FT                   GKNGAVAEVALGDGEYRLLDAFLSTRSGRWDGLGVMRRASLDLGGFTGTVRVRFRLTGD
FT                   GGQLWSAPVYPMAARLVLDTRSLPALELSPGTTPLGVSCPGECRATLGFDGP"
FT   CDS_pept        complement(324016..326409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73784"
FT                   /db_xref="GOA:C4XGK4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK4"
FT                   /protein_id="BAH73784.1"
FT                   /translation="MHAQPIVIVGGGVAGLACALSLTEAGRPCLVLEREPEVGGLLRSV
FT                   ALDGVVFDLGPHVLFLDAPGPGETFLRGLLAGAPVIRRPFAFSIFAAGRHWKFPNHLDF
FT                   FRYPLRYQIEALRAALKRRGAPPPEPISAALELSEKCGPGLYDLLFRDLFAKKALTPPE
FT                   ALHHHWLARVDRTIDNDKEPFVRRGKGQAVLAALSRLRQRYWYPAGGMADLAASLRRRI
FT                   EAAGGEVVTNVSHIGLVRDGGRIAKVVADGREITPAHVVWTAPANALLDALDSDAPRLP
FT                   TVTMRMVMLTYARTERVPRPYVYSYHPDPAMQANRIYYPESIFAERGPADREGLCLEVN
FT                   LEDATEPEEKTLARGVADVARLGLYPAQALRASKVVTLPAAMPVYPLDYEDRLARAMAP
FT                   VRDIANLHAVGRQGGFYFCLTPAAASQGLKMAGHLLGRAPAKPAAPGKKSLLDAGLATK
FT                   GAGPAERLKILKRHAQAFVRHATPARLWNFFAAERNRLQKRTVLDSMPYILKIETTNIC
FT                   NLRCAYCYDDRRAPLPGERPYGRMTFEQFRSIIDSCGKWLFKINMYGFGEPFLFPETLE
FT                   MIRYAADRNIGVGVSSNCNHRDPDLPRRIVASGLEVLIFSCHGVTQETAGRFMRGGNAD
FT                   LALENLKAIIAARKAAGRKTPFIDWQYCVTGFNEHEIELARETAARLGVDQVRFIRPFF
FT                   PEDAPDAWFSTMFPRQTLTHEHEAAPGCSWLYRSAYVNWDGGLIPCCRDPRDPSVDFGN
FT                   VFETPLPQLWNGEKYQAARALLADPSRHDLRKGIVCGRCPVTRP"
FT   CDS_pept        326586..327200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02940"
FT                   /product="putative chemotaxis protein CheC"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73785"
FT                   /db_xref="GOA:C4XGK5"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK5"
FT                   /protein_id="BAH73785.1"
FT                   /translation="MSQEISLEARMDILAECVNIGLGRAAEALNRMCESHVALSAPEIR
FT                   VMNRPTLTAAAAGRCPAVCEGVFLPFVGPMMGMTALAFAYGDAAKLVTGLTAAMGIDEP
FT                   SEDMREDTLREVGNVILVGVLGAMGTMLGLHVTYQPLSTAKSLEPLLAVADACQTVTLY
FT                   VRAHFVLERFQVTGDIMVVLAQEGFDALTAAIDGKILEMGG"
FT   CDS_pept        327203..328801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02950"
FT                   /product="cobalamin vitamin B12-binding domain/radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73786"
FT                   /db_xref="GOA:C4XGK6"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK6"
FT                   /protein_id="BAH73786.1"
FT                   /translation="MARIVLFSPTPPDLSAFGVRSLQASLKAAGHDVRLVLFPGSIGLS
FT                   QEDGSYVYRYADTVIDQALELAAGADVVGVSFFTNYFDRAVQLTAAVRERLGIPVVWGG
FT                   VHATVRPEEALDHADFVCRGEGEAALDRLARELATGRPADAIPGVWTLRDRAVVDNGLA
FT                   PLAPDLDALPFFDFSGQDQFVMAPERGRIVPLDAEALRLALPRLPHWDGRLVTAYRTMT
FT                   DRGCPHGCAYCNVPTVKALFRGGGVPYFRHRGVPHVMAELRGIIARYPFIEAIQLFDDT
FT                   FFSRRLDWLREFAAAYKADIGLPLYCQASPTTLDAEKLDVLIEAGLCYVEMGIQTGSPR
FT                   MREIFRRPEDDDAVLAGANLLHSRRDKLLPPDYHVIIDAPWETEEDLLATVRLLARLPK
FT                   PFGLAIASLVYFPETELYRRAKAEGRIHHEETEIYRRPFYLRPQRSYAAFMLYLLTFQR
FT                   IPAGGYAFLLRPGTVAWCSRHVPPAVYKLGYALGEVARLMAKGATALSRGDFGRIAAFV
FT                   RRTLRHDPTVAGRKG"
FT   CDS_pept        complement(328902..330926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02960"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73787"
FT                   /db_xref="GOA:C4XGK7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK7"
FT                   /protein_id="BAH73787.1"
FT                   /translation="MGNPLRAAIAAMTLLACAFSAALAGPAPAQTAAPAVLLLSSYHHG
FT                   DPWSDRIVAGFLQRLPTAKARVFVEHLDARRFPETEDRGDLTDYLAAKYAHVPIAVLVS
FT                   CDDAALNFWLARRETLFPGRPIVFCGVNDFTPARLSGQTNITGVGESPDVVGTLELALA
FT                   LVPTAHTVLALTADDAASSRANIDRFRRAARALEGRMRPVELQNVSLEAAKKALAAAPR
FT                   DAVAVRLAPLKSESGAAPLMGEDLAALAAVSQVPLFCLWDFDLGLGAVGGRVLRGQDQG
FT                   RAAAALVEQVLAGKAPADIRVTDVPAETVLDQTVMTRLGLPVDRAPPNTVFENAPASLY
FT                   ERHKGLFWAGGAALVISLPGALALLILLAGRRRAETRLAESERRYRELVESANSLILRF
FT                   DAGGRLVFVNEYAERLLGYSRAEMLSGKAVFWPSAPPDLTSLLARAMAAPHSLAGAGNE
FT                   NEVAAKDGRRVYLQWDNQPLFGPDGRPEGWLAVGADITARRLAEEALAARALAEEELAL
FT                   FGRELLAGGDDAVDRALVRLLSAFSVGRAIWFDNVEDSRLGLCCRLAAEACAAGLAPRR
FT                   DAPEAALVSYSIDGFHWADRMAAGEIVTGLDTDFPEDLQEILRLFEARALLAAPVTRDG
FT                   FWTGFLVIADVREPRRFTRQEHSLLSTAASLLSVYLARR"
FT   CDS_pept        331092..332696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02970"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73788"
FT                   /db_xref="GOA:C4XGK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK8"
FT                   /protein_id="BAH73788.1"
FT                   /translation="MTSPEQPFQAPGGPMDAPRADRSDDARYWRLFFEQSAMGILVGDA
FT                   TGRILETNPMALALLGYDRDRLVGASMADIVHPDDQAAAPLRANHRAALDGRPRHMDRR
FT                   YRRADGTYLPVAVSFGLLDRQAGTIQVMFRDISARQGLEKQRADALAKAEAAEAIKSAF
FT                   LAHMSHELRTPLNGIMGMLQLAQSACPGPEVADYLDTAMESARGLLRILSDLLEVTNIQ
FT                   GGRVRLAEEDFDLDAVIAPVAASLAYEAHIKGLQFVQRVAPDVPRHLRGDAARLRQILF
FT                   ALAGNAVKFTAEGQVVLSVETVPASEPLQLRFGLSDTGIGIPRERLPGLFEPFAQARPH
FT                   GGGIFGGAGLGLCIAKGLAEEMGGEIMLASEVGRGTEVRVTLPFALPEAAPARPIREPA
FT                   SLAGKRVLVAEDEAVNRLTIRVMLQKLGCRPQLVENGRQALTALAEGTFDCVLMDMRMP
FT                   ELDGLSAVRAMRRGEAGPAARTMPVVALTAHALAEDRCAALEAGVDAYLVKPVDMAELG
FT                   RALGQAMAGSRAVDAAG"
FT   CDS_pept        complement(332715..334841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02980"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73789"
FT                   /db_xref="GOA:C4XGK9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGK9"
FT                   /protein_id="BAH73789.1"
FT                   /translation="MPRLTVVIPAYNAAATLGDALDALAAQTMPRSAFSVIVVDDGSTD
FT                   ATAAMARARGVAVISQPNAGPAAARNAGAAAAPPDSDILVFTDADCAPAPDFLARLTAP
FT                   LDDGAVAGVQGAYRTRQTSLVARFAQIEFEDRYAYVARRPAIDLVATYAAAYRRAVFDA
FT                   AGGFDTSFRAADNEDTELSYRLAAAGHRLVFAPDAIVYHRHPATLGRYLTIKASRAFWR
FT                   LRACREHPEKLVRDGYTPPVIRLQTILAGLFALATVLAPFSRPAGLFALVALTALLGSA
FT                   LPFARFAARRDRAVARLAPMFVTLRSLAFAAGLARGLADRVLSRTACRPPHGTTPKRVG
FT                   LDLHTISGIRQGSRTYIEALAARLPQAAPDLDFVFYATRDGLDAARTLAGDAPNVTVRE
FT                   IPAGRLARLIAPFPWRLRREVDVFHCQYLAPLTPTVPCVVSLHDILHEAMPEHFPKGLS
FT                   RLMRLLYPLGARRAARVLTLSAYCRDEIVARYRVPATRVAYAFPGVDPAFAPVTDPAAL
FT                   ADMRARLGLPGGPYILFLGRMEPRKNVPGLAAAYALLRRRLGAQAPTLVIAGPDDGLFA
FT                   AFGQKLREAGTGEGIVFCGGVAQAELPALLSGAAVFAYPSFGEGFGLPVVEAMACGAPV
FT                   VASLAPAVPEAAGGAALLVDPSDPQALAEALYRVLAEPELAAELRAKGLARAKRLDWND
FT                   TAAMAVAAYRRALA"
FT   CDS_pept        complement(334852..336324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73790"
FT                   /db_xref="GOA:C4XGL0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL0"
FT                   /protein_id="BAH73790.1"
FT                   /translation="MADILVVNAPFLPKFSRPQRSPAVTKSGTLYFPLFLAQAVAVLEA
FT                   DDFEVVFVDAPAAGLDLDAVVARAKAETPFLAVLDTSTPSIDADIKAAAALKKALPGLT
FT                   TVLVGPHATALAGKVLQDGRGAVDAVARREYEATVLELARLLAAGPATPQRLATVDGLS
FT                   FLGAGGVVVHNPDRPFIEDLDALPPVAPVYARHLDIRHYFNPNAKPPMVTLATSRGCPF
FT                   RCSFCLHPQTLTGRTARCRSIDKVLDEVAWCLDHFPGLRTIFFEDDTLTADKVRCRAFC
FT                   QAIIRRGLVFEWTANARADLDPDLMGLMRRAGCRQLCVGFESADPTALSAMKKGLGAER
FT                   MRCFRADAAAAGIKIHGCFIFGFPGDTRESILATIDFALDLNPETAQFYPVMVYPGTEA
FT                   FADYEARGFIAAGRWRDWLTPEGLHGCVVRNESLYPAEIVRLCDLARKRFYLRPQFLIR
FT                   RALAALASPGEMARTLRAGRVFLKHLLRGSKV"
FT   CDS_pept        complement(336412..337260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03000"
FT                   /product="putative polyprenol-phosphate
FT                   mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73791"
FT                   /db_xref="GOA:C4XGL1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL1"
FT                   /protein_id="BAH73791.1"
FT                   /translation="MKNAMLLSVVIPAYNEEGNITATIDGIRAVLRREGVPYELVLVND
FT                   NSADATGAVLDALAEADPGVVVVHREPPRGFGRAVRAGLERASGDVIVICMADLSDDPE
FT                   DIIKYYRKIEEGYDCVFGSRFMRGSRCVNYPKLKLFVNRLVNKMMQIMFWTRFNDLTNS
FT                   FKAYRSYVIRDIMPLKACHFNITIELSLNTLIRGYAIAMVPISWQGRTWGSSNLHLTEM
FT                   GRRYLSTLLRAWFEKNLILDDLMAESMAHRTRLAEKAAGLEGRVASLERRLAAVEARVG
FT                   D"
FT   CDS_pept        complement(337321..338241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73792"
FT                   /db_xref="GOA:C4XGL2"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL2"
FT                   /protein_id="BAH73792.1"
FT                   /translation="MRVRESFSRDLLRLFVWYPLRLVAERLPPRAAVALYRAMGRLHAA
FT                   LSRGRAGRIAIAARAVNPALAEAEAEQAVLDAFATHYVNQLIVFQLPRLTAANFHELLE
FT                   IDGLDRLGLALAHGRGAVIPIGHFGPTQMPLAALGALGFPMVQIGHLSDEGLSFVGRRV
FT                   AFRLRARYEARIPARIVPPGPGVRLALTHLRAGGVVMTTADDGPGQPAFGHHATVEFPG
FT                   GALSVPLGPARLALSAGAALVPGFLEPGRDAPFRFVLDAPIIPPQGMDRDAAALAMTRA
FT                   FMARYADRVASRPGWWHGLETHLFS"
FT   CDS_pept        complement(338244..339536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73793"
FT                   /db_xref="GOA:C4XGL3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL3"
FT                   /protein_id="BAH73793.1"
FT                   /translation="MRIALVQSWLGPGTTDPVFPIGLASLAASLPGHVVAAFDPNVAPG
FT                   DPMAALAGFLRDFAPDLTGVSLRNIDSTNTRVNVSYLPPFGETVAVARQETTGPVVVGG
FT                   AGFSMFAEAVMAGWPAIDHGVALEGEAAFAALAATLEARGDPAAVPSLWTRRPDGSPFF
FT                   TGPSDKIDLADLPSPDFSILPLAPYVAVPWGVGVETKRGCALACVYCPYGFLNGRRYRR
FT                   KAPGQVAVEVVALRDVHGARRFTFLDSVFNLPADHAAAVMEALIEAGSPLPWSAWFAER
FT                   GLTRDFLTLARRAGCDTVIFSPDAFSDEALGALGKASSVAEIEAAYALVRDLGCFEVSY
FT                   NFFKNPPGQTAKAALAMLRFILKARREMGRKAHFELNSIRVEPHTALARRAVAEGIIPP
FT                   DADLLAPVMYTQPKTAWIEKGFDLLLRAAGK"
FT   CDS_pept        complement(339533..341065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03030"
FT                   /product="cobalamin vitamin B12-binding domain/radical SAM
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73794"
FT                   /db_xref="GOA:C4XGL4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL4"
FT                   /protein_id="BAH73794.1"
FT                   /translation="MRVALISPYPDITAYGLRSIAAYLKARGLAVRLILLPDPLGDALL
FT                   DAPERYPAHVMADLVRLCADCSLVGVSLMTNYVDNAAQITRALGDAGGPPVVWGGVHPT
FT                   IRPEECLAVADYVCVGDGEEALADLAEALATGNDATAIPNIWTRRADGCLAQNPVRPLT
FT                   QDLDSLPPPDWSHDDHHIWDPEHPQDGIVPLTPAMTEAFLARGTVSRLLGRVGYQTMTG
FT                   RGCPHRCAYCVNDAVKALYGAKGYLRWRGTEHVMAELETVRRTLPHIGYVWISDDAFFA
FT                   RPLEEIREFCRQWKARVGLPFTCLGSPATITREKLDALTDAGLCYLQMGVQTGSARIQE
FT                   LFNRKAMGNAVMLKAMAVINAYKDKLLPPSYDFILDTPYETLADRLESVRFIAQIPKPF
FT                   RLQPFSLVLYPGTKLHAMAAADGFLTDERRQVYTKSYTMRRPDYVNLLILLAKGGRMPS
FT                   KLLAWLASDAVAVPLSQPVMAPVWRAVFALAEPVKKLLRLARSWRARPGDHA"
FT   CDS_pept        complement(341172..342389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73795"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL5"
FT                   /protein_id="BAH73795.1"
FT                   /translation="MARPCVGLAHAVIGEAPDNYTEAGLTAVTALVDRAVAVCCDLPAL
FT                   VGGKSVFLKPNLVRPNPASPRSVVTDERVILAMVRLLVRAGARSVAVGDNPGWGLSLLE
FT                   ATAGLSGFLHRLEAEGAQLVAFDAKPPVPVPNPGAFLFDPVPLPQAVLEAEVYINLPKM
FT                   KTHVHTLVTLGIKNQYGLILDDNRMPFHRNDINLKIVDILRAIRPHLTVVDGLWAVQGQ
FT                   APLSGSSLPDMNVVVAGADVCAVDTVCADLMGIAANEVAMLRLARQEGLGETDLAAIDV
FT                   AGDDPDRCRRRFVRPVLSSMGAYPAVRVIEGGACQGCQSALRHALDKLATEDGFAAGTP
FT                   HTVYLGVPMPQAVNLRNVPGQLWCFGACAAPLAFDVRRPGNVARFVAGCPPHILDFYKA
FT                   YKAATR"
FT   CDS_pept        complement(342353..343873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03050"
FT                   /product="putative acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73796"
FT                   /db_xref="GOA:C4XGL6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL6"
FT                   /protein_id="BAH73796.1"
FT                   /translation="MFQDDETLAGMLRRNAQVRGGAPAILSGDVSVSHEALAEAALRLA
FT                   GGLAGLGLAPGQRLAVYARKTPQAVTAFLAAAAAGGAFFPLDPNQPPEVTRAILDRLTP
FT                   AVLVVAAEYLPALAALYPEDAPMPTVVCDGPAPAGKPTLAELAAGPMPAALPRVQPDDP
FT                   VYLNFTSGTTGAPKGAVTTLGNLLANTAAAIDAFALTPDDVHLCMMPVFVHPHETLLRP
FT                   LALGGTMVLCDRVSSRAVAEACSRHKVTALMAVAAIYETLLRLPAGADNPLAAVRLAES
FT                   GGMHVPSALAAGLRERFGASILPVWGSTETTGVALANRPGDAYAPCCLGRPVPGYDVAV
FT                   TREDGSPCDPGEPGELVISGPGVCPGYFGEEPRPEFRLYGGRFRTGDEVFHDGDGRFFF
FT                   AGRQSMLLKVGGMKVFPVEIEEALRQHPDVAEAVVIPVADALRGEAAKAVVAPKNGASL
FT                   SPGELRRFLSGRLHRLKMPRVIEIRDALPRTPGGKIAWRALVSDSPTP"
FT   CDS_pept        344029..344379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73797"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL7"
FT                   /protein_id="BAH73797.1"
FT                   /translation="MRQHRYYLGLMAAVLLVCLMVLAAGSAGAAKADDDGKPLKTGVTI
FT                   TGIVEDDYTDGLLVTTEDGTSYMVLTPEEVSLEQEEAFHKKFKGQSVTLTGNVFRDEDG
FT                   SLSLFVMNLPAQ"
FT   CDS_pept        345262..347439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03070"
FT                   /product="putative bacteriocin processing/transport
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73798"
FT                   /db_xref="GOA:C4XGL8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL8"
FT                   /protein_id="BAH73798.1"
FT                   /translation="MSNGSEAFRHNTGLMCFLLVARHHGIDLTMDSLSHRYGIHGEDVS
FT                   LKQLWRAGKDIGFKVRQVRLGWKKLFFLGNVFPLIARLRSGKYVIMSGVRGEHEGGEIV
FT                   VVDPSLGTLEFQFLSRAVLEEIWEGDMLLLKKVYSSKDTYKPFGLDWFIPEIIRHKSLF
FT                   RDVALATVFVNFLAIALPIYLQLAFDKAVGHQALSTLIVLSVSMVAVTIFDHILQYLKG
FT                   YIVLFATSKIDLRLDKTIFAHILRLPIDFFDFTPIGLITRYMFQKERIRQFMTGTLLTT
FT                   LFDLSMIVVVLPVLFFYSWKLTFIVLAMTSVVALILFSTMKTFRYAMQQLQHAEAVKNR
FT                   YMVETLRGMGTIKALALEPTRFRRIEADSAQTVSRNFRIRKLSLVVMGLSEFLQALLRV
FT                   VLIWYGCRLAIEQEMTAGSLVAFVMLSNLITSPICKIVSLLHEYQEVAVSVGMLGLILN
FT                   RPAEQSPNVRGLTTPITGSIGIDRVTFRYAANLPPALSDISLYFPAGSIVGVVGRSGSG
FT                   KSTLTRLIQGLYPLQQGRITLDGTDMRDFDLAHMRRSIGVVLQESFLFEGTIRENIAIT
FT                   KPTATFEEIVFAARMAGADEFIQGLPNGYDTPLFEGGSNLSGGQRQRVSIARTLLTQPS
FT                   ILILDEATSALDAESEAIIQANLTAIAHGRTMLIVSHRLSMLTICHSIIVLEKGELVGN
FT                   APHDELLRTCPLYADLWYKQNRHILGLVGSS"
FT   CDS_pept        complement(347646..352922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03080"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73799"
FT                   /db_xref="GOA:C4XGL9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGL9"
FT                   /protein_id="BAH73799.1"
FT                   /translation="MLSDETKELICCQLLMEQLTLMGRINIVTSDKGWILEKLATEITS
FT                   RVPYTTYTDAEDLKSDIQYYITYSRRIRRFSPIEIACYTHQEHDKEAANLFFSTASEVE
FT                   YCICMSKRYEDVLRGHGLTHVSTISPGVDLDELSLKIRIGVVGRTYHTGRKGEHLVAAV
FT                   MDIPEIEWHFTGEGWPGPAENIPADKMADFYRDMDYILVPALYEGGPMCVVEALACGRE
FT                   VIASSVGWVDNFPHIPFKNGDANDLRRVLKSLVEQKSALRAAVAAYTWDNWAESHDRLF
FT                   RDLLARHGRPPIAGSNVFSFGKASPTLSTASFQPALILHGNESNSKGGPSLRVPRTAKE
FT                   LRNHGFSCEVVWNTIRASSAHDLVHLFNIWSPQSALRILRQARSLDKPVVFSPIYLDLH
FT                   EHAYWSNQLLNHFKRFRGSELETVLTCEAKRLAKTRPETILFEPLPGFHSYLHEAVSLA
FT                   DHTIFLSQHERDRVAALGICPEQSSIIHNPVDSDFGLSENPQLFAETHGLREYILCVGR
FT                   IEPRKNQLMLALATRDLDIPVVLLGHSGSQQYTELIYQVNHPNLVMIDRLPNDSALLRS
FT                   AYAGARVVTLPSWAEGASLAALEAASTGASMVLGNRSSELEYFGNHARYCDPAHPGSIR
FT                   DAIVKAWDNPRHQDEIQELRRMVADRYSWERYAAATADAYRNAVVVHSSKKRPDSNSVV
FT                   NRSGTTPTRLVFDVTTSANHRGRITGIARHERNMALALLKHEGLELCFIVWHDPSRQFI
FT                   EVHSRLVEHGLLPDYLKYCQPDKDLLTVRSMPGAPLLVCGSAWMQNSRYTAGLLSLVKK
FT                   TDLRLTFIINDIIPVKFPYWFQDNYAPVFNTNLRHLLIAAHQVLAISRSSANDVEQFAL
FT                   DNLETSITVSTFELGSAIIEAGKADVAVAQSLSERLQAVANIQQGFVLCVGAIHPRKNH
FT                   RLLFDVWTKLNETMGNKTPVLIIVGGVAWCGEDVARAFQGSPLHQKYVRNLTDITDSEL
FT                   QWLYENCQLTVYPSLYEGWGLPVAESLRYGKICLASNTSSIPEIAPNLTDLLDPLDASP
FT                   WAQRIAFYCKSKTARAQREEKIGRLYQPKTWEEAASSLLQCLGTTHTAPSWRYLLGSLL
FT                   RGNCVDEYIRYFTTGWHTPEHWGIWSAETTASIKLNPTPQPQGDMILAASCMAVNSPSC
FT                   PFICTPSINGTALHRWVLDNRQSKICFAYIPQKLIDGSDAITVDFTCETLTHIGTAVNK
FT                   NDSRYVGLGIKEIALTDAGQIEAIPHLFTDNAATARLLRPGDSIGIHTPGLHLRNCVAD
FT                   GQVVDGWGVVVSEGKPVRLSLSLLEFHKDAVLEFLVRPVATTEHPVEVFAFAQGKFLTA
FT                   LRFADDAVTTVTLCVPQSAQYPGMVSLNIEFVGTSPLTPSKLGIGSSDCQFSLGFFGLR
FT                   MGRQTSPSRYREAWMTLGKEYGAAEDCAQTPCPTYDCDWYPPEPEGRWSIGALGTLRFQ
FT                   LADACDVPLLLGIEATLPPQPNNARPRLKVALNDVSLRNANAPNPGRWRFFFFVSPDIL
FT                   RQDNSNTLTISTDTGMAPFKLGLPDERHMGVQLHALRMDRIDAESALRNALSSLTSPVI
FT                   LSDAMPCEMRNRLHLTNQSLATGPVSGTSILGDDLFSVAFDAEPGQPLPIPHIVLLLFK
FT                   ARADLQAAYSLDTPQSRFQLLLWFLFFELDSETAKALPQNYYNFLITPQTSSYLKEDTP
FT                   LPFFAHHILHLRDDVMSAVKDEHGSLQQEKYLYWLMRYGRNDYAVVDEIFKRVRDTALN
FT                   LS"
FT   CDS_pept        complement(352909..355041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73800"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM0"
FT                   /protein_id="BAH73800.1"
FT                   /translation="MTYDLNIPGQINEFQLRAIEAVATLVPENGVVVEIGSLFGRSSYA
FT                   WGASVLPSVTVHCIDPWKGNSGATPLQDRWGITYSIEQFREYTKRLQNIVPHQGYSPRD
FT                   FSTWDQDIDLFYEDSVHRNPTFSKNLHFWLSHLKSTGIACGDDYRPRFPDIVNGVGALA
FT                   EQLGRELIIVDKFWCLLPSAELVPAVEAIRERLLVIKSEAEEAALTHPFAHTLSITNKS
FT                   HTISAGTPLSIEIYACNESPFSWNDDCGNPLTSNVLIGFQSTANSTTASSIYPLNTALE
FT                   PDRPVIDTVLISTTGLSPGTFTATAQLLLTDDQGKVNHILKDNMHWLFEITPEKNLHGI
FT                   PDTYQAFHEDKPENFNEISSLDVHAAYRMFLGRPPEGGEQRISNHLEAAKSLDGLRQRF
FT                   IVSPEFQRTIRRFIPDGYTKRHPTDLNTIKFRHQSVKHRDRTMDKIFEIPVVDPNLSRD
FT                   HLLNIFRYQPFKLPDGTITGSGNGQVYGGLTRAMRPGEVTKKEWDNFFLLNSELTMMYE
FT                   DIIWAIKNEFGSFKGLSFADFACNSGYFCYRYLQEGAEMATGIDGYDFSEAFSIVNRAC
FT                   SLNAKFIHASYNMMTHEAKGLADTYDIVSCIAFMCYSSDPTYLLTYLAKLANRALVVLS
FT                   KIPHGNDELFIKYANTESKYFNKQFPICFDAATEISEELFRCGLKSLGFKTVIEILREK
FT                   HWQPRGTAWRCFIALR"
FT   CDS_pept        complement(355031..356965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73801"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM1"
FT                   /protein_id="BAH73801.1"
FT                   /translation="MNGRDGSKEASIQRGDRSFLIHPDVARHDFGNDPFAGSHGALDHY
FT                   LGAGILYYALGYLSRSQVSICIGSGGGFVPSLMRRAQLDIGIDPSVTMLIDADIPDLAF
FT                   GSPHQPGGWLTTENTFLQRESDILVLPMLSRDAAKILTTEGIGIDYLHIDGDHSRTGVL
FT                   ADFKAYAPLLTQQGMITLHDYRLPSVSEAVREILESYPGWEHLTFPEVGTGTILLRRAL
FT                   PPDVPRQPQNWTEFTDKGRKTTLAQEELQSCITEYKRKSRFTHWQYLTTSAYRLRYVLA
FT                   MEFIDQTDCTVVEVGGYPNTVVRHLQQASVVHLVEPYAPQEYVAEVEALAAEAGTTLFL
FT                   HQTNLADSNFDSSCLGAFNLVLLGLDISPGCETREDYEQTLVALLRLISSANRVALEIP
FT                   DRAPSKMTWTLISEAFHPTLQLDVTLDYGHDPVADAYYVKDNRSLRRLILFSLEDSPCP
FT                   TTERIRSLVHETADALWKIHIKLNEPHNYAYCIGTTIDFTSEGNADGYKAQGWVGAEKD
FT                   HSWMIGDESVLFLSFDEKSMPSIPSVALEMDLKPLLAPGLLERQRVTVTINNFPFFSLI
FT                   VTEPGTININIPTDILRGQQPIKLLLQHPDARRPCDINPESTDRKLLSVAVRKLVFKNL
FT                   QQITENHDI"
FT   CDS_pept        357035..357196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73802"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM2"
FT                   /protein_id="BAH73802.1"
FT                   /translation="MRSLPCFDAKWKGCFFAERQRVDPSCQIRAMMQSVNKPWSETARE
FT                   TLVLLSAG"
FT   CDS_pept        complement(357401..357709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73803"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM3"
FT                   /protein_id="BAH73803.1"
FT                   /translation="MKSLFKILLLISLVVLSTTTPSWAAPTTGTVNYLLTVPSGADAPV
FT                   NYINITPTGSSTSATLTIPSGSVSMVSAIAMTALASNLTVQYQSSNKVLTALYLVKQ"
FT   CDS_pept        complement(357722..358645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73804"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM4"
FT                   /protein_id="BAH73804.1"
FT                   /translation="MKKHCHINRYMYNVFGITLCCLAGVVCITSLSLAQDAKQLSVFCQ
FT                   NTSLSDCLKIFTKESQIEVQLVGISSSNMVRINIQSNSQIDILNRILEAAKVESYAITI
FT                   DQAKQRAVINGIGVQANAPISASQPSDLTSINSAKNTPQQAQAANAFPEIDPAQTAADA
FT                   LTAKAPPNLDEVIEFPNEENVTVRELLLRRDQIELLTPKPHDIAFQGDDGQPVTFGDLR
FT                   KQQHEADAVTSADRVIELPDGTTLTHEQMRADLIEANKTLADKSASVADSKSEADSATS
FT                   QSTTSSTLRSSMKSSPSGTEKLDTPK"
FT   CDS_pept        358820..359071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73805"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM5"
FT                   /protein_id="BAH73805.1"
FT                   /translation="MLGGDLLWKLTISTYCNCLGITILCLRLISTLSGTQALTQIVAFE
FT                   EWSVTRHGYWKGSEAIERNRSAYGPTNRQNVWRNLTVV"
FT   CDS_pept        complement(359291..360751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03150"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73806"
FT                   /db_xref="GOA:C4XGM6"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM6"
FT                   /protein_id="BAH73806.1"
FT                   /translation="MPPKSPEPSKASKPSYGILSKFLQLAGAQWIHDGLHTFFLIYLAR
FT                   LSSSDYGEFMVAFGLASIILFLGEFGLNQPLVSSLCKKFSHKGDILAQYTLLKGALLVA
FT                   GWLGVAVFIHWQGYTPGLKNLVLVISAGVGLEAIASSFFVAIRVEGRQDIEGRIRVVSG
FT                   ILGYGYAIALLSLGAAPHWIALFKLIENVVNLIGGVWMALKFTNFDGLSLKRKSLARTW
FT                   ATAKNGTVFVLMALAAILYNKANLYFLQNQAGPTKVAQYSVTWELVDGISILVSNLLLR
FT                   SILYPLFVRLWKSDKSEFTRLANNSVRWLIGASIPIMFVLYIESDRLIGLIYGGAYYDA
FT                   MWMQKWLVGTIICGFIHNLAAYLMMSQGKQRLLLFVYIGGLVLNLALCATLIPMDPLLG
FT                   TCLSMLITKAAVAVTTTTYCQATMRIIDLKSMWRIAVACLAGAALYFATYRLGIREIPE
FT                   VLALVPFVFLVLQWRKELRAQKAQVGMG"
FT   CDS_pept        complement(360810..362756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73807"
FT                   /db_xref="GOA:C4XGM7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM7"
FT                   /protein_id="BAH73807.1"
FT                   /translation="MPAPAICGNANAESPPKRQIPCPMDATAMRKRPLTPHLYYRMPWN
FT                   LADNAITWLEPTTKCNLYCEGCYRENDPFGHKPLADVIRDLEQVKKMRRTDGISIAGGE
FT                   PLIYPDIVPLVRYVAAQGWKPIINSNGQALTPELVRELTAAGVVGFTMHVDSHQVRPGW
FT                   KGASEKDLCALRLKLAEMIHEHSGGTVSCSFNATIYRDTLADIPMLTRWAHEHIDLVQT
FT                   MVYILFRSARKRGDFDVFANGKPVDVGSLVYQLDHQENHEDLDSQEIADAIRLAYPDHE
FT                   PCAYLNGTEDPRTMKWLLTLRAGSKDEIFGYLDAKFAEWMQAFHHVLFGTYLAYTRPCW
FT                   TAWLQKLIFLTPFNKSLRKIFGRLLLKPKQWTKPIHIQSIMVIQPCDLFDDGRQNMCDG
FT                   CPDAIYYQDKLVWSCRVDELEKFGAFIQCAPRGCCGGGAKAAPAPAPQAAAEPAAEPVT
FT                   APEPAPEPVKEPEPTPAPQPEPIPAPAPAPAPTPAPAPAPEPVAQPEPQPEPAPAPEPV
FT                   AQPEPTPEPEPEPLPEPAPEPTPEPTPEPTPEPAPQSEPEPTPEPAPTPEPEPQPVPAP
FT                   RIETAPATKGISDPVVKVDLPPAPAAPEPAKAAKPAPAAEAKPAKAAKTAKPAAEKPAK
FT                   KAGKAAKKKTKGR"
FT   CDS_pept        complement(362852..363835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03170"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73808"
FT                   /db_xref="GOA:C4XGM8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM8"
FT                   /protein_id="BAH73808.1"
FT                   /translation="MTLDYAAALLGAVLFAAAPLILAALGETVSERAGVINLSMDGTVL
FT                   FAAMAAFAAARATGDPWLGLAAGAGSGAAIAAVLAVFGLFLGASELAVGFVLTLFCREL
FT                   AYFMGHAQARQPGPDLGALSIPGLSDLPLIGPAVFRQSPVVMLSLVAVAVVWFFLMRTR
FT                   PGLVVRAVGEAPAAAAARGLAVKKVQFGCALIGGALGGLAGGFYSLAVKPGWGHPQGCE
FT                   GAGWIALAIVIFGGWKPVRVALGALFFAAIQVSGIALQDVLPGLSGTLFQIAPFPVMIL
FT                   TLLVVNLRRSAAFREAARRVPLLGRFMPRTAGGAPGAIVGALDKGF"
FT   CDS_pept        complement(363832..364875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03180"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73809"
FT                   /db_xref="GOA:C4XGM9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XGM9"
FT                   /protein_id="BAH73809.1"
FT                   /translation="MTDRAAFLRRAGLSLALALGVTLAIVAAAGAPPIDTLAVMLSGGL
FT                   GSGQAWLRTLSALVPLLLCGAALCVTFAANLWNIGVEGQITLGSVFCLWFLRDFGLSGG
FT                   LPGELAVAGSLIAAMVGGMAWALLSGVLRTHGRVHEIFSGLGLNFVAMGVSLWLILGPW
FT                   KRPGMASMSGTEPLPAALWLPALGGKPMSLWGLVLAVCAFVFVAWLLHRTFFGLTLSAV
FT                   RQNAMAAERLGLSPKRRMLAAMAIGGALAGLSGGILVAGLYHRLIPSISGNYGYTAIMA
FT                   VLLASGSLRFLPLACLFFAVLTVGSIQLPLSLSLDSSLAGVVQGVLVLTLFAARRILPA
FT                   GLGGGRP"
FT   CDS_pept        complement(364872..366350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03190"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73810"
FT                   /db_xref="GOA:C4XH42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH42"
FT                   /protein_id="BAH73810.1"
FT                   /translation="MDVVLSHIVKRFGALAANDDVTARFAPGRVHGILGENGAGKSTLM
FT                   RVMCGVLAPDAGSITVDGTAHARLDPDGAGKLGIGMLAQDPLDFPPLTVWENFALGGGP
FT                   VLSRGQARERLDAVCRRMGFDLPPDVPVGSLTVAARQHLELARLFDRDVRLLILDEPTS
FT                   GISPAQKAALFDVLRTFVADGERSVVLVTHKLAEARELCDEATVLRQGKVVGHFAAPLD
FT                   PKALLGAMFGADGACQAAVPPRPTASSGESLLTVRDAVIADEKLVLEPFSLDVRPGEIV
FT                   GVAGISGGGQEAFLRGLAGIAPAVAGSLRVGGLELAGKPHKRFLDAAVHYLPASRMEEG
FT                   LFPGLTLLDHVRLAFPDRRDEARAIFEERCVGRFRLTNQPHAPAARLSGGNQQRLLLSL
FT                   VPDDTRLLLADNPTRGLDAASIAQIWDHFRQRAAGGAAVIFFSEDLDELLAQAGRVLVF
FT                   YNRALVADLRAGVFDAGCVGDLMTGRLAPGEMPQ"
FT   CDS_pept        complement(366378..367556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03200"
FT                   /product="basic membrane lipoprotein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73811"
FT                   /db_xref="GOA:C4XH43"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH43"
FT                   /protein_id="BAH73811.1"
FT                   /translation="MRRLTILAAVAALLAVLAGSALAADKPLTFGMLLVGPYNDKGYSQ
FT                   AQYEGGKYVEAKLPGAKMLYLDKVNPADRPGVTIPQLVDDLAAKGATLILAGSDDMKDG
FT                   IREAAEAHPDLMFVHISGDDALTGKAPKNLGNVFSKMEYAKMMAGFSAAMTTKTGKIGF
FT                   LGPLINDETRRLANAAYLGARYAWEKVRGKKAEDLSFKVSWIGFWFNIPGVTSDPNQVA
FT                   GSFFDQGYDVVISGIDTPEALTVAGARKKAGADVYALPYDYKLACQAAPEVCLGAPYFN
FT                   WGPPLLTVAKAVAAGTYKPGFEWLAPDFAALNDPDKSPIGFTEGDALAPEARKALAQFI
FT                   ADLGSGKVNLYAGPLEYQDGAVFVQAGSTATDKAIWFCPQLLRGMDGASASK"
FT   CDS_pept        complement(367630..368694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73812"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH44"
FT                   /protein_id="BAH73812.1"
FT                   /translation="MARILYGVHGTQHGHAIRALILARRLAALGHEFLFVSSEEGAGLL
FT                   SREFRVERFENPGTRYKNQRLDTPATLKLAARTLIKRPSELARLARLIADFKPDAAISD
FT                   YEYFVPIAAKRAGIPCLSIDHQHVISCCDHPVPWRLYPDYLGIRASIRFLFSACSDYLA
FT                   ISFFQPPAKPGARAMVAPPILRQSVIDRSPSQGSHILVYQSCGICDAFAPYLKSIDREF
FT                   RVYGYKVDKVDGNLTFRSYAEDGFLDDLASCAYVICGGSHNLMSEALFYGKPVLSFPVA
FT                   GAFEQQLNAIYLERLGYGKAASMERLAPGLIPDFEAALPAMRQRIAGGRFCGNQDVFGL
FT                   IDAFLRDGRLPGRS"
FT   CDS_pept        complement(368839..369996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03220"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73813"
FT                   /db_xref="GOA:C4XH45"
FT                   /db_xref="InterPro:IPR025993"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH45"
FT                   /protein_id="BAH73813.1"
FT                   /translation="MEGFVFGVMAAQLVVLAALFLLGRKHVRGGDGPEAMPQDRPRAAV
FT                   IVPVTGDTPGMRQAVASLIDQDYPDFLAVFVVAEASDPAADLVVGVAGADPRVQVVVAG
FT                   RAEACGQKNHNILAGLRAAHTADVFVFCDSTHVADRHFVTNLVAPIARGDAPMTSGFHK
FT                   VVPGDGATATVGMAVTCLALHLLQPIRAITQPWGGAMAVSRQAFDRFGLARLWGQNIVD
FT                   DFSMGPHLHTFGVAAWPVAAACLQTPLEKVSLARWDDWLTRQLLYLKFCIPPGWIVSIA
FT                   AVLLLAAPPVAAAAMLAAWIFGAGCGAGAALSAVYLAAFAGLGLCFRSLCPRRVGMLAW
FT                   LRGYAATFLMLGWCFGRTFTTNTMSWRGIRYKVGWGGVVMRVIRD"
FT   CDS_pept        complement(370564..371685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03230"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73814"
FT                   /db_xref="GOA:C4XH46"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH46"
FT                   /protein_id="BAH73814.1"
FT                   /translation="MARETPARVVFLLQDLEFGGTQRQALELGLRLDRSRFAPEFWMLA
FT                   DVRDFAPRAEAGGIPLTWLSPYPKVGAQSLAGLWRKLKASPPDLFVPLTAVPNIWGRVF
FT                   AKLQGARPVIGTCRGGGAIKRQHERFLKGLCDRHIVNAAPLAKELIALGRPAERVECIP
FT                   NGVDTDHFLPPPDDMRPVREVVLCLARFCEDKDHETLIRSFEYVVARRPRAELWLVGDG
FT                   PLRTSVRTLAARSPVRGLIRSYPSTPDPRPFFQQASVAVLSSVREGLPNVLLEAMAMGL
FT                   PVAATAVGGIPDLVVPDVTGLLCPPRNPEALGETIAGLLADEDKRLAMGRAARERAVAL
FT                   YSMDAMVRRHETVFAQALAGKRAPAAANRDAET"
FT   CDS_pept        complement(371685..372899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73815"
FT                   /db_xref="GOA:C4XH47"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH47"
FT                   /protein_id="BAH73815.1"
FT                   /translation="MSKRSSVALGTILKQSVKVARHPWIAGRLAALEKEKFLFSFLNPQ
FT                   AETGHARSIRQLSIRITDVCNLRCHTCGQWGDQGFLHGCDLKDLKKKEISPERYLALLE
FT                   DLARHGHRPSVYLWGGEPTMYKGWLEIIERATELRMPTSIATNATRVAAAADRLAAAPM
FT                   FLLQMSIDGHSAETHNAARPSAGGGDNHKVVQEALSAIKEAKKAHKTQLPLVAALTTIS
FT                   SANVHHLVDIYEAYKDRVDLFVYYLSWWIDEKSAKAHDEDFTRRFGFTPKLHWGWVGDW
FT                   TIKDHETLNKQLAEVQRRSKGWNNPPVNIIPNVAGVDSLREYYTNHESTFGYNQCISIY
FT                   QAVELDSNGDMSPCRDYHDYIVGNVRDHTITELWNSESYRRFRASLHTEGLMPSCTRCC
FT                   GLMGY"
FT   CDS_pept        complement(373573..374889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="DMR_03250"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73816"
FT                   /db_xref="GOA:C4XH48"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH48"
FT                   /protein_id="BAH73816.1"
FT                   /translation="MGEFPTQQNPGSGRGIVIHGAQWGDEGKGKIVDLLTESAKAVVRF
FT                   QGGNNAGHTLVVGGEKTIVHLMPSGILHDGKTCLIGNGVVLDPEVLCREMDTLAAQGVD
FT                   VTPERLTISKKTQVIMPYHRLLDGARETLLAGAKIGTTGRGIGPCYEDKMARIGIRAGD
FT                   FAYPELLAKKIAKALVEKNTLFTKLYDMPALDPDAVLEQILPVAKRLVPYLGDVSSIIQ
FT                   KTLAAGGDVLFEGAQGTHLDIDHGTYPFVTSSNTVSGQAAAGSGCAPSVLGRVVAVVKA
FT                   YTTRVGSGPFPTELFGTVGDYLQEKGGEFGATTGRKRRCGWLDLVLLRESARLSGPTDI
FT                   ALTKLDVLSGLFEIKICIGYRYKGKVYEYPPQDEGALEFVEPIYETMPGWEEDLSGITT
FT                   WEDLPLAAREYVSRIEQSLKTTCSILSVGPDRRQTIIRG"
FT   CDS_pept        complement(374889..375368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73817"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH49"
FT                   /protein_id="BAH73817.1"
FT                   /translation="MWRVCRLPSTAGPGGQIAFGRAGQFCYQGLSAAQHAAGFRGKGVV
FT                   VEQVLLKMAKQLRAFDEASIMALWDKYAETVERFEPTQRWEEAVLVLAMIQGMRFKNQL
FT                   FNHHWAKGRQPGEANEPAPAPAATDIAAPAPAAAKPGPKRQGKVLAFKPKDGGEA"
FT   CDS_pept        375383..376660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="DMR_03270"
FT                   /product="putative phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73818"
FT                   /db_xref="GOA:C4XH50"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH50"
FT                   /protein_id="BAH73818.1"
FT                   /translation="MSDLKKMYTTVVEDPFPSELVIRLGETELVFAKRTWTIDGEEKGL
FT                   RYGENPDQPAALYAPAAGRLSLGGVEFRGPGDGLICAATEEHLLQSGKHPGKTNLTDVD
FT                   NGVNILQYLTAKPAAVILKHNNPCGAAWSEAGLCAAFEAAFASDRIAAFGGAIVVNRTL
FT                   DVATAEKINAVYFEVVAAPDYEPAALDILKSKKNLRIFKLPGLAQLDKLVGQPYLDLKS
FT                   LADGGIVAQFSFRNRILAAADFLPAQATDKAGTTVVARTPTSQEAEDLLFAWAVEAGVT
FT                   SNSVIFVKNGATVAIGTGEQDRVGVVELTIFKAKTKYADSLAFAAHKLSLYELTQKAAA
FT                   DPEAAASLADIKARTEATMGGLAGSVVVSDGFFPFRDGVDLCIGAGVTAIAQPGGSIRD
FT                   TEVIAACNEATPQVAMVFTGQRSFRH"
FT   CDS_pept        376881..378983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03280"
FT                   /product="putative ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73819"
FT                   /db_xref="GOA:C4XH51"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH51"
FT                   /protein_id="BAH73819.1"
FT                   /translation="MALERYVGPGCLVEFMQGNQAQVAWVLEESSGRLRVYTLTHREEK
FT                   MAMARVLPWMGPRYDGARDRSAISEILAGHQAKREAAAKAIAPLELWELAQGEVREESA
FT                   EWFAGLVGEKPDVDAVAGMGRALLGCKTHFKFHAPKFEVYSAETVERRLTEAAAAEERE
FT                   KVVVAGQVFFKELWHGWATGDRKKGAALAAKLDPEAAAKLAAMLRRLMADADDQESAVL
FT                   WAMLRKGLPDHPLQAYILATQWGIVPPHYNYHLDQADYVAGDDWHAPYAAEIEARRAGL
FT                   AALSREPEPIPFVSIDSPTTRDIDDAFFAETRPDGTIRLVLALADPALDWDFGGPLDTA
FT                   VAHRASSLYLPEGVSHMLPECLGTDLYSLRAGDVRPSLVMEWDFSPEGEIVGFAMRKTF
FT                   VRVAENTTYAVVEAALDRGDAAPHLQLGWRVASWLRAKRLERGAVIIERPEPEISLSGY
FT                   PDDVKIEMSVCPAYPKAQLLVSELMILGNAAAADYAVSHGAAMLFRTQDARLPPEVRGI
FT                   HSDPPAIQRAVRELPPTLTEPDPRPHATLAAPAYAPVTSPLRRYADLINLAQLEALLRT
FT                   GAPRWSRGELEARLPLLSSRIEAVGRVQRFRPRYWKLAFLQRHCKERTFEGVVVDVAGG
FT                   FISLSLPDFQIYVRATRDTLGDTIYTGQRYALRLGRIDPLTNELRVFGAEEIPASLPDE
FT                   QLFGEG"
FT   CDS_pept        378984..379583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73820"
FT                   /db_xref="GOA:C4XH52"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XH52"
FT                   /protein_id="BAH73820.1"
FT                   /translation="MAATAFLVLTYLLGAFPFGLVVALVGRGIDPRLAGSRNTGATNVS
FT                   RLCGTKLGVLTLVLDLAKGLVPVLCARAMTDSPVFLSMVAVAAVVGHMYSVFLYGKGGK
FT                   GVATTIGVFLGGAPIPALLSVAVCVAVIRVSGYVSAGSLTLAVALPILCAWLGPVFLVP
FT                   AAAIIGGLVIHKHRDNIARLRSGQEKSWRKDRAKAA"
FT   CDS_pept        379587..380615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73821"
FT                   /db_xref="GOA:C4XH53"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH53"
FT                   /protein_id="BAH73821.1"
FT                   /translation="MLHLLYVVLGLVAVNLAAGWLLSRLPKGRGRTAGMGLLVAVDALA
FT                   LGLIVLELCMALFFAQSDGFNLTMSSRKWFERYWQPVNSLGYRDVEPAPRKDGEKIVMV
FT                   LGDSFAAGHGVDNPADRFGDGLARRLGQGWRVVNVAKIGWDSVDEYEAMAAYPVTPDVV
FT                   VLAYFVNDIYRAAEKSGHSLTFAVRFPQGTLTKYLVDHFALANFVYWRLARMGNLDDAS
FT                   AGFWDRLRGAYADKTVFAAHAAELDAIVAWCRERRIRLVALLIPSLSDVAGSAAMTARV
FT                   AGYFGERGVDVLDLTPLIIDKKPGELVVNGVDSHANVGLNAVMADLLYRALAPAPVPAP
FT                   GN"
FT   CDS_pept        complement(380698..383691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03310"
FT                   /product="putative signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73822"
FT                   /db_xref="GOA:C4XH54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH54"
FT                   /protein_id="BAH73822.1"
FT                   /translation="MTLVAVHRARYGARMTPPQHPFGQRIRERRLARLATDPAFTLRRL
FT                   AGRLGIQPSYLSRLERGAAPSLSEDNIQALARELGDDPDILLALAGKLPADVRQALLAA
FT                   PGDLLPLVRGLVRNPALAPGSSAQLWQSYRESQHLARVGSFVRDLVTGQDSWSEEFFRI
FT                   FGLPLDDPTPTFEDFMTLVHPEDQPAVAAVRARLMADDGPVQYAYRFRRGDGLWRHAKA
FT                   VARCERGPDGRARRIHGTVQDVTTERQALSDLRSVAQFPEGNPNVVLRLARDGRLTYAN
FT                   QASAGLLETAGLTVGDPAPAPLAAAVAQALETGRETSLELPDGEKTQRLTVIPDSAQAH
FT                   ANCYGRDVTAELALAGRVHELSRELAETRASLDAVLEASHDGVVLVRADGFVLRGNAAM
FT                   AQSLGRTDGPDALPGLHRNDVFGPDTAPMVEHDDLAVMAADRPSLLPPPVNVVVSDGST
FT                   RALQISRAPLRDADGRVAGFCAITRDITQWRQAAEALADSQARHQRFFDDAVLGVFRTT
FT                   AEGRILAVNPALARLFGYASPEAMLAEMGDDVSAGFAEPEKRRDVVRRLASKEGLLDFE
FT                   NVYRRRDGTTFIGALHARMTTTPAGERLIEGFVEDISERKRIAAELAASEERLKTHLRN
FT                   FPLPSFTFAKRGRDLVLADANKAAEALFRGRASAMLGSSAEAVFADAPDVYLALWSALE
FT                   GRRGDRRALALRPPGASEPGLFDMTFVFVAPDTVMLHAEEITALARMRESLQRTSDQLR
FT                   SILDHVPCAVYFKDTAGRCIMVNRAVAEAFGLPDEPLANLPGGSIHEPETAVRIADDDR
FT                   RILASGQAETFEEDVLVRGRPRRFLTTKTPLHDEQGQPYALCGMSLDITERVELARVLE
FT                   AERDTLRTILDHVPYAALLAANDGSTLFINHRFTALIGYSRHDIPHVAAWLPKAYPDPN
FT                   LRARVEADWRACQGVDCRRIYPVRCGDGRSRWIEFRCTALAEGRMLITLNEADPRRVAH
FT                   WLAPQPAV"
FT   CDS_pept        complement(383779..384327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73823"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH55"
FT                   /protein_id="BAH73823.1"
FT                   /translation="MTADKPRAIPRRHLIRALLGRDVPSAPAPEPERTVPAAQAADPHA
FT                   AGNAAYAAGDYAEAAAAYRASVRGDLSNPLVRARLGYALYATRQLIQAKVEFEHVLHLT
FT                   NGGDAFARLCLGLTLAALGKTDKAAANLEAFDASQAEELTALSRRIAAKLRDIGNGDPA
FT                   PLLLTLERSARAMGFLPEA"
FT   CDS_pept        complement(384345..385295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73824"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH56"
FT                   /protein_id="BAH73824.1"
FT                   /translation="MLGQGLDLDDVAASPALPCLAPERQLFDAAAVDPAELVSGDVELA
FT                   TLPEVHVRLLDALGKDETGPADLAAIIGRDPSLTARLLRLVNSPVYGLRGPVDSITRAV
FT                   TMVGQKELSTLVTGLAAVSAFSDIAPELCDMRMFWRHAAACGVYASLLARSVPGLAPDR
FT                   GFVGGLLHDLGQLVILRKLPAAAGRALILSRVEGLPASEAETAVLGFDHAAVGRTLLAG
FT                   WNFPPALIAMAGDHHHPDGAPGSRETALIHVADILAQAWDWPAFSGPPTPALNEPAWHS
FT                   LGLPESVLAEVARDGDAAIAEIESVFFSGPAGRPH"
FT   CDS_pept        386120..386329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73825"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH57"
FT                   /protein_id="BAH73825.1"
FT                   /translation="MAWEHLLENKDSGPQAFLDFVNQRLAKRQRELDAAVKFSSHYAQV
FT                   ESIVMELKAVRTKFVTLMRREGLL"
FT   CDS_pept        386326..386751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73826"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH58"
FT                   /protein_id="BAH73826.1"
FT                   /translation="MSRLALFLAPAMTALLLAAPGPVLGQVPPKVPAPEARAARGAGGH
FT                   DIVGNWTAEALGQTVTASFTRQGDMIYGVVVIPDPLSGGSNTYHVAGVILGDEFAAQHA
FT                   SGHLLKGTLTGPDTAEAVFAPKSGPSLKLRLTRRAGP"
FT   CDS_pept        complement(386929..387141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73827"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH59"
FT                   /protein_id="BAH73827.1"
FT                   /translation="MAQDNTLTYYLEMIEQAPSYQDLVFIRNRIFDAVEATLPKEDVDT
FT                   VKRTWTARAKDESVPVVPPGQGKTA"
FT   CDS_pept        complement(387317..387511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73828"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH60"
FT                   /protein_id="BAH73828.1"
FT                   /translation="MDQERTIILGGVECDYDPQTRIALVYCANCSERNEVEVWLADDGR
FT                   PEYAGFVCEKCGFFNTPEG"
FT   CDS_pept        387634..388758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03380"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73829"
FT                   /db_xref="GOA:C4XH61"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH61"
FT                   /protein_id="BAH73829.1"
FT                   /translation="MSPRPLVLHDAFAFPGGGELVAVTLARAFEADMLTGRFDPAAFPD
FT                   GYFAGRAPVSLEARSRHPLAAKLSLTLAMSLAFEGMPPVAAPLALHSGSLTLLGHGRIH
FT                   GPQLLYCHTPPRILYDHRDFYLARQPAFRRPLWRILAGRYRRRYEAAVRAMDAVVANSE
FT                   TVRRRIRDFLGLDAVVIHPPVDTAAYQYRGQEPFYLSTARVDVLKRVDRVVAAFAAMPD
FT                   KKLVVVSGGSELDRVRAMAREHPNIDIRGWTEAAELRRLMGTAIATIYIPRDEDFGISP
FT                   VESMAAGKPVIGVREGGLTETVVDGETGILLPPDPTPEDVARAVRALGPAEALAMREAC
FT                   QRRAAAFDTTVFMDNMRKLAREVMAGHSHNELQK"
FT   CDS_pept        388755..389870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03390"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73830"
FT                   /db_xref="GOA:C4XH62"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH62"
FT                   /protein_id="BAH73830.1"
FT                   /translation="MRKLRVLVNAVPLATVNTGIGRYLRCLYAAIERDYGRDLDIAYFD
FT                   GKRVSSTPPQPPADLAGRSRLTSLLWKLPPAVGLAVRLARHWQREAVFYQAAKGYDLYH
FT                   EAAFFPFRVPKNVATVFTIHDLSLITLPERHPAERVRYFNRYFHKRLPGVARYLAVSNY
FT                   TKAEMVRLLRLDPERIRVTWNAHEPEVFRPVDGPLPAGLPERYFLFVGTNDPRKNLHVI
FT                   PKALAAAGLDVPLVTAGWSGWSAERLDGAPPVELGYCDDATLAALYSKALALVYPSIYE
FT                   GFGLPVLEAMACGCPAVTTRLTSLPEVAGEAGIYLDDPSDPAAMGQTLARVAADAPLRA
FT                   EASRLGLARAGLFSWAESARRTVEEFEKSVQ"
FT   CDS_pept        389951..390253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73831"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH63"
FT                   /protein_id="BAH73831.1"
FT                   /translation="MSKRWCLEVIEGKKMKDSQGIYYYPNPADKRVRMYVRESFGQVEF
FT                   RLWNREHPEIWERHDWIPYADIEAAAAEYKKRGAGADPLVMYDVNVAKRLLADEG"
FT   CDS_pept        390258..390590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73832"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH64"
FT                   /protein_id="BAH73832.1"
FT                   /translation="MAAGPDYRVYGEIRGLAPEAWERLAGQCPLDTADYADGVLTLEHE
FT                   GRWADVEGFLEALAETFGPEATGHCDAIDNDAWTITRYVVDKGQMTSQTFGINDVLENT
FT                   VKEGNL"
FT   rRNA            391211..392759
FT                   /locus_tag="DMR_r00010"
FT                   /product="16S ribosomal RNA"
FT   tRNA            392830..392906
FT                   /locus_tag="DMR_t00030"
FT                   /product="tRNA-Ile (GAT)"
FT   tRNA            392915..392990
FT                   /locus_tag="DMR_t00040"
FT                   /product="tRNA-Ala (TGC)"
FT   rRNA            393068..395882
FT                   /locus_tag="DMR_r00020"
FT                   /product="23S ribosomal RNA"
FT   CDS_pept        complement(395479..395847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73833"
FT                   /protein_id="BAH73833.1"
FT                   /translation="MLSAVILSEHSYPAMPLARQQVHQRFVHPGPLVLGTTPLNSPTPT
FT                   EDRDQTVSRRFKPSSRTTLIGEQPNPWDLLQPQDVMSRHRGAKPHRRYELLDAISLLSP
FT                   AYLLSIERWPFHSGPPDH"
FT   rRNA            396027..396093
FT                   /locus_tag="DMR_r00030"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(396372..397508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73834"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH66"
FT                   /protein_id="BAH73834.1"
FT                   /translation="MKGDQMKTLIFCADGTWNGPNGDTDGDNLPDATNVFKLFCCLPGN
FT                   NADASLRLQNEQERFDANTRTLAKYLHGVGDSNNPLVKALGGAFGSGITARIIRGYTFL
FT                   SRNYNKGDEIVLVGFSRGAYTVRALAGFIAACGLLDATKVDLSDKMEAYVAAVGAWHQY
FT                   RKQAKGDGIKDIFDWFPSIFTLFQGVKTTGKGSVPIEAVAVWDTVGAHGIPLYIQDKDK
FT                   RYNYFQFADCKLSPTVKHGIHAVAADEERTDFSPTLWEPRDGITQMLFAGAHADVGGGY
FT                   NTTNLESDLSNIALEWMLNELAGLGVAFAPACRQIWGLHPANPLGPSHQPWTEGIWQKL
FT                   GHSRRVFPPGVLLEAPSRVQRKGKTVVLLPSGTSAIYT"
FT   CDS_pept        397673..398758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH67"
FT                   /protein_id="BAH73835.1"
FT                   /translation="MFYGSVGPALDQVGLIGRDDGLLFRWLAGKRACGPGLKSRPMAHH
FT                   LPNASRGTVFTMQTRCAFVFATDANYFFLAKGLVLSIEERMRSLFDCFVVDIGLDDAAR
FT                   AWFAAHGVGVVRFDRKRHVYFLPEEHLPPYADAQLCRPFLREMLSGYDIYLWCDADFWF
FT                   QSCDGMALFAELALRHQEQAVLCPEHHYGLAFTRNQKSAVDAARLWYGEIFDEGVAEAF
FT                   CHLPVLNSGFMALHRASPVWALWAKEIQRGYRKKKRYAFTWHVTEQMALNYVVYSHHLF
FT                   VPVDPIYNYPCAAAAVGHREDGKVIVTYPPYSLLRGVHLLSFQRYAQSYFDGRFLYRHG
FT                   AYLEPEELADVRRRFEKADRP"
FT   CDS_pept        398900..402067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03450"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73836"
FT                   /db_xref="GOA:C4XH68"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH68"
FT                   /protein_id="BAH73836.1"
FT                   /translation="MAPGRRLWALGKLPGPVLGLERLGDRRYATREPKGPSMLRLPGSI
FT                   RLNLILVVLGGVLPVLGVVLGSGWERREHEIVHVGQTTMRLAQYYAHQQASETARLRAV
FT                   LAGLAAEPAVREKNIPACTALFRDVLVGNPNCVNFALMDADGEALASALPFTRQNLAER
FT                   PEFRQAKATGRFSVGEYAIGKVSGVQVLPFAYPVYGASGELSGVLIVTVRLQDIATVFD
FT                   QSMMPAGSFVGLTDREGRRLYRHPPSAQAPVGKPIARDVWDRIRADNGQAVFSAVATDG
FT                   VRRIFAAHSVALSEQEQPYLSILVSIPESIAFEAADAVTGLWLGWAGASLLLATALAWI
FT                   VGRFGIHDPLVRIVETAQRLGGGDLTARSGLTGGRGTLGRLAQAMDRMAQNLEEDRAEL
FT                   VAARDALAREALRRQTLMDSSDDGIVVIDSEHRIVEANRRFAEMLGYEQDAVVGMLTWD
FT                   YEADWDEAAIRSSFNNPLAVRTVFESHHRRKDGSVFPVEVSVNGVAIQGEFYFVSVARD
FT                   ITERKAVEQALRDSEERYRALFENSLDAIALIEGAPLRLQWVNPAFCKLFGLSAEDAYA
FT                   LSAEELWSLAHPDDRRLLRPRLEDRLRQGLDLGRECYRIVCGDGRTRWVEMTGRRLGGE
FT                   SASTHMTIYHDITEEQERAALLAAAKDQAEAASRAKSEFLANMSHEIRTPINGIVTILQ
FT                   LMVASGLTEEQADQARMALAASRRLTRLLSDILDISRVEAGKMAIVQAPFHLRRAMMEV
FT                   RELLLPAGDPPGVTCTVSIDDAVPEIVIGDVTRFQQILTNLLGNALKFTASGTVSVTAV
FT                   AQPDASAGHPQVLFSVADSGVGIPKDKLDSLFAPFTQVDQGYRRDYQGAGLGLAICKRL
FT                   VGLMGGSIGIESEPGQGVVVHFNLTFGLPSDVLPQPAALRPRATVTDRLNLLLVEDEAL
FT                   ARLAIQGMLRREGHDVRTVENGREALTLLAREPFALVLMDVQMPAMDGLEATRRIRSGE
FT                   AGLAAARTPIVAMTAYAMQGDKERFLAAGMDGYVTKPVELGELLAVIDQVLSHRERSGT
FT                   APGAAEK"
FT   CDS_pept        402151..403413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03460"
FT                   /product="putative ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73837"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH69"
FT                   /protein_id="BAH73837.1"
FT                   /translation="MVRWLGLGAVLVVAALAGAGVWWGLSNGKPKPCLDPLGCVEIAPG
FT                   GAIRLGVIQALTGKVAPIGQDQLRGLELALDRKGGRLLDHPVELVIEDTGCRQEGGANA
FT                   ALRIVSDPSVVAIFGTTCSGDAAAAAQVMTEAGLSMISGNNSAPFLTSVGGKRGPKWQP
FT                   GYFRTSSNEEHSGPAAARYAYEGLGVRAVAMVHDGDIYTRGLAEGFRAEFERLGGRTVL
FT                   FAAVDKGDANMRPLLEAVAASKAELLFFPLFQPEGNHVLLTARAMPELVGVKLMSDGAL
FT                   IEKSFIEAVGEASKGMYFVGPTPPAPGPALDALRTQYQAKYRATPATDYYASAFDAAGI
FT                   LFAAITKAAVPGKDGSLVIGRQALRDALAATADYPGLGGKLRCDGFGDCAIPRFNVLRM
FT                   DDPAQGVAGLTANVVFTYSPR"
FT   CDS_pept        403423..405135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03470"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73838"
FT                   /db_xref="GOA:C4XH70"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH70"
FT                   /protein_id="BAH73838.1"
FT                   /translation="MSFRALWDNQGITTKLRLSFAVLFAIFLMGVGAGFVGLAVVRGAE
FT                   ADIVANLELRNGVLEMESQLERARRLYRDFLLQVPLVGFAQAQERYGQPALAAAARVIA
FT                   LSENLRRAMAAMPDGSDMAKRKIDMRFFTSTAKRFSQTLLSENELVILVADPETGLDVQ
FT                   MNAAVRQLGVSLKGWDELAFAVREISVLIQQYQLSRQRPVMQTAVNKVEALRRLIAATP
FT                   GLETARKTEALRLCDTFDKVAARLMDTAVSMSANANDFALQARAVDPIAEDLRRITAVE
FT                   VERAKGRIGWATRLAGGIVLFSALLGLGCIFWVARLLHRAVTNRIVELTRYAGNVRDGH
FT                   FGGAIDMAGSDEIGLLARALADMNGRIHDLVGGLEDKVRQRTLELDAKNRELDAKNQAL
FT                   AVLSLTDRLTGLCNRRRLDQVLSGEWRRAHRYGTPFSVIMIDLDNFKDVNDTFGHAVGD
FT                   AVLLRVADILLAVVRETDVVGRFGGEEFLLVCPETTVEDARVLAEALRRELQDTDFPIV
FT                   GRITASFGLADYEADPGPAALVARADKALYRAKQSGRNQVIVAPTTAAVSRTQ"
FT   CDS_pept        405250..407073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03480"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73839"
FT                   /db_xref="GOA:C4XH71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH71"
FT                   /protein_id="BAH73839.1"
FT                   /translation="MSVCTINLRGISKAFGVRQLFSGISMAVAERERVGLVGPNGSGKS
FT                   TLLKIMAGLAGADSGERTLRQGARLAYVAQHDTFEPGDTVEGVLSRAVEAAFGRAEAVS
FT                   GGRVAALAGRMGFTDPAALVESFSGGWRKRLSIARGLAGEPDVLLLDEPTNHLDLRSIL
FT                   WLEQFLSGAPFAFVVVSHDRFFLENVCTRTVELSSAYPDGVLSVDGPYSALVEAREAFM
FT                   ESQGALERSLANKLRREVEWLRRGPKARATKAKARIDAAGVLKENLAATQARNRAALRA
FT                   GIDFSATGRQTKRLLVAENLARSLGGRELFADLDLVLSPGTRLGLVGPNGSGKSALLRL
FT                   LAGEDKPDAGRVSTAPGLSVVAFDQKREQLDKDQTLRRAFTPDADSVIYRGQPVHLVTW
FT                   AKRFALRPEQLDLPVGLLSGGEQARVLIARLMLRQADVLLLDEPTNDLDIPTLEMLEDS
FT                   LMDFPGAVVLVSHDRSLIDRVSTAIVGLDGQGGVEVFADYAQWEEEFLARERAEAREAK
FT                   AREDRPAKAKPKAATPAKKLSFKEQREYDGMEAAILETEEALEAARAALADPAVASDGV
FT                   ELARRLEAVQTMEAEVARLYARWEELAAKIA"
FT   CDS_pept        complement(407169..407693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaB"
FT                   /locus_tag="DMR_03490"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73840"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH72"
FT                   /protein_id="BAH73840.1"
FT                   /translation="MARNIEIKARLTDRTRVEAAAAALADGPAELIRQDDTFFPCAKGR
FT                   LKLREFATGRGELIFYQRPDACGPKASWYDIAGTDEPAELRRVLGQALGAAGRVRKERT
FT                   LYLIGRTRVHLDRVEGLGDFVELEVVLAEGEAEASGLAEARRLMASLGIDETALIAGAY
FT                   VDLLTASPTNA"
FT   CDS_pept        407855..408298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03500"
FT                   /product="putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73841"
FT                   /db_xref="GOA:C4XH73"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH73"
FT                   /protein_id="BAH73841.1"
FT                   /translation="MGKALVLFGSTTGNTESVAEYVAETLKSEGLAVDLKNAADVTAEG
FT                   LAEGYDLVLFGCSTWGDDEIELQENFVPIYDELEKARLDGRKVAVFGCGDSSYTHFCGA
FT                   VDAIAEKAEQCGAKVVGMALKIDGDPDKAEAVSWAKDVVQSAA"
FT   CDS_pept        408577..408942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73842"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH74"
FT                   /protein_id="BAH73842.1"
FT                   /translation="MACVGGKCMLTSQVRRLREAGMDAMDAGNLEQAETLLRQSVTLAE
FT                   NEAGLDVVTANASYRLALTLHKAGRHDEAAEEFEKALALARGRAGCGSKLYQTILGHFA
FT                   AALPARATPDLACAVGE"
FT   CDS_pept        complement(409152..410330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73843"
FT                   /db_xref="GOA:C4XH75"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH75"
FT                   /protein_id="BAH73843.1"
FT                   /translation="MTEEVFIEVDAAQRNRFGEDICGDAFKTLRVQDEGRVIAVLSDGL
FT                   GHGVKASILSLMTATMALKYTATDADVVRAAEVIMDALPVCQVRKISYATFTVVDIHPD
FT                   GATRVVEMDNPPVILLRAGKALPLDFEEVSSPRYNDRLIRVYDLNMQPGDRLIFTSDGI
FT                   TQAGLGSERMRLGWRIKGCREFVEEVVAKDPSISARNLSQKILSQALRQEPFQRAYDDM
FT                   TAAVIYFRRPRRSIVLTGPPYAAHRDREFAQMLAEFPGRKIICGGTTANIVARELGRTI
FT                   RDSLQVGAISDIPPAAEMDGVDLVTEGILTLTRVARLLEQDEAPREKNPAVQLYDILLD
FT                   SDSIEFIVGARINEAHQDPNLPIDLEIRRNIIRRICKVLEEKYLKETRMSVF"
FT   CDS_pept        complement(410327..412078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03530"
FT                   /product="iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73844"
FT                   /db_xref="GOA:C4XH76"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH76"
FT                   /protein_id="BAH73844.1"
FT                   /translation="MLSHYPIYTIEAECQDCYRCLRQCPVKAIQVENGRATVVPELCIA
FT                   CGQCVAACPSQAKQVRSDLFGVYKLLRSDKLAYVSLAPSWVTEFPDVSPEAMIAALRKL
FT                   GFSGVSETALGAQEVSAAVAGILAQGGPRLLLSTACPAAVDFIRGYMPELVPNLTPLLS
FT                   PLLSHCRMLRRNYGPDIGVVFFGPCVAKKSEADNHPALLDAAMTFTDLKAMLREENIRP
FT                   EDLIPGPADRFMPHPAKEGALYPVEGGMSDTIKAYAGNDKVCFTTLSGIPTIESALQGV
FT                   HNHVLPRPVFIEMLACVGGCVRGPCVSSRRPRLLDQLDVFARAAQPGDDLPVRQPAVSI
FT                   AERKNPSPVDLPVYSEDQYTRVLRLIGKFAPEDEVNCGGCGHESCRGLARAMLEGLAEP
FT                   SMCVHFLRKRAMRKANALLRCIPAGVVIANNKLQIIECNEHFARLFGEETVMAYEASPG
FT                   MEGAALDKIVPFISLFRRSLDTETDIHRDALRFDDRVFSVTIFTIEPRNVIGGIVFDVT
FT                   GSELRRDEIANRAREIIRKNLETVQEIACRLGENMADTEILLRSLAEGFSSGAKPIGDK
FT                   DMRGRRP"
FT   CDS_pept        complement(412171..412413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73845"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH77"
FT                   /protein_id="BAH73845.1"
FT                   /translation="MKHEIVICMGSSCFARGNRKHLLMIEQYLADHGLSESVVLTGSRC
FT                   EDQCRCGPNIRIDGQLYGDINGERLLELLSRHLAG"
FT   CDS_pept        complement(412632..413012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03550"
FT                   /product="putative endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73846"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH78"
FT                   /protein_id="BAH73846.1"
FT                   /translation="MTPRRNISSGSKWEPLLGYSRAVVAGNTVYVSGTVGANADGTIPE
FT                   GAYAQTKRALEIIRDALAQAGADLTNVVRTRLFMADMGDFDAVAKAHGEVFGDIRPATT
FT                   IVEVSKLVDAAFVVEVEALAVI"
FT   CDS_pept        complement(413118..414437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73847"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH79"
FT                   /protein_id="BAH73847.1"
FT                   /translation="MQRKTLNDNAEFACPIVGTCLTIAELRRICRKFGDAVPEAASDYE
FT                   AHVFLVGQAKITASPASKYLQKYLDKKYRKELRMFWKTEDEAELRRLWRERADAGDVPG
FT                   PFWALMSHPTATNELLRDVYGEVHMLSHRVGAANRADLAKLSRLEDKLAETAAALEDSK
FT                   LVLRQAVSVWKTRCRQAMEELAAERTKRQAAERERISLREAIENSAVAAVRRDRDILRD
FT                   QLMELADRLQTTEAEAGRQALLLERMHADLTKTRQELADRDSEVAALEASLFAALGEAA
FT                   AAHAAHAEHHIDDPDGLGDHHDQPHACTGDCPCPAGGCRRDPAAAGSSLHLVGGGLAGK
FT                   RVLYVGGRSSLVSHYKVLAEKFGCELIHHDGGREQSSHRLWELLGCADAVVCPVDCVSH
FT                   EACSLVKQACKGCLKPLILARSSGLSSLARSLAELGAPAQ"
FT   CDS_pept        complement(414630..415688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03570"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73848"
FT                   /db_xref="GOA:C4XH80"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH80"
FT                   /protein_id="BAH73848.1"
FT                   /translation="MAPPRDLRFLEAARTLAMAVVVWSHASNTVFFREGDFSATPLFTS
FT                   CLVTFAVPTFFCISGYLLALFAPAAGDQAARPLRQIKKILPLFLAWNALTLVVLRLAYG
FT                   MPLVSLTALADLATGPAQLYYLFALLQLLALTALAAPFASPARERVWLLAGVATTLGFY
FT                   LASTLALHLSPPASHAFELVAIKIGPVWLGFFGLGGWLARNPQRLDALTRRWPLFTALA
FT                   VCAFIIYWADVDAQARSLGANYRQYFLLSGLAFQLAGCLALLGGCRAAEARAGRLFTLL
FT                   AETGRDTLGIYLAHYVLVLLFYAAVPAPVAPAYRLPLGAAAMAVSFGGSLALARLARRH
FT                   GGAVWARVLFGV"
FT   CDS_pept        complement(415691..416209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73849"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH81"
FT                   /protein_id="BAH73849.1"
FT                   /translation="MFRALIVSLCLVLLSPALPASAASGRHVFGKYAFGESCQKLFTGP
FT                   SFAEEKARPIWDPKYQMFGLVHDPEVTAQSRFTLHYDRDAKPNFEGVPLGRVYYGCDKA
FT                   TGRFSLVVMSHDLLAVPGLVRKATESFGPPTMTTMIQTIWNLPDLYVQIDQVYMIIYDT
FT                   RAGKPGGAS"
FT   CDS_pept        complement(416269..416946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73850"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH82"
FT                   /protein_id="BAH73850.1"
FT                   /translation="MDDTPAHTPAALSAPPAACRRCGRCCRLGGPALHAADLALLRAGR
FT                   LTLADLVTLRRGEGVTDNVAGRVGPSPAELVKLRPATSGRACLFYRDPPACAIHDASPL
FT                   ECRTLFCDAPQALAALYEKDRLTRADILAPGPLAELCAHHEAETDLRRLAAVCRAAAAG
FT                   DEDAREAARAALRFDAAMRELLPARLGVAPETLPFHLGRPLAQALPALRAAAAPAALYK
FT                   RRP"
FT   CDS_pept        417285..418598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03600"
FT                   /product="sulfite reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73851"
FT                   /db_xref="GOA:C4XH83"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH83"
FT                   /protein_id="BAH73851.1"
FT                   /translation="MAKHQTPLLDQLETGPWPSFVSDIKQEAAHRAANPDGLDYQVPVD
FT                   CPDDLLGVLELSFKDKETHWKHGGIVGVFGYGGGVIGRYCDQPEMFPGVAHFHTVRLAQ
FT                   PSGKYYTADYLRGIMDIWDLRGSGLTNMHGSTGDIVLLGTTTPQLEEIFFDVTHKMNTD
FT                   LGGSGGNLRTPADCLGSSRCEFACYDTQDLCHTLTNDYQDELHRPAFPYKFKFKFDGCP
FT                   NGCVASIARSDFSVIGTWKDDIRIDQDRVKAYVAGEFKPGGGSHSGRDWGKFDIVAEVV
FT                   DRCPTGCMSYDGAKLSIDNANCTRCMHCINTMPAAVKIGAETGASILLGAKAPILDGAQ
FT                   MSSLLVPFVVVENPYDEIKEVIENIWDWWMEEGKNRERVGETMKRLSFQKLLEVTNIKA
FT                   MPQHVKEPRSNPYIFFKEEEVPGGFAHDEKAYRQRHMR"
FT   CDS_pept        418615..419778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03610"
FT                   /product="sulfite reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73852"
FT                   /db_xref="GOA:C4XH84"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH84"
FT                   /protein_id="BAH73852.1"
FT                   /translation="MAFISSGYNPDKPMENRITDIGPRHFEEFYPPVIKKNKGQWDYHE
FT                   IVKPGVLKHVGLSGDVVYTVRVGAARLMSVTHIREICEIAEKHCGGHLRFTTRNNVEFM
FT                   VETEAAVEGLLADLASRKFAGGSQKFPVGGTGACVSNIVHTQGYAHCHTPATDASGPVK
FT                   AVMDEMFEYFQTMTLPAMVRISLACCLNMCGAVHCSDIGIVGIHRKPPIVEHDRLDNIC
FT                   EVPLAVSACPTGAIKPAKVEIDGKKVNSVAVNASRCMYCGNCYTMCPAMPLASGEGDGI
FT                   VLMVGGKVSNRISMPKFSKVVVAFIPNEPPRWPTLTKMIKQIVEVYAKEARKYERLGEW
FT                   AERIGWEKFFELCDLEFTHHCIDDFRDPAYYTWRQSTQFKFTKHIEA"
FT   CDS_pept        419839..420066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03620"
FT                   /product="putative Dsr related protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73853"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH85"
FT                   /protein_id="BAH73853.1"
FT                   /translation="MSSEKEQVLEFLTGKTGKSKFYFSDFCKIFPDKKQREVKKILTEL
FT                   VNEGKLEFWSSGSTTMYGMTGAGKQKAEEE"
FT   CDS_pept        420224..421660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03630"
FT                   /product="putative Dsr related protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73854"
FT                   /db_xref="GOA:C4XH86"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH86"
FT                   /protein_id="BAH73854.1"
FT                   /translation="MNYRPRLVLAGLSGGAGKTILSLGVCRALAQTGLRVRPFKKGPDY
FT                   IDAAWLGLAAGRDATNLDPFLLPPERIPSLFLEKSEGCDISVVEGNRGIFDGMDVAGSC
FT                   STAALARSLAAPVVLILDATKMTRTAAAVVAGVAAFEPGLNLAGVVLNRTAGPRHRDIL
FT                   REAIETLAHVPVLGQLPKIAENPIPERHMGLVSNREHDAVDPILDGIAKIVADHVDLDR
FT                   LLAIAQSAPALPDSLPPVCPTSAPAADAGQPAIGVVRDAALWFYYPENLEALERAGARL
FT                   VPVSILDDAPWPELDGLYLGGGFPETHVEAIAASAATRDRVRRLSQAGLPIYAECGGFM
FT                   YLCQGLDVAGMVHPMAGVFPVTTTLCARPQGLGYSLAAVVRDNPFHPVGTVLRGHEFHY
FT                   SKCQAAIGSCPGDVPPLPGPEAFALVMERGVGMLAGLDGLVTANTFAAYTHIHADGAPH
FT                   WAPNFVAAACAYRARGEKKK"
FT   CDS_pept        421732..422805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73855"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH87"
FT                   /protein_id="BAH73855.1"
FT                   /translation="MRVVRQIASPEGLIAWKSELAGVAVEGAEGLDYGRYFDGLEAFVT
FT                   HEPARSLLAGLCGGEPEMVVLRAEKHGALYHPASLTLTVDGRETKLCVNVAATAEARAM
FT                   LELEAGLLTGLRDNFTPEFLPAPHAFAEHDGLAFLLEDWFAGYHEFHQNDAGLVSLWDY
FT                   DTGTRTLSPAQGRELYRQAAAILTRYYHVATGASIGPWHHAAGDFVARVDNAGVSVRLI
FT                   TVRGYGASRDFSAAGELAEKFAALSFFTNMTMRLRLDRVEGVGELVVAGPEVAEAAVQG
FT                   FLDGLGALDLEPQRLAGLLEFLGSFSAEELVRAAEGLAWPCPDDEAALLATAWPDHAAV
FT                   VVAALGRGLGSEREGHC"
FT   CDS_pept        complement(422916..423737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73856"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH88"
FT                   /protein_id="BAH73856.1"
FT                   /translation="MPPSAKSIREDLARAKAAYAKNDELRAVQLLAGAFRSFTAVKLAG
FT                   SDRAPIESLFRECLTNIGKLDGVKKYAPNGVPYLKGQEPKLAAFMATLAKKMEADLAEE
FT                   GLEAMRQRKLRIDHAVIKGTKLLADGNLLEAQRNFRAAVEEYIDEAGLFPLIAGRLIDA
FT                   GHHKASLEYLKRALEESPDNQRIYDFLLQVGGKGEEWAAVERVLLDAKGKTSVPALFDQ
FT                   TLSLAAARLGHWEVAKAAAAQALAADPGLTDAKRVYAAATQKLVQPAAPSQ"
FT   CDS_pept        complement(423857..426523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="DMR_03660"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73857"
FT                   /db_xref="GOA:C4XH89"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH89"
FT                   /protein_id="BAH73857.1"
FT                   /translation="MSLANRLGFSQTPLFLVDGSAYIYRGYHAFRDLARSDGFPTSALF
FT                   MIFRLLFKILKEQEPRHLVFFLDGKGPTFRSNIYAAYKANREAMPEPLARQLEPLRQGL
FT                   SLLGVPVIIPQGAEADDGIASLAARFSSNLPVVIVGADKDLKQCLSDRVVLYDPSGKAE
FT                   KITTLSDFTADCGIAPASWPDLQALVGDTSDNIPGIPGVGPKTALDILRQLPTLEAVRD
FT                   GLDTIKPKVRDKIVPLMEELFIYRELTRLKTDILPETSLDDARLGAPDAKALREFLLAY
FT                   ELRNLARDIPGQPPAAAGSATSAAPAASAGPRAAQLSLFDAPRPDVAQSAGTLSAPPAA
FT                   VPAPVVFTPLDELPDPAGRQLALVPLETGYSLSYGPDEYGIDPTPDALAAFLARADRAA
FT                   VPSVKALLSASLAFAAVPLAVWFDLGLAAYLLNPESRAYAFDRLRDSLFADPSVDTEGV
FT                   SPTDNARAAALLADVLAARLETAGLSRLVAELEMPLVPVLVAMERAGIGIDKTAFAAFA
FT                   DEVAGRLAILETDIVALAGKPFNPRSSQQLGEILYTDLGLKAHGKTPGGAASTSQDALE
FT                   RLAGAHPLVDRILEFRKLEKLRSTYLAPMPALADRDSRIHTTLNNMATATGRLSSSNPN
FT                   LQNIPIRGEFGRRMRACFTAGPGNRLVAADYSQIELRVLAHLSGESALLDAFAHGADIH
FT                   ARTAAILFDKPEEAIAPDERRQAKTINFGLLYGMGPQKLSRDLGIKLDAAKAFIARYFE
FT                   RLPGLSAFYEGIVEAAKRDGFVTTLAGRRRLLPDIGSANSQLSSQARRQAINTVVQGGA
FT                   ADIIKMAMLAAAGDAALAGLGAVLVLQIHDELLLETPEAAAKEAGARLAGLMTGVISLA
FT                   VPLEVDWGTGRTWGEAH"
FT   CDS_pept        426770..428383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03670"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73858"
FT                   /db_xref="GOA:C4XH90"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH90"
FT                   /protein_id="BAH73858.1"
FT                   /translation="MTAAAKRPHLLLVMGFILSVFTAGSAFAQNGSGSNDRVAKRYAIQ
FT                   QTQDGYGPPPITDPSLETKVEKIPLPDFVKEKQTDPAAPKAGGAAQAGDGQSFDMQQSA
FT                   QRGLDANPQMQSARAQLTGSEDLRRQALANFGPVGTVSYSFQRVDAQVVGSTSLNIPAN
FT                   QIINATQGTNLSTTRTSSTRVGTWQNTYQLQLVATQPLFTGFKLLSSYQKAALTKEQAQ
FT                   ANIKYTELTLVKAVQQAFLTLLQARANVQSNKDSVARLESQYKVAQAYYDVGLKPRLDV
FT                   LQAESDLAQAEQDLLKAENNVLVQIAQLNSLLNLPLNQQTNYLGELAYIPFAMNIEDCL
FT                   DLAYKQRPDLYMAVKSVQIAERDAKIAASPLYPQVQAQAIYQREGNTLDLDVRDNSGGT
FT                   TPETTSFSITASLQAWDWGSTFFGFQAARENVKKLQADLAKLRLDIGYQVKTFYLNIQD
FT                   AAKRISVARTALEASKEGYRMAVARYQAQVGTSTDVLDAQARVSTAEYNLTQALTDYQS
FT                   ALADIYVAMGMKKLDLAAAQ"
FT   CDS_pept        complement(428943..430136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmeB"
FT                   /locus_tag="DMR_03680"
FT                   /product="Hme subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73859"
FT                   /db_xref="GOA:C4XH91"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH91"
FT                   /protein_id="BAH73859.1"
FT                   /translation="MLEKALKGSPRYWGTLIALGLVMALGLGFWLYQLTFGMKITGLNR
FT                   DVSWGFYIAQFTYLVGVAASAVMLVLPYYFHHYKEFSKMIILGEFLAIAAVVMCLGFIV
FT                   VDIGQPQRMLNVLLNATPHSVLFWDMVVLNGYLFLNIIVGWTSLQYFKNDMTPPKWVKI
FT                   LAIVSVIWAFSIHTVTAFLYAGLPGRHYFLTAIMAARFLASAFCSGPAILLLLTLCLRR
FT                   LTGFDPGQKAINRLAVIITYAMCVNIFFFLLEVFTSFYSNMPGHIAPFKYLFTGIDGHD
FT                   MMVPFMWTAVVLGLGCLLFLIPTPIRQNPTALTIGLIMLVIASWIDKGLGLLIGGFTPN
FT                   PFETVTVYSPTVPEIMISLMVFALGGIVLTVLWKIAIEVRSEVEGGNLSMVPPPAAE"
FT   CDS_pept        complement(430145..430921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmeA"
FT                   /locus_tag="DMR_03690"
FT                   /product="Hme subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73860"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH92"
FT                   /protein_id="BAH73860.1"
FT                   /translation="MKSNRREFLKLAAVSAMGIGAARLGFLGDAPAFAESVPTVANFEE
FT                   GLKAKHWGMAIFTAKMTPEMNAKCRKACHTEHNVPDIAGPKEIKWFWGANYEETFPTEH
FT                   GHYLSEEIEHRQFPLLCNQCEAPMCVKVCPTQATFQRPDGIVMMDFHRCIGCRYCMAGC
FT                   PFGARSFNFQDPRPFIKSFNPLFPTRMRGVVEKCNFCAERLAIGKLPVCVEAAEGALVF
FT                   GDLSDEQSDIRKALREHFAIRRKPDAGTSPSVYYIL"
FT   CDS_pept        complement(430961..431377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmeE"
FT                   /locus_tag="DMR_03700"
FT                   /product="Hme subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73861"
FT                   /db_xref="GOA:C4XH93"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH93"
FT                   /protein_id="BAH73861.1"
FT                   /translation="MYNAKYIIPGIIFFLALAFVPVVYNMGHKFEVTPELPKDQKDCVL
FT                   PTQEMRDKHMQLLNEWRNEAVRDGNRIFVNAKGQKFAKSLTNTCMSCHPDKAKFCDRCH
FT                   DTVGVAPYCWDCHNLTPDQKSPIPPVAQAATGGH"
FT   CDS_pept        complement(431381..432994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmeD"
FT                   /locus_tag="DMR_03710"
FT                   /product="Hme subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73862"
FT                   /db_xref="GOA:C4XH94"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH94"
FT                   /protein_id="BAH73862.1"
FT                   /translation="MAKYPPPEELIKINYTTPVKSWMDTKTAFKPGNFSYPGKPDILKY
FT                   LGMPNPREWTPTDDDWKLPPDWQRIVMEKFRSLLKKYRSFKIFMDICVRCGACADKCHF
FT                   FIGGGDPKNMPVLRAELLRSIYRGEFSAAAKVLGKLAGARKLEEDVIKEWFLYFYQCTE
FT                   CRRCSLFCPYGIDTAEITMMARELLHEVGCNINWILEPAANCNRTGNHLGIQPHAYKDM
FT                   MDFLCDDIEEITGKRIRPNVNKKGCEILFITPSGDIFADPGIYTYMGYLILFEHLGLDV
FT                   TWSTYASEGGNFGLFTSDKMMKKLNAKMYAEAERLGAKWILGGECGHMWRVINQYMSTM
FT                   NGPADFLETPVSPITGTKFDAAAGTKMLHIAEFTADLIKHGKLNLDPSRNDNFKTTFHD
FT                   SCNPARGMGLFEEPRYVLKNVCRYFYEMPENTIREQTFCCGGGAGLNNEEFTETRLRGG
FT                   LPRGNAVKYVRDRHGVNNLACVCAIDRATLPPLCDYWAPGVGVSGLHELVGNAIILDGE
FT                   KKRTTDLRQNPLPGMEDEEE"
FT   CDS_pept        complement(433040..434041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmeC"
FT                   /locus_tag="DMR_03720"
FT                   /product="Hme subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73863"
FT                   /db_xref="GOA:C4XH95"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH95"
FT                   /protein_id="BAH73863.1"
FT                   /translation="MAAFYSFLAVLALIVIPWLGVGMGMGALFGIVLPYIAIIIFMVGF
FT                   TMRIVDWAKSPVPFCIPTTGGQQKSLPWIKNSPWDNPYDKKGVFMRMVLEVLCFRSLFR
FT                   NTSVKLQQEGPKVGYSSEKSLWLFALIFHYCFLLILVRHLRFFMAPVPYPVHIAEFLDS
FT                   ILQIGLPVMYQSDALILAGLLFLLARRVFDGKVRYISLMQDYFPLLLLVGIVVTGIWMR
FT                   YVVKVDVIAVKELAMGIVTLHPHMPKAAIDPSVYAHLTLVCALFIYFPFSKLMHMGGVF
FT                   LSPTRVAPNMSRRAMWVNPWNDPSIKPHSYAAYEDDFREKMIEAGLPVDKQA"
FT   CDS_pept        complement(434078..434620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73864"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH96"
FT                   /protein_id="BAH73864.1"
FT                   /translation="MLKLVDHLVLDQQAVLDAWFDLILGTYSENTAVLWKKRDDPFANP
FT                   VRHRFEAGMRGIVVGLATCGQTPDVETFGPYLDEIVRVRAIQDFTPSQATAFIFLLKKA
FT                   VRETLWEKIAEHDLFVELLALESSIDVLALFAMDIYCQCREKLAALRIDQIKKQYDRLL
FT                   KRANLVCDLSAEGGEAQ"
FT   CDS_pept        434737..435309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73865"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH97"
FT                   /protein_id="BAH73865.1"
FT                   /translation="MPVYGAFARLGKKRADMQTTAAHVDILRAAAAFSSIARYNGTMPR
FT                   RQALHYDKTRLAELEDAGFLERVKLSFPCGKDVEGWRITAGGRFALAGEDAACALEPEH
FT                   LRILSDIYHYSKLSKNRGMMPKELAGEFDGDDVRDLFLHGYLLRINLKGTVKAKGWVVS
FT                   QKGLDALRRVGHRAPACAEDGPRTTAS"
FT   CDS_pept        435555..437273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03750"
FT                   /product="amidohydrolase-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73866"
FT                   /db_xref="GOA:C4XH98"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH98"
FT                   /protein_id="BAH73866.1"
FT                   /translation="MHRLALAFSLLLFACSPLAAAAPPAAAPPDVIFRNAVFATCNPAG
FT                   DLARAVAVKGGKFTAVGTEHDILALAGPDTRVVDLGGRFVSPGLIDAHTHPMETVYLLK
FT                   DWVDCRYPGVPSVAQALANISAWAAKTPKGQWIYAACVSASENKFAEKRLPTRDELDQA
FT                   APDNPVVLANGAHQVVINSAAIKALGIQKGQARMARGASVILDGDGEPTGVVLDAQADI
FT                   PTNPTPATLAYAYETGIADMWNAKGFTSLMAITPAAALPVLQKTAVSGEKPRIRYTVSV
FT                   WTAPNGADMPESLAAFAMPAGADPAFYRFAAIKAWMDGENDARSGYMCEHYLGHRPDDA
FT                   PGGRGSLVTTAAQAERFVAIAAKNGLAPMLHCSGDAAMDLGLSTYETLLASGARPPLMR
FT                   IEHFGMFQLKDDELARAKALFPKGLRISVQPMWMTELVRADFENMDKGLAASGFRFKTM
FT                   VEAGLRPAASTDMTGIYPGNLEPVKAMAACVTRASDAGVFLPAEALSPEQALRMWTIWA
FT                   AESLGEDAVKGSIEPGKFADLTVYSDNLFTMPGDKLATAQVTRTIVGGETVYQTP"
FT   CDS_pept        complement(437292..437795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73867"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:C4XH99"
FT                   /protein_id="BAH73867.1"
FT                   /translation="MEETLRLLALRLGEALSARGWLLGCAESCTGGLLSSVLTDAPGAS
FT                   AWFAGAVVAYANGVKRDVLGVSQAVLDAKGAVSRESVLAMTRGARGVLHADAAIAISGI
FT                   AGPSGGTPQKPVGTVWMAWEGPDFTDVQRFQFAGDRLAVKRLAVAAAMEGLLARALQTA
FT                   GPEG"
FT   CDS_pept        438088..439377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="DMR_03770"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73868"
FT                   /db_xref="GOA:C4XHA0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XHA0"
FT                   /protein_id="BAH73868.1"
FT                   /translation="MLDLKFLRQNPEAVAAGLARRRFPFDLDAFLALEERRRACITAAE
FT                   QKKSQRNAASAEVAKAKRAGGDASAALAGLGALSDEIKALDEDAKAIDAEVAALLLGVP
FT                   NLPHATTPDGASEADNPEVRRWGQPREFTEFAPREHQDVGAALGLDAERAVKLSGARFA
FT                   VLRGALARLERALAAFMLDLHTGSHGYVEVVTPYIVTDECLVGTGQLPKFAEDLFKLEG
FT                   RAAYLIPTAEVPVTNLHRGEVLPESALPLGYTCHTQCFRSEAGSYGKDTKGLIRLHQFG
FT                   KVELVRFVHPDTSYDELEKLTNQAEAVLQALELPYRVVALCAGDIGFSSAKTYDLEVWL
FT                   PAQGKYREISSCSNFEDFQARRADIRFKPDGGKKTAYVHTLNGSGLAVGRTMAAILENG
FT                   VQADGSVVLPRALVPYMGGLEVLEPEGKRA"
FT   CDS_pept        439374..439562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73869"
FT                   /db_xref="GOA:C4XHA1"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA1"
FT                   /protein_id="BAH73869.1"
FT                   /translation="MMTEEQRKVFWGEVKRGLLVGGAVGVLGGLFFMDMRRGLVLGLIG
FT                   GFFAVLTRRSIEKRRGR"
FT   CDS_pept        complement(439700..440278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73870"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA2"
FT                   /protein_id="BAH73870.1"
FT                   /translation="MRYTGINHLAMATADMDATIRFWRDLLGLRLVAGLGRPGYRHYFL
FT                   EISPTDMLAFFEWPSVEPIAPKDHGVPVKGPFAFDHLSIGVRDRNDLWDVKDRLEAAGF
FT                   WVSEVIDHGFIFSVYSFDPNNIAIEFSCPVPGVDISSHPIMADRHPSATAQEGAEPQPG
FT                   HWPAPTPTPPVERRIYPGEGRELVLVEDE"
FT   CDS_pept        complement(440308..441165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="DMR_03800"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73871"
FT                   /db_xref="GOA:C4XHA3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA3"
FT                   /protein_id="BAH73871.1"
FT                   /translation="MDIEAVCGKSVPFFKMQGCGNDFVCVDNRVLGIDPAAMPDLVMPV
FT                   CRKAFGVGADGMIFFDHAPEGSGLAYIWHFFNADGSRAEMCGNGSRCAARLAWMLGIAP
FT                   AKHVFGTDAGPIEAEVDPDSNQVTVQLTPPKDLRMAIDIEVEGRPFHLHFVNTGVPHAV
FT                   AVMDHLELVDVWKLGRAIRQHQYFAPAGTNVNFISSEEKGTLSLRTYERGVEDETYACG
FT                   TGAVASAIVARELGMTGEETDITTTGGEVLGVILRDGKTYLRGAAELVFKGEFYPQSLG
FT                   IDTE"
FT   CDS_pept        complement(441355..443139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="DMR_03810"
FT                   /product="putative para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73872"
FT                   /db_xref="GOA:C4XHA4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA4"
FT                   /protein_id="BAH73872.1"
FT                   /translation="MLGEAVFFSAAGPDGYSPWGWSRAFAAPAWHGQAYAAAEVIPLLE
FT                   RAGREQERGRWLVLALAYEAAPAFDPVLAVHAPAPGEPIAFAAAYDAPLPRPPRPGFAP
FT                   LPAAPFFPSLARPDYDRAIAAIRGELGRGEAYQVNYTFPLSGPAPADLSAWFAALAVRQ
FT                   QAGLCCRMDMGGRVVLSFSPELFFTRQGHRLTVRPMKGTAPRAADPEADAAAARALAAC
FT                   PKNQAENRMIVDLMRNDLGRLAVPGSVAVPELFAVEPLGAAWQMTTTVTADISPATGLI
FT                   DVLRALFPCGSITGAPKAAAMRLIRERETGPRGLYTGALGFVAPDGDCAMSVAIRTVVV
FT                   DTARRTAVYGVGGGITHDSRAGDEYAECRLKARFLSDPAAGFSLLETLRLDAGRLSFLP
FT                   EHLARLAASAAALGFAYDAAAVAAALDTAARHPGRARLRLTLSPLGEVAVTRHPLPARL
FT                   GRPARLGLCPEPVDPADPTLFHKTTRRARYDAALAARPDRDDVVLCNTLGEVTESCRAN
FT                   LVVRLDGRLLTPAAECGLLPGTYRARLLARGVVAEARLTPADLQRAEAVWLVNALRLWT
FT                   RAVPDFQAPAVGIALGLP"
FT   CDS_pept        443268..444542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73873"
FT                   /db_xref="GOA:C4XHA5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA5"
FT                   /protein_id="BAH73873.1"
FT                   /translation="MSARRVREKVMRGRLLKIFMVILVLVPVGLTAYLANSLYHRKGVP
FT                   QALENLTRQLFQSKEEEKKAEKRAQDLERKTEELQTAYDALVADLRGEVDSRQIRVRQF
FT                   REKLEINFVDKILFPSGSAEISPRGRDILTRVGAVLAKVKDKSIYVVGHTDNVPIHSAL
FT                   FPSNWELSASRAASVIRHLSESGGLAPERFTAMGRAFYQPVASNATPEGRQENRRVDII
FT                   VADVPLLAGETGSQSMRGTVSGGAAGTAGAPAAAGAPGTPGTSDVGATASGSESGSAAA
FT                   PAGPETAPPADGGAPAAAGPDASKPLRETAPPAGQTVAPPEPADRTPASPQDQAKAAAQ
FT                   DAAAKAAGSEAAPAKDDGQTASSEAAPAKSEDAKAAPEGAPPAAGPAKPGGASPSATSE
FT                   PSSGNAPDLPPPLPDKPAPAGPSGS"
FT   CDS_pept        complement(444955..445272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73874"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA6"
FT                   /protein_id="BAH73874.1"
FT                   /translation="MPDIPYDIKEQIIDLSKRIPADRRSVFISAAKKRLDGVSTSYTAK
FT                   WAIAGMAIGYLIDLLPFFEDATEIGGLLGAAIGQIKDQKVKEEAERLKLLIEESFREAM
FT                   A"
FT   CDS_pept        complement(445633..446403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03840"
FT                   /product="peptidase M22 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73875"
FT                   /db_xref="GOA:C4XHA7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA7"
FT                   /protein_id="BAH73875.1"
FT                   /translation="MANLPLPGPGKLLVLNAVAPALWVTCGRPGQDVVHRRAEATGRCA
FT                   EVLAPLIAKVLAEAGVRPAELGGLACVRGPGSFTGIRVALATALGLSLGANVPMAGLDH
FT                   LPLLAATAAAKATGAVVAITHARSGQVYLQSFLADGDLMPMGAPQALTVAEAAARAVDG
FT                   AAVGPLWLVGDGVARYRDAFLAAAPLAAILGPEYDSPSPAALMAAAASASYGFTPVEPL
FT                   YLRPSDAEENLDAIAAHRGLTRHDAEARIRQAME"
FT   CDS_pept        complement(446396..447475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03850"
FT                   /product="putative zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73876"
FT                   /db_xref="GOA:C4XHA8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA8"
FT                   /protein_id="BAH73876.1"
FT                   /translation="MIESIVAVALVLGGLIFFHELGHFIAARAFGMGVTTFSLGFGPKI
FT                   FGFTRGKTRYILSAIPLGGYVQLVAQDPDDTAPDDFPPETHFRLRPAWQRMVVVAAGPI
FT                   FNFVLAWLLFWGLLAADGRFEMLPIIGQVQKDSPAAVAGLAPGDVVTSLNGGPVANWDA
FT                   LSTAIRGSNGQPVKLTVSRDGKDETFVLTPTLRTVKNLFGEEETVPLVGIVASGKTRTV
FT                   PLGAGSAAAEAVKQTWNVVVVTYTGILKLIERVVPLDSIGGPIMIAQMVSKQAGEGLGN
FT                   VVALAALISVNLGVLNLLPIPVLDGGHLLFYAIEIVMRKPVSPRMRVLTTKIGLAFLIG
FT                   LMLLATVNDIRRQLSLIDG"
FT   CDS_pept        complement(447602..448864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="DMR_03860"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73877"
FT                   /db_xref="GOA:C4XHA9"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHA9"
FT                   /protein_id="BAH73877.1"
FT                   /translation="MTPISAANAAGPCPCPGQGYISSLSARDPGRPRRLALLGATGSIG
FT                   VSTLKVAAEHPGEYDVVALAGATNVKLLAKQAAAFRPAVLAVIDDARAAALAELLPAGY
FT                   RPDILTGPAGYAALASAPEVDLVVSAIVGAAGLGPTLAAVAAGKIVALANKESLVLAGD
FT                   LIRAAAAASGAVILPVDSEHNALFQALGGVGLPDLPLVEKLVLTASGGPFRCADRACLE
FT                   TVTPAMALAHPNWSMGPKISVDSATLMNKGLEVIEACRLYGLPVSQVDVVVHPQSIVHS
FT                   LAQLHDGSLLAHLGPPDMRVAIAYCLGYPRRLSLAVPRVDLVKLAALTFEAPRDDDFPC
FT                   LGLARQALCGGASHTVVLNAANEVAVDLFLTERLAFLDIPAAIAAALDAHAGQPLPDVA
FT                   TVADLDARVRRETADWAARRR"
FT   CDS_pept        complement(448861..450375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73878"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB0"
FT                   /protein_id="BAH73878.1"
FT                   /translation="MDDTASLDRDGRFAACLERLEELKAIKARREVLEERVFLEFLRAN
FT                   RGRINEFPLLETEQQSLMDMLLRRAEGLHPGHAFLKEHFSAYLIELNHWGKAKAVGDAA
FT                   AQEKLARRLERQETLLAKCLQGAVYASSLVKDNFSDAVIRHFGENSLVKIEEITATMVF
FT                   DELYWRAYIDRFIKEEVLGAYDGILAARRYRLLREGQLLIVVYPFDAVLEGLKGTTKAI
FT                   SKTRVQSSFEEAVSGDDGRQNAEAVLSLCLRADLGDTDKRLDRDELTFAARVGAMDAVA
FT                   GDYREALTDAAEDAEEKRERLGELCVALALGAMVSLRVVREDFSKALRDFSAKEVAWLI
FT                   QAAGYFEAKRLGNVLEHVMELDFAHLLREKGEADAARIQVKPARTRRAAKADVDALAEA
FT                   GLNKIRRKQFFDDDPDQPESLLWRAKNPAEFQEKLKLFQIEPELAKSLVTLWEEAGFKV
FT                   DLYLCINLAALGKVATNLPARVAEILGRYGIAPPGAADPAKARRDA"
FT   CDS_pept        complement(450389..451168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="DMR_03880"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73879"
FT                   /db_xref="GOA:C4XHB1"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB1"
FT                   /protein_id="BAH73879.1"
FT                   /translation="MKNKRVLTAAVGLPVLGAAVWFGGWPLIVLVAVASILGMREFFAM
FT                   TGRPGPVLEIVAYVLGAACVACLGFKLWPALIGLLALALWLEQFDFLRRFAALGETEPP
FT                   RGRLAVALLYVPVSLGLICAFSPLETALVLAVVMAADTGAYYGGHAVGGAKVWPAVSPG
FT                   KTWAGTISGVVASTLVASCFAAVTAAALPALAGLGAGLAVISQFGDFFESALKRAAGVK
FT                   DSGAILPGHGGLLDRVDGLLPAILAYAACRSLSGLAG"
FT   CDS_pept        complement(451276..451767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73880"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB2"
FT                   /protein_id="BAH73880.1"
FT                   /translation="MADGVIDLKKQLKELKAHEKLAGFTGFRLDLGDGGPAKDGVLKIA
FT                   EFVRPDKSGYVTLTFQTDPDPELDRRAALAGVFDRFGRFAQAVDAAAGTARFGPGFEYM
FT                   MVVNDGLVDGDLWFVVEFDLYYQKLAGRLRALIEQAVLPGLAGVMPVVFEPVNWWEGAS
FT                   "
FT   CDS_pept        451911..452867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03900"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73881"
FT                   /db_xref="GOA:C4XHB3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB3"
FT                   /protein_id="BAH73881.1"
FT                   /translation="MSLRDVLPRCGDWAWLAPALPLAPLAPLALCLVLLDSQARTPGVW
FT                   LAVFLGGAAAVGATLLAGRRDAQLAAAERESMVLAEQVLRLGKLAAIGEMAAGLAHEIN
FT                   NPVAIMMEEAGLGGDILADGAVPGAEDLAELRRALGQIETQGARCKEITHMVLAFARTP
FT                   DGRGDAVDVSALVEEMAGLTAKRADYAKVQLATRLAPNLPPAACSASQLQQLLLNLINN
FT                   ALDAMEPDGGELTLETTREGGRLVLTVSDTGPGIPQAVADRVFEPFFTTKAAGKGTGLG
FT                   LSICAGIVRQLGGDIAVSSTPGRGATFRVSLPVAHAR"
FT   CDS_pept        452883..453287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03910"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73882"
FT                   /db_xref="GOA:C4XHB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB4"
FT                   /protein_id="BAH73882.1"
FT                   /translation="MSDAPIRVLLVDDEEGFTEVLAKRLRRRGFHAVVALTGAEALAAV
FT                   AGQPFDVAVVDYRLSDADGLTLLPRLREAQPGLAALMLTGHGSEEAARESLAAGAAGHL
FT                   VKPCEIEELAAAIRAVAPEPAPSPRSESHA"
FT   CDS_pept        453280..453918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73883"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB5"
FT                   /protein_id="BAH73883.1"
FT                   /translation="MHDDVARFDARAAAWDASPHRRKLARDITAAMEAAGLFRQPVASA
FT                   LDFGCGTGLLTLELAERCESVTGLDTSPGMLAELAAKIERAGLPNVGVLEADLAAGTPV
FT                   PGGYDLVASAMALHHVSEPEPVLKRLLAAAAPGARFALADLDAEDGSFHDDPAGVHHNG
FT                   FDRIDLADMLAGLGYTDINAADAATIVKPTKCCGDRPYGVFLMTARKPG"
FT   CDS_pept        complement(454515..455222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73884"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB6"
FT                   /protein_id="BAH73884.1"
FT                   /translation="MRHATLLLLAALVGALLAGCSVEPKMTAQHNVYIDNWTKRNNPEV
FT                   YVEPQKAPPVPVSALIVPFQVTQDIPYGQDLGEQLTRVVWQTWTRDRVFPKLLYEANLK
FT                   NASTPQAVALARKMGIDTVVVGKFTYIMSGGSRGDSGVSLTFDVIDAHSGERLWSMAHG
FT                   GTMETGLTEDYILFLRKNRMPTEPLSAITATLAMDMGSPITNWNYGYKAPPPASPNPPP
FT                   PAPPAGAGAGAGS"
FT   CDS_pept        complement(455244..455579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73885"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB7"
FT                   /protein_id="BAH73885.1"
FT                   /translation="MLSWLQTKWRALSEWRRKVRELHPDAFRAMAGELAELAEVASKVR
FT                   PEEQAFLLKIRRIRQEMRELERLAERPEFRLLSAKKRHELRVSLLSSREQLLKTLSDAP
FT                   VVTTTPQ"
FT   CDS_pept        complement(455660..457339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03950"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73886"
FT                   /db_xref="GOA:C4XHB8"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB8"
FT                   /protein_id="BAH73886.1"
FT                   /translation="MMRITCPQCGFFREIPDAKAPVTPTMATCPKCRHRFRFRPQPTPA
FT                   VEESFVTAEPGVSSWRRPAARQERAATPPAAWESLEEPAVEAAPEDLGPSGPAPVADAT
FT                   FAPDPAPRADAMPQPDEIPAEDDAVPPPTHWEQQPEPRQPLVQRRRLDALDEQDEPAAT
FT                   PRPAKSAAKRQPAPTVRESVATTPQPARQPGLEPKPEPDFSDPDIPDEAPSDIARRIRA
FT                   RVEQGLDPTPAPQPVAAAAPEPEPEAASEPAPAPPRAAKPQTASTPPPRATAPKAETPA
FT                   APQALAPEDAVPPATTNAPADDQPQETTVRADGVRDIWARLQALDDRKAARPHLEHQRP
FT                   AEDEPEEPARETVTDPVPWERQDAYGFFPALILTLRKILFQPLDFFGNLPEGRPKSKAL
FT                   VFNLLISEFLLLIDFMWTLAGLRARIGSPGQNDALSVLGSSPLSFLLALLLVPLVISVG
FT                   IYLDAWVTHLLLILFRSTKKSFDETFRVLCYSAAPTVLTAVPVAGQLLSPVILVWYMAL
FT                   QAIGLKKCHEGAYTQTLAAIFIKWSIYLFLLLAMLQSFTPGQ"
FT   CDS_pept        complement(457466..458788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_03960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73887"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHB9"
FT                   /protein_id="BAH73887.1"
FT                   /translation="MSRIGPPPVPFCPNPGTRDMASRACRRSDATLAWAMIAAAPHPFF
FT                   TYSAEVLAWRLGSGQAVPPPPAAAPEATAARTARVLRALGERRRVALLGLGSGDLAAAL
FT                   AAALPENTGLDVVCLAPDIARKSLAAGRVPWLKPGGPAQLVADASVQAVCHLLWAKGLA
FT                   PENTLVTVNPEPAETGEANSLARVRRLLTAGRLLPDPGPTPTSRPLPTLALLARADEPA
FT                   LGTFFEAARGLACQAVIVWDAAEIPPAAEAAARLDIPVRHLARPLAGDFAAQRNALLAA
FT                   CPPGWVLSLDPDERPGPGFAAAVVRIMACPEAGAAYFPRLTLYPAPGWAKVGHGLWPDW
FT                   QLRLFRTDATPGPRYVRPLHERLEGHPGAAVLALDAPILHHNRLVADAAGVADKLEAFS
FT                   RMAGAARHRLNADYPTLPLDFFTSLVPGGGPGRCLLLPPGL"
FT   CDS_pept        complement(458960..459709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="DMR_03970"
FT                   /product="flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73888"
FT                   /db_xref="GOA:C4XHC0"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC0"
FT                   /protein_id="BAH73888.1"
FT                   /translation="MQNAVKTYLQTQVSTTTQGDLVIMLYDAALKFLHQAKERIAEKNY
FT                   AQKGILISKALDILSELQGSLNVNKGGDLAERLQKLYFFCSSRLLTANLKMDVTKIDEV
FT                   VGILTGLREAFVEANAMVATKAVPTEATQNTRVGVTAAPLGRNHLGAVMGGASLPHPGL
FT                   TTRPLAQVRPAAPTSAVAVAAAVTTPPAAPTRPEVPVASATPPADTAVEADQEAAPSAP
FT                   VVIETPRPAISPVRRAMAAYSQGRATG"
FT   CDS_pept        complement(459749..461440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="DMR_03980"
FT                   /product="flagellar hook-associated protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73889"
FT                   /db_xref="GOA:C4XHC1"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC1"
FT                   /protein_id="BAH73889.1"
FT                   /translation="MSNTVSSYSPITTSGQITYSGLGNGTDFDSMIKKLVQVEQSRITS
FT                   LQTWKKSWTDKQAAFQELNTQMLTLKTSLEDMDSMDEFMTKAVDSSDSTVVSAVAGAGA
FT                   ENGSHEVVVNRLATAKAMVTATGYASASTDINSSSSDAMFAYTYKGVTYSNTVGANCTL
FT                   TDLASIINNDPSNPGVKASVSYDGSKYYLQLRGMDTGSTASLVIASNSTLSGFGNSDFS
FT                   TITSNASAQLKLDGWPTASGSWITRETNSVTDLIPGLTMTLKSTGSATVVTTTDTDAIK
FT                   EKIETFVEQVNLVRTKIQEISRVDSTTQQASLLTGNYGIQLIDTNLKSAVAGLGVGFDY
FT                   DQDKYSTLSQLGILTDAEQGSTTEGLLVIDDDVLDAVLASNADAVGQLFAAQYVGRTSS
FT                   SDFSISSYIKNTTKNGTYKLSYTTDASGKITAATINGHAAMFNSNSNLITGAHGYDEAG
FT                   MVIRVVDTTPGTHTGEVGLKQGKAGQLSDLLGELTDSQDGPLHILDDNYDDITAMIDDK
FT                   IAYEQRRISTYASNLRKRFAKVDSMLGTYDQMQSQLESQIKQLSSD"
FT   CDS_pept        complement(461560..462453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hag"
FT                   /locus_tag="DMR_03990"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73890"
FT                   /db_xref="GOA:C4XHC2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC2"
FT                   /protein_id="BAH73890.1"
FT                   /translation="MALTINSNLMAANAARNLSNSYSALATSTQRLSSGLRINSAADDA
FT                   AGLAIRELMRADIASINQGVRNANDAISMIQTADGALQVIDEKLIRMKELAEQASTGTY
FT                   TSDQRLIIDSEYQAMASEITRIANATDFNGIYLLNGNLSGSTHSGAGINSSGKLKVHFG
FT                   SGNESSEDYYYVQIGTSTASALGLGIGAASGNDGRSISTQQMAQKALEAINDAIVSKDK
FT                   IRANLGALQNRLENTISNLQIQSENLQAAESQISDVDVATEMTQFVRNQILTQSAVAML
FT                   SQANSMPRMAMQLIGG"
FT   CDS_pept        complement(462656..463573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73891"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC3"
FT                   /protein_id="BAH73891.1"
FT                   /translation="MPVTASLAVSFVVDAQPKFRLQAFNLLATLLGSGTVTPQAVQVHL
FT                   VGEHPPDFVRFLAGLSVVAVPTKPYGAAASPYCNKLTQLRSKALAGADHVALLDADVAV
FT                   TGDLSRELPGPGARGKIVDTAAPPLPLLLALLRAAGLPRDAATAPAGFGPGQTLAANLN
FT                   GGVTLFDRETLAAVGPHWLKWTHFTLENARLLGPYAKHADQVGLALALIDLGLPPGHLP
FT                   DRLNFPTHLRPASYRPEHDQDAAILHYHHRLDDDGCLTPLGLPRIDAAQARANALIRDF
FT                   QLRHGRQAGLDALLADWRRSRSRA"
FT   CDS_pept        complement(463585..464703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73892"
FT                   /db_xref="GOA:C4XHC4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR018134"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC4"
FT                   /protein_id="BAH73892.1"
FT                   /translation="MTAAATSPRAMSMRPLACLLAALCLGLSSGYARAGTDASPAVTAL
FT                   VCGALLRDTVPGEGWPAARDVRLGEAVGAADRGLGCRFVVSGEAGQAPVVVAVRLTRPL
FT                   PEGGTAQDIWQAAARPGEPAVAAYALVAGLPVAAGEWTLTLIPPGGQPAVARFQVAGRP
FT                   AEAAASPPAAMPTAPGAKAAVKAAAAAPRPEPALPVAAPQTPPAAPQAAPALPALAAAP
FT                   VAPAEPGDQTARPVVPTAAQTTTPAAAPAGQANTSAPPSPPPGPAKAEPRPKTPPSPKA
FT                   EPAAGYLALQTGLFADADNAAAQAAKLRAQGLPACLAMSDKDGKRRYRVLAGRFGDRRA
FT                   AAAARAEVMAATGVAPLVTPVAASDIPRLRCR"
FT   CDS_pept        complement(464700..466067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04020"
FT                   /product="putative response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73893"
FT                   /db_xref="GOA:C4XHC5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC5"
FT                   /protein_id="BAH73893.1"
FT                   /translation="MPNAVKLRAEQAARRYERIVADYFAEGGLAVLCTDDDSFVRQLKY
FT                   ALGALRVDVKTVLREVADYDDVATLAAKIADRLPVPLLVFLERRLRQTACLKTVRTLKT
FT                   LYGDKIRLVVTTVELSRDELVLTHEIGADSCITKPISANALVEKCAFAVRPNNQLGVLF
FT                   DRAAALLAAGDLDQAARVAAKAFEIKPDSLKAHLLLGDVALAKGDHAQAESHYKDAARA
FT                   EKLYIEPLKRLVEVYTQTGDDAKRLACLTRLDELSPLNFERKAVIGEAYLDLGENDKAR
FT                   AFFEEARKVVGKVASDMVSDALMEMAKRIGERDQETALRFVTEAIEAKGEALGPKDLWM
FT                   FNNRGILLRRQGNWREAAENYRKALSIAPSDAGLRYNLGVAHAEGKDYYTALTHFEEAL
FT                   KLDPDLLLQGPTVGYNIATAYHRCRDLPAAREFLAQTLKRHPGYEPARRLLAHLGQ"
FT   CDS_pept        complement(466086..467285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04030"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73894"
FT                   /db_xref="GOA:C4XHC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC6"
FT                   /protein_id="BAH73894.1"
FT                   /translation="MGGKAKILFVDDDPEILATLKRTFRRKYLAETALGPLRGLEVAAE
FT                   HGPYAVVVADLRMPGLDGLEFFTQLKKLSPETVRIMLTGYADLRAAMDAVNTGHVFRFL
FT                   AKPCPEEELAESLAAGAALYAQATAERDFLKGALRGIIKLLSDLLALQNPEAFARAMRV
FT                   RRLVADMARYLGAPDAWRIELAVTLSQLGGLVLPQDLFAKLRRTGDLAGDEARLFARHP
FT                   GLAGDLLANIPKLDEVAAIIRHQETPHAGAGRDVPLGAKLLKAALDYDVLLTSGRARDQ
FT                   ALDALAGREGLYDPQALDALTALAGEREGLERREIPLSALTPGMILEDDVALPHAAVLA
FT                   TSGQMVDAGWLACLEAESLPGDVRCRVLAPPAEDAPPPGLADPELLALLRRVGRAQGSP
FT                   "
FT   CDS_pept        complement(467320..468603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04040"
FT                   /product="putative sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73895"
FT                   /db_xref="GOA:C4XHC7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC7"
FT                   /protein_id="BAH73895.1"
FT                   /translation="MSSDRAETTMPCDAAQREMALAARDIELLLGSIRSILVTLDGHNR
FT                   VRRFNASAETVFGLTAGSAAGRDFFDLGICWEGPDVRLALEESRRAHAPVRVDEVRCRT
FT                   AAGEERLLGLTVNPVDPAGDEAPGALILGQDLGEIKARELKAIHERRMQAIGRLAAGIA
FT                   HEINTPVQYVGYNAGFLDEAFTELLALLQAHGRLLEAVEAGDAPAVAAAAAEARRVAGE
FT                   TDIDYLRQEIPAAIANTRKGIGQVADIVRAMRQMSHPGTGEMLFFDVNASVRDIVAVTR
FT                   NAWKHVAEVTLDLSPELPLVYGAPHEVSQVLLNVVLNAAQAVEERVAAEPWRHGSILVS
FT                   SRLVPGFAEIAVADNGPGMDEAVRGRIFDPFFTTKAVGKGTGQGLAISHAVMTRHGGGI
FT                   DCLSRPGEGTTFFLRFPLEDGQTQHGAA"
FT   CDS_pept        complement(468600..469523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73896"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC8"
FT                   /protein_id="BAH73896.1"
FT                   /translation="MPGPSNAKPWKRPPCRHRDGPRPEASNEAACRRARTHMSFLGRFL
FT                   VEQGAITEAQLAEGLAYQREKNQRIGEVAVERGMLTAEQAEDIRQRQNVDPRLFGDIAV
FT                   GERQLSRRAVDDLLFLQKIHHTYLGEALLVLGHIDRNQYQALMGRHYALRDKGRVSLRY
FT                   LQEFFAENRVAECLFAALSRALQRWTGEEAAANGLDSAHDPAEFPEHTRIEGTVLGQRR
FT                   FAATIGLSRPLVERLAQAGPGLDAFYATVLHYFGDMLRDKGLRLETGTLLPAAGHPQAC
FT                   QDCLVVRAHTPTGGLGLTFWLEEAGT"
FT   CDS_pept        complement(469444..470259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73897"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHC9"
FT                   /protein_id="BAH73897.1"
FT                   /translation="MAAVPQPDSPPPKAANEPFRGVFSTQTQAFIGFGATKRKVKQNVQ
FT                   VYAEEQADGSYLLRSLNKHFIPSGKPRRVTREQLLSEYLPEPDLYMNKVVPMMRRARQY
FT                   VDAGDAHRAEGELLSAEFEYKNALRVDEEHIRATFGLGLTYLDRGELDNARLVCRRIIT
FT                   LEAAFGEEHKHLFNEFGIKMRKHKMYDQALRYYFKAYRLSKTDDHLLYNIARTYFERDK
FT                   PKLALKFLGMAQAINPAFPEAEALARAIERKALEETPLPSSGRSSARGF"
FT   CDS_pept        complement(470352..471551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04070"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73898"
FT                   /db_xref="GOA:C4XHD0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD0"
FT                   /protein_id="BAH73898.1"
FT                   /translation="MDKPCILFVDDDPEILAAYGRALRKRYAVETAAGPEVGLERLAAL
FT                   PDVAVVVSDLRMPGLDGVEFLGRVRELRPDAVRIILTGFADIDVAIAAVNKSKVFSFLT
FT                   KPCPEEALEEALEAALRQYQLIAAEKELLRGTVRGTIKLLTNLLEMVSPEAFGKSSRVK
FT                   RLAVDLGAYLGIAEAWRLELAAMLSQIGCAAMPAETLRRAYRGDPLPGDKAYEFAMHPK
FT                   IAAELVANIPRLREVAEIIAYQEKRYDGGGLPPDALAGERIPLGARILKVALDFDTLTA
FT                   HYGEKRRSQTPEADALARMRDRDGWYDPEILDALETLATLPDGFEPRQVPTDALAAGML
FT                   LDQDVVALGGTLVLGRGLELNAMSIRRLARLDGERGVKGRWRVLVPPPEQLAFAMMLDG
FT                   "
FT   CDS_pept        complement(471650..472159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73899"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD1"
FT                   /protein_id="BAH73899.1"
FT                   /translation="MFVVVKNGVIAATSPAAPDASSLAAYQGAVVLSVPDGTPVEIGQA
FT                   WDVALDAAKTSACNAIDAEAERRRSLVLTPGAGQMAAYQEKERQARTLLQDDTPTEGEY
FT                   PDIFSEIGITANSAGEVAMAVLAAAEKWRAYGRQVERARLTGKKTVRQAEDVETVIAAK
FT                   DRAVWP"
FT   CDS_pept        complement(472171..473574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73900"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD2"
FT                   /protein_id="BAH73900.1"
FT                   /translation="MRQDMTTPVYDSVAFLASDTFAVFNAAGDSFVSAFAPGLRLRADC
FT                   GTDGVLFGTVASSSHDAETGRTVVATAMDGGAALTANLAEVLHGNDVPESLCAHAALHA
FT                   LGGRDALPAASTGVPGLVALANAAETRAGAEAAKAVTPAGLAAAVKGLITTNTTIYVAT
FT                   TGNDTSGDGSSAAPYASIAKALSSIANKLIASGAVVTIQVADGTYYSNSTITIDHPDAD
FT                   KTQILGNTSTETTVPIASIDTLAQTLTIVGNYLSNADGAKNIQPGDIIGLTGSSTSGLN
FT                   GAYLVSGVSFDGTNTIIACLAEAIASATVGGGVAVIKPCNRVQLNFASGVHGVTFAVPT
FT                   TFKNLKGLRLNSLGGSSRGLYAPRAAAANVGGQLIFHGWAVGVYAASQTIFDLTTAYFY
FT                   GCTTAVLGYMSKANLYTGCVISKCTTGINAQRGSYIFSNSTVFRANTTDTSPALNTAGF
FT                   NGQSYITTS"
FT   CDS_pept        complement(473571..473867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73901"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD3"
FT                   /protein_id="BAH73901.1"
FT                   /translation="MADTIYQGDVGLEILVDCGRDLTGAASPALHVRLPSGAARSWPAA
FT                   VAGPGQDAARLRYVTRPGDLAEAGVYKLQAALTLGDWSGLGRTASFTVRPRFS"
FT   CDS_pept        complement(473875..474393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73902"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD4"
FT                   /protein_id="BAH73902.1"
FT                   /translation="MNGPWSNAAAAWTAVAAAWGKLGGQAAEATVGRPAIALAATGGAG
FT                   AARADNGGENLALRMETRPAGTLAAAQAPVSSAAPGVAGRPAAATGLAELIAARTDLDM
FT                   AGREAKTFAASTALARPAVLAAAPRACLAGTGIREVLRLLSPPTTATRLASPLSTRLGL
FT                   SCAIDIEQT"
FT   CDS_pept        complement(474397..474816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73903"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD5"
FT                   /protein_id="BAH73903.1"
FT                   /translation="MADLIYASFKEGLGKGHFNLAADTVRCALLTSAYVPSAGHAALAD
FT                   VAASETAGAGYVAGGQALSGVAWTLAGTSAALAAADPSWTEASITARYALIYVAKTVAG
FT                   RTNPLVCLLDFGADRGVTGGTFSVRFDASGVLALE"
FT   CDS_pept        complement(474908..476827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73904"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD6"
FT                   /protein_id="BAH73904.1"
FT                   /translation="MSEPNDAAGIVRNKFETAQNYANDAWHSATSFLARLGGLARVAYP
FT                   KDHLPELPAAPQYSGVPQPPELSGVALDTVAAPILPQLKDLDLDGIEIPAFRAVAPDIV
FT                   LPAAPAMELPRPPGDAPNLPDLELPAEPALVLPAPPVFAPLVIPELTTAVTPTFEGERP
FT                   PLPDMSAPGNLYVVPGEERHDSSLRRALAQRLEAEVRAGGAGYGPELEEGLWERAKRRV
FT                   DDALAQKLQEVSDDFAARGATGLGGPMVALLRAARADAAEGLASHSLDLLTKQTEMAAQ
FT                   NGRAAVDQALALEAQDIDLVNQRVARSFEAARELARFGYEGLAAEVAVHNAQLARYQAD
FT                   AAVFEARIRAGLSELEAYKARVEGARLASEVQKQAADLYLAELSGVTAMIGLYKARMEG
FT                   AAAKASLGRDRLSAYEAQVSGYVVAVNANTARFNAHAAALAGEEAKARIYAEQVRAYGG
FT                   EVEAAKTAAETRLAVAARENDTRLEAYKADVARFEAELRQAQAKADTLLKEKELALGLY
FT                   DAVLKADGAQNELRSRDHAAQVDAFLKSAEASIKEADMLLQNSLGELRLESEKIRSGAQ
FT                   ISAQMAASALNAVSATAQIGFSESVGERTTTTTSDSTQRSVSESTSRSTGSRESFNHNY
FT                   NYRV"
FT   CDS_pept        complement(476824..478242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73905"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD7"
FT                   /protein_id="BAH73905.1"
FT                   /translation="MDDDFTPTPRLRLAVGGDEPARLRRAGLRELDIMRRENVFDLPVY
FT                   ERRSRLATGETVLCRLVGGQEYVTLGPSRRREPTDEPRTAPAPKRRRDGDFYAIPDCLA
FT                   RYEGLAALQNAVPHGSLAGWTLGLGAAVTVIPAAEAGLPAYAGLPQAGISRDVGVFRLP
FT                   GGAASGLLYGREHIPDDAPFSVSCLVRLTAPLEYDYDFDARGVLNPVRAYLLRSQDGGD
FT                   FLKDCPGDLSPLLGFCSPHRHPKWEEDAVYPWSPWNDDFHAAPDRIAGARRASAPCPEA
FT                   PRLTGEAYLDGQGNPYPYPDGFEMGVQAAGVFVTGGNRLLAARLSHFENQFGAAPAVSD
FT                   PLEIGVWHHVVMTHETDETVRLYVVREDQAQGTAYGGKMPLCALDAACTYQASGVNAWT
FT                   LRSGENGEAIAAYRMNAAMDVGLPRFFHYALSPGQAWLLSLEALSGLFVADDHETAQAV
FT                   AQGLTPVTIVKEEA"
FT   CDS_pept        complement(478242..478700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73906"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD8"
FT                   /protein_id="BAH73906.1"
FT                   /translation="MTGEGLSLELASGATTAVSSLPVACACLHNGRVVFSDGVALYRVG
FT                   GDNDDSAAIPVRLTLPPVVCPGPARLGGLALDGLADGRVAITAVSDAGAEAWGELGPAG
FT                   RGGLPGRAACRLGRQYGHVWSISLRADDGATLDVVALEARFTDLDRRP"
FT   CDS_pept        complement(478697..480319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73907"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHD9"
FT                   /protein_id="BAH73907.1"
FT                   /translation="MMASLDEYLFAMEALPEETLAAQSLVVLDLAAAATGTCGVVTAGH
FT                   GLTLPLPAALAQGSWKPAAAARLPLPEIRASQAGWRPGVGETTLPPVQAAATGTIPALA
FT                   EAVLVPLFALAGGAACAALTLPLTVLGLSDLSRRGSGAPRLPGFVVRGQSCSLESPALT
FT                   GVVEAARAVALLGVGDPDLAEAVAGLPSGDDAIALALLDRTARALTYVADADDAWRCAP
FT                   ATLALGRGDCEDGAILLHGLMLAAGLPADRIVTVFGRVGANRDGHAWVAWRRHGDGRWT
FT                   ALDWTLGPAQGPMAALPTMGDPNAYTFVDYALTSGAFFPVRQDVAVFFARAAGDALALP
FT                   LPACRAGAAHGAAGEADLPATWDAAGRTGARAAVALAAPAVVGRAGYVRAVLVCPGLVA
FT                   KALAGERASLPLPGWRTAGFGGGGGQAAAGLPEWAGLGQAVQAALVSGEGRLPYPDCRA
FT                   CGLAGAAGFVLCRLLPPRGAGIGLVGPLGVSVAMLPCLIPDGAGRPESLALGAMALGGP
FT                   AAAGQGRAQRPGLGGRGNGEEWT"
FT   CDS_pept        complement(480303..480497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73908"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE0"
FT                   /protein_id="BAH73908.1"
FT                   /translation="MKQQQSSAPPLVMAEQAGPSGALMTATAGQDADPAGRAVPAAFAG
FT                   LRWRLLPDRSPARGHDGKP"
FT   CDS_pept        complement(480529..481197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73909"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE1"
FT                   /protein_id="BAH73909.1"
FT                   /translation="MTSSLVYYQTGSTVAAAALDPGQTAFYRDLLVRHRFRDALGHVPG
FT                   DDDALLWVEGEVFYSTCGVPGPHSVNTFSVGSSDGRNGCWAPDPKNAVPEYVGVRFDTP
FT                   IRVTAFQFASGLFSNHYCPYGYGPCACPTDFRFEASNDEVSWTTLYAATNYGGMRVATA
FT                   SPFYDEPADYWDDGVFLSERLNCDNDHYYLSYRLVVSAFKPDKNGNYNISELVFYGRTA
FT                   "
FT   CDS_pept        complement(481207..481779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73910"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE2"
FT                   /protein_id="BAH73910.1"
FT                   /translation="MADLYPQSLPCRFEGFPPRIQVVCGRAFSERPGTPYSFGSRVILA
FT                   QTPRSGQTSCVLAVGEPIPTTEIIYADTGDDDEYNLKISHYGLGRFYLADADDAWFRLV
FT                   VVKGIRLEAAGLSRAFETVDIWETLIPATAAVPAPSVTPDAVWLEDATDATETDRVRAT
FT                   WFTGDIPAGGRIVRGRLQLAGDVAVGF"
FT   CDS_pept        complement(481904..482362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73911"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE3"
FT                   /protein_id="BAH73911.1"
FT                   /translation="MALRLSTGLRNMLLGTASFKDIMQNGVIRIFPGVQPATADYGEGA
FT                   TPLLEITVSSGTFTPGTPTNGLNFTAPASGACAKAAGEVWSGAATSSGTAGWFRFYAND
FT                   RTTGADTGHARFDGSVSTSGAQLNMSSTAITAGATTTIDSFVVTMPAS"
FT   CDS_pept        complement(482410..483321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73912"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE4"
FT                   /protein_id="BAH73912.1"
FT                   /translation="MSRVVRLTSCLGLGASAAPVGLVCDPDTGRYALAEAVNVDVVEGR
FT                   LVRRPGYERLAGFGFGELCSGGGDLYGVAGDGLYLIPGQGQPRLLRGGLTPGAPMVWLR
FT                   LGDDVYYANGFENGRLRQGQAQPWAGERYPGPDRLDRFGPPPVGHELAFHAGRIWIAAG
FT                   ALVHFTEGAGLFDWVDALAGYLPPFVGRVRLLAPVTGGLYVGDEAGVAYVAGNDPRTMT
FT                   FARVCPTPPIPGSLARLPAGRHEAVAGEELGGDAAVWAASDGIWLGLPGGVVKRLAAVP
FT                   VPLAGRAAAVATRGRYLLFDRI"
FT   CDS_pept        complement(483318..484040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73913"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE5"
FT                   /protein_id="BAH73913.1"
FT                   /translation="MAMAAMNLPRADAQGIRRAVPDSLAGLTAEVSGIVGDPSVSEDDV
FT                   ARTLGRGLLAAAAAARLPDLAAWAEIPLAPGQADAPLPADLLHAPVDAFLLPARGRVRL
FT                   APDLAVLRRSCPATRPGRPRLAALAGGRLHVRPVPAVDVVIGFEYGRLPAPLAAPGDKP
FT                   EGLPVHLAGPLLVAYACRELFERLEEGADGVKTQTAAYGKRYETLLAELTATSAPRQTA
FT                   PADVPSAADPYGFGEDWP"
FT   CDS_pept        complement(484133..484852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73914"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE6"
FT                   /protein_id="BAH73914.1"
FT                   /translation="MAQPMKLSFTQDVGETSPAKREAVGALRITADGRKFRYAKAGSSP
FT                   VPAGSLVMAPAAVAAHTGRAATPANVGDRVVSLVVGAASVSENAYEDGYLQVAANDGGG
FT                   RQHRILSNTACPAGGTTVITLAEPVRAPLTAASVVSLIPSPWCGATVSASEENLPAGVA
FT                   VCDVPAGHYFFAQTGGVACCLAAGTAAVGSMLVPGPAAGSLAAMNASLDVDQPVAGVAF
FT                   AAAFTDGKHQPCLLTLD"
FT   CDS_pept        complement(484875..485846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73915"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE7"
FT                   /protein_id="BAH73915.1"
FT                   /translation="MSLSLSEIEAITNDYFAAAGGRAVDIYFRNSFLLDLLMNRQAGLF
FT                   ERPAGGEKIRVPLSYSDSEGGFFTRADTLSSDDRVTINAAAFNWKHAYGNATVYLTDEV
FT                   AAAGDYAVVQFVTQKLETAQRTCSGWLAATLYSAAGDEAPTLTGLRALTSPDPDKAYGG
FT                   IAENDLVAADGSKPWKGVTVADAETMSLETLQTLRSAAKVSDGRDGKPNVAVTTEALYN
FT                   KVSRILQVQQRFVTDDGVAQAGFAHLVYEGMVLAADDYCPAGHLFAVNTNHLGFAIHQN
FT                   GFFARQPWVDLAGPAGRSMKILWHGNLICSNRKAHACHANLS"
FT   CDS_pept        complement(485865..486440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73916"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE8"
FT                   /protein_id="BAH73916.1"
FT                   /translation="MEQPTHPAAAPTAGPAPGTAPGTEAGTDPGIAGLESVFSDLEARL
FT                   DALIEARLENLEARRAASQRAELAQRFAAEHPDFETLRENGALAARQRENSLLDEVGAY
FT                   FSHHLAEAGKANQEETERVRQKALAEGEAAAMERLRARRGSVALGAPSGAPQRGRADDP
FT                   QLEAPDRFGGVHAVLAARMAARRRDAGL"
FT   CDS_pept        complement(486620..486988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73917"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHE9"
FT                   /protein_id="BAH73917.1"
FT                   /translation="MPLYDFACRVCDREFEAMAPMDRTENICTCGGSAKRLLSVGRGYR
FT                   ADADWLPSVTAVADKTSPAPHVRAFLAEPSRANYRRFLRGEGIRPQEPGEERARRPDPG
FT                   PAVAREVLERHKARRGLV"
FT   CDS_pept        complement(487052..488806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73918"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF0"
FT                   /protein_id="BAH73918.1"
FT                   /translation="MTDAVNQLLPPAAEPQRVGRRVFELLEAVVRDKARLGLAEAWTRN
FT                   YRLGQGRPWQGPAQPGLPRLGANLLHLHRQRTVNLLTDNHPTFNVSRVSPVGDEDVYRV
FT                   LERAAAWWWNEQEQQAVFERSVINGETYGLAVEKVVFDPELEYGLGEVRTVNVDPFAFG
FT                   VYPTSCLDIQEAEAVLHFAPMSLRQAARRWPEAAGQLKSDAATLADLGDGRREILLGDG
FT                   RRQGLFTRFGEVLRQLAGAGGGDALGQDTVLVCECWARDYTMTDDGPLYPGFIRCVVVA
FT                   GPGSLVLSDQPNPSINPALPLDQAMASYLYDRYPFALANSLTDPTTIWGASDFEQLAEL
FT                   QLEINKCLSQLTYHKDRCARPKIINPRDSGVDNAAFTNRLGIVNPTSMAAAQGIRYLEF
FT                   ANNTRDIESVLTLYRELFSQISGIGELERAASPDHPVVAYKAIAALIEQASTLLRGKIR
FT                   NYSRLVRERGRMFLSHMQNWYAKERWISFAENGAIAIAPLRGEACRVPARLTVVAGSTM
FT                   PVSRVQRREEALALYDMEAIDRRDLLEKLDWDNRAAVLARMEEPGGAPPLLDLPAGGDN
FT                   PPRTPLAG"
FT   CDS_pept        complement(488803..489192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73919"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF1"
FT                   /protein_id="BAH73919.1"
FT                   /translation="MDLWVLRAAGTTAAKGDPNMILRCRLCHAPIAACDPARLIPPLTS
FT                   AVFEPLEPGFPPPFPPDVPWEAARCPQCRHHPQGYAPDGAKSLETDQGTWPLPEPEQPD
FT                   AASPDPKPANPGPIPKRDKPNRRSR"
FT   CDS_pept        489375..489791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73920"
FT                   /db_xref="GOA:C4XHF2"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF2"
FT                   /protein_id="BAH73920.1"
FT                   /translation="MLGMEKKVRAMYGDDVESKVGNPAVEAKETANSARAGLAIGILAI
FT                   VLALGVYVALDAKLSVVTQSVADVPAKVAAMDAKIAAFDALPGKLRKEMAAARLAELAA
FT                   TADALAVTLEGDANKASLAKVSEMIKQLKADVAK"
FT   CDS_pept        complement(489977..490480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73921"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF3"
FT                   /protein_id="BAH73921.1"
FT                   /translation="MPSETSIALRPIGVIRTPYAALEGMPIQPGGARDSLGRVELDPEL
FT                   APALADVDGFSHVYLIYCFHESSGYKTTVTPYLDDTPRGLFATRAPKRPNPIGLSVVEV
FT                   VAIDGNVLTVRGADMLDGTPLLDIKPYAPAFDAPAGPVRSGWLEGRGQTVGQTRSDDRF
FT                   VGPN"
FT   CDS_pept        complement(490493..491338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04310"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73922"
FT                   /db_xref="GOA:C4XHF4"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF4"
FT                   /protein_id="BAH73922.1"
FT                   /translation="MSTFYELATDLFDPLHSFWEHPKTRRVVAVSQVVAFLIGLIGIEL
FT                   NIRGLLPPFLARMTPMSHFYAINLAFTLVLIQEVVDLIFVLPCSVTKSLGKQFEVLCLI
FT                   LLRDAFKELVHLHEPIVLVEAVDVLLPMLADGAGALIVFMGLGLYYRRYRKRAQGKKGP
FT                   WLYPFVATKKFLAFCLLLAFLAYGAWIGWQAMTTGHVHPFFSVFYTVLIFSDIFIVLLS
FT                   HTYQPAFHSVFRNSGFALATLLIRFALAAPAYYAPAIGIAAMAMAYGVSRASEAFEADT
FT                   "
FT   CDS_pept        491500..494154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04320"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73923"
FT                   /db_xref="GOA:C4XHF5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF5"
FT                   /protein_id="BAH73923.1"
FT                   /translation="MKAPRDWSISLKIAIVFIAMLTALSGFTMLYFLYELGQYREASGL
FT                   ELRNRLMAEAKDSQRQAVGQAYDVIKYFYDVSQDDAALKKRAHDHLKAVVDAVAGQAKA
FT                   YYDAHKDAMPREEIEAQLKAMVRQARFDGDNYIWINDLTPRMVMHPTQPALEGQDISGY
FT                   RDPKGTALFQEMVKAAKDKGQGMVAYMWDKPGAKNDPKLKVSYVRLVPELGWIFGSGAW
FT                   VEDETARLQAEAKAQLSKMRLPDGNYFFIYDNTRPIPRVVMHPIRPDFDGKILDTAQFD
FT                   KATSMSPGVQAAAVPYPGGKTNIATGMADAVAATGEGFVSYAWPKPQAGGGETSESYPK
FT                   LSYVKLFKPWNWIVGMGDYVDGIDREVAQEAAQLDQAVRAIVVKLVIFSIVFLIGMAAL
FT                   CLLTVRRLLNRPISAIVSYADKVAGGDLAAAPASGLTAEMASLAASISAMVDHLKTELE
FT                   FAKGILNSVTLPCVVAAPDGKITLVNRWLAHFLGEKKEPEAYVGRHMNDVFASHAIVSQ
FT                   VLGDVMSRREIMTNVEYDGRYAWGERFFIKIDAAPISDGAGRMLGVFAMLATLTKVKLQ
FT                   QEALAEQNRLIAAAANTAEGISAKVADNARDLAERIDRTNEGVSYQRQRTLETATAMEE
FT                   MNASVLEVAQNAGLAAGSADEAKEKARQGSDMVRQVVAAIEDVKAMAETLRGDMAELDK
FT                   TAENIGRVLEVISDIADQTNLLALNAAIEAARAGDAGRGFAVVADEVRKLAEKTMTATR
FT                   EVGQAITAVQQAARRGNQETVRAAEAVSRSTDLAEAAGEALAAIVGMVDSTADQVRAIA
FT                   TAAEQQSATAAEISRATEEVSRIAEDIRAGMDASVDAVRGLNDETRELGQLIEHMQTSG
FT                   EAETDDQPRRLPS"
FT   CDS_pept        494182..494547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04330"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73924"
FT                   /db_xref="GOA:C4XHF6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF6"
FT                   /protein_id="BAH73924.1"
FT                   /translation="MARILIVDDAAITRTMLRGILEKAGHQVVEAADGDAAIAAFRETP
FT                   SQAAFVDIFMPGKEGLATIKELLELAPSLPIIAMSAGSTFTDTETLGWAKSYGAKFTLP
FT                   KPLAAAAVLETLGQIFQ"
FT   CDS_pept        complement(495060..498191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04340"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73925"
FT                   /db_xref="GOA:C4XHF7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF7"
FT                   /protein_id="BAH73925.1"
FT                   /translation="MVNFFIDRPVFSAVISIVITLVGAICILTLPIAQYPQIVPPTVQV
FT                   SATYDGASAQVVEESVATPIEQEVNGAQDMLYMNSVSSNDGRMVLNVTFDISRDLDLAT
FT                   VDVQNRVALANSRLPSEVVSRGISVKKQSPDMLLVINLSSPDGSRDTLFLNNYAKINIT
FT                   DALARVPGVGNVAVFGERDYGMRVWLDPDKLARLGLTSSDVAQAIREQNVQAPAGQIGL
FT                   PPAPPGQEFQLSVQVKGRLADPEEFADIIVRTGKGAEMVRVRDVGRVELGSQSYSAFTR
FT                   LNGNPTCTIQVYQLPGANALDVVEKIRAIMAEQAGYFPPGVSYTIPYDTTKFVTASIHE
FT                   VIKTLFEAVLLVLIVVYVFLQNGRATLIPMLTVPVSLVGAFAFMQVFGFSINTLTLFGL
FT                   VLAIGIVVDDAIVVVEAVQHKIDHEKLPPREATKAAMAEVAGPVIAISLVLISVFVPVA
FT                   FMGGVTGRLYQQFALTLAVSVALSAICALTLSPALCALILRPAGEGKGPLGAFFRGFNR
FT                   VFDACTRGYAAGVRVAIRRMLLTIICLFAVGAGAWHLLVTLPTGFVPDEDQGYFIVNAM
FT                   LPEGASLERNDAVVKQLEQTLSADPAVADVLALGGFNLLTSTYSSYSSVLFVILKPWED
FT                   RATPQLSLDAVMDRTRKQFAGVQEAIVMAFNPSPIPGLGTTGGFQFELQDRTGGPVAEL
FT                   AATAYDFLAEARTMPAVTGLFTDFSVEVPQLFYNLDRDKVQTLGIPPKTVFEALQTYLG
FT                   GLYVNDFNKFGRTYRVMLQAEPRFRTSPADIERFYVRSSADEMVPLSTLGVTKDIRGPE
FT                   YIRRFNLFRTVEISGGTPEGFSSGQSLKSMAELARDKLPQGFGYAWTGIAYQEATSGGQ
FT                   SVFIFGLALLMVFLVLAAQYESWAVPFAVILAVPMAVLGAMGAQMLRGLENNVYAQIGL
FT                   VMLIGLAAKNAILIVEFAKARHEAGDSPAEAAVSASILRFRPILMTSFAFILGVVPMLV
FT                   AKGAGAASRHALGTAVFGGMIAATVLGVYFVPALYCGIQRLVSRGDVKGEKTAE"
FT   CDS_pept        complement(498306..499511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04350"
FT                   /product="efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73926"
FT                   /db_xref="GOA:C4XHF8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF8"
FT                   /protein_id="BAH73926.1"
FT                   /translation="MRRLLLRPLPTCLSLLLLAALACLSGCGDQDAAKKQADAKPAEPP
FT                   AVLVQAKKPVVADVPVYGEYVGRVAAKENIEVRARVEGYLKERNFTEGALVKKGDLLFV
FT                   IEPRQYQENLQKARAELDRQNALLAKAKVDLGRFEQLYKQRAVSRDEYDTRLTNERELA
FT                   ANADSARTAVETAERDLGYTRVTAPIAGRIGKAYVNVGNLVGKGDNTLLAEISSTDPMY
FT                   VDFSISERDYLEFTKAIMANGDKPREYPLTLILADDSIYPLSGDADMADRALDAKTGTL
FT                   AVRGVFKNPQGVLKPGQFAKVRALLEYRKAALLVPQRAIIDVQGSKSVYVVAGNGKIEA
FT                   KAVTLGGSKDGNFVIDSGLTPTDMVVVEGVSKIRPGVPAKIVEAEAQTPAQPPAAAPAA
FT                   KP"
FT   CDS_pept        499523..500575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73927"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHF9"
FT                   /protein_id="BAH73927.1"
FT                   /translation="MAVAYDICFIKKLARWRNHNLQKGREIFASRQRLGQDGGGCRGND
FT                   NIQYVTIAFSCTVNRIRLMRADGGRPYRRQDSPVVGCFLLCSQLTVRPESSKAAGLLTG
FT                   RPLCRIPWPRAPDRASHAKETMMLSPSLRFLGPRRQDYLPGLLDHYVPISRGMALLGEA
FT                   LGRSLAAGQDAGFKVLAGEIDILEAEADKIKRRIRNHLPAGFLMVVDKTLFLNYTRSQD
FT                   NILDAVQEAVVWLGLGEFAMPRDLAEAMIECVAQARRTVELLEPALSETVNHVLAGRSD
FT                   RGEVKGRMHEIRLQHLKVVRSKRSLIAAAYASELEFARVYQIIRFVEYVFRASHSAEGC
FT                   ADILRAMLAR"
FT   CDS_pept        500764..501216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04370"
FT                   /product="Fur family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73928"
FT                   /db_xref="GOA:C4XHG0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG0"
FT                   /protein_id="BAH73928.1"
FT                   /translation="MKPPRSQRLQAIIARLHEGGYRVTPQREAILAAMADSPDHPTAEV
FT                   VHRRLLPYIPDLSLATVYKTLTALKACGEVLELQFSNQDNRYDAARPKPHPHLICQGCG
FT                   TVTDSDLPGVEAMALALAEATGYAITSHRLDFFGLCPACRARGAAD"
FT   CDS_pept        complement(501279..502463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="DMR_04380"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73929"
FT                   /db_xref="GOA:C4XHG1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG1"
FT                   /protein_id="BAH73929.1"
FT                   /translation="MAVILHLDMDAFFASVEQHDEPSLKGKPVIIGHHHRGVVSAASYE
FT                   ARVYGVRSAMPVSEAKRRCPHGVFLPGNRRRYSEVSRIVMETLGRFSPLVEPASIDEAY
FT                   VDITGSQTLFGPPETMARAMKADIREATGLPCSVGVAPVKFIAKIASDYDKPDGLTIVT
FT                   PETALDFLGPLPVSKIPGVGKRAEESLARLGIRVVADIRRHEPEFLARHCGKWGLDLYD
FT                   KAHARGSAVVCTDREAKSVSAENTFEADTADRDILAAWLLKQAERVGRELRQESLRGRT
FT                   VTIKLKFNTFKQITRSRTLAEPTASDSAIFETARALLDAEPLPHPLRLIGVGVSQFGEP
FT                   HRQLALLEPPGKTQARHDAQIDAALDRIRDKFGKAAIMRGRLFEYERNGERKEE"
FT   CDS_pept        complement(502556..502753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73930"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG2"
FT                   /protein_id="BAH73930.1"
FT                   /translation="MDAVSGGSAKPTTSALDQQTMGAQVVTQTLDKLNTDANGKVDADY
FT                   DFQTKVLSAMGKGAHLNTSA"
FT   CDS_pept        502894..505377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="DMR_04400"
FT                   /product="glycogen phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73931"
FT                   /db_xref="GOA:C4XHG3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG3"
FT                   /protein_id="BAH73931.1"
FT                   /translation="MPVASCPVHGLDADDLSCSIREHVAHSLGKRGQEAGCRDVATAMA
FT                   LTLRDRLVDRMLETRDRYRESRAKRMYYLSIEYLLGRCLGNNIYNMNLQGEMAGLLQSW
FT                   GFSLEEIREHERDPALGNGGLGRLAACFLDSLATLDMPGCGYGIHYEYGLFKQSIENDR
FT                   QVERPDYWMAEGMPLQLERRDQAVIVPLYGRVEDHQGPDGGYLPLWVDWQDLVGVPYDI
FT                   PIVGYGDRTVNYLRLFAAKSTDNFNMQIFDQGDYIKAIHQKVYSELISKVLYPSESISF
FT                   GKELRLVQEFFLVFCSIRDITRRFLKQNRNIEELPEFTAIQLNDTHPALAVAELMRLLV
FT                   DERRVPWDRAWNIVTRTLAFTNHTLMPEALEMWSVELMEKVLPRHLQIIYEVNRRFLDT
FT                   VRASGVTDEAKIRRMSLIDENGGKQVRMAHLAVVGSHSVNGVSKLHSELVKKVLFPDYA
FT                   ALWPGKFNNKTNGITPRRWLYKANPGLSGLISEAIGEDWITDLDQLQKLAPLAEDPSFR
FT                   ERFAGVKRAAKAKLADYFAKTTGIVVSPDAVFDMQAKRIHEYKRQLLNAMHVIHDYLRV
FT                   TEDGYVPPAPRVYVFAGKAAPGYFEAKEIIHLICRLSKVINADKRASDWIKVVFAADYR
FT                   VSLAEKLIPAADVSEQISTAGTEASGTGNMKFSLNGALTVGTLDGANIEIREAVGAENF
FT                   YLFGLTTPEVERLLGEGSYDPWEYYRKHPEIRRVLDALSAGRFSPDEPAVFHWMFEKLL
FT                   SRNERYLHLADFMTYLDAHERIGMEYANPDVWMRKAALNVARMGGFSSDRTIREYARDI
FT                   WGIKPFPPKGAAPRA"
FT   CDS_pept        505598..506785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73932"
FT                   /db_xref="GOA:C4XHG4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030894"
FT                   /db_xref="InterPro:IPR034479"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG4"
FT                   /protein_id="BAH73932.1"
FT                   /translation="MIGISKLYCGGVEASDALRYGRHSGKLPSHLLQFSKDKKPVVVWN
FT                   MTRRCNLKCVHCYAKAVDPEGADDIGTVEAKAMIDDLAAYGAPVMLFSGGEPLVRKDLT
FT                   ELASHAVSKGMRAVISTNGTLITRDKARELKSVGLSYVGISLDGGEEVHDKFRGVAGSF
FT                   KKALEGIENCQNEGLKVGLRFTINKRNASEVPLLFDLLREREVPRICFYHLVYAGRGSE
FT                   LIAEDLDHAATRAIVDLIMDRTKALHDAGLPKEVLTVDNHADGPYVYQRLLREDPTRAA
FT                   DVMELLSFNEGNNSGRGIGCISWDGKVHPDQFWRHHVFGNVRERPFSEIWDDPNIELLA
FT                   KLKDKKKHVKGRCATCRYLSICGGNFRARAEAVYDDVWAPDPACYLTDDEIRAED"
FT   CDS_pept        506901..508913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73933"
FT                   /db_xref="GOA:C4XHG5"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG5"
FT                   /protein_id="BAH73933.1"
FT                   /translation="MTLSRFLWPFSPAVRSDPGRPGLADDGPAVRAVFWAILLVAAWLR
FT                   FFHLETPSMWLDEILVPMAARHPVSYLFDLVTTSEVHPPTYYLLVKLLMACGVSDFALR
FT                   SLSATFGLASVAAIFVLSRRHAGLAPALFAMAFLAATPLALYVSRVVRMYAILVFLLIC
FT                   STGFLLAWAQSGSRRDLLRLVGVNLVMTSLHYVSFMILASQFAAVLWIAPRRGGRRPWP
FT                   DIGLYLAGSALAVGLVAPFFISRLLRTHRGQFMGYSYLEAAGNMLAKVGETLWFFPHQW
FT                   PAAVFFALIVLVGLVLAARLRSNLGRVVLCLGVLPVVFLGATKYDYYAFNVWHLSFLLV
FT                   PFSMAFGLAAARLSARVAAQVPAAAAALVLATGLGAWMLGPRYDAFYAPDTAILPFFTL
FT                   SKPLARNLPPLIGQDGAVVFCDMCTLNGYYWYADQYGAGDRIRAQAVEQGQAVRPVRFV
FT                   SGSGSFGGFAKTEAEFLARYGAPASVEKTFQAAVYRFDVAKTPLPAIGALPYTATAEAG
FT                   LTSFFAGVDRAWGLTLNPDWGGAAGPADTGEGGFEYVIENHVAGPQLVVCHQELVNTGR
FT                   GNTYVVRYRFNDESFVEAARLTGPSPAVDLGFVAERREPYKRLTIRVEMVLAPYTADFA
FT                   GGNQSTLGFKRLDVKVIPLEEAVTASAVAGKEGGS"
FT   CDS_pept        508910..509416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73934"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG6"
FT                   /protein_id="BAH73934.1"
FT                   /translation="MTTRAATCVLALLLALAVLGCDSRRPAPLAMLDLFTFRQTTPAVL
FT                   TNIEGLEHDEKGAWRWLLGPEGRVAFASDAARPYTLRFRLMNPLPDQLVTVSLNGRVLA
FT                   TYGPLPRVGWLEPSVAAALTFQARPGENVLAFAVSDWNGRTMAHMPTDARPLAAVFLDF
FT                   LLYAR"
FT   CDS_pept        complement(510264..510485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73935"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG7"
FT                   /protein_id="BAH73935.1"
FT                   /translation="MSATAATVKKAKEIETVVADINLSAEERLAIAVEALADIVAENDL
FT                   TCMRALFRMRRRAEVALARVAAADHPRH"
FT   CDS_pept        510656..511906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73936"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG8"
FT                   /protein_id="BAH73936.1"
FT                   /translation="MAWLPVDALESGMTLASDLKGPDGNMLLPKGIVLTESHIASLRRR
FT                   GVVQADVGSGQDEAMASAANLDPALIEASAQYVVRRFAANDVEHPAVAAVYEAAVLRQA
FT                   RELAAGAPLLPDIFPSPRAESMPDMFFREEGSVKDIVTSEVKLASFPDIYFKIRQILDS
FT                   PTSSPSQVADVVSKDTSLSAKLLKLVNSPFYGLPQRIDSISRAVMVIGGQEISTLVLGI
FT                   SAMNAFKDIPPELINMRTFWEHSVAVGVYARLLGAAAGQGGAERLFVAGILHDIGRLVL
FT                   FKKMPHAAVEAIYYAKANGLPLYAAEEEVMGFSHPLVGGLLLRAWKFPDALVSCVACHH
FT                   KPASCAGNVEPAILHVADFMAVGMGISPPASFVAPILDAPAWERIGVAPERLGELAEAG
FT                   LSQVEEIVSAFFPVRKH"
FT   CDS_pept        511933..512916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="DMR_04460"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73937"
FT                   /db_xref="GOA:C4XHG9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHG9"
FT                   /protein_id="BAH73937.1"
FT                   /translation="MNIGDFHRGRRLRRTEGLRDLVRETELRPADLIQGYFVVDSPDAD
FT                   FEKPIKSMPGQSQFSVERLVARVGQAMDLGLRAAIVFGLPAKKDPAGTGAYADDGIVQR
FT                   AVTRLKETYPSLTVVTDVCLCEYTSHGHCGLLDAHGEVRNDPTLELLARTAVSHVRAGA
FT                   DIVAPSDMMDGRVAAIREALDDAGFFHIPIMSYAVKYASAFYGPFRDAADSAPAFGDRR
FT                   GYQMDPANFREGLREAAADLAEGADILMVKPAMPYLDVLRALRDNFDTPIAAYQVSGEY
FT                   AMLKAAIANGWLDPKRSVLEALLGIKRAGADMIITYFAEEVLPWIK"
FT   CDS_pept        complement(513142..513999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73938"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH0"
FT                   /protein_id="BAH73938.1"
FT                   /translation="MKSAATVLEFVAACFVVACLALLPSVPRAAHGETLAQFQKSNTDK
FT                   SITIQGNQIKFYDLDVTFKKSRDPMTPWVVDAVYKGKKILKSAQTTDTFKQTEIAVNFP
FT                   KQGMSTLVLKLFDGGASCCWAHEVFTYNGVSISYAQVAIGWGGSFSPFAQDGLLETVDH
FT                   SLNGFSDMAPNDVVIDYYPGSHPAPIRYGVFADGGWRPDKPGEFPKRYEELEAAAKKAA
FT                   TAAGSNEQKHLEAATAAYYCLMAGKAKAQCLGDLKANLPQGYQPLAGALLDAIDTSVQK
FT                   FSFH"
FT   CDS_pept        514334..515500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73939"
FT                   /db_xref="GOA:C4XHH1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030896"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH1"
FT                   /protein_id="BAH73939.1"
FT                   /translation="MQHPHSKGSGHPHGMGSGHPGGHPLGHPGGHPQTGPAGAPPLRLV
FT                   AWEVTRACNLACKHCRAEACLDPWPGEFDTKDAKALIDTFPETGSPIIIFTGGEPLLRP
FT                   DIFDLVRHARSRDLRCVMAPNGTLVTPENAREIKASGIARCSISIDAPTAADHDDFRGV
FT                   PGAFEGALRGIEYLKSAGMEFQINTTVTRHNMGNFKEIFKLAEKLGAAAWHIFLLVPTG
FT                   RAAQLGAEIITAKEYEEVLNWFYDFRKTTTMHLKATCAPHYYRIMRQRAKAEGLAVTPD
FT                   TFGMDAMTRGCLGGTGFCFISAVGQVQPCGYLDLDCGQVREKPFPEIWRTSRQFLQFRN
FT                   KEEYEGKCGVCQYHRVCGGCRARAQTMSGNYMAPEPLCDYTPPKAGEE"
FT   CDS_pept        complement(515686..517026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04490"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73940"
FT                   /db_xref="GOA:C4XHH2"
FT                   /db_xref="InterPro:IPR032333"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH2"
FT                   /protein_id="BAH73940.1"
FT                   /translation="MPAAALGRIALALATCLVAAVWLPLGLDALFGLRCVRSIALFSPV
FT                   AGQFLFREYLSPGQEAALTAAEAGLAEHGLLHRDASGKALSRMDFENALPFQYAESLRV
FT                   RGLLPVTIQGREFDAEALRQGRLILGIRPADVAGGRPDPGLYALLDSRPDRVTLVFPED
FT                   RFRLAGRLEFVNADHNAPDPALSEAVNAALAAAGFVFPATAAYGRDTLLKPFDAGWFLT
FT                   DAAGGLYQLRRVRDLPQVARVPLPSGEAVAHVQVQEAAGGTALGLVVGTSGTVYWLGGD
FT                   LGLRALPCQGYDPARHWLKAVIDPFGDACIVDDAAAVAAAYRPAGGGPEIRATRAVPSA
FT                   ASGPGAMVSWLLCPLRLTLAPETSAFVAPTLAVGGLWSVLGAGLWAAVAGAFAWRKGGA
FT                   AAVPLAAACGAAGGLCGLATGFWTPHKPCASPLHDTPVACPADAPNG"
FT   CDS_pept        complement(517036..517716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04500"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73941"
FT                   /db_xref="GOA:C4XHH3"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH3"
FT                   /protein_id="BAH73941.1"
FT                   /translation="MTRALFWKDWLKVRAAFFALAAAHAAAGVWAVVALRAAFAAEHPE
FT                   SVWYQAAVLGNVSFDILRHLPWAGGLALACAQHLPETRGKRLRLTLHLPVTMERALSCS
FT                   LALGLGLCACLAAWDLAVVGLSAAARFPREIVTAHLAALAPWEAAGLAAYLGTTSLLFE
FT                   PTTAGRAQLLLVAASVAAVFLLPAAPGAWGHPGALALGLTLLAALAAVPFLAVSRQRLT
FT                   GKNQ"
FT   CDS_pept        complement(517807..518697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04510"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73942"
FT                   /db_xref="GOA:C4XHH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH4"
FT                   /protein_id="BAH73942.1"
FT                   /translation="MQEQVIEIRGLRHSYDGRVIHKGLDLDVGRGRVVGLLGKNGVGKT
FT                   TLINILMGFLRPAAGRCLVYGEPSHALSPATKSRVGLLFEGHLAYDFMTIDQIERFYCR
FT                   FYPRWNPGRFRDLMARLGLPGSHRIRHMSEGQRSQVVLGLIFAQEPDLLILDDYAMGLD
FT                   AGYRRLFVDYLADFAREGRRTVFLTSHVIEDMERLVDELVLLRAGGEARRMPLAAFRDD
FT                   FRCYILPGNAREVPRAGGAIHNVERAAGGRYEIFSFADAPEVAKALTAAGVSPEGLAPQ
FT                   AMSLEDAFVGYTGRY"
FT   CDS_pept        518790..520484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04520"
FT                   /product="putative phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73943"
FT                   /db_xref="GOA:C4XHH5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHH5"
FT                   /protein_id="BAH73943.1"
FT                   /translation="MNRSRPYSRAGRVAISVVRVARKAGAWKKSKKRRRGGSGVWLGQR
FT                   PEKDNAGGGMGRQSARGRECVVRLGRLTERTLWAVLACLALAVWPALADESCPLGPTAS
FT                   YTASQPGATGRFALFSDVHFSPFADPSLVRELAGSPVEWWRAILARSKPGLSPYGQDTN
FT                   NALFQSFLDDMAARNPRPDFILFPGDLLCHDFWTLYPKLSKDTTQAGLEAFIQKTVAYF
FT                   FGEVARRFPGVPVYAALGNNDSVEGDYRIAAHSPYLSLTVQALAALLPNESARADFGAT
FT                   YPQYGCYAVTLAEAGGVRLVVINNVFLSVKHPDAALGDPVLAFLERELVGAKARGEKVW
FT                   LMAHIPPGDDSMASGAALARKDEDRYKGFLREEQNDAYAKLLAAYAPTVVKAAFAGHVH
FT                   RDDFRIWKTSSGEPAGGMGLAPSISPITGNNPGYQCHTYDRATLELLDVTTYFLDLAKP
FT                   GTGWREEYVWSAAYGRGLRAPADWQATYLDLGQCPARREAFAAHFDLGSPHMEVTETSF
FT                   PAFWRAIASPTRTVWEAWSAPTPLAPWPLAGPGGQPSPAATACPGGS"
FT   CDS_pept        520615..521790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73944"
FT                   /db_xref="GOA:C4XHY2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY2"
FT                   /protein_id="BAH73944.1"
FT                   /translation="MPLPSCGGSLGVSSPSCGVLLLFSSPAGGFAPCRGPVEAGVSARI
FT                   DVLRIVLIGLIVLCHGGRYLGVLVPFDGPVVQFAATAFNRGPACLAVPLFFAISGYLLL
FT                   RKLELTPAGYVQLMGRKLYSIGLPFLLFNAIWIVWFLWVGSIAQFGGRSYILEAGILPK
FT                   LLGYDTSPVNYPLWFLRELLKIFAITPVFLLFLGRLPRAGLALLFVLWFVERPADEYGF
FT                   CGFAFWFYCGGLLARSGLDLGDTARLDRWVLPLFVLATAVVGLAPWLTQDVVAYAVGKR
FT                   FYQILGVVALWCLSRQPWIMGSGLLHRMAAASFFIFLTHEPTVSILQTRLLAVWRPEGA
FT                   AAQLVAFMLPGLVALILLYWLARGLSRFTPKLYAVLTGAPLRKRRAAPTAA"
FT   CDS_pept        521834..522025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73945"
FT                   /db_xref="GOA:C4XHY3"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY3"
FT                   /protein_id="BAH73945.1"
FT                   /translation="MDSREIIRRLEADGWFRVAQAVSHLQFKHAVKPGRVTAPHPKKDL
FT                   PAGTLRSIERQAGISLRS"
FT   CDS_pept        522036..522461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73946"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY4"
FT                   /protein_id="BAH73946.1"
FT                   /translation="MDYIAVIHKDADSDWGVSFPDFPGCVTAGETLEEARRMAAEALAL
FT                   HVRGLAEEGLSPPRPMTLDAVARHPDFADGVAVLVSLPEARPKNVRVNVMLPQADLEAI
FT                   DARAREQGVSRSSFLLRAARAALTGPGAGCGAWSDRA"
FT   CDS_pept        complement(522544..525057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="DMR_04560"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73947"
FT                   /db_xref="GOA:C4XHY5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY5"
FT                   /protein_id="BAH73947.1"
FT                   /translation="MSKYVPEDVERKWQRIWEEGGHFHVEADPSKPKYYVLEMFPYPSG
FT                   RIHMGHVRNYSIGDVVARFKRMEGHNVLHPMGWDAFGMPAENAAIKHKLHPAAWTISNI
FT                   DSMRTQLQRLGYSYDWRREIATCHPGYYVHEQRFFLKFLEKGLVYRKHSPQNWCETCGT
FT                   VLANEQVIDGCCWRCDQAVVQKDLEQWFLRITDYAEELLADLDQLVGGWPERVLTMQRN
FT                   WIGKSVGAEITFKLAEPVAGSEGVTVFTTRPDTLFGATFMSLAAEHPLVPSLIAGKPQE
FT                   AAVNAFVEKVRNMDRIVRSADDLEKEGVFTGAYCVNPATGKQIPIYVANFVLMGYGTGA
FT                   VMAVPAHDQRDFEFARKYDLPLTVVIEPKGETLDASAMTAAYTDPGVLTASEQFTGMDN
FT                   EAAKAAIIDWLDGSGRGKKSINYRLRDWNISRQRYWGAPIPVIYCESCGIVPVPDADLP
FT                   VELPRDLALMPDGRSPLPHSPSFTDVACPKCGGKARRETDTLDTFFESSWYFARYASAR
FT                   EAGRPFDPAELAYWLPVDQYIGGIEHAILHLLYSRFFVKALRDLGYVGFDEPFANLLTQ
FT                   GMVIKDGSKMSKSKGNVVDPDLMIGKYGADTVRVFILFAAPPEKDLEWSDTGIEGASRF
FT                   LSRLWRLVTEELSGVLTPMPACAPAEVLNLDGLPPLFAELRRREHAAAAKAGADIRERF
FT                   QFNTAIAVAMELVNFLYANVEALRAEPKGAKAVSSAVATLLTVLSPIAPHICEELWQTV
FT                   GHTSLLLNEPWPTHDPAALTSDTVEIVVQVCGKLRGKLTVPADADNTALEQAALAEPNV
FT                   AKHIEGKTVRKVIVVPGKLVNVVAN"
FT   CDS_pept        complement(525125..525526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73948"
FT                   /db_xref="GOA:C4XHY6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY6"
FT                   /protein_id="BAH73948.1"
FT                   /translation="METLSVPNVVLFDTDVLIDYGRGDPHAAAVLDAAHQDGISAVSVI
FT                   VHCELLAGCRDKREQGILDAFMAGFRCVHIDANISGGALGLLRRYRLSHGLRLPDALIA
FT                   ATALAHDWPLVTKNQKDYRFIEGLQLPPY"
FT   CDS_pept        complement(525514..525750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73949"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY7"
FT                   /protein_id="BAH73949.1"
FT                   /translation="MNMEKVLADLAALPPQAMEEAADFIAFLRARHGSAASDAPAGTKF
FT                   ASGETFFGLWRDRRDLSDASAWVDGLRRDEWRR"
FT   CDS_pept        complement(525781..526260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="DMR_04590"
FT                   /product="N utilization substance protein B homolog"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73950"
FT                   /db_xref="GOA:C4XHY8"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHY8"
FT                   /protein_id="BAH73950.1"
FT                   /translation="MTESDDKKPIVSRRKARKQAFEFLYGLSFEPAADERSLLRLFKRC
FT                   PHDVAEGEDDAGHEFAWELVLGVWRNQRDIDATIVRFSKNWKISRIAKVELTILRLAVH
FT                   EILSRPDIPLRVSLNEAIELSKRYGDENSRNFINGILDALAKAVDSGEFGIQKDL"
FT   CDS_pept        complement(526479..526949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="DMR_04600"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73951"
FT                   /db_xref="GOA:C4XHY9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XHY9"
FT                   /protein_id="BAH73951.1"
FT                   /translation="MLHVSTIEGQLDAKGLKFALVAGRFNDFITERLVGGAVDYLVRHG
FT                   GDRADLTIVRVPGAFEIPLAAKKLAASGKYHGIICLGAVIRGSTPHFDFVASECAKGLA
FT                   HVMLDANVPVGFGVLTVDNLEQAIERAGSKAGNKGVEAASAVLEMVRVLEQI"
FT   CDS_pept        complement(526998..528227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB/ribA"
FT                   /locus_tag="DMR_04610"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP
FT                   cyclohydrolase II"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73952"
FT                   /db_xref="GOA:C4XHZ0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ0"
FT                   /protein_id="BAH73952.1"
FT                   /translation="MRLSPIEDAIEDIRAGRMIILVDDEDRENEGDLTVAAEKVTPEII
FT                   NFMATHGRGLICLSLAPNLVDQLALPMMTQDNKSPFGTGFTVSIEAKVGVSTGISAYDR
FT                   ATTILAAVADGAVPEDLVTPGHIFPLRAREGGVLDRAGQTEGSVDLARLAGLKPAGVIC
FT                   EIMREDGNMARMPDLIEFAEKHNLKIASVADLIRYRMRYGHVAVTKVAEATLPTAFGSF
FT                   RAVAFEASSDKKTHIALVKGDIVPGEPVLVRVHSECLTGDVFGSLRCDCGNQLHEAMRM
FT                   IEEEGKGVILYMRQEGRGIGLGNKIKAYALQDQGLDTVEANLKLGFKADLREYGTGAQI
FT                   LVELGISKMRLMTNNPKKIVGLEGYGLEVVDRVAIETCPCSENTCYLTTKRDRMGHILH
FT                   LPDPDCGQAK"
FT   CDS_pept        complement(528518..529267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73953"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ1"
FT                   /protein_id="BAH73953.1"
FT                   /translation="MDVAALSALTQTTSAVAAPTTKSPQPAVAAKTDNMLAGNFVQADA
FT                   GPSKYLQARLDGLQTEKSFGGSMSALLTSMSTQFASTMAKVGSSSGDSTFVAAVINKYK
FT                   VEDSVGQAVDKEVGDSAQDNLDATRQDIEDKAEAAATGQSEDAAGQGAATPDATTTAGD
FT                   ASTTEAIQAAAAAQATSAGQTAEAVPAEAAGQTAETAPAESVGQTEPAGQAEPAGQATQ
FT                   AGLVATAQSPAQAAPVPAPGSTIDIRV"
FT   CDS_pept        complement(529475..529951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73954"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ2"
FT                   /protein_id="BAH73954.1"
FT                   /translation="MPIEYRSVCIFVADIDRARAFYEELMGQSPLHVLPGYVAYPHFCL
FT                   WREDTARRIVFDEEAGPPAGPMGRDNLELYFEDAALEDAFERVMTRAEIIHPPKSAPWG
FT                   QRAFRLRDPDGHIVEVAEPMEAVVERLRDKGLSPAEITAATMMPAEFVASVLGG"
FT   CDS_pept        complement(529981..530400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73955"
FT                   /db_xref="InterPro:IPR025091"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ3"
FT                   /protein_id="BAH73955.1"
FT                   /translation="MKRLAFFLLCAMLCLAAGSALAAEGDEAAAEAAAGKWLALCDAGK
FT                   YSESWREASSFFRGAVTEDVWNKGLSGLRAPLGPVQKRVRNTIIQARSLPGAPDGSYVV
FT                   LTYDTTFAQKAAAIETVTVMHEKDGSWRLVGYYIK"
FT   CDS_pept        complement(530436..531089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="DMR_04650"
FT                   /product="riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73956"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ4"
FT                   /protein_id="BAH73956.1"
FT                   /translation="MFTGLVMGLGRIAAVESRGNETRFRIKALFDLDNIVLGESIAVNG
FT                   VCLTVETFGDREYTAYASGETLSRSNLGKLKIGGVVNLERALALGDRLGGHMVSGHVDC
FT                   LAEVATVTPAGQSMQYKIDFPKEFSIFVVPKGSVALDGISLTVNECGEGWLTVNIIPST
FT                   QGATTISGWKPGTVINMETDVLGKYVLRMLGPWQDAQGKKESKISEAFLRENGF"
FT   CDS_pept        complement(531207..531680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04660"
FT                   /product="putative methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73957"
FT                   /db_xref="GOA:C4XHZ5"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ5"
FT                   /protein_id="BAH73957.1"
FT                   /translation="MSAQTFTDICVADPLALEITWKDGEVTALKLTWAEGKTRSVASEA
FT                   GRAVQAALEAYVAGGQADWPKLPFAWGKATDFSRRVLEELAQVPAGQPVSYGWLAAKAG
FT                   RPKAARAVGRVMASNPFPLIYPCHRVVGAKGALTGFGPGIDMKKYLLELEGTK"
FT   CDS_pept        complement(531913..532737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04670"
FT                   /product="class D beta-lactamase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73958"
FT                   /db_xref="GOA:C4XHZ6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ6"
FT                   /protein_id="BAH73958.1"
FT                   /translation="MTPTFPLLLRRFALFLLLLAAPALARAAAPSLIERPQWQKPFNDA
FT                   GLTGTMVLRQEGSPEILVHNPARAATAFLPASTFKIPNSLIALETGAVSGPSEVFPYDG
FT                   KPRHLPEWNADLTLARAFAVSCVPVYQEIARRIGPERMAKYLADFHYGNGDIGGGIDRF
FT                   WLDGALRITALQQLDFLGRLHRRELPLRRQVMDDVLTMMITDKTPNAVLRAKTGLTARV
FT                   SPNVGWYVGSVTRGPDVWYFALNLEVPENTPAAVAARKKIALDILKMEGLWE"
FT   CDS_pept        complement(532802..533617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04680"
FT                   /product="putative signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73959"
FT                   /db_xref="GOA:C4XHZ7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ7"
FT                   /protein_id="BAH73959.1"
FT                   /translation="MKDRPAHNKRWPKPAIFWSLLVPGLGHIAVGYPARGIALSVLLTA
FT                   TYLGQIYFKTIYTTSGFFLLIVSYTAIYGYIIFDAWRLSSSEPQKEKRWFMRLDSLIAF
FT                   GVLACLSSFYFDSLHFIPDEWRMPSSSMSDAILLNEHFLVDLTAYSPGEPDYGDVIAFL
FT                   FPEDETKLFIKRIIAKPGDLVVIENKQVFVNGAPIDDSHARHGDTAFQARRDSMPAMTV
FT                   APDTYFVLGDNREESYDSRFFGTIPKNKILGRARIILWSDTLSRIGKTL"
FT   CDS_pept        complement(533716..534720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73960"
FT                   /db_xref="GOA:C4XHZ8"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ8"
FT                   /protein_id="BAH73960.1"
FT                   /translation="MFADSSRVVNERFSGQKTAMTARVHTLAQAFRAVFGRKAKKIPLD
FT                   AGSSCPNRDGALSRGGCLFCNAAGSGTGLHLKGFGLRAQWDRLTLPARRRNEALVAYLQ
FT                   SFSNTYGPPERLAALVAELATLPDIEGLCLGTRPDCLDLEKIALLAAAPVGHVRLEMGL
FT                   QSANDATLRRIGRGHTTADFARATIMAADAGLAVTAHLMAGLPGEGVEDFLATVRFVAA
FT                   LPIAGVKLHNTLVVAGSGLAALHKAGGYQPMAREAYVEAVCRAIALLPGHVAVERQNAD
FT                   PAPGELLAPAWAADKQGILGDIAARLEREDIRQGCALGSETGMQPQGPPSPRP"
FT   CDS_pept        534768..535808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="DMR_04700"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73961"
FT                   /db_xref="GOA:C4XHZ9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4XHZ9"
FT                   /protein_id="BAH73961.1"
FT                   /translation="MSSFLNRILGLFSNDLAIDLGTANTLVFVKGKGIVLSEPSVVAVK
FT                   KDPRGGNKVLAVGLEAKRMLGRTPGNIVAIRPMKDGVIADFEVTEAMLRHFISKVHNSR
FT                   RLVRPRIIICVPTGITQVEKRAVKESAQSAGAREVYLIEEPMAAAIGANLPITEPTSNM
FT                   VVDIGGGTTEVAVISLSGVVYSKSVRVGGDKMDEAIMQYVKRKYNMLIGESTAEQIKIQ
FT                   VGSAHHSTSQGEMEVKGRDLVTGIPQNITISSEEVQKSISEQVESIVQAVRIALEQTPP
FT                   ELAADIVDRGIVLTGGGALLRGLDQLLREETSLPITVVDDPLSTVVLGSGRALDNLDVL
FT                   KEVTID"
FT   CDS_pept        535945..536937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="DMR_04710"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73962"
FT                   /db_xref="GOA:C4XI00"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI00"
FT                   /protein_id="BAH73962.1"
FT                   /translation="MAPGKWVHEQVASFWSRYLYFVGIRQQNDQLRLELDSAKKELAEL
FT                   RESASEVERLRQILSLTPPIDWTRRAARIISHRLGPNAALETFLIDKGSAHGVSVNMPV
FT                   VSPDGVVGRVLRLSPTAATILLITDPNSRIPVVSQKNRTQGIVKGEGPTKELTLQYVPQ
FT                   GAPVEEGEVLVTSGLEEIFPKGLPVAKVTSVGRSGSSLFQLIHAAPLFTPRQLEEVALL
FT                   FRATAAAAPVPTTAPVVAPPPPPATAPVSPVITPPNAAPSVKPPKGLKTPAAIPPAPGQ
FT                   GAPPPPPPAPAPTPAPAPAVVEPAKPAKKADKPAESEKKRRKPARTEGQ"
FT   CDS_pept        536934..537404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73963"
FT                   /db_xref="GOA:C4XI01"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI01"
FT                   /protein_id="BAH73963.1"
FT                   /translation="MRPAHIVFWTLLTLGGVWLQNIVPGVDFLAPGLILAMQEEKWTVP
FT                   VWLGGIWLFIQEGTGSMPFGAGILWYGALAGLYFFGHWLFEARNFLFMLILGACLGAMH
FT                   FLFINVMALLQDWSIYMDRLGVEAVQQALIFPIEWGLLYLIHHHLPGDPHAA"
FT   CDS_pept        537394..539259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="DMR_04730"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73964"
FT                   /db_xref="GOA:C4XI02"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI02"
FT                   /protein_id="BAH73964.1"
FT                   /translation="MRLETETPQQHAPRSGLILLQALVLGLFCLFTLRLWYLQVHKGGT
FT                   FSDMARDNQLRQVLIGSARGRILDRSGTPLAVSEPSFALGLVREDCEDIDGTLTKVSEW
FT                   TGVDKHVLSETVKRGKKRVKPFEPLILITDLPYEALARIEANAMLYPGLEIVVRQKRYY
FT                   PTGALMSHVLGYVAEANEDELEKNPQLSLGDSVGKQGLELTHEDELRGSKGRKQVEVDA
FT                   FGRQHNEFILEPPRAGADLKLSIDIGLQKECSRLLEGQAGALLVMEPDTGKILAMVSQP
FT                   SFDNNMFVLGVPADKWRELRDNPRHPIQNRVTQGVYPPGSVFKLLMAAAGLSEGFVRPG
FT                   DVVACPGVYKVGNRDFHDWKKGGHGALDLRGALVHSCDIYFYKLGDRMGIDRLHDYAVA
FT                   SGFGTRTGIDLPHEKAGLIPSKEWKKKRFGAAWSKGETVIASIGQGYVLTSPLQIGRYL
FT                   SALVNGGRLMKPELVETEAPQVDATLPLKDGDRQVILDAMVATVESGTAKSLLRSDAVM
FT                   AGKTGTAQVVKLINADIRRKTHEMPYEQRDHAWLASWGRKDGKTYVVVCLVEHGGHGGE
FT                   VSGPLVRKVYEYLFGPAPGKPPRAAGAAPAAAPGEPAVDPGDVGD"
FT   CDS_pept        539369..540481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="DMR_04740"
FT                   /product="rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73965"
FT                   /db_xref="GOA:C4XI03"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI03"
FT                   /protein_id="BAH73965.1"
FT                   /translation="MPFDRRFILSVNWSLVALTAMLFGVGVLNLYSASGFRMGDELSMQ
FT                   PFYNRQLIWGLAGLGCMLAMVVFDYKYLAAIAWPLVISTSVLLVLVLVMGKTVGGAKRW
FT                   LPIGGFAFQPSEVAKIALLLLAAKILSKRSERLGWLDLAGILAVSLPVALLIIVEPDLG
FT                   TGLNVLLLVAGLILYRGLTGPVFKTLAIAGPILIPCGWFFLKPYQKGRILTLFDPQRDP
FT                   LGAGYHIIQSQIAIGSGQMWGKGFLEGTQSQLRYLPEKHTDFAVAVFAEEWGFMGGIAL
FT                   LTLFCLFLLQFYVTAKNAKDRFGSYLAAGVFFYFFWQILINMGMVLGIMPVVGIPLPFI
FT                   SYGGSATIVNFTLVGIVVNVSMRRYLFKKG"
FT   CDS_pept        540435..540932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73966"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI04"
FT                   /protein_id="BAH73966.1"
FT                   /translation="MSSTSPCGATCSRKASAERTCGHGGSVPRRSEGLVGKHDINAFLG
FT                   VGTSFVGRLTFGGVVRIDGHFEGEIVSTGTLVVGSQAHVAGRVEVARLVCDGVVAAEVA
FT                   ASSSVAVHGRGRLCGAVRTPSLSVAEGGRVDGLVTMGNGEQPPRQALAAGSSVNSSQTP
FT                   PS"
FT   CDS_pept        541062..541481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="DMR_04760"
FT                   /product="ATP synthase subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73967"
FT                   /db_xref="GOA:C4XI05"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI05"
FT                   /protein_id="BAH73967.1"
FT                   /translation="MIDLNATFFVQLVNFVLILILLNVILIGPIRKILKKRAEFVASQM
FT                   EGIESFASSADAKLKDYELSLDAARAAATAGRMAMKAEGQAKEKDLLEAAGAEAASKLQ
FT                   AARAEISAQSAAAKKALEGKVSGLASKAVAKVLAA"
FT   CDS_pept        541561..542100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="DMR_04770"
FT                   /product="ATP synthase subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73968"
FT                   /db_xref="GOA:C4XI06"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI06"
FT                   /protein_id="BAH73968.1"
FT                   /translation="MFGLAAVAYASGDAGGAEAHGLNWKDFLFRVVNFVLVFGVIAKLA
FT                   GKKIVGFFRGRGEAIENQLSELESRKAEAAKRLAEIEASISNLSDEKARIEDEYRRQGE
FT                   ALRDSIVAAAEAKAAQIKEQAVTAAAAEARVAMQELRAQLADSVVAAAKASLEKKLTAK
FT                   DQDKLVDEYLTKVVFN"
FT   CDS_pept        542097..542648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="DMR_04780"
FT                   /product="ATP synthase subunit delta"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73969"
FT                   /db_xref="GOA:C4XI07"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XI07"
FT                   /protein_id="BAH73969.1"
FT                   /translation="MTGNIVARRYAKALFALAKKAGKKAPAEYGKDLEAFASVLEGSPD
FT                   LLKVFANPIISADVKKSVLSGVAGKIGLKPMVINFLSLLADKDRLPCVLEVSALYRTLL
FT                   DEAEGVMRGQLVTAFALADARQDQIKVKLEKQSGKKLVLSFAVDPSIIGGVVLKVGDKV
FT                   LDASLRAQLEILKEQIKRGE"
FT   CDS_pept        542653..544161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="DMR_04790"
FT                   /product="ATP synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73970"
FT                   /db_xref="GOA:C4XI08"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XI08"
FT                   /protein_id="BAH73970.1"
FT                   /translation="MQIKAEEISQIIEQQIQHYESRVEMSETGTVLSVGDQIARVYGVQ
FT                   NAMAMELLEFPGGVMGLVLNLEEDNVGVALLGEDTHIKEGDPVKRTGKIFSVPVGDAVT
FT                   GRVIDPLGNPIDGLGPVEAKETRNVEIKAPGIIARKSVHEPMYTGLKAVDAMTPIGRGQ
FT                   RELIIGDRQTGKTAVCIDAILAQKGQGVFCFYVAIGQKKSTVALVAETLRRHGAMEYTT
FT                   IISATASEPASLQFMSAYSGCTMAEYHRDNGRAALIIYDDLSKQAVSYRQMSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAAKLSDALGAGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QVYLEPNLFNAGIRPAINVGLSVSRVGGAAQVKAMKQVAGTLRLDLAQYRELAAFAQFG
FT                   SDLDKATQLKLSRGMRMVELLKQPQYKPMNVAEQVISLFAGTRGFMDDVPVEAVRKFEE
FT                   GLQEYFHNAKSDILNEIQEKKALDEGLIAKLGAAIDEFKKGFKA"
FT   CDS_pept        544253..545134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="DMR_04800"
FT                   /product="ATP synthase gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73971"
FT                   /db_xref="GOA:C4XI09"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI09"
FT                   /protein_id="BAH73971.1"
FT                   /translation="MPALKDVKVKINAVRKTKQITKAMNMVASAKLRNAQSRIERFRPY
FT                   ADKFYEMLGELAKGADSSIHPLLEARAEVKTVLLVVITSDRGLCGAFNNNIINAALKVA
FT                   RAKTAEGKDVKIMCVGRKARDSFRRTSFEIVAAYVNEMAAFDFSLATRIGAEVIGGYVG
FT                   GTYDEVTMAFGKFISLARQEPTLLPVLPLSPAEAGEVKEDVGAKAEYIYEPSVEGLLAE
FT                   LLPRFINVQIYRGLLDTSASEHAARMRSMDNATRNCDDLVSSLTLVYNKARQTAITKEL
FT                   MDIVGGSEALKG"
FT   CDS_pept        545153..546565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="DMR_04810"
FT                   /product="ATP synthase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73972"
FT                   /db_xref="GOA:C4XI10"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI10"
FT                   /protein_id="BAH73972.1"
FT                   /translation="MSATSGNVGKIVQVIGAVIDVEFPEGKLPNILNALDIKNVNNEFA
FT                   TDLVVEVAQHLGDNVVRCIAMDSTDGLVRGMTAIDTGAPISVPVGKGALGRILNVVGRP
FT                   VDEMGPVDSKTFMPIHRAAPAFVDQSTSIQLLETGIKVIDLLIPFPKGGKLGLFGGAGV
FT                   GKTVVLMELINNIAKHHGGLSVFAGVGERTREGNDLYNEFKEADILGKASLVYGQMNEP
FT                   PGARARVALTALTCAEYFRDEEGQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPT
FT                   LGTDLGGLQERITSTNKGSITSVQAVYVPADDLTDPAPATTFSHLDGTLVLSRQIAELG
FT                   IYPAVDPLDSTSRILDPNVLGGEHYGTAREVQSILQKYKDLQDIIAILGMDELSDDDKL
FT                   TVSRARKIQRFLSQPFFVAAQFTGKEGRYVKLEDTIKGFREIIDGKHDEIPEGAFYMVG
FT                   DINEAVENAKKG"
FT   CDS_pept        546571..546975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="DMR_04820"
FT                   /product="ATP synthase epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73973"
FT                   /db_xref="GOA:C4XI11"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI11"
FT                   /protein_id="BAH73973.1"
FT                   /translation="MAQLRLEIVTPDKLVLSQDVDYVGAPGLLGEFGVMANHIPFLSAL
FT                   GIGSLMYKVGGKANYVFVAGGFAEVSGNKVTILAEVAERPEDIDIERARRAQDRAKQRM
FT                   DREKDKVDFARAQSAMQRAFYRMRVRENAH"
FT   CDS_pept        547290..547721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="DMR_04830"
FT                   /product="ATP synthase epsilon chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73974"
FT                   /db_xref="GOA:C4XI12"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI12"
FT                   /protein_id="BAH73974.1"
FT                   /translation="MAKTFALQIVTPDRMVLQKDVDSVTATGVAGEFTALPYHVPFLAA
FT                   LSVGSLAYRENGRLNYVFVSGGFADVTAGKVLILAEAAELPEEIDIDRARKARERAEAR
FT                   LAATRQENIDYTRAKSALQRALTRMKLGNVPQAAGLGRP"
FT   CDS_pept        547811..549172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="DMR_04840"
FT                   /product="UDP-N-acetylglucosamine
FT                   pyrophosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73975"
FT                   /db_xref="GOA:C4XI13"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI13"
FT                   /protein_id="BAH73975.1"
FT                   /translation="MTQREGALALAAGKGTRMKSDAPKVLATLLGKPMLWYVARALSAL
FT                   FGDEVRAVVGHRAEAVEAAFPELAGRLVLQAEQLGTGHALACALPTLTAAGLTHVLVVN
FT                   GDAPLVTDASLGAFLDAARNADADLAFVTISLPDPGSYGRVVRSGQGVAIVEAKDFDPA
FT                   VHGEATGEINAGVYRLRLETIAPLLARLSNANKSGEYYITDLVALAQKAGLSVLPVGCG
FT                   DDEAYLGINCPRELVAAEEILRRRIVDAHLDAGVIIRAGESVRIGPEVAIGPGADLCGP
FT                   LEIYGPTTIGTGTTIASHCRIENAEIASGATIHSYCHIAQARVASGCLVGPYARLRPGA
FT                   VMEEGSHAGNFVEMKKATLGPGAKANHLTYLGDAEIGAGTNVGAGTITCNYDGVHKHKT
FT                   VIGKKAFIGSNTSLVAPVTIGDGALVGAGSVITSDVPDGALALGRGRQVIKPRK"
FT   CDS_pept        549216..549395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73976"
FT                   /db_xref="GOA:C4XI14"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI14"
FT                   /protein_id="BAH73976.1"
FT                   /translation="MDIFDALEQRVEALVARKKALEEENAALQAEVARLADEQKTVATR
FT                   LDGLLEKLQEELEP"
FT   CDS_pept        549440..549694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73977"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI15"
FT                   /protein_id="BAH73977.1"
FT                   /translation="MPKYSLSIVGLDLSFTTDAEPQRVEAARKLVEQRYNLLQAGGKTL
FT                   GKEKLLAFVALGLADDMLLSNQRLDALHDRVGELLHKID"
FT   CDS_pept        550075..551634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73978"
FT                   /db_xref="GOA:C4XI16"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI16"
FT                   /protein_id="BAH73978.1"
FT                   /translation="MEFSTIFMGIVGIGLGVPAGYYLDKWISQKTLNEARTLADRILDE
FT                   ARKEASAHKKEVVVAAQDELFRQKQELEKEFRDKTQSLEEKEEQVHKRRERLEEKQELI
FT                   VQKESEMLASEKRLTAKERELADKAEELTRLADEHDKRLQEISGLTMEEAKKRLMDEIE
FT                   SKTRHEAARMVRQIEMEAKETADKSGKKILALAIQRYAGDFVGEQTVTAVTLPSEEMKG
FT                   RIIGREGRNIRALEAATGVDLIIDDTPETVILSAFSPLKRQIAKMALERLITDGRIHPA
FT                   RIEDIVKKCEQELDVKIREIGEQATFDCGVHGIHPELVRLLGQLQYRTSYSQNVLQHSL
FT                   EVASLAGIMAAELGVDIKRAKRAGLLHDLGKAVDHEIEGPHAVIGADLAKKFGESGDIL
FT                   HAIMAHHEDVPPKSILATLVQAADSLSGARPGARKELLESYVKRLEELENLALDFDGVS
FT                   KAYAIQAGREVRVMVDSENVDDDKTFLLCKDIAKRIEENLTYPGQIRVTVIRERRAVGI
FT                   AK"
FT   CDS_pept        551721..552539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04880"
FT                   /product="heat shock protein DnaJ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73979"
FT                   /db_xref="GOA:C4XI17"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI17"
FT                   /protein_id="BAH73979.1"
FT                   /translation="MEQPDCYAVLGLPEDADAAAVRRAYRRLARHCHPDANPDDPRAAE
FT                   RFLTLAAAYAVLGHPARRAAYDGRRRYAKAVRDVTPSPVAASSPAAFAPLDPRVLLPRR
FT                   GKDMAAMLDIPDSLAAVGGRLTLDFGVGGDCPVCDGKGALRQACWMCAGRGTIWQPLGG
FT                   GLSAVGCPPCSGRGFVVATCPACAGSGRHDKPRQGVLVIAPHSRDGDMVRVAGAGQPGV
FT                   GDGPPGDLLLTLRLFAVPEAEPAQGLAAWGGGPEADQAQVPDLPGFLVYE"
FT   CDS_pept        552552..553331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73980"
FT                   /db_xref="GOA:C4XI18"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI18"
FT                   /protein_id="BAH73980.1"
FT                   /translation="MRMLFLGDIFGRPGRAIVTQRLAGLRRDLGLTRVLANAENASGGI
FT                   GLTAKSARQLLETGLDVLTGGNHTFRHPDLSPLLGANDRLLRPANYPAGAPGRGWQVFR
FT                   PKDAAPYAVINLLGRTFMAAVDCPFAAAEGILGQLPADVPLRLIDFHAEATSEKKALAY
FT                   FLDGKVSAVLGTHTHVQTADAQLLPQGTAYMTDLGMTGPAASALGMDPEEVIARFRTGL
FT                   PRRFVVSKAAPEMQGALMDIDASAGKVVTIAPWRLAG"
FT   CDS_pept        553357..553833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73981"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI19"
FT                   /protein_id="BAH73981.1"
FT                   /translation="MRYARRLLLAALACLVLAAAAQAAPERTAIYMTVAGPLEVVRDGA
FT                   SSTVLLGGRVIHQAMGAALTAQSYMSVGELGDGYDAVLIRHGVGNAECPITYDLVAVGA
FT                   DKTYAVVPAINKCSRLVNVNVDGDRLLLVTERQNGRTEIIEYNDKQRRRPDAKP"
FT   CDS_pept        553845..554219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73982"
FT                   /db_xref="GOA:C4XI20"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI20"
FT                   /protein_id="BAH73982.1"
FT                   /translation="MRALLLGLLLAGVCLLGGCGDETVYDWQRPHDTYQVGSFSKADNA
FT                   NALKAKLGQNGFECRIETEIKNGQFVLNVLVDVYDRQPDTMTRLERIAGVKPLLRERTP
FT                   AKTAAPAGSSPAPAVPASGI"
FT   CDS_pept        554253..555530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="DMR_04920"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73983"
FT                   /db_xref="GOA:C4XI21"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI21"
FT                   /protein_id="BAH73983.1"
FT                   /translation="MNIFDELSWRGLVHQCSDEAELRKHLSSRDRVMYCGFDPTADSLH
FT                   IGNLVPLMALARFAKAGHKPLFLLGGATGLIGDPSGKDKERQMRTADMVAASAEKIRSQ
FT                   AMAFFERQGVADRVTPVNNLDWTQPISVIEFLRDTGKHFTINYMMAKDSVKSRIGREDT
FT                   GISYTEFSYMILQSLDYEYLNRTMGCTLQIGGGDQFGNITAGLELIRRKSGSQAFALTF
FT                   PLITTATGAKFGKSEKGAIYLNTALTSPYAFYQYWINADDRDVCNFLRYFTYLSKEAID
FT                   ALAVETAERPHLRAAQKTLARETTTMIHGAEELAKVEAVTEALFGGGDLRTVDAATLRA
FT                   ALDAAPGKNYDALDVVPPLPKLLVDLALCPSLSQARKDIKAGGIYLNNVRVADENQTLA
FT                   ASDYIGGNIALLRKGKKNYGVVTLGV"
FT   CDS_pept        555936..556835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="DMR_04930"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73984"
FT                   /db_xref="GOA:C4XI22"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI22"
FT                   /protein_id="BAH73984.1"
FT                   /translation="MQKKVPSLRFPVSKGDRTMVGAMARLVKVEHSVFALPFAYIGLFV
FT                   AAGGWPGWRPFLLLTVAMVAMRSFAMAVNRLADVKFDRKNPRTAGRELVTGEVSLRAAW
FT                   VFAAGCAVVFVGACAGLNALCLALSPVALAWGAFYSLTKRFTWLCHFVLGSVLGLAPVA
FT                   GWLAVAPEFALPAILFGCGVTCWVAGFDVLYACQDVEFDRSQGLHSMPSRFGVGTALAL
FT                   AAFAHVDAAAFYLLAGYAAGLGWIYYAFWAVCSAVLLVEHKLISEHDLSRINVAFFTLN
FT                   GVIAALLGLGTLLAVFLK"
FT   CDS_pept        556860..558386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04940"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73985"
FT                   /db_xref="GOA:C4XI23"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI23"
FT                   /protein_id="BAH73985.1"
FT                   /translation="MTPIAVLFLIALGLSLALTPFARWAGRRFGILAMPAARNIHVTPM
FT                   PRSGGLALFLTFMACLPLAAALLPPAAVAVLGGRTMGYVLLGAALVFAVGFADDKWTLP
FT                   SKLKLLAQIAAASIAYYGGARITSFALPGLFVVQFDVSSYLVTVFWFVLLINAINLIDG
FT                   LDGLAAGVVFFASAVQAGLAVMRAEPHTAALFAVLAGATLGFLRYNFNPASLFLGDGGS
FT                   YFLGYMLAALSVSGSVKSQVGATLLMPVIALGVPLLDTISAPLRRFMRGRDMFEPDKRH
FT                   VHHKLLSRGWSQRQVVLFLYGITIFLALSALVLVNLRNVPAGLFLLVVGGALVFLVRKA
FT                   GYCSYFAMDKILGWLRDVSDDAGFARERRTFLHHQIEISQAHDLAELWTRMTEALDHLR
FT                   FDLAEMVLSGDGAGSCRLDPEPPGAAPVDGPPVYRWRREGSAVSDRELLCSPAVMKLEL
FT                   PLLAKGGRPLGALWLVKDVAADPINEFTLRRVENLRRTVTEALEGLLPPS"
FT   CDS_pept        558383..559525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04950"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73986"
FT                   /db_xref="GOA:C4XI24"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI24"
FT                   /protein_id="BAH73986.1"
FT                   /translation="MRVLQVGKFYPPDAGGVETGTRQMVETLTRLGHENAVLCFAGAGP
FT                   YDDGAETVPVLRAAAWATIASQPLSTEYLLRLADLAPRFEVLHVHCPNPLAAVALWLIR
FT                   PQAKIVLHWHSDIIGKKALRALVSPFEAWLCRRADLVIGPTAVHLQASNRAALFVGKGA
FT                   VVPFYVEPGTADPDRLDPAGLAAVRARAGGRRLVFALGRLVPYKGFAVLIEAARWLPDD
FT                   AVAVIGGGGPLAGELARQIQTAGLGHKVLLAGRIPDNELPAWFAACDVFCLPSVTRAEM
FT                   FGIVQLEAMAWGKPVVSTAIAGSGVAAVNRQGETGLVVAPGDAPALGDALATLLADEAL
FT                   AARLGQGGRQAVAARYSPAAVADALGAAYARLDICAPRTL"
FT   CDS_pept        559504..559878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73987"
FT                   /db_xref="GOA:C4XI25"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI25"
FT                   /protein_id="BAH73987.1"
FT                   /translation="MRAPDAISGQTFKGVAHMSDNKCGCPCSCFAPMTWIAVALGALFV
FT                   LFMFFEAVTIRWWIMLPIAAVSLYLFGVQRGQTSGREKCICSWGFWLVIAALVLRDMCL
FT                   SGQLTAAYCRMIAAGLPLHG"
FT   CDS_pept        559871..560446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73988"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR027565"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI26"
FT                   /protein_id="BAH73988.1"
FT                   /translation="MANTPSDSLFRRIGPGATESGHDRFAVVDAALLAVKAADARANAR
FT                   LRDMHRFHAANAENPQRMVNALQPGSYVRPHRHLSPAKSESFVLLTGSLGHVVFADDGS
FT                   FTAADCVVLDRERGVLAIDVRPGLWHGIVALAADTAVFEVKPGPYAPLDDKDFAPFAPA
FT                   EGTPGAAAYLADLEDRFRTLTGLPPRAW"
FT   CDS_pept        complement(560553..561809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04980"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73989"
FT                   /db_xref="GOA:C4XI27"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI27"
FT                   /protein_id="BAH73989.1"
FT                   /translation="MEKVLIVEDSKVFARILIRKIEDELFFDACWASNFEEARYLIEEN
FT                   PDKHDYIVALLDLHLPDAADGRIVDYVIGKGIPSIVFTGDVDCAVRDRIWSKKVVDYVA
FT                   KDSPDSLDYLCSLVRRVSLNKYVHVLVVDDSSTVRRHLMRLLEAHEFIVHEAENGETAL
FT                   DAISRHPEIKVVIADYFMPGLDGVELTRRIRRLRRKDELAVIGISAYGNTILSARFIKN
FT                   GANDFLNKPFSSEEFYCRVTQNLEMLEYIQKLRETAIRDPLTGLYNRRHFFEAAKTLHA
FT                   DLARGDTPMTLAMIDIDFFKKVNDTYGHAAGDEVLKHVAQGLGNRFRGHDVAARLGGEE
FT                   FCVLARGLSGQQAMAAFDDLRNSIERSKAKAGKTAIGVTVSIGICDKPHGSVDAMLAAA
FT                   DAALYKAKRTGRNRVLWAE"
FT   CDS_pept        561942..564548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_04990"
FT                   /product="putative sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73990"
FT                   /db_xref="GOA:C4XI28"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI28"
FT                   /protein_id="BAH73990.1"
FT                   /translation="MTGPSPRQLAEALAEEGASALSGEPSRSLAEGLSLGVAVLDGQRR
FT                   FVRGNARAREFFERQGAACHRVLRARGEGCEACPTRGGPAVIAPGAACVGLGPDGRDGV
FT                   VCVFEAGVWTVQEGLLPVLEQAPNSIFAVDRDFIVRYVNRAFVSLHGGQAGEYLGRHLA
FT                   HIIGAAIFSRFHAAALAALDSGTPNTEEVTLVHGGREREYLATRIPLLRDGLPLGVWGL
FT                   LTDITDRNMAQRELDASRRRYRALVEDQTELVVRLDPALRRTFVNANLAALLGAPVEAL
FT                   IGGYFGDRLPEAETQALRRRLLELTPRASTCELEHAIVLPSGEERRLHWSVRAIFDESG
FT                   RIGEYQALGRDVSIVRRMEQELSQSEAKYRDIFEHSAEGIFQFEPSGAVVACNPALARI
FT                   LGYASPEAVLAEPGDLFTRIQARQEDRLEFLRQLARHNRVYDFEMQVVRRDGRAAWLSV
FT                   NARAVLDADGRLARVEGAARDITDRKRAEGERMLLVSAVDQSAEGLVIVSRDFRLEYAN
FT                   PAFAQIVAGGQGMLGRDALDGLLAPFLTESVRKMLGLGLRWSGRLRLTRPGGEEAVAEA
FT                   LISPVRDTAGQVVNHILLVRDMTYELDLERRLRQAEKLEAIGVLAAGVAHDFNNILTPI
FT                   LLNSELVLSDLPVLHPLRKPLSDVVLASERARDLVRQLLAFSRQGEISVSDLPLAPLVK
FT                   ETAKLVRGMAPAGVELKLEIGGEPYCVRADPAQMHQVLVNLCLNGVQSMVGGGRLEVGL
FT                   APVDGPPRPEGGGIAAGAPLASLAAGPYVRLWVEDTGHGMAPEVAERVFEPFFTTKKPG
FT                   QGTGMGLAVVHGIVKSCGGAVLLTTAQGKGSRFEVYLPRAAAPDACSAKPADGASR"
FT   CDS_pept        complement(564658..565320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05000"
FT                   /product="putative D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73991"
FT                   /db_xref="GOA:C4XI29"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI29"
FT                   /protein_id="BAH73991.1"
FT                   /translation="MPVRRLCPPFTALCAFTLALLLAAAPALAQKTPAQAGLVDITTVA
FT                   PDIALDIRYATPNNFTGVAVYPAPRCFLRADVAKRLASAQAELKKEGLSLKVYDCYRPF
FT                   AIQKKFWALVPNEDWVAKPVEKDGKPASGSKHNRGAAVDLTLVDAAGQELPMPSGFDDF
FT                   SEKARRDYTGGDPAARANAKRLEAAMQKAGFDPLPSEWWHFDGPGWQSFELLDVPIN"
FT   CDS_pept        565500..566015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="DMR_05010"
FT                   /product="thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73992"
FT                   /db_xref="GOA:C4XI30"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI30"
FT                   /protein_id="BAH73992.1"
FT                   /translation="MSERTGLITFLGGGLTLVGNPVGVGDAAPEFAVLTNELAPAKLAD
FT                   FPEKGLILIAVPSLDTAVCDLEARKFNKEMESLSGKAKALVISMDLPFAQKRWAEAAGV
FT                   TNIVTLSDHRDASFGQAYGLLIKELRLLARAVLVLGPDRKVAYLELVKEVTNEPDYAAA
FT                   LAALGKVL"
FT   CDS_pept        566055..566684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73993"
FT                   /db_xref="InterPro:IPR005619"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI31"
FT                   /protein_id="BAH73993.1"
FT                   /translation="MKNHSSSRRRLRASALFAALVLILALGGCGGQKATVTPSVVVEPE
FT                   ALGRGVDVSVAVKDARPNDEVGLCNPQSSFAGKLQTACDPSPAIHAAVEKGLRDKGFTP
FT                   SPARESVVRTITVELVELAYKPSHEGVHLAAKAVCAVKVTADNNGQILTRRYEADTVWK
FT                   LPAEGVEPEFDKLLSMTVSKALSRMASDYELIAFMQKTVLRTRDIK"
FT   CDS_pept        566785..567894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05030"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73994"
FT                   /db_xref="GOA:C4XI32"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI32"
FT                   /protein_id="BAH73994.1"
FT                   /translation="MALSVGIVGLPNVGKSTLFNALTKAQNAQAANYPFCTIEPNVAIV
FT                   PVPDPRLTALAELVRPQQVLPATVRFTDIAGLVAGASKGEGLGNKFLAHIRETEVIIHV
FT                   ARAFEDDDVVHVSGSVDPARDIAVIDAELILADAQVLENRLDRMVKQTKGSKDRDLLDK
FT                   VEAGKRLLDHLMTGQPASSVDGVDTPGMIALFDEIRPLSAKRVIYCANVAEGDLGQPDN
FT                   ALVAKVRAIAESRGAETVVVCARMEEDLAGLTDEERLEFLASYNLDESGLDSVVRLAYR
FT                   TLGLLSFFTAGPKEVRAWTIAAGTKAPAAAGQIHSDIERGFIRAEVIGFEDYLKHQTEA
FT                   KCRAAGVLRQEGKEYVMADADVVHFLFNV"
FT   CDS_pept        complement(567954..568121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73995"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI33"
FT                   /protein_id="BAH73995.1"
FT                   /translation="MSRVLRPRAVTAGRHEKGPDQQLLVRPDPQQGGRPPGCVRFALSR
FT                   VLENALALSP"
FT   CDS_pept        complement(568217..568873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiC"
FT                   /locus_tag="DMR_05060"
FT                   /product="cobalt-precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73996"
FT                   /db_xref="GOA:C4XI34"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI34"
FT                   /protein_id="BAH73996.1"
FT                   /translation="MPHTSPIQPIFAPDAIEAASLAIIDSEVPEPRPYDGPRWDVVRRL
FT                   IHTTADFELLDLVRFSEGSVREGIRAIEAGATIVTDTEMARCAIPPRRLAPFGCAVRCF
FT                   MNDPEVAAAAKAAGSTRAALAVDFALDLPGPLIFVIGNAPTALLRLLSRIDGGASAPAL
FT                   VVGMPVGFVNAAQSKALLMTRADLAWIAIAGRKGGSALAGATINALAILAGAKTA"
FT   CDS_pept        568865..569818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73997"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI35"
FT                   /protein_id="BAH73997.1"
FT                   /translation="MRHERLLWAILTGFRGGAKDRLECGWRGKTLLTRVTKKYLRRMIA
FT                   YEISSKALERGSSMHSLIKGLTLFLAGALLAAGPALAHETVVKPGAEAAAPGKALPFGV
FT                   HSAHVFIESEELEAAPDVKAFVFEGGKLAEVALALKANDKGLTYDGQAVFSKPGTGIVY
FT                   VHRLPQFWSLTPEGMKKGTKKELPGATKSNRYEKFAKGLVAVGGETAGFDALVGARLEL
FT                   VPLTDPAKAKVGEDLPVKVLLDGQPMPATVLATYDGFTKNPNTYAYYTETDDSGVAKVR
FT                   LTHAGLWLVRTEAKAVPADGSADQEVLRSTLTFFVK"
FT   CDS_pept        569821..570429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73998"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI36"
FT                   /protein_id="BAH73998.1"
FT                   /translation="MFRLPLALTALCLVAAVWHPAGAMAHGVGSRELDPGAARAMVFLY
FT                   ADGEAMAFAQVQVTAPDGTVHQSARTDGKGGFAFLPSGSGVWRVAASDGQGHRAEREVA
FT                   VGATSALGSSGGAKAAGTNPGVFSQTAGGVGDVTGQPGQPGAPQQSGAATMTASALAAM
FT                   PAQAASTAGIGPNWRDVALGLSLLANLGLGAACLRRRGR"
FT   CDS_pept        complement(570913..571179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH73999"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI37"
FT                   /protein_id="BAH73999.1"
FT                   /translation="MKVLLSAAALLSVLCAATLAFAGSDDAKWVAKCISDNKDAKVSIE
FT                   VVTKYCTCMNNKMDDNETLSITAWEKTHPTEQAACDKESGWTK"
FT   CDS_pept        complement(571853..572389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74000"
FT                   /db_xref="GOA:C4XI38"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI38"
FT                   /protein_id="BAH74000.1"
FT                   /translation="MEWGQVFPLAPAALKTGWLTALFGGMLVLWVGLFFFITHMIQGAA
FT                   SARIAVSGGVLSAKGGFYGRDIALADVDAAGAYRLDLSQGGPKGLKWRTNGVGLPGLAA
FT                   GWYRLTGGEKALVFVTDKARAVYVPTRLGYALVASPADPDGFLNALRRAADDAAKDADA
FT                   PRASDAPPPAAGPAT"
FT   CDS_pept        572616..573482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74001"
FT                   /db_xref="GOA:C4XI39"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI39"
FT                   /protein_id="BAH74001.1"
FT                   /translation="MHWFWLSLTTAATQAVKDTFLKAAMGRTDPTLAMFLYSAGAAMFL
FT                   WLFAAPTAEVVLAPSFWPLLALGGALGGLTYWLYGLALSRGDLSLTLPMLAFTPLFLLI
FT                   TSPITLGEFPRPGGLVGIALVVVGAYVLNLRERRHGLLGPVRALFTNAGSRLMLAVAVV
FT                   WSIGANIDKLGLQASSPALWGASVYTATALGLLPFLGRTLKHSLAALPGFPWAILTAGF
FT                   LEAVGLFCQMHALPLTQVSYVIAVKRLSIIFGVLLGAAVFREPDLAHRLPGAAVMVVGV
FT                   FFIAVFG"
FT   CDS_pept        573518..574819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05110"
FT                   /product="putative phenylacetate-coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74002"
FT                   /db_xref="GOA:C4XI40"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI40"
FT                   /protein_id="BAH74002.1"
FT                   /translation="MSAYRFLPDLSAEAIADIQASGLNWTCRHAFAGSPVYRERLAEAG
FT                   YEPGQNLTLDDLTSLPLTSVEDLRQGYPLPLLSVPETEVVRIHASSGTTGKRKILAYTQ
FT                   RDIDTWKEMFARCYELAGLTTLDRVQIAVGYGLWTAGAGFQLGCEHFGAMALPVGPGNM
FT                   EIHLQLLEDMGSTCLCSTASMALLLAEEVHKRDLRKRVKLKKVIFGAETHTDKMRRRFE
FT                   KWLGIEESFDITGMTELYGPGAGLECTAHQGIHYWADKFILEVLDPVTLTPVAPGEVGE
FT                   MVVTSLCKEAAPLIRYRTRDLTRQLPEPCPCGLSMPRHDRILGRSDDMFVFRGVNIYPG
FT                   QIASVLEHFKDVDSEFQIRLLRRDGRDQMVVKVERKPGTGPELDQNLSEAISIEMRKHL
FT                   FVRGWVEIMAPGTLPRTFGKTKRVVDDRNGIEEE"
FT   CDS_pept        575268..576458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05120"
FT                   /product="rubredoxin-oxygen oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74003"
FT                   /db_xref="GOA:C4XI41"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI41"
FT                   /protein_id="BAH74003.1"
FT                   /translation="MQKKLMAPGVYWLGAVDWDRRLFDDLVPLPDGTSYNAYLVQGTDK
FT                   TALLDAVEPAMTDTLLAQLADVPRLDYIISQHAEQDHSGAIGLLLERYPEARVMATAKG
FT                   KAMLHDLLRLPEDRVEAVADGDRLELGGKTLTFLHLPWVHWPETMASYLAEDRILFSCD
FT                   FFGSHIAASELFVTDPCRVREAAKRYFAEIMAPFRPMIEKNLDKLAGLPMAMIAPSHGQ
FT                   VYDKPDWIVAATRQWATAAPANLVALPFVSMHGSTRRMVEHLTAALVARGTAVELFNLA
FT                   VADVGKLAMALLDAGTIVVGAPTVLAGPHPLAAHAAFLANALRPKAKFLSIIGSYGWGG
FT                   RTVEVLAGMVPNIKAEVLEPVLCKGLPTPETYAALDRLAEAIVAGHAAQGFAARVD"
FT   CDS_pept        complement(576523..577296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74004"
FT                   /db_xref="GOA:C4XI42"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI42"
FT                   /protein_id="BAH74004.1"
FT                   /translation="MTNLFWTSETSVMLLLGLPTVAYLVIAYWRNAPPIQNLSETIANF
FT                   NLFNSLYSIFLSMALVTLLVNFNNVQDDTRRESEAMVSMARLLNGLDDAAGAKRALVDY
FT                   ATAVVRYDLPAMAQGEMSPEAHAAIDGLWNQAYKLQPTTKAQESLTRLLLQDLADITKC
FT                   RLTRRIKAKENLHPMIFGLIVAGYYVMLIKTWLTRVGNRKTQLVFELPMFAMIILVITV
FT                   IEDLNTPFVGIVNIDTSFFDYALKRVSELAGLPRP"
FT   CDS_pept        complement(577416..578117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74005"
FT                   /db_xref="InterPro:IPR014997"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI43"
FT                   /protein_id="BAH74005.1"
FT                   /translation="MDEQQVPLSQCAVCPYDWSERWCRAAKGKAPADCPSLRLRDLAGA
FT                   SVACMTEGACAAFAKQASLQEAACYAGGEDGYAAVRAIKPRIVEIVEFARRMGYQRLGL
FT                   AFCIGLRFEAKVVHEILTTNGFAVASVGCKAGGKAKALLGIGPAEQVDPTAAHETMCNP
FT                   VFQALALNEARTDFNVLLGLCVGHDSLFFKHAEAMGTVLAVKDRVFGHNPLAAIYQYDT
FT                   YYRYLKNPLPD"
FT   CDS_pept        complement(578121..578429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74006"
FT                   /db_xref="InterPro:IPR012903"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI44"
FT                   /protein_id="BAH74006.1"
FT                   /translation="MPPHTPAFSPNLQWLPRRRSAMTMDNVRRLYERFETDKELRKKLY
FT                   MAEGKDAREAALREAGLFFTDAEFDEMIDPLHVKCQTVEEAERFFEFRNWWDMLRRS"
FT   CDS_pept        complement(578462..579514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="DMR_05160"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74007"
FT                   /db_xref="GOA:C4XI45"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI45"
FT                   /protein_id="BAH74007.1"
FT                   /translation="MQTIPVGLVGVTGYTGMELARILAVHPSLTLTRATSRAEAGKPLK
FT                   AIYPFLEGFPAGEVAITAPDAADLAASCRLVFLAVPHGAAMDYAAELLAAGLKVVDLSA
FT                   DFRLLDAGIYAAWYGLDHRHPTLLPEAVYGLPELYGEQLHTAKLTANPGCYPTSVILGL
FT                   APALQNGLVATDDIVCDSKSGASGAGRKAAAPMLFCEVHDSFRAYNLGKHRHTPEIEQE
FT                   LSKLCGAAITVSFNPHLLPIDRGILSTIYTKLAAPMSVEEVRELYAKHYANAPWVRVLP
FT                   VGKLPETRFVRGTMFCDIGLVVDPRTGRLIVVSAIDNLCRGASGQAVACANLMSGLPVN
FT                   AGLNLAPMMP"
FT   CDS_pept        complement(579528..579863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74008"
FT                   /db_xref="InterPro:IPR014995"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI46"
FT                   /protein_id="BAH74008.1"
FT                   /translation="MPRTQGGIRPMASESDKTGGCCGQRSGQEPCMPPVSFITFILSLA
FT                   QSAMVLMGEAPDPESGRTLSNLPEAKHTIDILAMLDCKTRGNLTSEEKEVLGSLLCDLR
FT                   MLYVKKQ"
FT   CDS_pept        580017..581444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="DMR_05180"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74009"
FT                   /db_xref="GOA:C4XI47"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI47"
FT                   /protein_id="BAH74009.1"
FT                   /translation="MLTKIVATLGPASLSPDVMLEMARHGVRIFRLNFSHADAAYFAPI
FT                   IKTIRAIESELGVPLTAMADLCGPKTRIGEVAGSPRTVAKGEALLLGLPDERPDPDRDE
FT                   RVFVSLDVPPLLAGLRVGMPVNLSDGLLQFHVTREIKADRLYEIEAQNAGLLSSNKGIA
FT                   FPGKHHPLPALTKKDIKDLHEGLDVGVDAVAISFVQNAEDVIQTKEEIKRHGVWVPVVS
FT                   KLERQNAVDNLDAILAVTDAVMVARGDLGLECPMSELPIIQKKIIRACRHAQRPVIVAT
FT                   QMLLSMVKNPIPTRAECTDVANAILDGADCVMLSEETAVGDHVVDTVKVMQEISQNALE
FT                   YYLERIASPYAPKREKNPRKFVAYSACLMADNLESKAILCHTVSGANARLTSTRRPRQN
FT                   IYAMTPDPRVMRFLNFAWGVKPRLLDCADCGYMEQVENFVNECPDFEKGEPVVITAGRP
FT                   TPGNDMPGTNEIKIYYK"
FT   CDS_pept        582241..582861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05190"
FT                   /product="MarC family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74010"
FT                   /db_xref="GOA:C4XI48"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI48"
FT                   /protein_id="BAH74010.1"
FT                   /translation="MDMTFQHYLLGLFAVANNIPALPLFMNLCRGAQTPVQHRLCGVAT
FT                   ASSLATMAISLFIGAAVLDFFGISIAAFRIAGGLLLVSSGLSMLKSSCDEADGLPPVSV
FT                   SRMIPMAVVPIAIPLTTGAGTISTIVLFAESAHTMAGLLRIGGAICVMSVVNYLAFYYS
FT                   PAIVRFLGRTGMDIFTKIFGLITLALGIQFIITGLTAAFPVLH"
FT   CDS_pept        complement(582882..584282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05200"
FT                   /product="putative drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74011"
FT                   /db_xref="GOA:C4XI49"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI49"
FT                   /protein_id="BAH74011.1"
FT                   /translation="MHRDVVMPFPAAGAPVLTLVTVCIAQFMAPFMLTAVGVALPSLGR
FT                   DLGASAMQLGLIEQLYVVSLAMAMLAFGRLGDIVGQRKVLLPGLALFTGLTCSLGFAGS
FT                   VEMVLVQRFFQGLGAAMVLSGSLAMVAAAYPPEIRGRKIGLVSACTYAGLSVGPVIGGW
FT                   VAGHFGWRYVFLMSVPLGLCATAMCLFGVRQGKAAASGEGMDWPGAMAYAASVGLIMLG
FT                   AAHARELPLGPAMIGGGLIGLACFLRLQANTPCPLLDVSLLRQNRFFTLSCLAALGNYA
FT                   ATFGITFLMSLYLQYAKGLPPRLAGLALLCQPVMQVIASPVAGRLAERFAPAKLATVGM
FT                   LVSSAGLLACAAGIGQDTPLWLLGLELAVIGTGFGLFITPNSTAIMGSVQKRQFGLASG
FT                   MVASMRTLGMAVSMTSVTLIFALLMGEAAIGPDTLPAFLTSMRIGLTAFAAYSCLGVIL
FT                   SFLRGKTR"
FT   CDS_pept        584545..585201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05210"
FT                   /product="PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74012"
FT                   /db_xref="GOA:C4XI50"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI50"
FT                   /protein_id="BAH74012.1"
FT                   /translation="MERLIEADLQRLKTETLTAFRLAQAAVDTAVRSVFERDPALADAV
FT                   ISGDAAIDALECSLDAEVLRILALHQPVAGDLRAIVGCMRCAGDIERIGDQAVNIAERG
FT                   LILMELAPQAPPPKLVELAEATRDFLAHTADCFTNLDLTMARRLCEESDEILELNVTIL
FT                   KEMAELMRDAARPVERAVQVCFIAHGLKRVCDQCTNIAESVVFTREGACSRHRCD"
FT   CDS_pept        585218..585706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05220"
FT                   /product="putative chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74013"
FT                   /db_xref="GOA:C4XI51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI51"
FT                   /protein_id="BAH74013.1"
FT                   /translation="MAGRGFLAAGVVGWLHDAAGTCRRTPASRHEHPHRGRPAPMRKTI
FT                   AFILRQLGLKNVQFAEDGDEAWGIINTGRIDLVLLDWNMPRLSGLSLLERIRKSERHGQ
FT                   LPVIMVTAEAHADHVVTAAQAGVTDYVVKPFSPDTLAKKLHAVCDRCPSLVRLRAGIR"
FT   CDS_pept        complement(585681..586790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05230"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74014"
FT                   /db_xref="GOA:C4XI52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI52"
FT                   /protein_id="BAH74014.1"
FT                   /translation="MNTAMPQCAKILFVDDEGAVLDSLRRNLGRCYDMETAVGPEEGLR
FT                   RLETAGPFAVIVSDLRMPGMDGVAFLAKARELAPEAVPLMLTGHGDLDAAMAAVNEGRI
FT                   FRFLTKPCPPDILARSLDAALAQYRLAAADRELLRVTLENARLKEDVERILRHDLKTPL
FT                   TTIVSLPQVMAEDENLTSDQREMLSLIEDAGYTILGMVNLSAALYKMERGQYQLEPAEV
FT                   DLVPMLRKLFASHADTARRRELALTLSLDGRPDSPEAACLVRGESLLCCSMLANLMANA
FT                   MEASPQGGTVSVELRREGETVRVAIANQGEVPQSIRDRFFEKYVTAGKPKGTGLGAYSA
FT                   RRVALAHGGDIVMETGGGETTLTVSLPAA"
FT   CDS_pept        complement(586806..587462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05240"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74015"
FT                   /db_xref="GOA:C4XI53"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI53"
FT                   /protein_id="BAH74015.1"
FT                   /translation="MRPGRAAPLSREAAMDTLSYPAYLLALTAGMLTPGPAMLQALSLG
FT                   LRHGARPVAAAALGNVCATLAQVAAVLAGLAFLAREPLLLRLISLAGAAYLGWLGLCLW
FT                   RAPARLALPEASRASLTGLFAQGLGVAACNPKAWGFLAAMLPRFAASGAVDAATLALTA
FT                   GPVCLLGFGGMMAYARFGAWLASRLASPAALRRVFRIMAVVIWACAGFFAAARFP"
FT   CDS_pept        complement(587555..588325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="DMR_05250"
FT                   /product="tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74016"
FT                   /db_xref="GOA:C4XI54"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4XI54"
FT                   /protein_id="BAH74016.1"
FT                   /translation="MSQSILTTRIMEALAAGRKALIPFLPGGFPDKERFFDELAALDAG
FT                   GADIIEIGVPFSDPVADGPVVEQASLDCLLNGTCLSWLFYELGKRKGQYRAGLVLMGYY
FT                   NPFLQYGLEQLAADAADAGVSGFIVPDVPLEESGPLREALDKHGLDLIPLVGLNTSEER
FT                   LAAYAQNARGYVYFVSVLGTTGMRESLPTEVKERLTAVRRIFNVPVALGFGIKSPEQLY
FT                   AFGDLVDGVVFGSALIAHIKAGGTAAEFMARWRG"
FT   CDS_pept        complement(588322..589515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="DMR_05260"
FT                   /product="tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74017"
FT                   /db_xref="GOA:C4XI55"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI55"
FT                   /protein_id="BAH74017.1"
FT                   /translation="MTMHKKGYYGDFGGQFVPELLMPPLLELEEAMRTIVPSEPFKKEL
FT                   NALLADYVGRPSPLYRCPNLSKELGFDLWLKREDLNHTGAHKINNTMGQGLLTKYMGKT
FT                   ALLAETGAGQHGVATATAAAMLGLDCIVYMGAEDVVRQAHNVKRMKLLGAEVVPIESGT
FT                   KTLKDAINAALRYWIAEQATTHYCFGTAAGPHPFPLLVREFQAVISLEARAQCLDKMGR
FT                   LPDYVVACVGGGSNAIGMFHHFVPDETVKLIGVEAGGTGEPGCYHSAPISLGTPGVLHG
FT                   MRTMLLQTSEGQIEPSHSVSAGLDYPGVGPEHAHYGASGRVRYDIAVDDQALAAFEALC
FT                   RREGIIPALESCHAVAWVLNHAAEIPKGSQVVVCLSGRGDKDLGIIEAHEAKLGGAK"
FT   CDS_pept        complement(589717..590340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="DMR_05270"
FT                   /product="N-(5'-phosphoribosyl)anthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74018"
FT                   /db_xref="GOA:C4XI56"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI56"
FT                   /protein_id="BAH74018.1"
FT                   /translation="MSAPLAKVCGMTRAEDVVGCAEAGADLLGFIFAAKSPRRLTPAQA
FT                   AALPRVAAKRVGVFVEQTLEEVLSIMAEAELDLAQLHGGQDPEFCRAVGPHRVIRAFWP
FT                   QKHPTIGSLAAEMAAFDGAVRYALLDAGTSGGGHGTSLDFSALAELAPPMPWLLAGGLG
FT                   PDNVAEALRIAKPHGVDLNSGVESSPGLKDLQKVRRSLWSVKGV"
FT   CDS_pept        complement(590337..591107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="DMR_05280"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74019"
FT                   /db_xref="GOA:C4XI57"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI57"
FT                   /protein_id="BAH74019.1"
FT                   /translation="MLEKFRAAKAAEVRRLVGLEAAQQLPEPYKGKRPSFSDALIAKAP
FT                   MAVIAEYKRASPSMGDINLGLGPHDVAAMYAASGAAAISVLTEETYFKGSLDYLETMSR
FT                   CGLPLLRKDFLLHPLQVVQTAATKASALLLIVRMLTDVELNEMLRLTYDAGLEAVVEVF
FT                   DERDLERAEAAGAHIIQVNNRDLDTLKTDFAVATRLAAYKRPGRLWIAASGIKTRADVE
FT                   AMQALGFDAVLVGTSIMAEADPGAALARLAGSAA"
FT   CDS_pept        complement(591100..592110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="DMR_05290"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74020"
FT                   /db_xref="GOA:C4XI58"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI58"
FT                   /protein_id="BAH74020.1"
FT                   /translation="MEKHVECLELLAIGKNLPPDLATYAFRAMYTGEMPASCVGAFLMG
FT                   LKTKGEAAVEIAAGVTTALEQARLVEGLTGPRIDTCGTGGDNTCSFNCSTAVALYLAAM
FT                   GHKVVKHGNRAVSSACGSADAVESLGFPLVVEPDAVAAELDKHNFVFLFAPNYHPAFKR
FT                   IGPIRKELGARTLFNLMGPLLNPARPTHQILGVPTSRHVPLMAEVLALTGLSRGVVVHG
FT                   AGGFDELTPFGPADVCWVKDGWLKKERIDPATLGVSESKLGDVVVSGRDEAVAVLQGVL
FT                   SGKGPQAMLDMVALNLGCALHLLEDGLTLRQGVDKAKDAIAQGAAAAFFKDVFHA"
FT   CDS_pept        complement(592122..592526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74021"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI59"
FT                   /protein_id="BAH74021.1"
FT                   /translation="MNTIPALIDKAEASLRAARLLGSEGYLDFAVGRLHAVMRYVAEAF
FT                   LIRHGYPVADAANIPSAFALHLTATGYLPETFNRFLTEAARLRDRAENETDTGITAEDV
FT                   SEQIERAKAFLYLAREELADTPKSPPHAAA"
FT   CDS_pept        complement(592539..593111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpG"
FT                   /locus_tag="DMR_05310"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74022"
FT                   /db_xref="GOA:C4XI60"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI60"
FT                   /protein_id="BAH74022.1"
FT                   /translation="MFLLIDNFDSFTFNVVQAFQQCGHDPLVLKNDDPKILELAASGKL
FT                   EKVCISPGPSNPTNAGLCLQFLELLPATTPVFGVCLGHQILGHFAGAPVVVADRIMHGK
FT                   TSDVYHRETGLFEGLPNPMECCRYHSLLVLASKAPDKLEITAWTEQNEVMGMRYRDRPW
FT                   VGVQFHPESVFTPDGMKLIGNFPDKIL"
FT   CDS_pept        complement(593095..594546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="DMR_05320"
FT                   /product="anthranilate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74023"
FT                   /db_xref="GOA:C4XI61"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI61"
FT                   /protein_id="BAH74023.1"
FT                   /translation="MDREDGKKGQPMSAIKLRQEGTWLPADVQTPISLFLGLVGERPGI
FT                   LLESAEVDGRLGRYSLIAWDFRLRIRLKDGKLDVNARDQRLAGLEKHSGRGMMEGLRAV
FT                   LADLNILAPEGFDDVPPITRSLVGYFGYGVAGVFEPKLAKVLPPDEAEFCLVLPGRVVL
FT                   FDHVKHRCLHLSLDEGKKAKIEHANIFAPMNRPVLGKVVNTPDAEGYMDAVAQCKEMIR
FT                   AGECIQTVLSTRFAAPFSGDPFVVYRRLRQVNPSPYMFFMRLPRVTLLGSSPELLIRCR
FT                   DGELTTCPIAGTRHRSADPVEDDRLAEELLADPKERAEHVMLVDLGRNDLGRMAEKGTV
FT                   KVEKFMAVERFSHVMHIVSYVTAKLKKGLDALDVLQCAFPAGTLSGAPKVRAMEMIADL
FT                   ENRLPRGPYAGCIGWIGLDEGRVNLDTGITIRSMWIRDGMASWQAGAGIVYDSDPASEW
FT                   KECQNKARVIAEVLAAKEEGDVFTY"
FT   CDS_pept        complement(594510..595628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="DMR_05330"
FT                   /product="chorismate mutase/prephenate dehydrogenase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74024"
FT                   /db_xref="GOA:C4XI62"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI62"
FT                   /protein_id="BAH74024.1"
FT                   /translation="MGSHTRSDAGRRVDEAGREKRQERALPAPAGGLSPPDPSHGEGFG
FT                   AAACCAADGATGSSTEAENKFQEVQHIMPNTNSNKPSTQPQEKVFGEGGGPGEETPFFK
FT                   KGFPPPGAPRAISTIALVGARGGMGQLVAAKCRAAGVAVRELDRPLTPDGIAAALAGAD
FT                   MVLVSVPVYATAEVTARLAPHLAAPQILADVGSVKTLPIAAMVEGYGGPVVGTHPLFGP
FT                   APAQDDGLRVAVMDGRPGQDVWATELVADWCRRIGFAPFPSTAKEHDKAAAYVQGLNFV
FT                   TTVAYLAAQAAGGEVRKYLTPSFERRLAAAEKLITKDAALFTALFEANPHSHEAVRNYR
FT                   NFLNIAAGGDIDLLVRRAEAWWTEKTEKKDNP"
FT   CDS_pept        complement(595589..596926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="DMR_05340"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74025"
FT                   /db_xref="GOA:C4XI63"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI63"
FT                   /protein_id="BAH74025.1"
FT                   /translation="MPIITAPPSKSVSHRAVIAASLAAGTSRLTGLLDSQDISRTRDCM
FT                   IAMGAAMHPQSDGSVVVSGTAGRPLGGEDEEEHSVALDVGESGTTCRLLVAVAAAGRGH
FT                   FLVRGHGRMHDRPIGELVNALLPLGPECLYLEKSGCPPLAVVTQGLAGGTTSISLEDSS
FT                   QYLSGLLLAAPMAAGPLTIEITGKKTVSWPYVAITLSALADFGVPFTVQTRQGDAWVEA
FT                   DWRAITDVVPGQIRFAMQPARYRPREYAVEADWSSASYFLAAGAVGPAPVTVAGLRQDS
FT                   LQGDRAIRDILARMGARIEETAEGLTVFPSELHGQELDMGRCPDLVPTVAAAACFASGE
FT                   TIIKNVAHLRLKESDRIEAVAENCTQAGAVVTTLPDGLRIKPKALRTDQRVEFSAFDDH
FT                   RLAMSAAIFELAGIDVVIDNPGCVAKSFPTFWDKWEAIREAMQDEE"
FT   CDS_pept        complement(597141..598292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="DMR_05350"
FT                   /product="chorismate mutase/prephenate dehydratase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74026"
FT                   /db_xref="GOA:C4XI64"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI64"
FT                   /protein_id="BAH74026.1"
FT                   /translation="MNPDTTQPAVAPGSLEEALLEIRHGIDAVDDEIVALLNKRAALSL
FT                   EVGRRKDGRASAIFKPFREQEVLARLTAANPGPLPNNHLIAVYREILSSSRRLQRPERV
FT                   AYLGPEGTFSHFAAMAALGHSPDFLPQTTIGDVFAAVAGKQADLGVVPLENSLQGTIGQ
FT                   SLDNFQRYNVFIQAEITCRVSHALLSTATSLDAVEIVYSHPQPLAQCAGWLKTHLPRAK
FT                   VIPTDSTAAAAARLAGEPNAAAIGHLRLAAMHHLNVLASPIEDLPDNWTRFFIIGPEDT
FT                   KQQTRDKTSLLFTVPNKPGSLHQVLAHLAGEGINLTKLESRPIRGEKWQYFFFADLQCD
FT                   LTREEYKKLLATLTENTHSLRILGCYPAGPQVDLAEGATDKAE"
FT   CDS_pept        complement(598294..599268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05360"
FT                   /product="putative 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74027"
FT                   /db_xref="GOA:C4XI65"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI65"
FT                   /protein_id="BAH74027.1"
FT                   /translation="MTKEIWLKVVPFDKNVITLGLESGVDGFVVEAADADKVLALGRTQ
FT                   VMTPDQFELIPICCKDDEGTAIDSLKACRPVFLAQGWEIIPVENILACTEGLGLECESL
FT                   DRARLAAGVLERGADKLLITPEAVCDLKTIVNELKLSQGTMELVPATITKIEHAGLGHR
FT                   VCVDTTSILKTGEGMLVGNSSAFTFLVNAETESNPYVAARPFRINAGAVHAYCQMPGDK
FT                   TRYLEELASGSEVLIVSHKGATKTAVVGRIKTEIRPMLLITAEVGGKEGKVFLQNAETI
FT                   RLVTPEGKPVSVVALKEGDTVLVSTDVAGRHFGMRIAEEIKEG"
FT   CDS_pept        complement(599272..600069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05370"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74028"
FT                   /db_xref="GOA:C4XI66"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI66"
FT                   /protein_id="BAH74028.1"
FT                   /translation="MLLGKAVRLERIFNRNTHRAIIVPMDHGVTVGPISGLIDMRDAVN
FT                   QVAEGGANAVLMHKGLPRCSHRGRGRDVGLIIHLSASTSLSPFPNAKTLVGTVEDAIKL
FT                   GADAVSLHINLGDETERDMLAHLGETTSRAADWGMPVLAMVYARGPKVKNEYDVDVVAH
FT                   CARVGTELGADVVKVPYTGDIESFSKVTDACCIPVVIAGGPKMDNDRDLLQMAHDSVQA
FT                   GGSGLSIGRNIFQHAQPARIVQALHGIVHLDWEVDQALELLKD"
FT   CDS_pept        600569..602146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05380"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74029"
FT                   /db_xref="GOA:C4XI67"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI67"
FT                   /protein_id="BAH74029.1"
FT                   /translation="MGFLRIILALSVVIGHSDHSFGLPGLNTTLAVRSFYVVSGFYMAM
FT                   VLSTKYNGKPYYVFIKSRYLRIFPLYLAVLLLTLVYGCVTWAIIGSVQWPLAGWANTLT
FT                   RLDDLSIVYYALANVFIFGQDVLGFFHVSENGGLVFDYLNRLSNSSLGGYMLVPQAWTL
FT                   GLELAFYLVAPLFVAGSSIVILGVILGSCLLRFVALPAWGVEANAFTYRFFPFEIAFFG
FT                   CGALAYKLYARYRILDKGRTFHVVAVLALAPLFLAFDWNIPDLTRYAALALAIPSLFLL
FT                   TKNSRLDRFVGELSYPIYISHILVLYAITQYTQVGYELPGVLVTLALSLLLYLAVERRV
FT                   ETWRGRVVAGTNRRFPSAKGLAAAAVCALAIVAVLLTGKALLESKHLSQSAAMVDYDFI
FT                   KDTPRNMILIGFEPPENNASSAWRWGLGEKSEILFSLPKATNCNLVFQFFPVADGQTVS
FT                   VYFNDLLLETFRLRKNDAIYRQYALPAKKSGNVVRFVYDDWNGRVVRYIPEDSRPLAVN
FT                   FNKFELTF"
FT   CDS_pept        602929..603420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprB"
FT                   /locus_tag="DMR_05390"
FT                   /product="adenylylsulphate reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74030"
FT                   /db_xref="InterPro:IPR011802"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022738"
FT                   /db_xref="InterPro:IPR038465"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI68"
FT                   /protein_id="BAH74030.1"
FT                   /translation="MPTFVDPSKCDGCKGGEKTACMYICPNDLMILDPQEMKAFNQEPS
FT                   ACWECYSCVKICPQGAISARPYADFAPMGGTSIPMRSADSIMWTVKFRNGNIKRFKFPI
FT                   RTTPEGSIKPFEGKPEPGDLESELLFTETALVAPKEALGKKFDVTGADTVQCWLDGFCK
FT                   "
FT   CDS_pept        603469..605466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aprA"
FT                   /locus_tag="DMR_05400"
FT                   /product="adenylylsulphate reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74031"
FT                   /db_xref="GOA:C4XI69"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011803"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI69"
FT                   /protein_id="BAH74031.1"
FT                   /translation="MPTIPVKDEPKGVALAEPELIEKDVDILFVGGGMGCCGAAFEAVR
FT                   WADKVGGISMMLLDKASLERSGAVAQGLSAINTYLGKNDADDYVRMVRTDLMGLVREDL
FT                   IFDLGRHVDDSVHLFEEWGLPCWTKDAHGHNLDGAQSKAAGVSLRTGADPVRSGRWQIM
FT                   INGESYKCIVAEAAKNALGQDRYLERIFIVKLLLDAKQPNRIAGAVGFSTRENKVYVFK
FT                   ANAILVACGGAVNVYRPRSTGEGMGRAWYPVWNSGSTYTMCAQVGAEMTMMENRFVPAR
FT                   FKDGYGPVGAWFLLFKAKATNAKGEDYCVTNRAMLKPYEDRGYAKGHIIPTCLRNHMML
FT                   REMREGRGPIYMDTAGALQATFANLNAEQQKHLESEAWEDFLDMCVGQANLWACTDTEP
FT                   EKKGSEIMPTEPYLLGSHSGCCGIWVSGPDEAWVPEEYKIKADNGKVYNRMTTVNGLWT
FT                   CADGVGASGHKFSSGSHAEGRICGKQMVRWVVDHKDFKPTLSVTAAELAKEIYQPWHTF
FT                   KDNVGVSTDPIVNPNFISPHNFMMRLVKCTDEYGGGCATLYTTSKTLLDTGFQLLQYLE
FT                   EDSKKLAARDLHELMRCWEQYHRLWTVRLHMTHIMFREETRYPGFYYRGDFLGLDDSKW
FT                   KCFVNSKYDPATKETKVFKKTYYQIIPDAQ"
FT   CDS_pept        605623..606864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmoA"
FT                   /locus_tag="DMR_05410"
FT                   /product="quinone-interacting membrane-bound oxidoreductase
FT                   complex subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI70"
FT                   /protein_id="BAH74032.1"
FT                   /translation="MSSNAILVVGGGFSGITAALEAAEVGHEVYIVEKNPFLGGRVMQL
FT                   NKYFPKLCPPSCGLEIQFQRIKNNKNVKFFTLAEVTKVTGKAGDYEVTVKIKPRFVEPG
FT                   SVDLSDAAKKLSKDVKSDFELGLGDRKALYMDVPFAFPNRYVLDKERCTKEDLEVLSGS
FT                   DVINLDDAPKEIVLKVGSIVYATGWKPYDVTRLTNLGAGEIANCVTNMQLERLASPNGP
FT                   TCGNIVRPSDGKAPRSVAFVQCAGSRDENHLNYCSYICCMASLKQAAYVREAFPDARVT
FT                   IYYIDLRTPGRYDNFAKRILDDDRINAVKGKVAAVAEDAGTGDVILTVEDAVTGIKSDN
FT                   RFELVVLATGMQPSIAGERLPVDVPVDEMGFIVGGEEKGIFAAGCAATPLDVMKSAQSA
FT                   TGAAMKAIASVRGR"
FT   CDS_pept        606870..609161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmoB"
FT                   /locus_tag="DMR_05420"
FT                   /product="quinone-interacting membrane-bound oxidoreductase
FT                   complex subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74033"
FT                   /db_xref="GOA:C4XI71"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI71"
FT                   /protein_id="BAH74033.1"
FT                   /translation="MAEKIGVYIDESSVAPLLSAEELVAFVKAKCAGACPIVKSHKRLS
FT                   SPDGVAMIKADIEGGEIDAVMLAGTSPRVDWEVFDFGDKVIVDRVNLREFVTLSYKNPD
FT                   GSAPVAGQPVPRELTSMVQDYLRMGVVKLQKMAKPNPEIPETNKTILVLGGGWTGINAA
FT                   LAAAGAGYSVVLVEKEAALGGKAANLYKTFPLAYPYLEATDTGIDRLIGLVAGNSKITV
FT                   KLSTSLKLLAGAPGLYEATLASGGKEETLPIGSVVLAAGWQPMDGEALAPYGYGTLKNV
FT                   VTSAEFEAMVKAGSIKRPSDGKAPKTVAFIVDVTKALEAKPAAVVEEAPAEAAKPAEAK
FT                   EGEEAGPVFSPIKTPKHLAYSSELTSLVALKQANYVREKLDDAVAMIIYDNMMVPGINE
FT                   RYYRAAQDNPGVMLTKGTVTGVAEEGISLVVSAKDTLLGGDISLAADLVVVPTGIVPAT
FT                   ALDPTINLLYRQGPAFPDLQLFDGFADSNYICFPYETRRTGVYAAGCVRQPMTMAQAKE
FT                   DAAGAALKAIQCIESASRGVAVHPRSGDLSYPVFNFVRCTQCKRCTEECPFGALDDDEK
FT                   GTPKPNPTRCRRCGTCMGACPERVISFDNYNVDMIGSQIRECEIPPKIEDGGPRVFILA
FT                   CENDAYPALDMAALRGKKWSPYVRIIPVRCLGSVNAIWVADAMSKGVDGVMMLGCKYGD
FT                   DYQCHFVKGSEICNRRKENIAESLKRLGVEPERVEQYQVAIDEYDKIPDMIDQFMDMVL
FT                   KIGPNPFKGY"
FT   CDS_pept        609175..610374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qmoC"
FT                   /locus_tag="DMR_05430"
FT                   /product="quinone-interacting membrane-bound oxidoreductase
FT                   complex subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74034"
FT                   /db_xref="GOA:C4XI72"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI72"
FT                   /protein_id="BAH74034.1"
FT                   /translation="MANEQRIKPDLQFVKDVQAAGGEAVKKCYQCATCSVACPLAPPET
FT                   PFPRKEMVWAQWGLKDRFEGDIDIWLCHNCQTCSDLCPRGARPGDLVSAIRNITYRDLV
FT                   TPTIIGKWMSSPKHLPKLIAIPAVLFMLIWLITTGFKLPQGEIVFGKLYPGDYTIDPIF
FT                   MLVSAFVAFTFYKGVTKLWKSFEKSTPTTLQIGTKAKKPTLIESLKAVIVDEIGTHSKF
FT                   NECGNDNTERYKGHLSLFYGFVALAIVTGVVAVSHWGGKIITFIAPLGHTPMPLWSPVK
FT                   ILANVGAVALVYGLVMLTRRRINVDPAKSTSSYYDWYLLGVIWAVGLTGLGAEIFRLAG
FT                   VPSLAYPTYYLHLISVFMLFAYLPWSKLGHLVYRTTALVYAHQAGRLPLKREEEKTFLV
FT                   "
FT   CDS_pept        610389..611078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74035"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI73"
FT                   /protein_id="BAH74035.1"
FT                   /translation="MAEARKVFPMNAFVSYLKGVDKEGNKKGVAEMVGFMTGMEIDAEL
FT                   APFAAALAKAWIYEQHPELVRMSSGELGATAQNVSVAVLPPDVVAEVNAIFAKLTDSKK
FT                   TIDEQAAKLAKVEAELAEKTAILKDVEVRMKAAEDKAKRLEESAKDAGEKVIVASEAKV
FT                   VEYIGKVDELLKMIEDVKKHGVVTVSGGGAAAADGGASGGTGEPVVGGEPAADFGFGSD
FT                   AFATDKW"
FT   CDS_pept        complement(611441..611710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74036"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI74"
FT                   /protein_id="BAH74036.1"
FT                   /translation="MENSHRFFRNAPCRYFPCHPGADPEAFNCLFCFCPLYFLENCGGD
FT                   HQMIKGIKDCTPCLRPHRPEGYDEILSRLREEAAARREGTLPED"
FT   CDS_pept        611738..613126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74037"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI75"
FT                   /protein_id="BAH74037.1"
FT                   /translation="MQQPDRVNGLIEPRDSAMAIATTNTTAQDFLKKAAASTPGSGKAR
FT                   LDPKLFQNMLQSGYGINGEVGKNSKLSIPKENMITGLEMLSSGEGTGKDAALSMLGYQT
FT                   DAKALTAMEQGMNQGKSPGLSPGLSQGMASFQGSALATLSRMAMEQAATGQTSAPGAAA
FT                   AASVEADGSSIRRAVDKSAVRMAVSASARHPDDLGHLGRVNQASGRGGFTKREEELLLA
FT                   VAGAENILAETTRVEQAKETAAVSRKVLPSTLEHKAGRLSAQYESNSEIDYIGYDSRGG
FT                   TSYGQYQIASKTGTMDYFLRFLDDKAPDIAGKLRAAGPADTGGRAGRMPAAWKAVAASD
FT                   PRRFEALQHEFIRSNNYSPAAKSIVLTTGVDVTKRSYALREVLWSTAVQHGPGGAERIF
FT                   TQAIEKAEALPPGQDFDKAVIEEVYRVRGQKFFRHNKRIREAVLSRFQDEKTTAIALLD
FT                   SPSV"
FT   CDS_pept        613207..614568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05470"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74038"
FT                   /db_xref="GOA:C4XI76"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI76"
FT                   /protein_id="BAH74038.1"
FT                   /translation="MTPTDAKPAEAGDAVSLSRKIDGLRRCFALSRLVAESLDLSEVLE
FT                   RIMTTSRQALCAEAASLLLVDDTPGPGQGELVFTVAQGPACMPLKSGFRLAPGQGVAGW
FT                   VAASGEPVLLADAYADPRFNREVDRQTGYRTRSMLCVPLTYRERVIGVVQCINKAGGGE
FT                   FCADDLETFSLLAAQAAVAIVNARLHGEALAKQRMDFDMEVAASVQQGFWPKGAPTLTG
FT                   FDVAGVSRPCDATGGDYYDYLMRPGEHGERHFLVAVGDVTGHGIQAALLMASVRAFLRS
FT                   RLLSPGGPAAIVGDVNRLLAEDMGVSGRFITLFLLELCPETGQLRYVRAGHDPALLYDP
FT                   ATDEFQELGGRGIPLGIDADWRYEENLVKGLPPGAVLALGTDGIWEARDAHGEMYGKTR
FT                   LRHALRRAASLDAAGVAREALADLEAFRQGEPSRDDVTLVVVKAWAGAKHTEAA"
FT   CDS_pept        614565..615278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74039"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI77"
FT                   /protein_id="BAH74039.1"
FT                   /translation="MKSRIATTMVLAAGLALAGCSKEDPTGFPKVDYNKDGRVIFEELI
FT                   VIFPDLTVEEFLAADADGNGTLSDREYGRFRDARTAGKKLDAAAVPAAPAAKPAEAPAA
FT                   KPAEPTAPAPAKAAEPAPAAAIPAPAAPVTEVVETVVAEPPAPAPAPAPTAPAAAKPAP
FT                   AAEKPASTATKPAVGADKPVAAGGATHTVARGDTLTRLAKKYGVSAQAIMEANGMKNAD
FT                   QLQLGKTLTIPAPAQ"
FT   CDS_pept        615627..616829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74040"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI78"
FT                   /protein_id="BAH74040.1"
FT                   /translation="MLRKISVAELSPGMFVVDSGLSWLEHPYLFGQEGEIKSLAAVREI
FT                   AEAGYTEAFIDTERGTYAQGRSAEPTLAELLARETDRPAEPAVPLEEELVAATAVYQDC
FT                   LCIARNVLETVKAGGELDMDEPTSLVDDVIASAVRNPDALVALCKLRRHDAYTFTHGVN
FT                   VAALSVAFGTALGLDTLGLRDLGLAGLFHDIGKTGVPDAILNKPARLSPGEFEQVKNHP
FT                   GYGRQILEGRGLPEAVLRGVAEHHEKWGGTGYPHGLAGEDVHPYGRIIGVADVFDALTS
FT                   RRAYKDGILPTKALGVLYGMRERDYPPGLVERFIKFMGPYPVGSFVRLASGHHAFVSKS
FT                   NPGRPLFPELLLTFDPAMARLKPRKIEAKPDAAGKSPIIEVVDPARHGIDPLEFLCPTG
FT                   R"
FT   CDS_pept        complement(616932..619100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05500"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74041"
FT                   /db_xref="GOA:C4XI79"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI79"
FT                   /protein_id="BAH74041.1"
FT                   /translation="MPISPPVGEHPLSPDAPRRPANPPPPQPRPANRQAQRAATPSRNR
FT                   RRNAVLLPSCSPIQRQPTQAQYEKSFIFNRHRNHPISFCASSGEDNRHVAGSSAITQHT
FT                   QEDSIMQLFNDMRVGKKLLLSFLAMACLTVVVGQIGFQSMRDINSLAESMYAKELLGLS
FT                   AIKEAGIALGHIDRASKNMLLADSQEAREIYIKRIDQYKIDFLKNYNEALPLFWTEVGK
FT                   QSLKRLDDLWRTYNISLAKLIALNKSEAPAAHRESTVLSMGQLAEETDAINEAINTSSA
FT                   LKDANAHKFAQQIQDTYTTNRDYLLGITLTSILLGIGLGLVIARSISKPLNQTMQFAQE
FT                   VTKGNLDASCPVHRRDEIGQLAEALRDMLVRLKDKIDEAFEQSERAAKESERAGQAMQE
FT                   ALEAKKLAETAKTEGMLQAAGQLEAIVEVLHTASEDLSTQVDQSSNGAREQAQRIGETA
FT                   TSMEQMNASVLEVAQNASSAAATADQTKAKAAQGADVVGQVVAAIAQVQAQSQEMMHDI
FT                   SSLGTQAEGIGQIINVISDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAEKT
FT                   MTATKEVGQAVRGIQEGTRKNIDNVERSGKTIGKATQLATLSGEALRQIVTLADTTTDQ
FT                   VRSIATASEEQSSASEEINRSLEDVNRVSLETSETMRHSTLAVSNLASQAQALKDLIEA
FT                   MKSEETAVPAGRQALPMLGQPKAERYRQ"
FT   CDS_pept        619161..619718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74042"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI80"
FT                   /protein_id="BAH74042.1"
FT                   /translation="MDINTTYDKLSGQLTIRSGLSDGQAKTAGTTTATSAKASTTGQSA
FT                   TQNLNLDSAYISPVLQAKLQTEALQTQFTKTLAAKFEELDIDVSRPITLTQGADGKVTV
FT                   SGDHPDKAAIEKLFTDVPTLTEAFTALSKTSSDLASMTSSQSASLVRTNGYAAYLKQIQ
FT                   SSASSGDFFYSYMDGAASTYFG"
FT   CDS_pept        619855..620865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05520"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74043"
FT                   /db_xref="GOA:C4XI81"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI81"
FT                   /protein_id="BAH74043.1"
FT                   /translation="MKPEPLLGLRARITRLGTGGMYMAADCFIGIDVSKETLAVHTLPD
FT                   GNDFQFVNDPDGIKAICRKFSKFRPKLIIIEATGGLQIPVATALSLKKFPVVVINPRQA
FT                   RDFARAKGRLAKTDKIDAEILALFGKQMEPEVRPLKDEQAQEMSSLMSRRNQLIRMLVM
FT                   EKNRFTRAYGSVRADIEKNIDWLEERLSEIDTHLGTVVRASPIWRERDNLLRSVPGVGD
FT                   VLSRSLLSNLPELGTLNRREIAALVGVAPLNCDSGKRRGKRRVWGGRSDVRSVLYMAVL
FT                   SAKKYNPVIRDFYNRLKEAGKPHKVAAVASMRKLITILNAMVRSGQPWGQYAHAA"
FT   CDS_pept        complement(621125..622288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74044"
FT                   /db_xref="GOA:C4XI82"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI82"
FT                   /protein_id="BAH74044.1"
FT                   /translation="MDATQSRQPGPRPPVRAGFDDGAGPTLFFHGVQNAMRKYFIDNLR
FT                   WMSVLLVIPYHVFLCYNTFGYEYYVYAMPVQVFSVFDLLCAPWFMPLLFFVSGISTTYA
FT                   LGKRTNRQYLAERLGKLLIPFLAGAILLTPLMAYYARKHYEGYAGGVWENYILFFRHWT
FT                   TGSKGVPPYEVGQMWFLLYLFAISLAALPILKLAREGCGRLRLELWPLWAIALLFVPLG
FT                   CVWDLMPGPPQSLAGCFALFLLGGLFFHTDALQEKLARQAWRLSFPFAALLLAGVALTG
FT                   RLGPGWWSPYLQALVMWMGILALMGLGRRYVNFTNPVTRYLSASSFALYIFHQAWLVMI
FT                   AFYAIRSIASPWLQAPTILGLCLACSLVSYEACRRLALTRFLFGIKR"
FT   CDS_pept        complement(622376..623092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="DMR_05540"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74045"
FT                   /db_xref="GOA:C4XI83"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI83"
FT                   /protein_id="BAH74045.1"
FT                   /translation="MTPRVRRFTDVAALTEAAFAFVAERAMEAVAARGRFSLALSGGGT
FT                   PLPLYAALAARGLGIAWNDALMFFGDERLVPWDDPENTFGAVRRVLFDKITAPAANIRP
FT                   MPVQLTPPEAAGAAYEAEVRAALGRPGEAVPRFDLILLGMGPDGHTASLFPGSPVLGET
FT                   KRLVAAAPPPTTAKPAVARLTFTLPLLNAARRVAFLVTAKGKETPLDKALAGPDPTVPA
FT                   SLVQPENGVDWFVAEG"
FT   CDS_pept        complement(623089..624600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="DMR_05550"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74046"
FT                   /db_xref="GOA:C4XI84"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI84"
FT                   /protein_id="BAH74046.1"
FT                   /translation="MVLGRTTSTPSADACRFDAVDAPFTLVIFGATGDLTARMLLPALT
FT                   ALTTGGHLPDNFAVVGASRTELTEEAFRERMREAAKEFGDCDNDAWAAMASRFTYKQVH
FT                   YDDPASFTALAGFLDDLAKERNLGPNRIFYLAVPPTVYEDIAVNLAGAGLAEETGGYAR
FT                   LVIEKPFGRDLETARVLEKALHTRFAEHQIFRIDHYLAKETVQNILMLRFANAIFEPLW
FT                   NRRYVNYVSILAAESIGVGHRASYYDHFGVLRDMFQNHMMQLLSLCAIEAPSLFEADLV
FT                   RDEKTKVFRALRPFSDKDVAEHCILGQYASGMVDGKRAPSYLDEEGVPGDSTTPTFAAM
FT                   RVYLDNWRWQGVPFYLISGKRLPAKRTEIAVQFKPVPFSMFRGIFGDHIEANRLILRIQ
FT                   PDEQVSLTFQAKAPGPMCLRSVTMNFNYYQGYTGAALTAYAKVLLDCMLGDQTLFWRQD
FT                   GVELCWKFLTPLLEKPSAERLFLYKSGTWGPQEAGRFFSAHGLVP"
FT   CDS_pept        complement(624626..625549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="DMR_05560"
FT                   /product="putative 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74047"
FT                   /db_xref="GOA:C4XI85"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI85"
FT                   /protein_id="BAH74047.1"
FT                   /translation="MNIAMVGLGRMGLNMARRLARGGVAVTAYNRTVQKAHDFAAEEGG
FT                   AARAVDSIPDLVAALPAPRLVWLMLPAGAATDEHIDELLPLLSPGDILVDGGNTFFRDD
FT                   LRRHEAAAKHGVRYCDAGVSGGIWGLAEGYCIMIGAEPDVAAVLKPYLDVLTGPGGNLH
FT                   TGPVGSGHYVKMVHNGIEYGMMQAYAEGFEILAASQFGEKLDFTAICDLWNHGSVVRSW
FT                   LLELAQRAFAADPRLESLEAYVDDSGEGRWTVNQAVENAVSAPVITASLFERFRSRQPN
FT                   AFQDRVLAALRNQFGGHAVKRKDGHD"
FT   CDS_pept        complement(625561..626289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05570"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74048"
FT                   /db_xref="GOA:C4XI86"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI86"
FT                   /protein_id="BAH74048.1"
FT                   /translation="MSGRTRKLLLAALAVALVAAFFGLGLHKHLTLEALKASRQALTDA
FT                   RAAAPLGFAVGYFLLYVLVAALSLPGATVLTLGGAAVFGFWTTLVLVSFASTIGATLAC
FT                   ALSRTLFREAVTKRLGPRLAAVDAGLAREGAFYLFTLRLVPLFPFFVVNAVMGLTAVPL
FT                   STFYLVSQIGMLPGTAVYVNAGTRLGELTSLSGIVSPGLLVSFALLGVFPLAARRAVDV
FT                   VRRKRVGKSTQPAPSGPNHP"
FT   CDS_pept        complement(626299..627648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="DMR_05580"
FT                   /product="deoxyribodipyrimidine photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74049"
FT                   /db_xref="GOA:C4XI87"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR008148"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI87"
FT                   /protein_id="BAH74049.1"
FT                   /translation="MLVHPARVRPLAEKPRRAGPVVYWMSRDQRAEDNWALLAAADLAR
FT                   ETGAPLHVAFALAPGYPGASLRHYDFMLRGLAETEAALRARGVPFHLLLGDPAAVAPEF
FT                   LRAIAAGACVTDFDPMRVKTLWKRAVAEAFAGPLLEVDAHNVVPCVVASPRREYAAATF
FT                   RPKIHKRLQEFLEPFPELPAFPDVALVATPPVDWGAARASLSVDAFPGPVPDIVPGPAA
FT                   ARAALDAFTAERLPGYAARRNDPNAGAVSGLSPYFHFGQLAPQRAALEVLAARAGHVAD
FT                   ADAYLEELLVRRELSDNYCHYTPNYDRYDALPDWARKTLDAHAGDEREHRYTPAQFEAA
FT                   ASHEALWNAAQRELVATGRIHGYMRMYWAKKILEWSPSPRQALDTALSLNDRYALDGRD
FT                   PNGVVGVLWSVGGLHDRPWATRPVYGQIRYMNERGCRRKFDANAYIARHS"
FT   CDS_pept        complement(627825..628619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazG"
FT                   /locus_tag="DMR_05590"
FT                   /product="putative nucleoside triphosphate
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74050"
FT                   /db_xref="GOA:C4XI88"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI88"
FT                   /protein_id="BAH74050.1"
FT                   /translation="MTEQDTRKNAAALAGLQDVIDALLGPDGCPWDKAQTPETLCDYII
FT                   EESFELVDCIRSGDVVGVGEELGDVLFLLLFVATLHERRGDFDLAQAFDGAAAKMIRRH
FT                   PHVFADCDIKDREELLRNWERIKRAEKAEKTGLYASLPKGLPPLLKAYRVHSKAARAGF
FT                   TWESDEAMAQALAAERAEFEAAVAAGDQTAMEEEFGDYLFSLTEYGRRLGLKANACLDG
FT                   AVSKFLARYKSMEKLAAARGLDLDKLDMTAKNALWDEVKISS"
FT   CDS_pept        complement(628616..629755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05600"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74051"
FT                   /db_xref="GOA:C4XI89"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI89"
FT                   /protein_id="BAH74051.1"
FT                   /translation="MTPTLNIADLSLAILWLFFAVRGYMRGLVKEAGSLAAIVTAFYLA
FT                   GAYHKQLAPNLTEYISGNYAGTAAYLLIFTVTLLGVWFVALAISGIVKITMTQWADRFF
FT                   GGGFGLVKGVILTAVLLFLLRLAAPDPDFLKGSMLVPVLDKMSTKLVNYIPPDINEKLR
FT                   KFSKKELPDPINAALEKKAAAAAAAAAAAIGDKKPAEADKKPAEPEKKAEPAKKPETKP
FT                   EAKPEAKSAEPPKKAEPAKPEADKKPAAPAPKPEAKPAEPAKPEANAKPAAPSPKVEGK
FT                   PTEPAKKPEVKPAEPAKKTEPGKPESSLKPASPALKVEMRSTQAATPGQTPAKNTETAK
FT                   ALGNASPPAAAADKTAPAAKPRPAAPDKALQAAATDKPS"
FT   CDS_pept        629759..631174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05610"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74052"
FT                   /db_xref="GOA:C4XI90"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI90"
FT                   /protein_id="BAH74052.1"
FT                   /translation="MWRRWFAVANASVADAAAKTKLSKKLPPAAGGLRPPAAPHGEKGF
FT                   REAAWLGFLAGWETNGAGMATGRKRVAPAAGGSTACPGSGDAVSNEKSPKDVPMENRIL
FT                   PTEINAFLAARVLGQQELLRRISVSLYKHIHGLPAPNVLLIGNSGTGKTTLMQAVAAFY
FT                   EAHPELDRFRLMLIINANTLSPEIEGEDRTTRLFKKLEARARVTFGGAMTAAQLKDYLE
FT                   NATVCVDEVDKISARVSGKPNVEGITTQYALLTLLEGEEFLYRATVLEDGQEITREIPL
FT                   ETGKLLFICGGAFEELYDQVYNCIVNRRDDRRLKEVSEVERRPDGTMNVRTVTRFRLRE
FT                   YLRLADMFAFGMMPQFIARFGAVAMLEELGREELRQILIGSPNSPLRLCLEYFRHMGIR
FT                   LLVTDQAITAIADAAAKNTRIGARALREIFNGLIAPYEYDPYGSPRYAETDKGPTLTID
FT                   LEAVMEYQGQTAS"
FT   CDS_pept        complement(631171..632316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="DMR_05620"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase/5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74053"
FT                   /db_xref="GOA:C4XI91"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI91"
FT                   /protein_id="BAH74053.1"
FT                   /translation="MAPDNDAVFMARALELAERGRGFVTPNPRVGAVLVRDGAIVAEGW
FT                   HKVFGGPHAEVECLREAEERGIDPAGATMYVTLEPCNHFGKTPPCSRTVLEAGVSRVVI
FT                   GCLDPNPVAGGGAETLRQGGVAVDVGILGQECRDAVADFVVYKTMGRPYVTLKLAMTLD
FT                   GRIAARTGDSAWVSGPESRRRVHRMRAASQAVMVGGGTFRADDPRLTHRLEVVDPLSGN
FT                   PQPLAVVVTRSLPPADARFALVRERSPSLVFLTSEAEARAAAGLALAKRGVRVYGLPLR
FT                   DEGELDLLPGLTRLRDEARVFRLLCEGGGGLAGQLVAQGLADELALFYAPKVLADAEAV
FT                   PGFSGRIIPRMADAAGFRFCGLRQVGEDILVTARPAAEPSA"
FT   CDS_pept        complement(632306..632767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="DMR_05630"
FT                   /product="putative dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74054"
FT                   /db_xref="GOA:C4XI92"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI92"
FT                   /protein_id="BAH74054.1"
FT                   /translation="MDKRLPWPDYFMRIAYLVAERSTCLRRKVGAVAVRDRRILATGYN
FT                   GSPTGTAHCLDIGCLREKLGIPSGERHELCRGLHAEQNVIIQCALHGVPIAGADIYCTT
FT                   QPCLICTKMLINSQVNHIYFSQGYPDPLSAEMIAEAGIGFDVLEGDHGS"
FT   CDS_pept        complement(632882..633262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74055"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI93"
FT                   /protein_id="BAH74055.1"
FT                   /translation="MRRRKPASTREGRPGPGSHAMGAALYLSFILLIFCLARAARSSLE
FT                   KDPAAIAPEELPESAWRALRRSAQGITVTEAWVSMNGEAGLRYRVRGVMPGGGRVELDI
FT                   HHDGTAYRRDGPPPLPRAAGRT"
FT   CDS_pept        complement(633289..634773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05650"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74056"
FT                   /db_xref="GOA:C4XI94"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI94"
FT                   /protein_id="BAH74056.1"
FT                   /translation="MIDTMRKVGLPLGPALFLLVCLIPPHDGLSQQAVYCAAVTALMAT
FT                   WWITEAIPIPAASMIPIVLFPFLQIMPSAKATLPYANHLIYLFMGGFFIAVCMERWNLH
FT                   YRIAMHTIRLVGTSPSRIVLGFMVAAGFLSMWVSNTATTVMMMPIGLAIIKACADITGD
FT                   HDLRHNPFAVSLMLALAYAASIGGLGTIIGTPPNTIMVAQIDKLYGQTISFLDWMKVGV
FT                   PLAATFLIITWLLLTKVLFPVKGDILQGKGAQLIQAELAKLGAMKKEEKLIVAVFAVVA
FT                   TLWILMGLVKWPIFKGVSDASVAIAGALLLFVIPSDLNKGVFLLDWKTAVKIPWDVILL
FT                   FGGGLCLADGFQDTGLTKYIAGLLVDLEGMQLIWIIACIVALNIFLTEVTSNTAVATLM
FT                   IPVMGAIAVGMKINPFGPIVAACIACSYAFMLPVATPPNAVVFGSGAVTIRQMARTGLW
FT                   LNILGIIQITLVVYFLMPWVWGIDLTVLPDWAIPKK"
FT   CDS_pept        635022..635456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74057"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI95"
FT                   /protein_id="BAH74057.1"
FT                   /translation="MPSDIRSVILDMVRNSDRPVKDIADAVGKPYSTLMRELDPGDARA
FT                   KLGVELLLLPLMQACDSTAPLRCLAEALDCRLVSNRGITPDKPTFHEELLDTYQALVDY
FT                   HRAMLEGLPPDVVGKKRETLIRQLKEDFAFYVARSGGGEG"
FT   CDS_pept        635566..635868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74058"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI96"
FT                   /protein_id="BAH74058.1"
FT                   /translation="MAFCPKLSYHLDSRPRPGAGNPAEAGSRSIAMSAKTASFAAVCPH
FT                   CGQAVTATASSADVTAGSVSVKEKCQRCLGEFDAIAEADCLEWDDQCKVEMSRLG"
FT   CDS_pept        635897..636376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74059"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI97"
FT                   /protein_id="BAH74059.1"
FT                   /translation="MAYWLIKSEPGCFSIDDLAAAPDRTTGWDGVRNFQARNFLRAMRL
FT                   GDGLLFYHSVTDPGVVGLAEVAREAYPDATAQDPDSGHFDPRASPDKPLWDMVDVRFVA
FT                   KFPAPVPLAALRGVPELAGMEVLRKGSRLSVTPVTDREFAVIRAMGLGQGGPGTR"
FT   CDS_pept        636408..638969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05690"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74060"
FT                   /db_xref="GOA:C4XI98"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI98"
FT                   /protein_id="BAH74060.1"
FT                   /translation="MRNPPWLPVVGFPLPSAWVLALVVLLDPGKALADVSLQSLNMVDG
FT                   LGGVFPQMAALWASLALAGVMAGIIVALLVALASRKQALAALGESQARYQGVVENAPAA
FT                   IFIVNAAGRFLDVNPKACRLTGYDRETLLGLTIGEVLDQDSWQAVATYLADFKEGARIA
FT                   EVSGRRRDGAKRWWSVSAVRLDGERVLGFAADVTERRRRDDARSVFYELVQNAEHVVVF
FT                   KDRDLRYVMVNRAYQNLTGRPLEDVVGKTDPEAFEGLSAPEQIARYVENDRRALNLPRG
FT                   RTLTSEEEMRGEGGGVRTFLTKKFPVYAEDGRLLGVATMASEITERKKAEARLRESEGR
FT                   YRLLAELAPVSIMAFDAAGRIIFVNRRHLDTFAAGRRDRDYFLGRRLTDLPGIVRAGIA
FT                   GKLAPLLEGREVDLEAVHFPEFTGGHSGYVNLRGVPFLRDDGSLAGGILIREDVTARIE
FT                   MERTLTAARNEAQAANQTKSEFLANMSHEIRTPLNGVLGMLQLLRDTPLTAEQGEYADL
FT                   AIQSSRRLTRLLADILDLSRVEAGKMAILCESFELARAVTEAVELFRPSARQAGVELRV
FT                   YVDAALPARVAGDAARFQQVLANLVGNALKFTAKGSVAVEAYPLPPRREGETRALFSVA
FT                   DTGCGIADADLTRLFEPFVQGSRGYSRNAQGAGLGLSICKSLVELMGGNIAVDSEVGRG
FT                   TTIFFCCSFNVCEPAGQAAAPVAAPAAPGGLRVLVAEDDRITRLAVRRLLEKEGHAVAE
FT                   AVDGVQALEALLRQPFDLVLMDIQMPGLDGVQAVRVMRDDPRYAVVAGLPVVALTAFAM
FT                   AGDREAFLTAGMDAYVPKPVFRDELLRAMEDALAAGRARNV"
FT   CDS_pept        639074..640891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05700"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74061"
FT                   /db_xref="GOA:C4XI99"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XI99"
FT                   /protein_id="BAH74061.1"
FT                   /translation="MTGPPRLGRAALFPYRFPVRPPGTVLFAMPRLAGLRAVVAVLCVA
FT                   ASLAAAAVGHGAEFVPGVTRPVVVGGDRDYPPYEYLDKNGQPAGFNVDLARAIGEVMGM
FT                   RVEFRLGSWAEMRQALLDGEVDILEGMSFSEERAAEEVDFAPPSAVVNHAIFARKGERL
FT                   ARSLDDLAGKKVIIHRRGYMHDQLAARGYEQDLILTDTPADGLRLLASGVGDFAVVAML
FT                   PGNYIIRDNKLDNIEVVARSVATLRYGFAVKKGNEALLARFSEGLAILRGTGQYEALYN
FT                   KWLGVLEDRPLPWTTVARYAGAVGLPLLALLGGSMLWTHFLRRQVAQRTASLSQALDEL
FT                   SRNQRQLVQADKMAALGILVSGVAHEINNPNGLILLNIPILRKAQADAVRLLARRYEEE
FT                   GDFLLGGIPFSRMRNELPRLLEEMQEGAQRIKRIVNDLKDFARREEGSARSLIDLADAA
FT                   RMAVRLLDAAIRKATDRFTAVYEPDLPLVWGHAQRIEQVVVNLVLNACQALPDRDRAIV
FT                   LEVVHDVEKNQVVLAVRDEGTGIAPEHLPHLTDPFFTTKRETGGTGLGLSVSAGILKEY
FT                   GATLSFHSVPGRGTTAVVAFPVANMEHAA"
FT   CDS_pept        640888..642303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05710"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74062"
FT                   /db_xref="GOA:C4XIA0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA0"
FT                   /protein_id="BAH74062.1"
FT                   /translation="MSDTPFPAFGILLVDDEPAWLRSLSLTLESSAGVTNLFLCQDSRD
FT                   VLPLLQKGGIRLALLDLTMPGLSGEELLARIGEEHPEVAVIIVSGVNQLDTAVRCMKLG
FT                   AFDYYVKTDEEDRIVSGVLRAIRMIEMRDENRAVSDSLAAGTLSRPEAFAGIVTRSRAM
FT                   FQVFAYIEAVAKSSQPLLVTGESGVGKENVVRAVHGLSGRTGPLVAVNVAGLDDTVFAD
FT                   TLFGHVRGAYTGAEAARKGMIEEAAGGTLFLDEIGDLSIASQVKLLRLLQEGEYFALGS
FT                   DLPKRLQARVVVATHRDLAVEEAAGRFRRDLYFRLRTHQTRIPPLRERREDIEPLARHF
FT                   LAEAAAAMGKPVPAMPRELPGCLAGYAFPGNIRELRAMLYDAVSLTTGPALALDGIQAA
FT                   VGRCDACREAPPANLFAGCDRLPTFAEAAELLVDEALARAGGNQTLAARLLGVSQPALS
FT                   KRLKARRDAEGGE"
FT   CDS_pept        642989..644332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcu"
FT                   /locus_tag="DMR_05720"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74063"
FT                   /db_xref="GOA:C4XIA1"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA1"
FT                   /protein_id="BAH74063.1"
FT                   /translation="MLTMQLCVILLCLLLGTRYGGMGLGLISGIGLFVLCFVFGVQPGK
FT                   PPIDVMLTILAVIGCAATLQTAGGLDVLMRAAERVLRKHPEHITLLAPITTWSLTVMCG
FT                   TGHVAYTMFPIIYDIAINKGIRPERPMAVASVSAQIGVCASPVSVAAVSMVSMLAQAHG
FT                   IGKAISIVDLLSVSIPATFFGVLCAGLWSMRRGKDLDKDPEFQAKLADPEQKAYIYDGG
FT                   ATLLDKVFSKESYRAVWFFFAAIAAVVVLGAFSELRPSFGVPGKLKPLSMNLVIQMVML
FT                   MAGAFILIFCKVKQQTIANSAVFKAGMVAIFSVFGVAWMTDSFFEAHYETLKASLSAVV
FT                   VAYPWTYAIVLVVVSKLVNSQAAALAAVVPLGLSLGLEPKILLAFLPMCYGYFILPTYP
FT                   SDLACINFDRSGTTRIGKYILNHSFIIPGAIGVGCGTLMSYTLVKIFM"
FT   CDS_pept        644356..645195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttdA"
FT                   /locus_tag="DMR_05730"
FT                   /product="L-tartrate dehydratase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74064"
FT                   /db_xref="GOA:C4XIA2"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA2"
FT                   /protein_id="BAH74064.1"
FT                   /translation="MRTIDKKTVVEAVAALCMEANRFLPADVLAAFARAKAAESSAAAR
FT                   EVFNQLEENAALAKETGLPLCQDCGLGVFFVEVGEDVRLAGGGLREAINEGMVRGYQDG
FT                   FLRKSTCDPFSRKNVGDNSPAIVHFDLVPGDRLKITMMAKGGGSENMSRVMMLAPAQGW
FT                   KGVREFVIRRVAESGSNPCPPIIVGVGIGGNFELAAINSKKALMRELDDVHADPEVAAM
FT                   EADLLASINRLGIGPMGLGGGTTCLGVKVKLAPCHLASLPLAVNIQCHSARHKEVTL"
FT   CDS_pept        645195..645749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttdB"
FT                   /locus_tag="DMR_05740"
FT                   /product="L-tartrate dehydratase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74065"
FT                   /db_xref="GOA:C4XIA3"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA3"
FT                   /protein_id="BAH74065.1"
FT                   /translation="MAEHHLTTPLTDADVSKLRAGDVVYLTGVIYTGRDAAHKRIVDAL
FT                   DAGENPPFPLQGAVIYYVGPSPARPGRPIGSAGPTTSYRMDSYAPRLLKLGLKGMIGKG
FT                   MRAAPVREAMETEMAVYFGATGGAGALLGLRIKDAKVIAYEDLGPEAVRELTVENFPVL
FT                   VINDCVGGDLYAVPDLEAALG"
FT   CDS_pept        645742..647142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="DMR_05750"
FT                   /product="C4-dicarboxylic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74066"
FT                   /db_xref="GOA:C4XIA4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA4"
FT                   /protein_id="BAH74066.1"
FT                   /translation="MASPGAVSAGGVCPGGPKPLYASLYFWVVAGIVAGIVLGLVPATK
FT                   GLAMEMQPFGTAFIRMVKMIIAPIIFCTVVTGIAKMGDMGKVGRVGLKCMLYFWAMTLC
FT                   ALAIGLVVVNLLQPGAGMDDYAARMQANQAETAKVEEFAGKARKLSTTEFMLNIVPHSA
FT                   VDAFAKGDILQVLFFSILFGVGLASLGEKTKRLVGVIDEFGQGLFKVVHYIMYFAPLGA
FT                   FGAMAYVVASQGHDALARLFYLMLGVYVTCALFIFVVLGLVCRLAGFSLLRYLAYIRDE
FT                   ILLVLGTSSSEAALPRMMRKLERAGADKSVVGLCLPMGYSFNLDGTCIYLTMAAVFLAQ
FT                   ATGTPLDLGHQLSLLGILLLTSKGAAAVTGGGFITLAATLQTMGTIPVASLTLLLGVDR
FT                   FMSEARAITNLIGNGVATLVVAKWEKALDVARLEAALSGGLCDDEDAAPLLASAEPALS
FT                   VVENEQQR"
FT   CDS_pept        647158..647817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="DMR_05760"
FT                   /product="fumarate reductase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74067"
FT                   /db_xref="GOA:C4XIA5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA5"
FT                   /protein_id="BAH74067.1"
FT                   /translation="MSVPSTATHAGLPVGKLAAWLDWVQMLTGAALVLFMWCHLMLVSS
FT                   VLISPKVMNALAWFFEVTYMAQVGGPLIFLAFLVHFVLAARKIPFATSQQRVMLSNAKR
FT                   LRHTDTWLWVVQATTAMGILIMGGIHLWVVLNDLPISAEKSAARIQSGFWFVFYLILLP
FT                   MVELHVGVGFYRILVKWGFLDRSGRFSLKKKENAMTMIFIGIGLLTLLRYYFLPLK"
FT   CDS_pept        647830..649653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="DMR_05770"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74068"
FT                   /db_xref="GOA:C4XIA6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA6"
FT                   /protein_id="BAH74068.1"
FT                   /translation="MRIIQSDVLSVGAGLAGERVAIEAAENGFSAICLSIVPARRSHSS
FT                   AAQGGMQAALGNSAMGEGDCPDVHFADTVKGSDWGCDQEVARLFCDNAPIAMRQMAFWG
FT                   VPWNRVVPGEQTYYKGGKPFTAFEKPENEGLIHSRNFGGTAKWRTCYTSDGTGHCVLFT
FT                   LDNRAAQVGVTVIDKVEVIGLIHDGETCMGAVARCLKTGELTAYLAKATLIATGGFGRI
FT                   YRESTNAVICDGGGLIAALDTGVVPLGNMEAVQFHPTGIVPTDILVTEGCRGDGGTLLD
FT                   KNEYRFMPDYEPEKAELASRDVVSRRMTEHMRKGLGVPSPYGDHLWLDIRHLGEHHIRT
FT                   KLREVDEICQSFLGVDPVHQLIPVRPTQHYSMGGVRTNKDGAAYGLKGLFSAGEAACWD
FT                   MHGFNRLGGNSLAETVVAGMIVGAKIVEFLKGAETVIKTASVRDAMAAQQARIDDLINC
FT                   ANGRENPYAVKNAMHDAIMKGAGIFRNGKDLETCVADLQEILGRARRVGLRSNGKGANP
FT                   ELTMALKIQGMVKLALCVAYGALKRTESRGAHTREDYPERNDRDWLTRTLATWAEGADL
FT                   PTLNYEAATQTFELPPGDRGYGGGKIIARDE"
FT   CDS_pept        649795..650550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="DMR_05780"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74069"
FT                   /db_xref="GOA:C4XIA7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA7"
FT                   /protein_id="BAH74069.1"
FT                   /translation="MARTLTFNIFRYNPSDPASSPHMDTFTLPETERMTLFIALNKIRE
FT                   EIDPTLMFDFCCRAGICGACAMVINGRPGLACHTKTKDMPEDITLMPLPVFKLVGDLSV
FT                   DTGTWFRGMYQKVESWVHTDKVFDPAAKEERMDNALAEQIYELDRCIECGCCVAACGTA
FT                   LMREDFLGAVALNRLARFILDPRDERTEKAYFDIVGTDEGIFGCMGLLACEDVCPKQIP
FT                   LQEQLGKLRRKMALAAVKNILPRFLKKDF"
FT   CDS_pept        650919..652100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05790"
FT                   /product="ABC transporter substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74070"
FT                   /db_xref="GOA:C4XIA8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA8"
FT                   /protein_id="BAH74070.1"
FT                   /translation="MKRIVIALALVLCAAQPALADKVAAPIPIGIAVAQTSNVALFGQE
FT                   QVNGAKLAEERLNAAGGVNGTKIALVFQDTAGDEAGAVNAFQNLLNRDKVVAIIGPTLS
FT                   QQAFAANPIADRAKTPVVGPSNTAKGIPEIGEFVGRISAPMTQVAPNSLKQAMKIKPDL
FT                   KRVAVLYAQNDAFSSSETTTFQDAIKELGLETVTVQKFQTTDTDFTTQVTAVLGANADL
FT                   VVISGLAADSGNLVKQLRQLGYKGLIVGGNGLNSPNMFPVCGALCNDVLVAQAYSPGAV
FT                   DKNPVNKDFAAAFEAAYKKGPAQFSAQAYAAVQVVVEALAKIEKETGKKIADFELADLR
FT                   AALNKSLRTGTYLTPMGEISMAPSGEVQQKDFYVSKIVMNPDGKTGAFVLVSE"
FT   CDS_pept        652171..653121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05800"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74071"
FT                   /db_xref="GOA:C4XIA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIA9"
FT                   /protein_id="BAH74071.1"
FT                   /translation="MDFAWLLQSLLNGLSIGSVYAVFALGYTLVFSILGIINFAHGAVF
FT                   TLGAYLTYALAVGHFGINGLLADWTMPVTLPFVPALILGALLSGLAGMAVERLAFKPLR
FT                   KRGADPLLALVSSLGVALIVVNLIQYLVGAEIYSFPADIFGDLPMAVIFKIGGKPVAVR
FT                   TIQIILFGASLVMLAGLGWFIGRTRGGKALRATAENADTASLLGISVNRFILGTFFISG
FT                   LLGGLSGTLIGVSFGVAGPYFGVSYGLKGLAVIVLGGLGSIPGAVLGGLVIGLGEAFLP
FT                   SDMSSYKEAVAFVLLFAILLIRPQGLLGGRLEQKV"
FT   CDS_pept        653124..654023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05810"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74072"
FT                   /db_xref="GOA:C4XIB0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB0"
FT                   /protein_id="BAH74072.1"
FT                   /translation="MSGFFENYGFLIVTIVQQALLGLSIYFPLMAGQLSLASIGFYSLG
FT                   GYVAAIMGTHPALAPLREALGFWMFPLEWLGALILSVILGIAVGYPALRLRGIYLALAT
FT                   VAFVQVVNVAVLNMPIAGGAVGLFGIPQAFESRLDYIWFFGPLFLFALFLVWRIGNMGR
FT                   GLAFFAVREDELAAGAMGVATTGNKVTAFVLGCALAGVTGAMSAPFLNTWNARQGTFDA
FT                   SVTCLAYVLIGGSRSIWGPLCGAALLVSLPELLRPLKDSRMILNGVVLVAACVYLPQGI
FT                   MGGLAALRSRLSGRGGAA"
FT   CDS_pept        654020..654799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05820"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74073"
FT                   /db_xref="GOA:C4XIB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB1"
FT                   /protein_id="BAH74073.1"
FT                   /translation="MSALLQATDLRRRFGGLMAVCDVSIEVRPGEIMGLIGPNGAGKTT
FT                   FFNLLTGMTRADSGTVVFDGHDVTRAKPEAIARLGLARTFQNIRLFGGLTLMDNVRVAG
FT                   RVQARHGLLSGLCFTPGSRREDEAVTEEAYGLLRLVGLEDRADNLAASLPYGDRRRLEI
FT                   ARALALSPKLLLLDEPAAGLNPSEKLGLADFIRDIKERFDLTVLLIEHNVPMVMGLCDR
FT                   VMVLNFGQTIAVGAPEDVQRDPGVIEAYLGGDAHGAA"
FT   CDS_pept        654786..655493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05830"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74074"
FT                   /db_xref="GOA:C4XIB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB2"
FT                   /protein_id="BAH74074.1"
FT                   /translation="MALLEVEALCVNYGAVSAVRDVSLSVEQGEIVTLIGANGAGKTSI
FT                   LRAISKLVAPRSGVVRFDGRDVTALPPEALVRLGMAHSPEGRQVLAKQSVGDNLELGAY
FT                   VRKDRAEIAKDMARMYELFPRLSERRNQSAGTLSGGEQQMLAIARALMSRPRLLLLDEP
FT                   SLGLAPLLVSEIFEIIAGLGAMGTTILLVEQNARLAMRAAARTYVVESGGIVLEGPSAE
FT                   LAADERVTKAYLG"
FT   CDS_pept        complement(655572..656114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74075"
FT                   /db_xref="GOA:C4XIB3"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB3"
FT                   /protein_id="BAH74075.1"
FT                   /translation="MSDQQAARGSPTTPENPMDHDKDALPPPALTRDDVFLARCHGVIK
FT                   MAVRFLAVLMTFVICWGTLDVVWVMYRRMAANPYFLLDISDILATFGAFLAVLIAIEIF
FT                   ENIVMYLRMEFIQVRLVLATALMAAARKVIVLDFQETDPQFVWAIAAVILALGVVYWLL
FT                   SAKKAAAPAPGNPAGAP"
FT   CDS_pept        656362..657129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74076"
FT                   /db_xref="GOA:C4XIB4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB4"
FT                   /protein_id="BAH74076.1"
FT                   /translation="MSGKANISESLAKGLAILDLFGVEDAGFTLSEIAARVGISKTSAH
FT                   RYVTTYCEQDYLARDPRSGLYRLGVRTLALAQSMIETSELVRGLRPFVDEAAARHGIHI
FT                   DVALLSRDAVYLVYRRDSADTRVFRSFSYASSLHYLAAGKAAMAFMEPRALAGIMSRLQ
FT                   LTAKTDRTITDKAVLEAELAEARELGYAKNNEESLPGLIAIGAPLFSLRTGEVVGAVSF
FT                   DSSTATYSMQELERLFAGYLVELAKKISAVVSL"
FT   CDS_pept        657181..658314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05860"
FT                   /product="ABC transporter substrate binding protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74077"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB5"
FT                   /protein_id="BAH74077.1"
FT                   /translation="MRKMLLLCLALVLGFANAALAADDTVKIGVFLPLTGQNAFGGQLE
FT                   LEGVQLAAKENPTVLGKKVELFVVDNKSDKVEAANAVKRLIEKEKVQAIIGTYGSSLAM
FT                   AGGEVSEKAGIPQVGTSCTNPLVTQGKKYIFRVCFIDPYQGAGAATYAYKTLGLKKAAM
FT                   LVDLASDYSVGLSKFFSKSFTKLGGQVVATLNYQSGDQDFTAQLTKIISEKPDVLFIPS
FT                   YFAEGAIIMKQAKELGATFKIMGGDAMDNPKITDIGGAAVEGFVHTTFPYDPSMKNMTE
FT                   MAKKFTAAWKAQYPGKELNVNAALGYDAYMIILDAITRAGKADPESIAKALAATKGFQG
FT                   VTGATTINETHDAEKPVGLVVIKDGKKIYEGEITPEL"
FT   CDS_pept        658411..659304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05870"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74078"
FT                   /db_xref="GOA:C4XIB6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB6"
FT                   /protein_id="BAH74078.1"
FT                   /translation="MNSATFIQHMLNSLTLGSLYALVAIGYTMVYGILRLINFAHSEMF
FT                   MLGAYFVFWGITLANLPWPVAMVIAIVVTATLGIVVDQVAYRPLRDAPRISALISSIGV
FT                   SFFLQNVAIVFFQAIPREVYRPQWLENPIIMGGVRVLPLTLFVPLLSLALMLGLIWIVY
FT                   RTKAGLGMRAISKDIETSYLMGVPVNRIIALTFGIGSALAAASGIMWALRYPQLQPIMG
FT                   TIPGFKAFIAAVFGGIGSIQGAVIGGLALGFIEIMTVAFFPDLAGYRDAFAFVLLIAVL
FT                   MFKPTGLLGERLEDKV"
FT   CDS_pept        659304..660341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05880"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74079"
FT                   /db_xref="GOA:C4XIB7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB7"
FT                   /protein_id="BAH74079.1"
FT                   /translation="MRRGQTIILNLVAVLALGGFLWLAEGNFDGYKIQILNLIAINIIL
FT                   ALSLNLIYGFTGLFSLGHAGFMAIGAYICSILIMTPDQKDMLFLLEPAYDWVQNAHAPF
FT                   LVAVLAGGLVAAAIGALVGFPLLRLGDDYLGIATLGFAEIIRVLANNFPRLTNGALGFK
FT                   GIPDYANLWWNFGWCLVTLYVIVRLLKSNTGNVLKAIRDDEAAARAMGVNVFRYKLLSF
FT                   TVGAFFAGIGGALLASLLTTIDPKMFLFTLTFNILMIVVAGGLGSLSGTVMAGIGITVL
FT                   LEWLRVVENPVDIFGYELPGVPGMRMVVFSLALIMIILFRREGLMGMRELHWQSLSKVF
FT                   SRGRA"
FT   CDS_pept        660341..661126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05890"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74080"
FT                   /db_xref="GOA:C4XIB8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB8"
FT                   /protein_id="BAH74080.1"
FT                   /translation="MSGDVILATNDVTMRFGGLAAVTDLSLAVRRGTIAGLIGPNGAGK
FT                   TTCFNMITGFYKPTMGSIVFNGQEVTGLPPHKVCKAGIARTFQNIRLFGNETVLENVMI
FT                   GRHLRQKTSWIDAVLFTPGYLREDKSMRAHCLELLAAVGLADLADEKASSLAYGAQRRL
FT                   EIARALATEPSFLLLDEPAAGMNPQESEDLMGFVRTIRQDFDLTILLIEHDMKVVMGIC
FT                   EHIWVLDYGVTIAEGAPEAIRRDPKVILAYLGEEGGLHA"
FT   CDS_pept        661119..661823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05900"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74081"
FT                   /db_xref="GOA:C4XIB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIB9"
FT                   /protein_id="BAH74081.1"
FT                   /translation="MLEIRDLHVHYGGIHALKGVSLDVPKGSIVTLIGANGAGKSSTLR
FT                   AISGLVKNKRGRISWNGTDISTKNPVDIVKSGIVMSPEGRRIFAHLTVLENLRLGAYSR
FT                   SDEAGIAKDIDWVFELFPRLSERRNQKGGTLSGGEQQMLAVGRALMAAPQLVMLDEPSL
FT                   GLAPLIVKEVFDIIRMINAKGMTVLLVEQNAYAALKVAHQAYVLEVGTITLSGTGEALI
FT                   ADDRVREAYLGG"
FT   CDS_pept        661933..662448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05910"
FT                   /product="putative asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74082"
FT                   /db_xref="GOA:C4XIC0"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC0"
FT                   /protein_id="BAH74082.1"
FT                   /translation="MGKHVKLAVYSMGGTIDKVYFDDLSDYSVGDPQVGAILTQAGVDF
FT                   TWSVTEIARKDSLYVTDEERAVLRGRILADAAGHVLITHGTDTMTRTAEFLADIPGKTI
FT                   VLTGAMSPARFAASDAPFNVGCAVGAVWSSPPGVYIAMSGRVFPAGAVRKNRKRGRFED
FT                   AAPAGGEG"
FT   CDS_pept        662531..663757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05920"
FT                   /product="putative threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74083"
FT                   /db_xref="GOA:C4XIC1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC1"
FT                   /protein_id="BAH74083.1"
FT                   /translation="MCFASGRSPMIELADVLAARERLSPRLAPTPFLQSQVLSAMTGAA
FT                   VWVKFENHQFTASFKERGALNKLLTLSETERSRGVSAMSAGNHAQGVAYHAKNLGIPAV
FT                   IVMPAHTPSVKVEHTRAHGAEVVLAGETLAEATEAAKRITAERGLTFVHPFDDPMVMAG
FT                   QGTVALEMLDAVPDLDVMVTPIGGGGLISGVATAAKGVRPDIEVVGVQAACYPSMLCAM
FT                   RGEPPEGTGNTIAEGIAVKYPGALTTEVVKARVDAVLTVDEPRLEQAVALFLFIEKTVA
FT                   EGAGASPLAALLEYPGRFAGKKVGLVLSGGNIDPRLLASVIMRELIREGRVVTIRLPIS
FT                   DRPGTLAQVTAVLRDSGANIMEIQHHRTLLALPAKEASLEIAFEARDREHGRSVVAALT
FT                   AAGFQPEVL"
FT   CDS_pept        complement(663812..664258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74084"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC2"
FT                   /protein_id="BAH74084.1"
FT                   /translation="MEIRYPARLEPQEGGGYFVSFPDFADTFTEGDSEEEALYYASEVL
FT                   TAMLETKIAHDLPIAAPSPAGPGERLIAPDAKTQAALLVRFARGPRALADLARALGTSW
FT                   PAAKRLEDPGHWPSLKSLERAAAALGQRLVLSFEETKTGRDHTR"
FT   CDS_pept        complement(664267..664452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74085"
FT                   /db_xref="GOA:C4XIC3"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC3"
FT                   /protein_id="BAH74085.1"
FT                   /translation="MNGHDVIERLKAAGWRLDRIKGSHHVMLKDGRAVPVPVHGAKDLG
FT                   AGLLAAIARQTGVTLK"
FT   CDS_pept        complement(664483..664614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74086"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC4"
FT                   /protein_id="BAH74086.1"
FT                   /translation="MIFSYTMLSYVFQGRDASGGVRAGDGNAGHAAGFPETPSEADS"
FT   CDS_pept        664771..665412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74087"
FT                   /db_xref="GOA:C4XIC5"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC5"
FT                   /protein_id="BAH74087.1"
FT                   /translation="MARWFPEALAAAFAVFFVLLGLSPVSREVWWAEVIPIMVVFLLLV
FT                   ATARRFRFSNLAYALMSVWLVLHTIGGHYTFANVPFGFVTDLFGFSRNHFDRMAHFTVG
FT                   FYAFPLAEFLWRRRLAHPAVIAVFGLTMIMAVACAYEIIEWWYAAAEGGQAGIEFLGSQ
FT                   GDVWDAQKDMLADTLGAVAVVALFWIVRRRLPVEPDRAGSYRHDRSCRVS"
FT   CDS_pept        666297..667319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05970"
FT                   /product="molybdopterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74088"
FT                   /db_xref="GOA:C4XIC6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC6"
FT                   /protein_id="BAH74088.1"
FT                   /translation="MRSIPVHQASGMVLCHDITRIVPGEGKGPAFRKGHVIEDGDIDTL
FT                   LKLGKEHLYVWDLADGFIHEDDAAERMARAIAGEGIVLSAPCEGRINLLAAHAGLLSID
FT                   AGILRRLNGIEEVTIATLHGNVVVTPGQMLAGTRVVPLVVDEAKIEAVEAVCAAYGPVV
FT                   RVRPFRPLKVGVVTTGGEVYHGRIKDAFGPILRRKFEALSCAVTRQIFVPDDQDMTVRA
FT                   IARLIDEGADMIAVTGGMSVDPDDLTPSSIRAAGGEVVTYGSPTFPGAMFMLAYVGEIP
FT                   VVGLPGCVMYHKASIFDLTVPRLVAGEYLTRDDIVELGHGGLCAMCPECRYPACGFGKG
FT                   "
FT   CDS_pept        667417..670149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05980"
FT                   /product="aldehyde oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74089"
FT                   /db_xref="GOA:C4XIC7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC7"
FT                   /protein_id="BAH74089.1"
FT                   /translation="MQEKILIVNGIERKIIADPEAFLSDVLRNQLHMVGTKVGCAQGQC
FT                   GACSVIIDGKVTRACITKIRRVADYANVTTIEGIGTPANLHPLQTAWVVHGAAQCGFCT
FT                   PGFIMSAKGLLDGNPKPTREQVRDWFQKHRNVCRCTGYIPLVDAVMDAAKVLRGEMTLC
FT                   INHNMPADGNVFGSRAPRPTGVAKVTGQWLFGDDQKNMLPPGTLHLAIVEARVSHANVK
FT                   GVDTAEALKMPGVHSVITAKDVKGKNRITGLITFPTNKGDGWDRPILCDTKVFQYGDAI
FT                   ALVAADSEANARAAAEKVKVDLEVLPAYMSAPAAMADDAIEIHPGTPNTYYEQNHAKGA
FT                   EVAPFFADPAKYEVMGGDYYTQRQPHLPIEPDVGFAYTNEEGKLVIHSKSIGLYLHLYM
FT                   IAPGLGVEPENLVLVQNPTGGTFGYKFSPTMEALVGVAAMVTGRPVHLRYNYAQQQYYT
FT                   GKRSPFWTKGKIAVDKATKKIVASEMEWIVDHGPYSEFGDLLTLRGSQYWMAGYGIPNM
FT                   RAKGYCVATNHGWGSAFRGYGSPEIMFPSECLMDEMAEKLGMDPLEFRYVNVYRPGDTT
FT                   PTDQVPDSWTLPEMIDILRPKYKEALANAKKNSTATHKKGVGVAIGIYGSGLDGPDSAG
FT                   ADAELNADGSVTIYNTWQDHGQGSDAGTVGFAHEALKPLGIPACKIKLVLNDTSKCPNS
FT                   GPAGGSRSNVVVGQAIKNGCEQLVAAMKKADGTFRTYDEMVKEGLKTRYNGTWTAPAKD
FT                   CDANGLGSPFCCYMYGVFLAEVTVELATGKTQVDKMVLVEDIGTINNRQTVDGQNWGGL
FT                   AQGIGLALTEDFEDIKKHSSLAGAGVPYAKDIPDAMELIYVESPREHGPFGNSGVGEVP
FT                   LCGPHPAIINAIYNACGVRIRHLPAYPEKVLAGLKALGK"
FT   CDS_pept        670240..672546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_05990"
FT                   /product="iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74090"
FT                   /db_xref="GOA:C4XIC8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC8"
FT                   /protein_id="BAH74090.1"
FT                   /translation="MDQQGLRDIEYRCIQEEQPACQAACPLHVDVRKFMAQVRSGDFSG
FT                   ARKTLDRTLPLPTVLGRVCDHLCQTRCVRLPIDAALAMGSLERAVLQATGPAAKPLSMP
FT                   GKGKRAAVMGGDVSALTVAWDLGKKGYAVDMYFPGDAPGGHLRALSPEILPPAALAAEI
FT                   EIMGRMNVTFRPGTTLDAALLDQLCADNDGVYVEALSVPALGLARDDVDSLTLALAGRE
FT                   GVFCGGFAAPGEPLSVISLAGDGRRAAVSLDRHLAGVSVTASREREGACPTRLFTNTTG
FT                   VIPLPAVAAADAAAGFTPDEAKAEAARCLDCQCLECVKACTYLARYKGYPRVYARQIYN
FT                   NLSIVQGARSYNQMINSCTLCGQCEELCPSGFSMPDLILSARRDMVSRGKMPLWAHEFA
FT                   LEDMAFSLSDAFRLMRAAPGETTCSHLFFPGCQLGGDPAASVPAVYAHLRAGLAGGVGL
FT                   GLACCGAPAFWAGRQDLAEAAMTAFQADWEALGKPRVIAACSSCQATFARLAPDIPVVS
FT                   LWRVLLDEAGLPAPAGQLPDAPVAIHDACTGRHDAAGLAAVREILAKRGVAVEELPASG
FT                   KLASCCGFGGLQANAHPELAAATIARRVAESPRDFVATCSMCRDRLAGAGKRTFHLLDL
FT                   LFPSKAADPARPDPGFSYRHEARVRLKRAVLETFWNEPAPPDTPPAVRLVIPDAVRAVL
FT                   EARHVLDTDLARVVAYAEATGRKFTDAATGRHLAGLAGARVTYWALYEMLDGVAHIHAG
FT                   YSHRMNVTGVDRQEA"
FT   CDS_pept        672552..672767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74091"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIC9"
FT                   /protein_id="BAH74091.1"
FT                   /translation="MNDTPTYLPESGDWSCAACGEKLAPAPVGVTYLQGGFTITLMTCP
FT                   KCGLSLVPEHLAVGKMFEVEQLLEDK"
FT   CDS_pept        672767..673537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74092"
FT                   /db_xref="GOA:C4XID0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XID0"
FT                   /protein_id="BAH74092.1"
FT                   /translation="MPFAAPLTGPAPFAPPAGPGLGGGRPGEKPYERADVRRATGGAIR
FT                   PGGLALTDRALDLLPFAAGARLLDCGCGAGATLARLSAAGFRAVGCDISALLAAEAAGR
FT                   VPGRALRAEACWLPFASTVFEGVFGECVLSALARPEAALEEIARVLVPGGYLVVSDLYL
FT                   RAGSPGSGGAGAGCAAGALPREVAESRFARHGLPAVVFEDHTRHLIDLSCRLVLELGSA
FT                   REVMAVLTGREPGCAGDGQKPRLGYGLWICRKEA"
FT   CDS_pept        673513..673983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74093"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIS9"
FT                   /protein_id="BAH74093.1"
FT                   /translation="MDLPQGGVTMNPTLLEILPLAHKGYCCSQILILLALAAQGRENPE
FT                   LVRAAMGLCHGMGGTGGACGIMTGGCLALGLYTGKGRDEETPFEQGDALVSDFVDWFSQ
FT                   RALDDYGAITCAAILSDGKPDPTRCGGLMADAWNKMLELLVAYGLDPSEGRD"
FT   CDS_pept        674111..675457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74094"
FT                   /db_xref="GOA:C4XIT0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034474"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT0"
FT                   /protein_id="BAH74094.1"
FT                   /translation="MMTATESVCPVCLARLPAYREQDGDDGWLVRTCPKHGLFRTRYWH
FT                   GPPGPQGWDRPKIPKPGTEPLGTAPGPGCPYVCGLCPEHHQRTCTVVLEVTGRCNLGCP
FT                   VCFADAGSASAPDPSLADIAARLVQARQQAGPANLQISGGEPTMRADLPDIVAAAKAAG
FT                   FPFVQLNTNGLALAADAALAPRLAAAGLDSVFLQCDGVSDAVHTALRGRPLAREKRAAM
FT                   EACAAARLGLVLVATLVPGVNVAEVGELVRLAAKLAPGVRGVHFQPAACFGRYPGDGAS
FT                   APRLTLPELLAALEAQTGGELRADDFHAPCCEHSLCSFSASFFVGPDGRLAVSGGGNCC
FT                   DTGAAAIPAEDGARQSMAFVARQWGPAKAAPEPAAICDDFDRFLATAASRPKLSVSAMA
FT                   FMDAWTLDLERARGCCIHVAVPDGRLIPFCLYNLTAADGTALYRPKPCA"
FT   CDS_pept        675448..676506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06040"
FT                   /product="putative phenylacetate-coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74095"
FT                   /db_xref="GOA:C4XIT1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT1"
FT                   /protein_id="BAH74095.1"
FT                   /translation="MRVSPFDAWIATAIGQDGDTPDPARLVDWQLSALGRALDHARKAP
FT                   FYRDRLAQLPPGFPESFEAFAGLATTTPADLAAQFPRFLAVPQDAVARMVTVATSGTTG
FT                   PPKRMGLTDVDLAETLACFQVVMAVTLNPGERVLILFPADKPDSVGDLIGRGMRRLGAL
FT                   PVFGDPTGNPSRLAEALNAHRPASLIAAPSQLRAALEDLAAMQAARETLRSVVYASDFL
FT                   SPELRERTAARFGCRVFDYYSATEMAYGGGMECLAGVGYHLREAQLYFEVLDPRSDVAL
FT                   AEGQVGEVAFTTLTPRGVPLVRYRTGDAAAMLPGPCPCGSPLRRLGPILGRIEKTSDGF
FT                   AVVTPDKGKGRA"
FT   CDS_pept        676503..677531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74096"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT2"
FT                   /protein_id="BAH74096.1"
FT                   /translation="MIELIAGINDRLSRGEALAAVTIVTNEGSTPRTAGSKMLVFADGS
FT                   IAGTVGGGLGEGMAIAAAKETLSAGPSRLLGIDMTGQASAGADLICGGRMRVFIERIDP
FT                   DDATKALFAALAGHLAAGRGCLIVARIGDGASGRALIAPDGVLGDAVPPEVLEAARKQG
FT                   RGIAAPICFEAAGVPWVLEPALARDPLYIFGGGHVSRPTCHMAALVGFGVTVFDDRPEF
FT                   ANPERFPDARETMAYKELADCFAGRPFEESASVVIVTRGHAQDKDALALALRTRAGYIG
FT                   MIGSVGKRDSVYERLRAEGFTAVDIARCHSPIGLEIEAETPEEIAVSIVAELIACRAAR
FT                   RG"
FT   CDS_pept        677632..678525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74097"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT3"
FT                   /protein_id="BAH74097.1"
FT                   /translation="MRLVCRARRQCARRGWDAARFGREAPAASGKSAFQDPLMKIDIVA
FT                   NGQLLDVSIGLDAKRSFSCVLSPPDGDVTFVDVLPEVYEIYTNILGVNFEESEQKGKPV
FT                   RCGKGCVSCCHQLITVSVHEALLLTHIVGLLRQEEQQRIQSTFEGSLKRLEEAGLLRDL
FT                   LHSHVNAFEDRALVVGAQKRYWSLGLACPFLLGDTCAIYPCRPFICRQYGVSSDPEHCG
FT                   QVFQKDHLIERIRLSHDFGSAAASFDGLEAIKTRTIPLPAIFLVHGMLHCFERPKATAE
FT                   VMIARFLRHVDKHFSR"
FT   CDS_pept        complement(678821..679918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06070"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74098"
FT                   /db_xref="GOA:C4XIT4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT4"
FT                   /protein_id="BAH74098.1"
FT                   /translation="MNLTDQDLAVQLKITRQDIRRRKELLGFTEEDAQTLAELKLDIGL
FT                   IVSSIVDEFYDDQVTKPEIERTIGDSGTLGRLKHHMSNYILDMFSGTYDDVYVLSRLRI
FT                   GLVHDRIGVPPMLYISSIRTLFQILRERLTSKLSANKQCSTCHGILGALEKIILFDLTL
FT                   VMDTYIHALVKQVTNSKIELENYAKSLEEEVSSRTKELIEFARTDALTQLNNRRAFFDA
FT                   LRREVARSLRHKEEFVLAYIDLDNFKQANDTLGHQEGDRILICMAEAVRESLRAEDLGA
FT                   RIGGDEFAVIIANVDLAKAKEVIERLTKRFDTNKGNSPVTMSVGLARFNLEYPQLPDAL
FT                   MKEADVAMYNAKKHKGNSIATFGQS"
FT   CDS_pept        complement(680024..680611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74099"
FT                   /db_xref="GOA:C4XIT5"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT5"
FT                   /protein_id="BAH74099.1"
FT                   /translation="MRKGNRRIFLHPATQRGRTPAMTHAPYPDPSQDVFRHLVERLAQT
FT                   GLPHVVHVHAPTRTVAEAEANLDFDTSRIVKTIAFALRSGGLVLAALRGTRRVAYPALA
FT                   GLLGVGRRDLAALSPEEVMTRLGVAPGSVSPLLAEGRGKLLVDADVLTITPTLYCGLGR
FT                   SDRTLEIAPKDLVAAAGGTGEAIVRVGMISKA"
FT   CDS_pept        680671..681183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06090"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74100"
FT                   /db_xref="GOA:C4XIT6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT6"
FT                   /protein_id="BAH74100.1"
FT                   /translation="MARQAKGWSPYLAGALSGLVSVGSVWVAGKYLGASTTFVRGAGLA
FT                   ERLYAPDVVTTLAYYIKEKPIIDWQFLFVLGIALGAFVAAKASGDFKVQLVPDTWRARF
FT                   GDGIGLRALAAFVGGAVAMFGARLADGCPSGHGLSGMSQLAVSGYLAGAGFFAGGILMA
FT                   RLLYRGK"
FT   CDS_pept        681185..681709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74101"
FT                   /db_xref="GOA:C4XIT7"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT7"
FT                   /protein_id="BAH74101.1"
FT                   /translation="MELVFGLVTGVLFGFLLQRGQVLRYDVQLGALRLKDMTIVKFMLS
FT                   HIMVAMVGIYLLNDLGLVKLSLKATVVGANALGGLIFGLGWGLVGYCPGTSLGAVGEGR
FT                   LDALAAIAGMLVGAGIFARAYDGLLPTVYTWGDYGKITLAGVLGVNHWLVIAILIVAFA
FT                   AILRFIERKGL"
FT   CDS_pept        681964..683301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="DMR_06110"
FT                   /product="glutamine synthetase type I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74102"
FT                   /db_xref="GOA:C4XIT8"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT8"
FT                   /protein_id="BAH74102.1"
FT                   /translation="MAVFNCKNADDVLRAVKDYNVSFIQFWFIDVLGVLKSFQITPREL
FT                   ENAFEEGMGFDGSSITGFTKIQESDMVAFPDPATFQLVAWRPSDRPVARLFCDVKNPDG
FT                   TPFAADSRYVLKRMLKKAADLGYTYYVGPELEFFLFANSTEPKILDHGGYFDAPPRDLA
FT                   NDVRRDINFALESMGVAVEYSHHEVAPSQHEIDLRYQEGLIMADYAQTYRVVVKEVARK
FT                   HGCYATFMPKPLFGENGSGMHCHQSLFRGAKNAFYDASDPYHLSGEAKGFIAGLLRHAP
FT                   EFTLITNQWVNSYKRLVPGYEAPVYIAWARRNRSALVRVPMYKPGKESATRIELRSPDP
FT                   ACNLYLSFAAMLGAGLKGIEEGYTLSDPIEENIFKMTDEEMEEKGVTSLPGSLREAVDN
FT                   LEKSELMREVLGDHLHAALVENKKAEWDAYRTQVTEWEIERYLPIL"
FT   CDS_pept        complement(683796..684452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06120"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74103"
FT                   /db_xref="GOA:C4XIT9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIT9"
FT                   /protein_id="BAH74103.1"
FT                   /translation="MDLVMQLVDMVLHVDKYLNALAADYGTWTYFILFMIVFCETGLVV
FT                   TPFLPGDSLLFATGALCAGGVLNPHLICILLVSAAFIGDNLNYWIGRRVGPAVFEREKT
FT                   RFFKKEYLLRAHAFYEKHGGKTIILARFVPIVRTFSPFVAGIARMSYPQFLVYSIGGAV
FT                   IWVTFFVYTGFFFGNMPFIKRNFSIVVLAIIVISVLPGVIEYLRHKKAAAAVAGK"
FT   CDS_pept        684604..685875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74104"
FT                   /db_xref="GOA:C4XIU0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU0"
FT                   /protein_id="BAH74104.1"
FT                   /translation="MGMAVCDTDTAKGSGRSFRLVCEAGERDLVEAFLGATGHVAEAEP
FT                   FSPWCRRVTAEPTALGASLAARFGYIHIQDRSSMLPPLLLDPPAGARVLDMCAAPGGKT
FT                   GFLAQLVGPTGFVLGNEPSPDRLATLRQTLFRESLANTATCSFADLSPQLPAGSFTHIL
FT                   LDPPCSGWGTLDKNPQAAKIWAGDKVAPLVALQRKLLATAAALLAPGGRVLYSTCTTNV
FT                   AENEDQTRFALDELPLRQIPLAAPAGFVFEAPHRGDVSGVLRVDSAASAAQGFYLALFE
FT                   KVGGEAHDPDDGVFPGEPVPRAAIAAAGCEPSGLPPGVVRSFGDKAFFLHAGAAWLPAG
FT                   FRYQGFAVGSFRSRVFRPHGRARLLMGRGGPGLNEEALSRIEALLAGQSLPAGDLPARP
FT                   GLYWRGLPLGFLTKKGSRALWSDR"
FT   CDS_pept        685895..686755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06140"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74105"
FT                   /db_xref="GOA:C4XIU1"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU1"
FT                   /protein_id="BAH74105.1"
FT                   /translation="MHGNDRKLARLFHPHTGKAVVAPLDHGVSEGMLSGLEELTSLLEM
FT                   VSRFPVQGIMLNKGALRAYLHEIPVDVSAVLQLSGGTRHCQPPYARSLMCSTAEALRLG
FT                   ADMVAVQVNIANEFEDRMLADLGAIVDEAHGFGTPVLALIAPKGERVVNEMDPSLINHC
FT                   IRLGAELGADVTGVPYSGDARSFGRAVAASSSRVLVTGGPSRADFKSFAAMVEAAMGAG
FT                   AAGACIGRNVFQHPNPTEAMRRIVEIVHGKEVLELAEEVLRQAEEAQAAAEAAAEAAAG
FT                   DAAGE"
FT   CDS_pept        686832..687110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74106"
FT                   /db_xref="GOA:C4XIU2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU2"
FT                   /protein_id="BAH74106.1"
FT                   /translation="MPAMEKIDIALPPEMADMVRRAVASGAYASASEVVSDALRDWRDR
FT                   RAGLEDAVLAVRHAWEAGLASGPGRFEGFEALMSEARSRLDASRKNG"
FT   CDS_pept        687117..687407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74107"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU3"
FT                   /protein_id="BAH74107.1"
FT                   /translation="MPGLCFTRAAEDDLLAIWGYIADEDQDAATAVLRDIHGKCLFLAA
FT                   HPKAGPARPDIAPQLRYGLAGRYLVLYRETEGGIEVVRVLHGARDLRALFP"
FT   CDS_pept        complement(687529..689652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06170"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74108"
FT                   /db_xref="GOA:C4XIU4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU4"
FT                   /protein_id="BAH74108.1"
FT                   /translation="MRIRTKLLCFLLAVVIIPLCALGLYSWSRTSELGRELARGAAKAL
FT                   EANAAGELVQTAEMFGEHCAATLDLLETSLALTVDAAKQLLDVQSPTSPPRLMPMDSDF
FT                   DAGTVTDAVLTPIGGSDVNASYDHMVFHLAPGLTRQAALPEMRAMSGLTPFYRTLFANH
FT                   KSLMQFGYVGLASGLHCAYPGHGGYPVDYDPRRRPWYQNAAAKPGVTWDIMTDAATRQV
FT                   VASMALALRTDSGRVLGVAGLDIPMARLFLQSDLSRAWSDKIRSMVVSLGTQGAAGKPD
FT                   LIIVACRDYAQKSRDWTAPVELERIESPDTAILAEVTHELAAGRSGVRRLTYRGEDTLL
FT                   AFAPVAKKRLAVVLAAPREVVVASARQAEARVMASASGLAGQIGLFLAGAVALVALLAV
FT                   AASKTVTRPVRELAEAARKLASGDFSARVTPYGRDELAEMAASFNDMAPQLVERMKLKN
FT                   DMALAMEVQQHLLPGRPPAMEGMDIAALSLYCDETGGDYFDFLEFAQDDASHADIVIGD
FT                   VTGHGVSAALFMATGRALLRGRAVGQPGPGALLTEVNDLLCQDTHLTGRFITLFFLRLD
FT                   RGAKEMVWCRAGHDPGMLYDPAADAFGLLQGSGIPLGAVPDWSYEEMRRPWLTPGQVLV
FT                   LFTDGIHEARNPSDGMYGKERMEAVIRREAAGPASAIVNALVADLKEFKAGLPLEDDVT
FT                   LVVIKATDEGKAG"
FT   CDS_pept        complement(689804..691651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06180"
FT                   /product="putative chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74109"
FT                   /db_xref="GOA:C4XIU5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU5"
FT                   /protein_id="BAH74109.1"
FT                   /translation="MDAPQAPASSRPTFFRRPRALWRLLARRYTHIALMRWLVLGVVAG
FT                   LGSGTLAIAFHAGLEGLSHLLQVHLAGLTLPHPSGEKLLSGLPGPYRPWLIPVFTTAVG
FT                   LVTGLLVTRFIPKSLEGVTDGTDAMIKAFHTQGGVIRPAVPALKSGTAILTIAAGGAAG
FT                   QEGPISQLGAGFGSLLAQKLGLTARQRRILLLAGAAGGLGAIFRAPLGGAITAVEVLYC
FT                   EDFEAEALLPAVVSSVVAYTLFAFVFGGRAILATPNYNFTNAFELPFYLALAVAASLAA
FT                   RLFIRVFFAVKFKVFGPIAKRFGPTIAMMAGGMGMGLLGWRFPELCGGGYGWLELAAGG
FT                   KLDMLFLLGLFGGKFLATALTIGSGLSGGMFAPALFLGGTVGGVVGQAGHMWRPDIVTQ
FT                   PGGYVLVGMATFFAGVAHAPIGPLIMVCEISLGYGLLAPLMLCSAVALVLCDDIHLYEN
FT                   QVDNKFASPAHAADATTNILETLPVSSVFTPGRTVVLEECVTLRAITDVIAATRNFVFP
FT                   VQNERGVLTGLLDVHDARGVLFEPSLRDLVVARDLMRSPTVVHPDTSLYDALMLFVETD
FT                   LGQLPVVAPDKPDTVLGLLDRRHVFTAYSSTLAAIKAEA"
FT   CDS_pept        complement(691657..692595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="DMR_06190"
FT                   /product="riboflavin kinase/FMN adenylyltransferase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74110"
FT                   /db_xref="GOA:C4XIU6"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU6"
FT                   /protein_id="BAH74110.1"
FT                   /translation="MIVVNRVEDIHEALHGVCLTIGNFDGVHMGHAKLLQRTRERAVAA
FT                   GLVSVALTFDPHPRRVLMGNAAPPAITLLEHKLECIGQSGVQVCVVLPFTRELAAREPE
FT                   DFVGQVLVGGLCLKHLVIGYDYAFGKGRRGNFEMLSTMGQKYGFGVERLDPVIINGAVV
FT                   SSTRIRDMVQAGNVWDARPLLGRFHQVRGLVVHGQKRGRKLGFPTANVGVRDELVPLSG
FT                   VYAVWVEVDGILRPGVANIGKNPTFGDFDLSVEAHILDFKGKIYDQPIRVHFVQRIRSE
FT                   KKFSGPEELITRIREDIGLARMILAAPDARP"
FT   tRNA            692791..692877
FT                   /locus_tag="DMR_t00050"
FT                   /product="tRNA-Leu (CAG)"
FT   CDS_pept        complement(692965..695352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06200"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74111"
FT                   /db_xref="GOA:C4XIU7"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU7"
FT                   /protein_id="BAH74111.1"
FT                   /translation="MPTSNRFSVNLAALALGVAVLAALVLRFYHLDSCPLWWDEVLVPL
FT                   NAQYGVAYVIERALRCDFHPPYFTLLGTLFLGLGTSELALRLIPALCGVGLVAYVGRSF
FT                   APLFGQGPSLVAASLLAVSAMNLFVSRSVRPYALIVLFSCMAFGFFLRYLKGGGHRDGL
FT                   ALLACNLAFVLFHFSGLIILFAQLCVFLFWRLAYDRRTARLEWITATAFCALVAGLLAP
FT                   FFLAHVAGFAAPAQATMAATFLECLKNIANGLASATMIPKDLSFNSSVTLNSLLIVCIV
FT                   VGILRSYRIDRRLTLACLIYIATPIVVLTLKRYASYFNPWHVLFLSPVLLLFAATGICA
FT                   LLEKATKSPLVGPVVAIVIALAGTVYFFTANSVIFSKQYHYTASYQPLAQAAGRYIDPK
FT                   AVTVFSDGSLADCIGWYTKQYAVPDPFTHSPDLAANAPVDVTFVSFGDFAHFGATEQEF
FT                   LQLFGPPTSVATIPITPLQPLTRYSFHYPHSSLPTLADLPTTRTLTSAPRDLFSHASRL
FT                   HNVTLYQYFEKGVRVLDPARPGIVEYEFACPDAQMAPSLLAGSLSYRNTAVGGRLTATY
FT                   SFDDEPLTPFFVSAGPDGSTRKSFLLVRKAPYSRLRLRLQLDNPRPPAGMTGPSMDSLQ
FT                   WTDLTLYANNIATERFISSSLVIDTTLGAIEHEGTTAYRWASGPTTRFQFALSAPETIT
FT                   IEAACNNPIPGQGINYFLNGAPIASVKDLPVQPWLGEFTEQTITARGQAGENLLELRFE
FT                   KWNQQPNDPQATFAPKDGRPLAAACTLLRINRQQPPDLTEQR"
FT   CDS_pept        complement(695987..696649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74112"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU8"
FT                   /protein_id="BAH74112.1"
FT                   /translation="MRIKRGAMVSFWFRATVISAALVLCATGALAKTVFLGGSQTAGWK
FT                   HMGMFKDVVNKGAVSNTTAKILKTLGPVVAQKPEKVFILEGINELYSPNAAILARYREI
FT                   LLRINKGSPKTMIFVQSVLPVVNRQDLSNDKIMELNAGLKTLCGEMQNCVYIDLYSHFA
FT                   EGGALRESLTTDGVHLRPDGYKLWQALIEKYVTQPNDQLTRPETVAGLSQPAATSAN"
FT   CDS_pept        696849..697730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74113"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIU9"
FT                   /protein_id="BAH74113.1"
FT                   /translation="MRLIRGVAGLGNEAVRPMTSPATPRRLLEEALAQRSRCHLSLPEN
FT                   VVGLKNLDCAILEATNRGILLESIGKAAAGSHWVGLDVKGYFRVVIKRQTLEETFYTFD
FT                   SRIKAAAASPAGLARLRLAEPERLVFGQRRKSLRLEPDVDRLREAFFWRYDKAAGFSLD
FT                   YPALRSADFRNGQARLINLSAGGLGLAVSPALAGPRGIEAVKGDRLVVRLELDEPRADV
FT                   AGDFWMVAKVCHVAASGCGGDRQFGLQFLANGSLDAKVGKIRWQPVEGHVIPELADILY
FT                   YWHLDRHREKLG"
FT   CDS_pept        complement(697731..698684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74114"
FT                   /db_xref="GOA:C4XIV0"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV0"
FT                   /protein_id="BAH74114.1"
FT                   /translation="MRKCLSLAARFGLAAACLTYALWGIDFHRLGQALAGFPVWAMLLY
FT                   AVTVLASALAPGLRLRFLVGDRISSVAGVRACLLGLGVNNVLPARLGEMAKAAYLCREA
FT                   GLSLGQSLEAVFWERFFDLSALLALGVAVAAMLGQGVLLYPLLAIVGGGWAFLALLRLR
FT                   PAAAHACLRLVPGERLKLFAGEMLTLFEGRLRAGFLLRLAAWTALCWTGFILTFAVGLT
FT                   SIGGRPADPTMILTVFAVVTLGFALPAAPGGMGVYEASAVLALGWFGVDRDQAFALGLT
FT                   LHMLQYIPVTLAGMWVLAASGLSLADLRRRAETPGL"
FT   CDS_pept        complement(698757..699041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74115"
FT                   /db_xref="GOA:C4XIV1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV1"
FT                   /protein_id="BAH74115.1"
FT                   /translation="MKRIGILICALVLGLCALAYAAGDAAKGAELAKGCACHKSKGDLD
FT                   GLDVAALTAKMQAFKEGQGENKAMVAIMKKQSDENIADLAAYYASLPKK"
FT   CDS_pept        699229..700026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06250"
FT                   /product="DSBA oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74116"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV2"
FT                   /protein_id="BAH74116.1"
FT                   /translation="MVSRTVLALLPLLLLVACAPSPSRDGVKEAIKEHPEIVLDALGER
FT                   KAELFALVVEGQQDYQTGQRQARQDAELQKPLSPAIDPARAMRGPADAATTVVVYSDFL
FT                   CPYCAKGATTLKEFASRHPDSVRVLFKHYATDELAKQVALVYEALAAQNPQLAFAFHDA
FT                   VFAAQAEVEQGGEPVVYALAIKLGANVNQLKRDLKRPELAKRIEDDTAEARVFGFDATP
FT                   TFVINGVSVRGAAPLSEFEDVLRRVARSGGQEAPCAACDKKKP"
FT   CDS_pept        699996..700625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74117"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV3"
FT                   /protein_id="BAH74117.1"
FT                   /translation="MRRLRQEKALMPTPGPHPQARRPMRVCSRVFAVLLGSLLFVACLA
FT                   AAPVSALAEEHTPPSTAVTLDEAVLVAMLDDLIKYYEDARPAESQIVALLPVHEKSKDS
FT                   PEYKKLRFLFDTYQKATTSLNNLVDMLYIYLKLGNSKESDINAYVVNRTKNIVTFLNNM
FT                   VYLLTTRNQEYDVPASSDVQKLYETYLVRLTTLLYELNKAMPQFAR"
FT   CDS_pept        complement(700859..703336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06270"
FT                   /product="two-component hybrid sensor and regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74118"
FT                   /db_xref="GOA:C4XIV4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV4"
FT                   /protein_id="BAH74118.1"
FT                   /translation="MNQPQPGPALPGPAFALRLDPAGRVKAADPAALSLLGDCLGAPPP
FT                   LPCPAPGTSLDWTGAGGVWRLWTEAAPDGSLVLRGLDVADLAAAAVAGQTRQRQFADII
FT                   DGATEGVAVAAGGRLVYVNPFMERLTGYDAATLRSKPFVDFLHPDDRRTVLGIHLRRLA
FT                   GGQAPQGHAFRIVTADGGLRHVNAASAWMEWEGRPATVSFLADISELKAAEQALAEHVH
FT                   SQEEVIAARTASLRESNDRLAAEAARHERTAQKLKTARTKLARALRAKSVFLANVSHEI
FT                   RTPLNVILGMADLALRPDSGGQADLTRCLEMIREAGTSLRGILGDLLDLSRVESGRLEL
FT                   DAAPFSPRQVLEATLAAHRHVAQRQGLALTGATAADVPEHVIGDAGRLAQVLGNLVGNA
FT                   LKFTSVGGVSLRLTLARPGRRAPDGRVNLRFAVRDTGIGIPEDKQKTIFESFSQADETI
FT                   GRRYGGTGLGLAICRRLAALMGGRLRLASAVGEGSEFVLTARFPLAPGPAEPAGPARLA
FT                   LPPLDILLAEDADLAAEMIQAFLVPKGHNVIRVVNGEEALAALALRRFDVVLMDIQMPV
FT                   MDGLTATRRIRSGELVGIPRDIPILALTAYGAVRDRERILGSGASGYLAKPVNFDQLLD
FT                   ALAASQSLAPDRSPLVEAGPAATTADVAERRDDTPAAKPRSGRSRTKAGSAAASSRSKA
FT                   ASAQADAQTNNAAEPAFDAGRDEALANLGGDEALYDRLIAVFLRDTPGDQARLAAALDA
FT                   SDAAGTALLAHSLKGNAGVVGATTAVARARELEHAARAGETARFAACRQALDEALDAAL
FT                   AGFAAKGHQPAAP"
FT   CDS_pept        complement(703541..704401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06280"
FT                   /product="lipolytic enzyme G-D-S-L family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74119"
FT                   /db_xref="GOA:C4XIV5"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV5"
FT                   /protein_id="BAH74119.1"
FT                   /translation="MNVGLRAAGNLLDGAPHAIFPRHPLPGSTGLKTDKLLVALLAGCL
FT                   LSMSGIAFYYKLGWDRMDAQMREIASDVDLVNATMQDLGGLYRRTRIAIIQAQLRSQGL
FT                   PLIVVFGDSIVEQLYCPALAGRNVLNAGISGARVLESQPFLESVLAAAPGPLVIVAMGV
FT                   NDAFGTAGTTPEQFEAGYETLCKTVLADNRRLVLVNLPPIESDKPEAQRFDASKIARYN
FT                   AIVAAVAGRLDVPLADINAMLAERRKTSGQSQTVDGVHLNPAAAAAWRDAVYTVALRAL
FT                   TRPDS"
FT   CDS_pept        704509..704937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74120"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV6"
FT                   /protein_id="BAH74120.1"
FT                   /translation="MRIRLLPLATVLVVVLLAAAAAQAQAVPDLVGTWKSVAHEGITTG
FT                   SRHFPKNDSGPHFVSSQFVLHIERQEGRRFVGVKSSPHHKETVMGVIGYDGSTIHILED
FT                   EGSFTGKLLPDGSLELVYSHDVGASKGIGIARYVREAK"
FT   CDS_pept        704937..705770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74121"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV7"
FT                   /protein_id="BAH74121.1"
FT                   /translation="MRRGTALFLLCLALASGPARAGGIDCAKAQTAVEKTICADPQLLA
FT                   ADAAVAEAFAAAVAASPDPAAVRAGQRAWLAIRNACPDAACLGQRLTERRAALTAAASG
FT                   AAKALWDERAALQARLHWPKDCEDSFRETFAAAQGGPGLPLRDTGVERHALGDGRTLFL
FT                   VQCDQAAYQGVYAAMETGPGDGPARLLRFPTADADGGRVIRREDDSLVGDLQFHDADKT
FT                   LTVLTKARGVGDCGSYAVYGFDAAGKPAVRELRARECPKKAGPYLPPERWPLVGR"
FT   CDS_pept        complement(705778..706167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74122"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV8"
FT                   /protein_id="BAH74122.1"
FT                   /translation="MSPRPAAKHRRQGGGMKPSTAAMASLVVALALAFVPLSAMAGTPF
FT                   DVTISSADWGKSVAVRYHHGLFGWIDAGRVEFHHDGRTVIAPRGGQPSVTDNLADSLAR
FT                   YAADRLGNPALGRQLAQVIEREVGK"
FT   CDS_pept        706167..707159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74123"
FT                   /db_xref="GOA:C4XIV9"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIV9"
FT                   /protein_id="BAH74123.1"
FT                   /translation="MQFCCHRAWRAGTGCLRGGPALGSDREKAMKRYAFVLALVLVSGW
FT                   LAAAHGGVDAGWQPLMDRLAADGLDRAWVEKVFAGAGVDYEPSIMARKVDAMVRKQFEP
FT                   RPAPTKKTLEASNYRQFLTPASIEAGVRYIRENRGAFDRAQREFGPPPELICAFLMVET
FT                   KLGTYLGDQDALSVLASLARASGLGQIAPYMKTLRGDAERSAYADWAAKDRSEWGFREL
FT                   AALLRYAKAKGQGPGAIPGSIYGAIGICQFMPSNALRFGVDGDNDGVLDLFTPADAIVS
FT                   VASYLRGHGWVPGMTGEQRDKVVYAYNHSELYVLAVTTVADRLKARLGG"
FT   CDS_pept        complement(707276..707608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74124"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW0"
FT                   /protein_id="BAH74124.1"
FT                   /translation="MKYLIIFIVIIGIVTYIFLGAPSPKEEDAHVADRREQVWERIAYL
FT                   EHRRRDMLAEARTNQMATGPSRSRLTSRGAYYAGYRDGFNQGYYEGSFLSANRKPDPLF
FT                   FKVPNP"
FT   CDS_pept        complement(707726..709135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06340"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74125"
FT                   /db_xref="GOA:C4XIW1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW1"
FT                   /protein_id="BAH74125.1"
FT                   /translation="MGNVLIIDDDQTIRDALARVVDRLGHTPTLASTLAEGLLRAGKDD
FT                   VDVVFLDVRMPDGNGLDAIADIRRSPSHPEVIVITGWGDPDGAERAMRQGAWEYIEKPP
FT                   TVKTMTAPLVSAMEHRRGRASSTTVFRFPGILGGNPARTACLEQAARAAGSDVNVLLTG
FT                   ATGSGKELFARAIHDNSPRHAAPFVVVDCAALPATIVESVLFGSEKGVYTGADRRREGV
FT                   LLRAHGGTLFLDEVGEMPLSVQKAFLRVLQERRVRPVGALEEVPCRFRLVAATNQDLES
FT                   LARQGLFREDLLFRLQGVGIELPPLAGHPDDILELAAHFAAEAAKRQELTPKPLSDDFS
FT                   RALLAYPWPGNIRELKNTLEGCLALAQADDALLPIHLPLHIRVLAARNRVIGRAADAPP
FT                   PPAEPTLTDLPAATALPTFRDYRDGREARYLRELAARHGGDIGRMLDVSGLSRSRLYAL
FT                   LKKYGIPAARA"
FT   CDS_pept        complement(709361..710026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74126"
FT                   /db_xref="GOA:C4XIW2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW2"
FT                   /protein_id="BAH74126.1"
FT                   /translation="MFFFAGKARAPCPNVRPCAMAGPNRQPLPRRDPMKRALLKLAVLL
FT                   TMLALAGTAHAWKKPPFKNVDKNGDGVIIFEEIVVFNSGLTMEVFAVIDLNKDGKIDPA
FT                   EYAAMGGKTAKGKAAKPWWRCSSKEGSLLYKQGTDLLLAGKNAEAATVLRQALTTPLCV
FT                   DYLSYAYYNLGVACMRLGDAPCAKANLEKARALNVNNTVPENNFGLDGWPRKPGVVGK"
FT   CDS_pept        complement(710056..710265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74127"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW3"
FT                   /protein_id="BAH74127.1"
FT                   /translation="MSFVLQKPSPAAEQPRFDCIFCNRPALVSSEAGRADQARIVEVFC
FT                   RHCGSRKTMATRLSADGARWEPAD"
FT   CDS_pept        complement(710347..710733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06370"
FT                   /product="thioesterase superfamily domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74128"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW4"
FT                   /protein_id="BAH74128.1"
FT                   /translation="MDVNTHKSVDPGLCGQPETLGEGLARVAFTALPAMAADDRGLVHG
FT                   GFVFGLADYAAMLAVNDPNVVLGAAEVRFTAPVVVGETLMAEARLTDTAGKKRLVTVTV
FT                   RRGEDAVFTGTFTCFVPEKHVLDR"
FT   CDS_pept        complement(710843..711010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06380"
FT                   /product="Flp/Fap pilin component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74129"
FT                   /db_xref="GOA:C4XIW5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW5"
FT                   /protein_id="BAH74129.1"
FT                   /translation="MLTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTT
FT                   FNTVATSLGS"
FT   CDS_pept        complement(711295..711462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06390"
FT                   /product="Flp/Fap pilin component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74130"
FT                   /db_xref="GOA:C4XIW5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW5"
FT                   /protein_id="BAH74130.1"
FT                   /translation="MLTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTT
FT                   FNTVATSLGS"
FT   CDS_pept        complement(711746..711913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06400"
FT                   /product="Flp/Fap pilin component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74131"
FT                   /db_xref="GOA:C4XIW5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW5"
FT                   /protein_id="BAH74131.1"
FT                   /translation="MLTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTT
FT                   FNTVATSLGS"
FT   CDS_pept        complement(712197..712364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06410"
FT                   /product="Flp/Fap pilin component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74132"
FT                   /db_xref="GOA:C4XIW5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW5"
FT                   /protein_id="BAH74132.1"
FT                   /translation="MLTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTT
FT                   FNTVATSLGS"
FT   CDS_pept        complement(712649..712816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06420"
FT                   /product="Flp/Fap pilin component family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74133"
FT                   /db_xref="GOA:C4XIW5"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIW5"
FT                   /protein_id="BAH74133.1"
FT                   /translation="MLTAITQFIRDEEGATAVEYGLMAALIAAVIITAVTSIGTNLTTT
FT                   FNTVATSLGS"
FT   CDS_pept        complement(713004..715199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74134"
FT                   /db_xref="GOA:C4XIX0"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX0"
FT                   /protein_id="BAH74134.1"
FT                   /translation="MAGSRQAMNNAMRPPGRFLAGLALCALAVLAFWDVPRSGPTASDD
FT                   LTYERAVLDGRIGVFSAELAAGSGRFHHYLHVGLTSLAYRMDSPALRRSVALAGFLGVI
FT                   IALAALAARLSRRPELGLLVATLALGLYQDNWHHNILTAYPLVFDSGMLCLLLAGYALA
FT                   RRAETGRTGWLVVANLALFLAFCHFEAFVAYVPILAGLVWLTARGGARERLRAMLPAFA
FT                   VLPAYAAVYLGYRLAHPSQYAGNALDLTSPAAILKTAWAYSRPALPLGGFAFNLEYVNR
FT                   FPQFAKAYVLSFGQYLSELAANLSLLAPAWVALGLLAGGLTYHCLDRAVRARVPWLTWL
FT                   LCAFAVVCPNALIALSPKYQEPAASGLAWYVTTTFSFYAVAVLLALGGLALAGRLPAGP
FT                   RRVLAAGLGLVVGLAALVNASVNASVRDSKIAAGARWRVAALACQSRLIAGLPEGARLV
FT                   APDLFTAVNTELVGPDYWPAYFRAHAGRGLTVASGLGGADPEQTPVYVLRRLSGLLDRD
FT                   TALVLARVTGLGPAPADPYAAAPDAPALLAGQAVVAMDAANRFYDLVFRDASGWRIAPL
FT                   TVGGGPFSRTDIKGDGLLPASMARLAAHSLATGEAAPVVLRFGPGFSAPERSVTGDVVW
FT                   AGDTAELALVNNTSAVFRVTLAATAAAPAPVTVALGGALMPDGATIECSALVTPLSLSL
FT                   TLPPGRHVLILRALPPTGAKKRLGLIDARCVPQAPAP"
FT   CDS_pept        complement(715189..716526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06440"
FT                   /product="arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74135"
FT                   /db_xref="GOA:C4XIX1"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX1"
FT                   /protein_id="BAH74135.1"
FT                   /translation="MFWIATAIFVGAYAVIVSEKINKTKVALFGAALTLATKVLTQHDA
FT                   LHDADLGVDWNVIFLLISMMIMVNIMTKTGVFQYVAVRAAKIARGEPFAIMAILAVVTA
FT                   LASAFLDNVTTVLLLAPVTLLVAKELEIDPVPFLITEALASNIGGTATLIGDPPNIMIA
FT                   SKAGLDFMDFIVHLTPAIIIVMAAWMFVWKLVFGQRLHVGAAQKARILAMDEGALIRDP
FT                   ALLKKSGLILGLTILGFTLHGFLGFEPATIALLGASTLLLISGEDPQKVFEDVEWPTIF
FT                   FFIGLFIIIGGTVKAGLIEVFSQKVIALTHPTKDSMFVLSMVMVWFSGIASAIVDNIPF
FT                   VATMNPLLAELAEKVLGPETGLTGPALYTHPTMLPVWWALALGACLGGNGTAIGASANV
FT                   IVVGLSEKAGHKITFARFLKYGAPVTLGTIAISMGYIYLRYYVLGW"
FT   CDS_pept        complement(716545..716997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74136"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX2"
FT                   /protein_id="BAH74136.1"
FT                   /translation="MRLRELMRTNLSRARRDTPFGDLVAAHRRRDSRLVYVVDEADRLL
FT                   GVVSCYDLLRAALPFYVDSGLARALPEDAAVLRDGFAAACRDKTAGDVMTAEVVTVSPD
FT                   DTVFAAEAYFAEGRHNVLPVVDAMGRVVGEVTRRTILVVLAGSCGL"
FT   CDS_pept        complement(717068..718057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06460"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74137"
FT                   /db_xref="GOA:C4XIX3"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX3"
FT                   /protein_id="BAH74137.1"
FT                   /translation="MTKPLPHVVVTRAIPEAGLALLRERATVWVNPEDRPLTRDELLAQ
FT                   AKDADGVIGLLTDRIDAGFFDACPKLRGYANYAVGYDNIDVPEATRRGLPVSNTPDVLT
FT                   QATAELAFALILATARHIVASDAVLRSGQWSGWGPLQFIGTQLAGKTLGIYGPGRIGLA
FT                   VARLSRGFDMKIITCGGRKPNPALVAEFGAASLPFEAFLAAADVVSITAPLTDTTRHAF
FT                   NAAAFARMKPTALLVNTGRGPIIDEAALVVALREGRIAGAGLDVYEFEPRLAEGLAALP
FT                   NVVITPHIGSATTEAREGMAVLAAQNLIAMLEGTTPPTCLNPEVLARP"
FT   CDS_pept        718176..720137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74138"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX4"
FT                   /protein_id="BAH74138.1"
FT                   /translation="MGGNVSFVCLYGQSKECPMTTIYATCRGDRRFYDGELRDTLTLAD
FT                   AVAAARPGDVVQLLPGAFFPPTRIDPGNRALGEAFPVEIRGFAGSEDAPLTIRGFGPTT
FT                   AFYGEGKAEIADARLPTADQFAFFKLFDSQWVVFENFDVAGCWPCFLFMEHSRYVTVRN
FT                   VRVFDGRYVVFARGERSHHILIEGCRWRQDPTGALWRDITWEAVKREDETGYYYYNGGF
FT                   FGSVDISGSLVFRENTLCTAFNGLRLKASASKGNRLNHNVEITGNRFHRLRDNPVEPER
FT                   TAVNWYVRGNRIVNAHAWFSMDNVAGGFWYYCGNTGYFNDKPGLPEGDNTGGAVYKYDV
FT                   EGGMPDRPVLAAFNTYFLRANLIKEGRTRNLRHVDNVVLFCTPADLRGYDPDPPCPFPA
FT                   SCPDPCAPSPLTADPESFGCVPPLAEPGPSFVASSEFLDDPAGDRIVFDGDLTNRPWPA
FT                   GFAPAGFEADGRVEPALHFRAPFAGDLRLSGPSLPAVPVRLAAGTDWAGDYDWQSPALA
FT                   VAGAAQPAGAPAPCPPFVFCMPANPAPGYDEAPRPVDLSFEAGRLVVHCSRPLAAGTCQ
FT                   ALVRDRRGEVVEVAGRTEGTRLFLTIPGPWRRKAAQVVLPADLTGADGQRVSLWGNDPR
FT                   VTISSKIHFTTATEGLTV"
FT   CDS_pept        720873..721730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="DMR_06480"
FT                   /product="protease HtpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74139"
FT                   /db_xref="GOA:C4XIX5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX5"
FT                   /protein_id="BAH74139.1"
FT                   /translation="MTSQIKTALLLGLLTALILIVGQAMGGRTGLVIAFGMALVMNVGS
FT                   YWFSDKIVLAMYGARELSPADAPGLHAMVEELARNGGIPKPRVMIIAQEAPNAFATGRD
FT                   PAHGVVAVTEGILRLLSPEELRGVIAHELGHIKNRDILVQSIAAVLGGAIVMMANMLQW
FT                   GAIFGLGRSSDDEEGGGSGVVGSLLMAILAPIAASLIQMAISRSREYLADATGAQLSGT
FT                   PLALAGALGKLDAYSRQIPMNANPATENMFIVNPFAGMSMASLFSTHPPTEDRIRRLRD
FT                   MAGR"
FT   CDS_pept        721862..722398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06490"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74140"
FT                   /db_xref="GOA:C4XIX6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX6"
FT                   /protein_id="BAH74140.1"
FT                   /translation="MSRKPCFRAADSRDAARCHEIEQSAYEGAEAATLEKIALRIDLYP
FT                   EGFVVMEIDGQVAGFINSGCARKVVMSDEAFKELVGHDPDAPNVVILSVVIDPAMQGRG
FT                   YARLMMEEFVERMARMGKATIHLMCKERHVGLYAKFGFQYDKPSASDHGGMSWHEMVRR
FT                   LDAPALSATPHGDGA"
FT   CDS_pept        722405..722896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06500"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74141"
FT                   /db_xref="GOA:C4XIX7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX7"
FT                   /protein_id="BAH74141.1"
FT                   /translation="MLLGWLFPRPRSNFPPSPDRLASIYRRRQGVSMLESKAFQRTAMA
FT                   VWLFSVASVCYLSLLPAIELPVKFWNADKVYHLIGYGWLGFLPLFAFARGGTARNAAYL
FT                   MIPLGALLEWGQSFVPGRASSMMDAVANAVGVFIGIWLAETLMARCRGCKGLGGDVERM
FT                   "
FT   CDS_pept        723301..723762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfH"
FT                   /locus_tag="DMR_06510"
FT                   /product="cytochrome c nitrite reductase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74142"
FT                   /db_xref="GOA:C4XIX8"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR017571"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX8"
FT                   /protein_id="BAH74142.1"
FT                   /translation="MGHAGKGGVRLLVVAGLVVVGVGLFLALGPPGLLAKSETPDFCAS
FT                   CHVMESQYEAWFHHGAHKRIRCVDCHLPNDNTASHYLWKSIDGMKDVVVFHSGRVPDDI
FT                   RISAHGKEVVQANCIRCHETAVEMIDQKRWCWDCHRRTMHRHVGVPFTR"
FT   CDS_pept        723883..725349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrfA"
FT                   /locus_tag="DMR_06520"
FT                   /product="cytochrome c nitrite reductase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74143"
FT                   /db_xref="GOA:C4XIX9"
FT                   /db_xref="InterPro:IPR003321"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIX9"
FT                   /protein_id="BAH74143.1"
FT                   /translation="MRGKLLYKLAMGAALAAFLFVPYACSPPKPEPVKTVVIPDGEIDP
FT                   AVWGKAYPEEYETWKMTEQPTPAGKSKYKRGFDADRITYDKLAEFPYMALLFNGWGFGV
FT                   EYNEPRGHAYMVRDQLEIDSTRLKAGGVCLTCKSPYAPLLVKEMGVDYYKLPFKDVLNK
FT                   IPEQFRTLGVACIDCHNNKDMSLTVSRGFSLTPALEGMGVDWKKLTRQEMRSVVCAQCH
FT                   VTYNIPKDKEMQSVGVFFPWQYGKWGAITVEDVIKKIKSDDSVKEWKQTVTGFKMAFMR
FT                   HPEFEFYSNNSVHWKAGAACADCHMPYTKVGVRKVSDHRVTSPLKNDMKACIQCHTESP
FT                   DWLKQQVITIQDRTASLQIRAGNATATTAKLFEAVHKAKEQGKAIDQALYDQAKDFYEE
FT                   AFYRSLYIGAENSMGFHNPTEALRVLGDSVAFAVKAEAYLRQVLTKAGVDVPIKVDLEL
FT                   AKYLEGRGAKKLGAPADQEFKDPMGVQDRF"
FT   CDS_pept        725544..728354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74144"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY0"
FT                   /protein_id="BAH74144.1"
FT                   /translation="MTTPRTVLRPVTVLVLLLCLAALGRPARADDSAAAYDAAVREAKA
FT                   HAADPGPWSVSNLKVIAGPGSGDGNAYVDGKVVAATFTKSSYYTSAYPGLSMTVYGQPA
FT                   SSASWVTVGGELKSYLTSQGVTFADVKLETSRVLGMSQTNSNDAVVELLVSPDVNTIQR
FT                   PTKDPSVAGQPTSLGSAAAFVRPAGMSDAAYGNFVAYYHSWEAAAYGSSNFPWTQLGYT
FT                   YRWGLGPTLADIRGLSEFIVPGGSRWTVYAVYSLGSYLYTSGSGSGDFRVTGALDTLWA
FT                   GRQFQPRGDSVVIEAGATVSGGQGLLISSPGYTVSNAGTITGTTAAKYGLDGTADVAVL
FT                   FLGREAAPGSLAEPYGRTNTLYNAGNIDSPGTAVMALAGDTVVVNSGTITGGQAAVVTG
FT                   DGADRLELRGGTVSGRVDLGGGQDSLVATGPSSLAFALAPQGTSAPPVQNVESVSLGPQ
FT                   TSLALTFDPSGYVATGQRYAIVSGGLVNLADSGLTVTSNLPMVRFTAATDAAGLSVTGW
FT                   RDPGWYARSLTSPSLGAALDAAAATVRPGMEGLIGFLDHSPDAAGAGSRLLPGPQTRSM
FT                   ALAVDGASAFTAAFAERLAGLRGGSGAAGLAAPGFYGHGAGLGDLEALGRLAVSGQPAA
FT                   LAEPWRAAVPGAAPADDGLGLDDTTAEGPLEAFATLYGGQGQGVSSGDAPGYASNLAGA
FT                   MGGLGIRALPGLRLGLVGGYAWTGADYFTGRGRGDDQVWRAGAYAAVDAGPWTLDALAA
FT                   YGWHTARNSRPVWDSVAESTGTMGEWLGFVRAARRFDFGNGFAAEPFAVGQLVSLHRDA
FT                   VTESGAGAANLLVAADTSLSLTSVAGLRLEKTFAFGAWRLTPEVFGGWKHEYGDPAPSV
FT                   TAALAGAPDAPFAASGGTVDRDQARFGAGLRLWGAGGAAVAARFDGTAGGTRSSYGLSL
FT                   GLRLGF"
FT   CDS_pept        complement(728437..728856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06540"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74145"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY1"
FT                   /protein_id="BAH74145.1"
FT                   /translation="MKTSIVCLDGSQPSFRALDRALDRVGCVPMDILAVCVVEALSFFD
FT                   CDATDCETAFAAHLREPKAILAEAEEIARLRGVTIRTRWAPGRPAETVARIAREEGADA
FT                   IYLGSRGKDDVENLLLGSVSMRLVQIAPCTVVVVR"
FT   CDS_pept        complement(728997..730070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06550"
FT                   /product="putative molybdenum-pterin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74146"
FT                   /db_xref="GOA:C4XIY2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY2"
FT                   /protein_id="BAH74146.1"
FT                   /translation="MNEPKNAETGGKRFRAARIFSVPDDVKFLDTLELTRLSEAFSAWT
FT                   ARAGRPDVAVSRNRVRLIFLMLRHTGARLGEVLAINDRTDVNLESLSVMLGGGEDGPGR
FT                   EVQIPAELGEALAAVFDNPAYAGLRGTLFRLDQGHVRRKFYERAEECGFTKELVNPSTI
FT                   RRSRAVELLRDDVPLPVVQRILGHSTADLTAAFLHLPEDQRRKVERQVLTRETRRTSAR
FT                   NAFFGRVAHIQRGDIQSIVTVESLGGHAVNSIITNESLKNLGITEGSFVTAEIKAPWVV
FT                   LEACTDMPRSTAGNRFQGEVELLRLGELTSEAIVALSDGTRLCAVVTTQSARDLELHEG
FT                   QKVWALFTAFAVVLHME"
FT   CDS_pept        complement(730134..730514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74147"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY3"
FT                   /protein_id="BAH74147.1"
FT                   /translation="MAKQIVVAEGSSPPIGPYSLGVWAGDLLFVSGQTPIDPATGTVAS
FT                   DNVVEQAHQTIKNVRAILEAAGLTLDNVVKATVFIKNMNDFAAINDVYASYFQKPYPAR
FT                   SCVEVARLPRDVLVEIEVVASR"
FT   CDS_pept        731002..731412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74148"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY4"
FT                   /protein_id="BAH74148.1"
FT                   /translation="MVLGVSSAAKRLGKATGKGVGMVAWWKQAFFVVLGVAALAVFSQA
FT                   GSAVAGDYSFKVHNKSDVGITKVLVREAGGSWGSFDIGTMIEPGRTAKLVWAKHTNNQD
FT                   CEQWIKVVYADGSEAKATKFDFCEDNLEIEFE"
FT   CDS_pept        complement(731562..733031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74149"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY5"
FT                   /protein_id="BAH74149.1"
FT                   /translation="MKTMKSLALAAALLMGATTLAHAATEVKMTGDARVYGNFFEGRNF
FT                   TGWNKTGTKTEDNFEIWERFRLRSDFIANEGVKFRLGIKVEDTWGHGTFTAANPETAVQ
FT                   VDLAYLQFKYPGTDIEITAGLQDVNLPQSSMFYMSPVWSDKMAALTIKAPLIENTLSVL
FT                   TGFGRLIDTNRTYDTTTTQVADELDAYFLALPVTIEGFKATPWGMVSVAGRNTDYAYKD
FT                   TTDVAEWGNNFNNTLMSAASAANRTSATGLGRWKNDQNPYYWVGGAFEVTALDPVKFYA
FT                   DVIYGAGAAGDTKAAKREGWMVDAGAEYTGFDMVTPQVFAFWSTGEDKSTSNGSERMPY
FT                   MRSYWGPGNSFLFDNSQELGKGSNMYVSPVGNYGIGASLNKMTFIENLTHRLTFVYLRG
FT                   NNSARAIRYARTYLSNSYFSMGHDLTTNEYLMGLNFDTKYMIYENLAAVLETGWAHGQF
FT                   QESVWGHRMVSQADSLGNNAWKVAFGLTYKF"
FT   CDS_pept        complement(733371..734129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgdC"
FT                   /locus_tag="DMR_06590"
FT                   /product="activator of (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74150"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY6"
FT                   /protein_id="BAH74150.1"
FT                   /translation="MSEVAGLDVGSRAIKLVVRREGETILSRRLPTTFDPAGQLRQLFA
FT                   DGVPKRLAVTGYGRELARELYPTARAVTEIKAHALGGASLFPQAATLLDIGGQDTKAIA
FT                   LLPGGRVGRFEMNDRCAAGTGKFLEYVATAFGLSVAAFAALALTGDDPPLISSMCTVFA
FT                   ETEATTLMARGVSQANIALGLHKAVAGRTLAMLGRVGLTPPVVFVGGVAQNPCLVRLVA
FT                   EAVGFDVLVPEAPDMTGALGAALWLAAETP"
FT   CDS_pept        complement(734126..735403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hgdB"
FT                   /locus_tag="DMR_06600"
FT                   /product="(R)-2-hydroxyglutaryl-CoA dehydratase
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74151"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY7"
FT                   /protein_id="BAH74151.1"
FT                   /translation="MSDAAHKAMWEKLDLDIEAHDGLLAVLGKFYGDIYLSQEGRLKGA
FT                   EYLDFVLSEVHGLRIKEIQDAKAAGKKVVGTFCVFVPEELTLAAGAVQVGLCAGAKAGT
FT                   ELAETLVPRGTCDLIKSFVGFKLARLCPYTESCDLIVGETTCDGKKKAYEAFSQLANMH
FT                   IMEVPQCKAPCDMTLFRSELVRYKEALETLTGNAITAAALAEATKVVNAKRRALQRLSA
FT                   LRAADPAPISGRDALLINQISFYDDPVRFTAKINELCDEIEARVAAGQGVAPKKTPRLL
FT                   LAGCPMAVPNWKLPYLIESSGAVIVGEESCIGERNTRDLTDETPADLDGMLDALAARYM
FT                   QIDCACFTPNDERLDNIAALAKRLNADGVVHYGLLFCQPYAHEAMKVGKAMTAAGIPYL
FT                   AIETDYGMEDAGQLKTRVEAFVETLA"
FT   CDS_pept        735614..736027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74152"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY8"
FT                   /protein_id="BAH74152.1"
FT                   /translation="MARILQFEPRRQVVRPHRETLDTALSPKRPHISDRDLWTRDYRET
FT                   DNIVYAIMKIKEILDYHLYYDDVWPYLLLSFMESVHTSRQGGGEDLPATGASLKDYVLS
FT                   AVTADNKRDLSMVLLLADLIEKSPTYRGTSSSP"
FT   CDS_pept        736263..736484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74153"
FT                   /db_xref="GOA:C4XIY9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR013432"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIY9"
FT                   /protein_id="BAH74153.1"
FT                   /translation="MRATVTQIGNSTGIILPKEAVARLKVQKGDSVYLTETPEGYAVTP
FT                   YDPAFEEQMAAARKGMARYRNALRELAK"
FT   CDS_pept        736481..736870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06630"
FT                   /product="putative death on curing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74154"
FT                   /db_xref="GOA:C4XIZ0"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ0"
FT                   /protein_id="BAH74154.1"
FT                   /translation="MTDWKWVSEAVVVAVHGEQLAAHGGGAGVRDRGLLSSALARPRHL
FT                   AGYGAPDACALAAAYAFGLIRNHPFIDGNKRTGFLTAFVFLEINGWELTATEAEVVAAV
FT                   LSLAAGELDEAGFADWLREHGVEVE"
FT   CDS_pept        complement(736884..737099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74155"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ1"
FT                   /protein_id="BAH74155.1"
FT                   /translation="MKYKDFIGEFEYDAEAKFFHGRVVNIRDTVTFEGASASELEQALT
FT                   DSVEDYLEFCRDLGREPDKPFSGKFN"
FT   CDS_pept        737211..738704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74156"
FT                   /db_xref="InterPro:IPR041578"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ2"
FT                   /protein_id="BAH74156.1"
FT                   /translation="MKKMFPGYYLPSEEDFESLWKDGLFVFDTNVLLDMYSYPDAVRDV
FT                   FESVLRKIQDRIWIPFFVGLEFQQNRFKRVLQSEKNIKSLLDKIQNTAKELSDEVESIE
FT                   LEKRAVGLEDVQERLKAVRDSHLSLSEAVELVYKKVPLVSLDDDIANKIYDLFEGRIGS
FT                   AVENQDKLDKMLVGADERYVNSIPPGFRDSKKDGSVFWGGVVYPQKYGDFIIWKQVIDH
FT                   VLNSGNKKVVFVTGDRKEDWWFKVEGKTLGPHPLLVEEIFRIGKVDVFWMYSSDQFLEY
FT                   AERYLRATEVTKETIDQVKELASGGSDLLGDEPRHVNVCFDVLEDKNVADSYKTFMEHL
FT                   EGVARRESAASSSSSGNYYGIVEGNVKNLGKILDFVVYKFNCEYCLGGVDCFDFIGVTG
FT                   NARLGLVIKDVSAEKNWFKKVVDGYWLSRYSAATGGVVDDFAVILLVPSEVIYEASSFS
FT                   WRKMVDQSLKSFVLKYKPRAVVVGVFVGGEFKEIISVCP"
FT   CDS_pept        complement(738768..740672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="DMR_06660"
FT                   /product="acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74157"
FT                   /db_xref="GOA:C4XIZ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ3"
FT                   /protein_id="BAH74157.1"
FT                   /translation="MPPTTGTLDALLVEQRVFRPAPATVIEANIKPHDLAEAYALAGAD
FT                   HLAFWEKAALELEWRRKWDAVLDDSRPPFYRWFPGAQGNIAHNALDRHVHAWTKNKLAL
FT                   IWEGEAGDCRKFTYFELYREVNRLAGALRGLGVGRGDRVCLYMPPIPETVIAMLAAAKI
FT                   GAPHVFVFAGYSAKALRERVNDSRAKVVITADGFYRGGRMIDLKAVVDEALPGVRPEAA
FT                   ESVVVVRRTGHDIDMQEPRDLYYHDLLRQESPEAPTEVMEADEPLFWLHTSGSTGKPKA
FT                   VIHGHAGYMVGAHHTFRTVFDVKPTDIHFCTADPGWITGHTYGVYGPLLTGATVILYEG
FT                   HPLYPQADRLPSIIERYGATIFYATPTLIRMLMRYGPQYPKKRDLSTLRLLGSVGEPLG
FT                   PEAWMWLYKHFGGSKCPLLDTWWQTETGMAMIAPMPISVLKPGSVGKALPGIEAEVVDE
FT                   AGAPVEPGQGGYLVIKKPWPAMCLGLEGDPAGYRAAYWERIPGMYFAGDVARRDEDGYF
FT                   WIQGRADEVLNIAGHRVGTAEVEAALTAHRFVAEAAVIGLPDKIKGEVAKAFVVPDPGW
FT                   IAAFPDADAFDAELRAHVRRELGPIVVMRAVELRDTLPKTTSGKILRRQLRKEELREG"
FT   CDS_pept        complement(740705..741598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06670"
FT                   /product="putative response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74158"
FT                   /db_xref="GOA:C4XIZ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ4"
FT                   /protein_id="BAH74158.1"
FT                   /translation="MDRITALLVHPDPAVRTALRTELCRVDFIRVLGEAADAYEASELL
FT                   RAIPYGLLFCGVDLGGEMGGFELAEALAAAKRQPGLVFIAADETRAFRAFELGAADYLL
FT                   WPFTPQRFAQTLDRLARFRPAFREAPPPEWRAAAAPRPGQDDDGDDEAGGEETVRLPLE
FT                   EDEEDRFLSALRQAWDPRHERAVDIEKLPITLDGRTILLPYTQILFIEAYEDYSFVHTA
FT                   SQKMLTSYRLKNLEERLRPHRFFRVHRKYLVNLDQVTEIATLPGGNFMLRTAGKTRIEL
FT                   PIGRRRIGELKQILGL"
FT   CDS_pept        complement(741726..742871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06680"
FT                   /product="putative twitching mobility protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74159"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ5"
FT                   /protein_id="BAH74159.1"
FT                   /translation="MEHALLDALVGQALAAAPRASDLLFPPAGPAGALVDGAFTPLPGL
FT                   GAPTSPPTTDALARELLGQNARLAADLTRLGSCDVSYRHSSGWRFRANIHRAGQGLGLV
FT                   LRRLPAAPAPLAALTLPPAAARLTELAEGLVLVVGATGSGKSTTLAALAAAILAARPVH
FT                   VVTLEDPIECLLPPGRGIVTQRERGTDFPDFAEGLRAALRQAPHVIVLGEARDRDTLDA
FT                   ALTAAETGHLVLATLHTADCAGAVERVLACFGPAEEKLARNRLAGSLKAVLAQRLLPRL
FT                   GGGRAVSAELLVTTLRLRERIASGEATSLGVADIIEQGAPYGMVGFDASTAALFAAGLI
FT                   TEETALARASDRAALARGLDAVKAARGQAVSTITGLRLEGE"
FT   CDS_pept        complement(742981..744054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="DMR_06690"
FT                   /product="twitching mobility protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74160"
FT                   /db_xref="GOA:C4XIZ6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ6"
FT                   /protein_id="BAH74160.1"
FT                   /translation="MAQLDAFFKMLKDTGASDLHLSSGCQPMLRLNGRLERIKYKVLEN
FT                   EELKTLLYEIAPQRLLAVFEETGDLDFAYAAPGLGRLRCNYFRQERGVAAAFRAIPETV
FT                   PTLADLGLPDILGELAMRPKGLVLVTGPTGSGKSTTLAAMIRHALEARRDHIITVEDPI
FT                   EFLHASAGCLINQREVGRDTRSFAAALRGALREDPDIILVGEMRDLETIELALEAAETG
FT                   HLVLSTLHTVSAAKTIDRVIDVFPGDRQAQIRSALSESLTAVISQTLLRRADAPGRVMA
FT                   MELLLANTAVRNLIRENKIFQINSVLETAKAQGMRTLDDSLLELLAAGRIEPADALRNA
FT                   VNKTRFEGLVPAPAASA"
FT   CDS_pept        744392..744577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74161"
FT                   /db_xref="GOA:C4XIZ7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ7"
FT                   /protein_id="BAH74161.1"
FT                   /translation="MHERKMEVKETYTVQEVARLLKCSDQTVRKLLKGHELRGAKVGRG
FT                   WRICHDEVVRMTRLQG"
FT   CDS_pept        744616..747765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74162"
FT                   /db_xref="GOA:C4XIZ8"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ8"
FT                   /protein_id="BAH74162.1"
FT                   /translation="MGKEDKITPSQRLLELIRKSSGAAGTAAPAASNAGEAVRRPTIGP
FT                   STAAVAQPDPVAPTGLAATPVVEEAVVTPTAPTAPATNSQLDAAADANPQLVYDPYGAG
FT                   LATASYQGGVSWPGFGEIPPAKPADGAEFDPAMPAAGPAELQPEPVIDLAVEATPADAT
FT                   EAAGAPGVLAEALPELVLDLDDVATPADATEAAVAPGVLAEGLPEPVIDLAVEATPADA
FT                   TEAAVAPGGLAQALPELVLDLDAAPAPFGLAEIPDAPSVPAEAQPELVLGRDAAPAPAA
FT                   GSTSQAETAVPGGGLPELVLDLDAAPTMFFTPAPVAAAPSDTAATSETADGPGALAPSD
FT                   TANAEEPPQADDADNASGPMAESAPVAAADLAVVAASAGMVSETAAGTPKKRRGFNWRS
FT                   LLPGGRICHVGVDISATELVCVAVRGQDADFEVLGLEAVPVPQGVEPGQPEFAALLGRA
FT                   LSGLCLPGQMPKVWAAAQSARSNIQFLTIPKVPSRQVDNAVYWTAKKDMGFDEADVIFD
FT                   FERRGEITEKGAVRLGAMAYTTPREAISLLQNDFAQAGFPLAGLTLEPFAHQNLYRRRI
FT                   VDGPTEGATANLHVGRNWSRLEIVSNGDIMFVRVIKTSMSGMEQAVYDALESRGLAAPA
FT                   QPAKAPAGAPGAAGPREEVVLDLDALSGSAEAGLVLDLDAPASPVTPEPEPQGPSPQPS
FT                   TGETVRPLEADHARELLDSVVYGCLSVDDCHPGYGLELDDVMDMLRPVASRLVRQVEMT
FT                   LKHYRESLGQDQVTRLTVSGPLGGSRLFLDFIQEHVGLPCESLDPLAGRPLPAGTAIGG
FT                   RLPGALFSQALGLALSDEGHTPSAFVTYKERAAKRASRLLEQGALVGLAAVLAGMALLS
FT                   FSAMAKRQTLERERDALNQRLAGYGASLDAAALARKSEELRTKIEAMQRYASRNRIVGI
FT                   WEEALALAPDGVRIGSMTTECGPPDKPLDQAAAQAAAQAAKNLKDGKDPNAPVSRLIIE
FT                   GVAIGDARLFDSMLASYVVALEGSPLLEEISVKRSELEGLEGGATGLRFVLAANLTESK
FT                   P"
FT   CDS_pept        747762..748295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74163"
FT                   /db_xref="GOA:C4XIZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4XIZ9"
FT                   /protein_id="BAH74163.1"
FT                   /translation="MTLAEMRGALPPRTLLTLAVGAAVALGFLAVFLLPEYREIEQLTV
FT                   RTAAMRETLNDRSQLEPVAKALGETQAKVREVGPVGGRDKLPLADVERLTTIFDALAKP
FT                   HGLRLSAVSPDAASVTREGLLAVRLAFLGTPEAARRFMLDLGGFGPVVKVESAATMYGR
FT                   EGREFTLKCWLAVR"
FT   CDS_pept        748324..748833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74164"
FT                   /db_xref="GOA:C4XJ00"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ00"
FT                   /protein_id="BAH74164.1"
FT                   /translation="MTRREKIILAVTGVVAVVAAVYLLLDTGPAVAPQPGGQVQAQAAA
FT                   QTQAAAQAREAAQALVRQAAPGGVETALMAALDKPWRVAVLYDKPLEARGGTGRPTVVP
FT                   RFTGYVELGSGRLAVIDGYEYQAGDTLEGGGYKVLAVSPDKVTLESLANGQRLDIPYDG
FT                   QDALGR"
FT   CDS_pept        748830..750953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74165"
FT                   /db_xref="GOA:C4XJ01"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ01"
FT                   /protein_id="BAH74165.1"
FT                   /translation="MNRRKPGREKTMQVTGNKRRPGGFAATAAGMILIMAVGCVKKPQK
FT                   DTFIEHWETMANKSEGYSPVARPRKVEFSKATIKADKPEKEAPKPVKALPKQKVTLRMY
FT                   DTDLVAVVRAMARAANQNVVLSSSIPGAAGGDKALRINVNVVDAPWDETFTSILTANGL
FT                   AYAVEGDIIRVMTLADMEQQNKLKEAHNKLLAEKTKAKELEPFVMARVEINFAELPKIY
FT                   ATLSAMCGGSAQSGLAGGQGQANQAKPGETVRDITPTSATSDAMNIQGQSGARNPGQLN
FT                   CSVVPDQHSNSIIVQGPPNDAERLVALIEELDKPRPQVKLKAFIVQTDRETGRQLGVQW
FT                   GGLLKNSNLRISPAQTGTSTTTLNTGNTSGNTVGSNTSTNSSLSGNNSTTLNNTLAANT
FT                   ANNSTTTTTVNADGTVTTTTSSTSSPSDSSVSNLAASAASALAASMLAANTGTSSNSTS
FT                   GSSTLASTASPAFAGGTSGQGFGLNFPALSSALTSASGLGAAGAGVNFLFGNIAGNVLE
FT                   AQLTALAESNKVKILSSPTITTMENHSAFVENGMDVPYVSTSQNGTNVQFAHATLKLEM
FT                   LPHVVDNSNLRMKIVVKDDQVDTTNTVQGNPFIYKRETQSNLVVEDGDTIVISGLTRDT
FT                   VGDNEAGVPYLSDIPGLGWAFKTKASSIKREEIYIFVTPTILKEKPISPPPAVAMIRPS
FT                   DAAETDKIGSLTQ"
FT   CDS_pept        751044..753002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06750"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74166"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ02"
FT                   /protein_id="BAH74166.1"
FT                   /translation="MSYYLAMGLTREPFSNSPDPDMLYRSRTHLECLQHMEIGVRLRRG
FT                   LNVVLGAVGAGKTTLARELTRVLGADGDIEAYLLDDPACASTTDLLLSILTLFGLDAAS
FT                   MWRDPMILKEVVKAELARRSGEQGRTVALIIDEGQKITPDCLELLRELLNFETATHKLL
FT                   QIVIFAQSEFEETLAARPNLDDRVNYRYRLECLNRAETARMIETRLARCAPDGETPGVF
FT                   TPAALRRIHRRTGGHPRKIVRLCHLSMLLAVGFGKARVSWWLVGRAEREAAGGRSLLSR
FT                   LPRWPRAPRLAVAGAACAGLVLVLSLAAPGLPGLPALPDLSRLAQDAVSRLDALLAAPT
FT                   PPAAPSSPSAPQAQALYAPELAGVVSTEPQVPARPESPASPAADVAAVPAVSAPLAPRA
FT                   ASVVHAPPANPTALEGLGASLALSAAALPAEPAAAETTRIGRAVALETAAPATAAAVKT
FT                   SAVAPAAPETLGQSVVRSGWAVTRQAARLYGNGGRAVMARLAKANPGVNFDRVRAGDTL
FT                   VFPAIPAAPLEAGQCLVKVAAVASLDEGFAYLGRHAGADMNLSLYCTYAPATGLRYDIV
FT                   LGSLFGDRASAEAALAELPRELASRASIVSGYGPDAVAFTDLGPWPGLRGGPKMAGPAG
FT                   GSQDTKQRMVVSEAARP"
FT   CDS_pept        753034..754743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06760"
FT                   /product="putative general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74167"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ03"
FT                   /protein_id="BAH74167.1"
FT                   /translation="MEPRRRLRLGEMLVAAGLVTEDQLRQALAAGKRSGLRLGQQLVRE
FT                   GTVKEADIVDLISRQMGLAKYTPERYPVTSDLAELLPAEMALRSKLVPLSKAGNLIRVA
FT                   MPDPLDITTIEDIEIYKNCEIEPVICTERELGYLTSAVYGMGLGSEGVLDSIESMRDGE
FT                   ETPSVAVSDEMQLSSLEDRAGEAPVVRFVNSLLSQAVREGASDVHISPERDQVQIRMRI
FT                   DGKLKAVPSPPKPMILPIISRIKILGNLDIAVSRIPQDGRFSVAIDRKEINIRVSTLPT
FT                   IYGENLVLRLLDMSGGGLFLHDLGLSADDLAKIKLVVDKPYGMFLSTGPTGSGKSTTLF
FT                   ALLREISRPDINIITLEDPVEYRMEGVRQVQLNRKAGMTFASALRSTLRQDPDVVLVGE
FT                   IRDAETAAIATQAALTGHKVLSTVHTNDAAGAVMRLMDMGIEPFLVSSTLMVSIAQRLV
FT                   RRVCPNCAEPYTPRPEVLRFWNLEDTAGSVFMRGRGCFMCGDSGFRGRLGLFEILVMDE
FT                   EIQEMVARRATSREITRFAADSGRLKLLQDDARLKILEGKTTFEEASSAVLV"
FT   CDS_pept        754951..756180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06770"
FT                   /product="putative general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74168"
FT                   /db_xref="GOA:C4XJ04"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ04"
FT                   /protein_id="BAH74168.1"
FT                   /translation="MPQFAYEAINEAGNPIKGVLEAETADAVRTRLLGMGYIPVAVRKG
FT                   VAAAASGGFGESLEDALTRISAQEMILFTKQLRTMLGAGLSMLEILRVLEQQSENPKLR
FT                   RVCSRMSDQVKKGSSISAAMAAQKGVFNELYISMVRAGESAGALPAVLERLTYIISHEH
FT                   QVRTDIKSALQYPITVVIALVGAFFFLLKFVVPTFAGIFANAKIELPWPTRMAMQMHTV
FT                   VGEYWYITLSIFLSVLIVLYLWFRTENGKVTRDAFFLHIPIVGMLLRKAAMSRFAAIFS
FT                   ILQASGVPVLTTIDILVGTIGNAAIAKEFRRIQEMIKSGQGLAGPLSRAKYFTPMVVTM
FT                   VAVGEESGNLDEMLSAISEHYDAEVAFAVKRLSDALGPVLIVGLAGVVGFFALAIFMPM
FT                   WDLTQAQTKM"
FT   CDS_pept        756188..757531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06780"
FT                   /product="fis family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74169"
FT                   /db_xref="GOA:C4XJ05"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ05"
FT                   /protein_id="BAH74169.1"
FT                   /translation="MAAPKPMEQDSPRKRDSPLVGGSLLILVPGILGGVAALPILTAGS
FT                   LWPGLFWWRHAEILSLLSGGAVYLAATGLLLWVRRPIRRFLHSTRQIDVLAQTPAPAAR
FT                   SRDELDRLEGVFDQVVELLSAMDARALFPNMVGESRAMRAVFSQLLKVAATDATVLLLG
FT                   ESGVGKELAALSLHEKSGRAKGPFVAVNCAAIPEGLLESELFGHERGAFTGAVARKIGK
FT                   FEKAAQGTLFLDEIGDMPPETQAKILRAIESRQFERVGGGKPLRLDVRVVAATHRDLPE
FT                   MIRQGRFREDLYHRLNVFPVRLPPLRDRREDIPLLAGRFLEGFRPGARLSVEALQRLLA
FT                   HDWPGNVRELKNVLERATVLAGGDEIAPRHLPGLSGQGPAEATAGDEAADLDSRLAAYE
FT                   RTLIEAALSRTGGVQSRAAALLGIKERSLWHRVKKLGIAVGPFRGQGG"
FT   CDS_pept        757724..758131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74170"
FT                   /db_xref="GOA:C4XJ06"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ06"
FT                   /protein_id="BAH74170.1"
FT                   /translation="MEKARTLRHGEQGFTLIEIIAVLVILGILAAVAIPKYNDLQKQAQ
FT                   IKTAMGALPAVVTMATNDYHSFMMSNPGSNASNFSNSRSGNVTDFIGSYNATGGVVTAY
FT                   VTGAVTGTGPAAWWSNVSGSASIMTYKFTLE"
FT   CDS_pept        complement(758337..760550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06800"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74171"
FT                   /db_xref="GOA:C4XJ07"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ07"
FT                   /protein_id="BAH74171.1"
FT                   /translation="MQIEKNPLWRAGKHPLLWGCLLLTAVTVLNNWPMASFGFAWDDHG
FT                   YVIRNYAIQDPVSLKTILWCLTAFAEANWHPMTWLALHLQFQFFGLNPGGYHVTNLLLH
FT                   IANTLLLYALLYRTTRAVGKSLFVAALFSVHPLHIESVAWISEIKDVLSTFFFLLTLHA
FT                   YASYARRPELWRYGLVGLLLALGLASKPMLVTAPFVMLLLDYWPLGRWTGGPEAAFPGA
FT                   AGPRFPNRRLILEKLPFFAMVAVVCVLTFLAQREGGAVVHLGAISLALRLGNVANSYVL
FT                   YLWRMLWPWPLSFFYPYTPVPPWRIVLCLCGLVALSLVAWRNRRRAPYVLCGWLWYLGT
FT                   LVPVIGLVQVGSQAMADRYTYIPSIGVFVAAAWLLDALRTRLRVSVLLPAALAGATIFM
FT                   AMSASLDYLLKWINEEELYQHGLNIYPDNAIALNNYGIYLVERQKNDRALQHFKKEMEI
FT                   NPQAARGLINLGSLALLERKYPEALQHLVAALRVNPKNGMIYYLLGQVFLKIHDYTVAE
FT                   ALFRHALHSKQSVSRAAAALADLYVTQGRHDEALDVAAAFLPNLYDKDPPKALLLWNAS
FT                   RAHRLKGDTAKAREVAAEALRLQPVFPNASRELALLALGDGALDAAVSLLKESHQQTPW
FT                   EPENWALLGQLYLRQGKYSRAYEQFRRALTRSQELHATTETEIHLALAALLQRFGRPDI
FT                   AALHVARAHDLRILCSPKDAPAFRSRLEEAAPAVSPPIQGSPQ"
FT   CDS_pept        760630..761205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74172"
FT                   /db_xref="GOA:C4XJ08"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ08"
FT                   /protein_id="BAH74172.1"
FT                   /translation="MICQSVGLKRPARRSRSANQRGFTLIEIIVVLLLLGILSAVAISK
FT                   YSTNNITAATEADVFKASLRYAQQRAMGDISTWGLSIAADGLSYSLFTNNPDLKTNPIL
FT                   PGVGANTRVLASGVTMSVSNAVSNGGKSEIIFDYRGRLAASGGSNTSAGTEYLKTAPLA
FT                   VLGTNVTVTFTGDTGKSMTIYAKTGFAQ"
FT   CDS_pept        761498..762130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74173"
FT                   /db_xref="GOA:C4XJ09"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ09"
FT                   /protein_id="BAH74173.1"
FT                   /translation="MHDFRDNIHCGYDADKWELLSSNAKKFRYRRNFVHAFHLWHCKIM
FT                   KNNHGFSLVEIICVLVILGILGAFASVGYVRFIRLYSSIKDVDVAIQQGQIAMNRLFTE
FT                   VTTIDTTATAKPFVLDTSAATAYSTPYKFTSLDGSAGVDNVVSYDSSTKILSLNSVPLC
FT                   ENVSAFLMQKDDSATGVANLSYVTTKLTITVGSKSQMLSSQFTLKNL"
FT   CDS_pept        762148..763716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74174"
FT                   /db_xref="GOA:C4XJ10"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ10"
FT                   /protein_id="BAH74174.1"
FT                   /translation="MVFRKGPLGRDVKLRGSVLFVVIGAIVVMSVIGAAMSRLQGAGTG
FT                   TEVQENRIDDAYYAAISGINYVAARITSAMNDPEASGWNLLSLNGTYTINAGQQFELAI
FT                   TKGSGTDYNIQSRGIMLTSGSSKQTNCILKTTKTYSWVPPTPPETPPNLGSYNFVNPSN
FT                   RPNYAAYAADDKRTYPTGTDTGDIITRNIVVGKDYYYGFGNVWFAGTNTGYSVDGVSSF
FT                   GKGIRMFLTFKFLTTVGDGFTVAILNGSQNNYLSSGGDSAEGGLLGYAGDSRVYNSNDG
FT                   GFASTILEYVDKSGYAKGLNPPKFAVEIDTYTNKSDDSKWNPSAKKASCTDDNAFMNDL
FT                   TYGSKKHHVGIMYWGDDTAYLRKTCPGPGDGFKGNVKRYTDVRHGSEDNAPNSPNSQMQ
FT                   YIDDFVVGRTYFLRMDVLKSGATATIKSFVGTCKGNDLNTSCVNEVYGTTTANHTGTLS
FT                   DTKTDFSYANIASSQNLTGVTVSDSMTFTTSEATAFSNFLWGFTSGSGVAAQQIEFRNI
FT                   SMSFR"
FT   CDS_pept        763876..765276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74175"
FT                   /db_xref="GOA:C4XJ11"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ11"
FT                   /protein_id="BAH74175.1"
FT                   /translation="MAFQAPGHIFRTRAGQYPETGGSLLYVILAITLLAALSASVAKFY
FT                   SSTLSTSLAGVQDIRAYYLALSGLNFWSAGKTGTYSLTGGTFTLAQSGPDAQGFYTVTS
FT                   LGRTADNANCRLTAKRQSTKPITFDDDIKDFILPVFGKTANSKYAVLVFDKDMPDAQSG
FT                   WSEAEWATLWTANANRYAGGWVRLGGNATDTNGAIWYGGDYGACSATPCQSGACRDGAC
FT                   TLGKGLRAFFRFTFSCYDGSVDSTSCADGYTFAVISAGNNAATASGGPASGSLGELLGY
FT                   AGPGPSGTGIAPPKLAVEVDTYPNKGNGKETETGNRHDAGNENHVAVVYWGDDFGRNAS
FT                   YDDNAHGVGDNPTAGSTGYVAKAKAASGPNWLEDGEAHALRLELHRTGEGAASGTYRVK
FT                   VWVDPKASGRDDVTADYAAESPLLDHTTTLAGRYNTGLDVIRFGWTEGTGGAVQTVAVY
FT                   DFSLDFRR"
FT   CDS_pept        765318..765869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06850"
FT                   /product="putative transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74176"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ12"
FT                   /protein_id="BAH74176.1"
FT                   /translation="MPVLFAALLLLCCLSGQARAGDAIYQYRDAKGAIHLSNRKLDDKF
FT                   QPFDYMRLPAGTDQSKIYPFIRYYCRRHGLDPELVRAMVEVESGFAVRAVSPKGAAGLM
FT                   QIMPGTGRDLGLADAFDGANNLEAGIRYMRALMDAYGDVRLALAAYNAGPGRVKKGGTV
FT                   PDIPETQAYVEKVLARRGAR"
FT   CDS_pept        766057..766401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06860"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74177"
FT                   /db_xref="GOA:C4XJ13"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ13"
FT                   /protein_id="BAH74177.1"
FT                   /translation="MVVNWQESLGEAVKALGALAKGNPGIMDGYKALDGAGSAHGALDL
FT                   KTRELISLAVAATTRCDTCIAVHAKAAAEAGASREELLEALAVAITLNTGAAFVYSSRI
FT                   LEAYDTFSKK"
FT   CDS_pept        766462..766983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74178"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ14"
FT                   /protein_id="BAH74178.1"
FT                   /translation="MVLSRPSHSEARMKAHSVFAALMLILSLSLGGCAGFGQGKAEDMA
FT                   KASAAMPLNVDNVSMVRAAVAGAKAKAPRAETRDDYVRLARTVYVAPWAAGHNAAATTE
FT                   VALAQAKAGNQAARDYLTIMVYDIQLQTAMEGTSLSTEDWHAVYVGSGIMTEAAYAAYV
FT                   DMARGGKVLP"
FT   CDS_pept        767099..768052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06880"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74179"
FT                   /db_xref="GOA:C4XJ15"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ15"
FT                   /protein_id="BAH74179.1"
FT                   /translation="MDIALSSLPRAARTIALDAAKICLDLFKVMVPILIGVKILKELGW
FT                   ITYLAKPLAPLMSLVGLPPECGLTWATAIANNLYAALAVHAALVPDMSPLTIAQATVIA
FT                   TMMLIAHNLFVEGAIAKRCGVGFWGQAGLRLVCAMACGMLLNAVFSAFGLFTAPAPLLF
FT                   TPAADDGSLVTWAVGEVKNLGMIYVVIACLVGLMRALDALGVTRLFEAALMPFLKLMGI
FT                   GGGAATITVIGLVMGLAYGGGLIMHDVHKGKVDRRDVFPAISLMSLSHAIIEDTLLMYL
FT                   IGATMWGTFVGRLLFSLLVVAALSRLTAGLARPRLA"
FT   CDS_pept        768065..769207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74180"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ16"
FT                   /protein_id="BAH74180.1"
FT                   /translation="MTKPAMGRYLAWLALAVGLGAAALALGGAVAASTVDPAFEALVSR
FT                   LAADGLPEAKVRRLFSRAEMAFSPKAMSDKLTALYMRKYGLRLVADIQTRLAALGWYPG
FT                   PADGKLDRMTRWSIKAYQAAEGLPQLGTATETLLAELSASPKHAPADLAFPQFPKAEVH
FT                   DIVLTPERLAEAREFYQRNRAALARARERFGVPEEYMVALLAVETRVGRYLGDEVAVVN
FT                   LASLVAGEDVSRLPRAFAYEKPAPDRLAWIKAKATEKGEWAYGELRALLRYADAQGIDP
FT                   LSIPGSIYGAIGICQFMPSNALKYAVDGNGDGKADLFDPDDAVASLGNILRAMGWREPM
FT                   SEEAMRKVFYGYNHSQVYVNTIMDAARRLRDASGSGTTKP"
FT   CDS_pept        769283..770128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06900"
FT                   /product="polysaccharide deacetylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74181"
FT                   /db_xref="GOA:C4XJ17"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ17"
FT                   /protein_id="BAH74181.1"
FT                   /translation="MRAKALCCAVFAVIGLFLDALPARAATILVYHSFGVRSSMSISLP
FT                   AFEAQLDFLEKNGNKVIGVDELVATIAAGKNPPDGAVVIAIDDGWATVMAAFEVLKRRN
FT                   LPFVVFLPMAYTANPYCKVTLSQADIDKLRAYPKVVFADHSFSHSPKLAKSEEFAREDV
FT                   RKSRERFRQVLGFDTKYFAYPYGAVSESYTRALREAGYEYLFVTGDSPVSATTKVTAIP
FT                   RIAANRLSVNVLASVLRNHAVLMAKAKATPAPAAAAPAPGPDPTLASAAPADPSPRAVE
FT                   "
FT   CDS_pept        complement(770517..771527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06910"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74182"
FT                   /db_xref="GOA:C4XJ18"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ18"
FT                   /protein_id="BAH74182.1"
FT                   /translation="MKPEPLLGLRARITRLGTGGMYMAADCFIGIDVSKETLDVHTLPD
FT                   GNDFQFVNDPDGIKAICRKFSKFRPKLIIIEATGGLQIPVATALSLKKFPVVVINPRQA
FT                   RDFARAKGRLAKTDKIDAEILALFGKQMEPEVRPLKDEQAQEMSSLMSRRNQLIRMLVM
FT                   EKNRFTRAYGSVRADIEKNIDWLEERLSEIDTHLGTVVRASPIWRERDNLLRSVPGVGD
FT                   VLSRSLLSNLPELGTLNRREIAALVGVAPLNCDSGKRRGKRRVWGGRSDVRSVLYMAVL
FT                   SAKKYNPVIRDFYNRLKEAGKPHKVAAVASMRKLITILNAMVRSGQPWGQYAHAA"
FT   CDS_pept        complement(771678..772958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06920"
FT                   /product="putative partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74183"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ19"
FT                   /protein_id="BAH74183.1"
FT                   /translation="MEAAMLAICPFCRARHEIAEAEATSGTTCSHCHRRFAVRRKEPAL
FT                   TGADVGTSLLRIERPHGLFERPGVVERRLTAVPRPAPAPQPAQAASLAALAQPSTDLPD
FT                   NRPFQTAQPARAAVLAAVPAVAPAPQASDDEAAFPILAEPDAAAEEAAAAALSAIKSQL
FT                   AAEPAPLTLPEPGTGRARRIGVMLSKGGVGKTTTAVNLAAGLAALGKRTLLIDADTQGQ
FT                   CAYALGVTPGKGLAEYVDGSVSAEDALTPVRDNLWLLAGGKGLAGLKRLISRKDFGGER
FT                   TLDDALSGLDDRFDVIVVDSAPGWDALTVNVLFYVRELLVPVALEAMSLQGFSEFLRSF
FT                   AAVSRYRPQLALRYVVPTFLDKRVRGPAALAEELAALYPDRICPAVRYNAKLSEAPAEG
FT                   RTIFEYAPRSPGAKDYQTLAERVAADG"
FT   CDS_pept        773442..774914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06930"
FT                   /product="multi antimicrobial extrusion protein MatE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74184"
FT                   /db_xref="GOA:C4XJ20"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ20"
FT                   /protein_id="BAH74184.1"
FT                   /translation="MPQPAPSPSPGIPPGCNTRPPIVGDQRRRLMQRWHGPGGIAHVLR
FT                   IGLPLLAGMGSITAMHLTDRIFLGWYSQDALAASLPAGATFFLLTSFFLGTAGYAGVLV
FT                   AQHVGAGQTDKVGRVVWQGVWFALASFAPLILLALAAGPIFAAMGHPAEVRSLEETYYR
FT                   VLMLGAGFMVLEAALAAFFSGRGLTRVVMCVNIGGAILNIPLNYLLIFGNWGLPSLGVA
FT                   GSALATVTAWAAMAGAYGLLIFTRRNDGLYGVFRGRAFDRPLFARLVRLGMPGGAQVFL
FT                   DVFAATVFIALAGRIGKAELTATSIVLSANTPAFLPLIGLSQGLAVIVGQSMGAGKPAE
FT                   AVRAAGSAVRIMAIYMVIMAAVFLGFPDQLALIFSPNEADASFGAALAYCRPLFAWVVV
FT                   LGFCDVVIHAAFGVLRGAGDTRYLMVAAALVSAFALVAPAWLAVTAFSFGVVGLWGVFA
FT                   FYAAVMAVVLWLRCRGGAWQTLRLVRPAGDGH"
FT   CDS_pept        774995..775723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="DMR_06940"
FT                   /product="putative ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74185"
FT                   /db_xref="GOA:C4XJ21"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ21"
FT                   /protein_id="BAH74185.1"
FT                   /translation="MRCTASLRIKEPAMRDTAVKRMFEDIAFSYDMQNSALSLGIDIWW
FT                   RRCFVSMIEPRQGTVLDAATGTGEVALAIRRRRPGLTVIGLDFSPAMLDVARAKAAKAQ
FT                   VAGYHLGVADCRDVPLTDACVDAVTMAFGIRNIAERVAVMREFHRVLRPGGQLHVMEFG
FT                   MPRFELGKALYRFYFDRILPPVGNFLSRTDYAYSYLVESVDAFPADNDFLAQMGEAGFA
FT                   ERRVTDLTGGLARVFSGRKL"
FT   CDS_pept        775810..776412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06950"
FT                   /product="UbiE/COQ5 methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74186"
FT                   /db_xref="GOA:C4XJ22"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ22"
FT                   /protein_id="BAH74186.1"
FT                   /translation="MEVNWPERFYCRSFVRKIAQWREVGFFRATHPIPPGAKVLEIGCG
FT                   DGGGAAIFARRFAPSLYHGLDVDPAMVKVAAGRRKGPDWDKRLFVLGDAEKLPYADGAF
FT                   DAVVNFGIIHHLPDWRRGLAEVARVLRPGGAFYFEEIYPPLYANPLFRVMLAHPREDRF
FT                   HGPEFRAVMAREGLTLLPGYHESCLFILGVAIKTGRP"
FT   CDS_pept        776542..777927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="DMR_06960"
FT                   /product="putative cytochrome d ubiquinol oxidase subunit
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74187"
FT                   /db_xref="GOA:C4XJ23"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ23"
FT                   /protein_id="BAH74187.1"
FT                   /translation="MDFLADALLLSRVQFALTTAFHILFPPLTIGLAVYLVVLEGLWLR
FT                   TRDLAYYRQFRFWSGLFAVNFAVGVVSGIPLEFQFGTNWGPFSATVGNFFGQVLGFEGT
FT                   MAFMLESAFLYIMLFGWKRVGPRMHFFATIMVCFAASLSAFWILVANSWMQTPSGGHIA
FT                   NGVFVVTDYLAAIFSPDLPLAFSHMYLACLELTAFVVGAVSGVYVLWGRHTAFFLRSFK
FT                   FAALAAVVLAPLQALVGDLNGQEIGRIQPAKVAAIESHWDTNKPGTGAAWHVIAWPDPE
FT                   AERNVFAISIPDVLSLLITHDPTGIVPGLKDFPKQDRPPIVLPFYSFRLMVGVGTAMIA
FT                   VMAWTILLWRGGRLTVERAGQNRLLFLSWALMAPGAYVAVIMGWVTREVGRQPWLAYGL
FT                   IRTENGHSALSAGEVGLSLAGFCVAYTLLFGLFIHFMGKRLRRGPDLDELPPPAHRPKP
FT                   AVG"
FT   CDS_pept        777980..778990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="DMR_06970"
FT                   /product="putative cytochrome d ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74188"
FT                   /db_xref="GOA:C4XJ24"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ24"
FT                   /protein_id="BAH74188.1"
FT                   /translation="MEAPVTLADVWYWILALLLWLYVFTDGFDLGVGILCLVEQNEPRR
FT                   SVMIETVEGVWHANQTWLVMLGGVLFGAFPLVYGTVLAALYLPAGFLLFALMTRGMGIE
FT                   YRPETDDPRFWSQVFGWGSVAVTVAHGLLLGAILQGMPFDGLRYLGGPLDWLAPFPILV
FT                   AVTLLCLYPMFAAAWLVLKTEGELQDAARLWGIRFGSAAVACLVLLVGYIALDGSLGHL
FT                   VGRPGQGGLSPLFVLLLVVAVLNAALYFRALGKGWEHRPLMYCAAMLAFVFLAFGLNLF
FT                   PLIVPPAVTAASAAAPDDMLRVMLYVIGGLMPVVLFYNAYQYRVFRGKAVPGEEA"
FT   CDS_pept        778995..779939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06980"
FT                   /product="UbiA prenyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74189"
FT                   /db_xref="GOA:C4XJ25"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ25"
FT                   /protein_id="BAH74189.1"
FT                   /translation="MNAPVCPAPEHRGLALTVYLALSRTPHGLLDLAGPFCAALLCRGG
FT                   LPPVSVVILGIVTVFAGYTAVYALNDIVDYRSDKLQLEGSGEDERVNYLDAAFIRHPLA
FT                   RGCLSLPGAVVWFVCWAVVAFAGAYALNPVCAVLLIVGCLLETAYCLLLTVTHLRALIN
FT                   GVVKSLGPLAAAYAVVPEPSPWFLAGLCAWVFAWEIGGQNIPADWHDARRDAIFGARTV
FT                   PVVLGGRRASRLAVVMLGISLIVSAPLLALSPLAVSAPLVLAAVLGGAWLMLPPAVSLA
FT                   ASLDDAQAASLFNRASAYPALVLAMLVLHLLTR"
FT   CDS_pept        780027..782132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_06990"
FT                   /product="putative sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74190"
FT                   /db_xref="GOA:C4XJ26"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ26"
FT                   /protein_id="BAH74190.1"
FT                   /translation="MPPESAAWTELLPPLLAREEPWLMERVLVHAKAQGYTAYTSTLVE
FT                   AWRVSVAGLSAAVAAALAGDPCRLADYPADASNPDDPVTAFAVREAALHRQRGISLAMF
FT                   WGLLKYYRQAYLELLDARADVLGEGLAQARSFVAACFERMEYAFVLRWEELSEKGLHDA
FT                   LARENRALANEKNKYLTVFETVPHALFLLDADGALDNANALALALLGRESACGALYYGG
FT                   FSPQGEDACPELLGRPLTELLPWLAPALDAPVGQVASRLPVEIVVEIDQADRHYSVVAE
FT                   TLRDVSGKFAGKVVLCRDVTERRATENALARSEELYRSLVEAMHQGVAVLSPEGRVDFA
FT                   NQTLCDLLGRPMDAVISQPLFAFLRPEDHGRFMESLAARAQGQADPYELRLRRPDGRSV
FT                   VIMASPSPLVGPDGDYQGSLEVFTDVTRLRQLELQLATAKRLEAIGQLAGGVAHEINTP
FT                   LQYLAGNLDFAQNGLAHVLTLLDKYETALAQAEAGPGLDAAKAAIDAFRRDNDLEMLLA
FT                   ELPQALAESRHGAERVAAFVRSIKRFAQTESVGRRAIDVNEAIRATVEVAKSAQEYPIT
FT                   MCTDLANDLPPLPCVPGDFNQLLLCLLINAAQAIEPKPDANGRIDIVSRRQGQAIAITV
FT                   ADTGKGIPAELQDKIFDPFFTTRDVGKGGGQGLAIALSIVQKHKGDIRFASEPGQGTTF
FT                   CVTFPLE"
FT   CDS_pept        complement(782503..783240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07000"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74191"
FT                   /db_xref="GOA:C4XJ27"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ27"
FT                   /protein_id="BAH74191.1"
FT                   /translation="MSQNPEKRFTPQELAAFDGTDGKPTYLAYNGVVYDVSASRLWKAG
FT                   KHMNRHHAGGDMGLELSQAPHSPDVLERFPRVGLLDAPALKPESAADRVPPWLAKCMKR
FT                   FPMLKRHPHPMTVHFPIAFCTAAPLCLLLALITGKQAFAAALPVLLGLGLVFTPVAIVT
FT                   GLFTWWLNYASARVTPIMIKLAATPVLFLALLWTFIESVKTPDIMAEAGSHIGFVLVVL
FT                   ALLPIVSVIGWFGAALTFPPHDD"
FT   CDS_pept        complement(783237..783665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07010"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74192"
FT                   /db_xref="GOA:C4XJ28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ28"
FT                   /protein_id="BAH74192.1"
FT                   /translation="MLRALIIDDDPVTKRFLAEILAPFAACELAANGREGLDAFAQALR
FT                   AGTPYDVIFIDVMMPAMDGHQALEAMRHLEHEQHVGPADAAKVIMVSAADDSRNVYRAF
FT                   FQGQALSFLPKPFTSDAVLAELRKFDIIDQPALQRSTA"
FT   CDS_pept        complement(783973..786162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07020"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74193"
FT                   /db_xref="GOA:C4XJ29"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ29"
FT                   /protein_id="BAH74193.1"
FT                   /translation="MRIRWKLFWLLAALSLVPLIVLRVNSQLALSRLAERLSSRVGAHL
FT                   VAEAKTRLGRTVEDHARLLAARRQTLALAAALQADAVAQALAAPPDKTLDPHKQAVITT
FT                   ALPAMPMNMGMGRADHPDHEGFVETPGYYRVDLEGRRLPLPIDPGRVLLRLPPEASAEA
FT                   LPPDAAALAGLARPLKRIAALVGPLAHFQDTILADGTVAVYPAVPGWPRRASPLSAPWY
FT                   QAAIAADAPVWGQPQGEPGTGRVSVVVAAPVRRPDGGVIGATAIFTPLSDLLASVSSPG
FT                   HIAPDIESLLVVAAPDDKGAPRLLVEAGEVVRAARGGHGWQAFVHPAPLASPDEATLAV
FT                   MALDVAAGTSGVVRLPYNGREVLAAYAKTGENEALLQLAPVDDVLAEAAAVAGDVDTSI
FT                   RRLYIIGSFIAGAVMLGLAFVSLAASRVVTRPILVLTDMARRLAARDFTARVPVKGHDE
FT                   IAELGRVFNELAPTLDAHVRLCESVALASEIQRSLLPGQPPDIDGLALGAACRYCDATG
FT                   GDYYDILPFDGPKAGLVGLAVGDVTGHGLEAALLMTTARALLRPRAAAPGTPGEILTDV
FT                   NRELARDTMGTGRFMTLFYLEIDPAGRRAAFARAGHDPALVHDPATGQTSELSCKGLIL
FT                   GAMDDAVYATGHIADLAPGTIILIGSDGLWEARNAEDEMFGKDRTRAVLAKSAPFGPQA
FT                   VCQALMDALDAFRGETPLADDVTLLAAALNSKTPT"
FT   CDS_pept        complement(786292..788511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07030"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74194"
FT                   /db_xref="GOA:C4XJ30"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ30"
FT                   /protein_id="BAH74194.1"
FT                   /translation="MDCTNELNPAQLEAVSTTEGPVLVIAGAGSGKTRTIVYRLAHLVL
FT                   KGVEPASILLLTFTRKAAQEMLTRAGLLLALGAQGISGVAGGTFHAFAFAALRRYSEAA
FT                   GFPGGFTCLDAADCEDILGQCKDRLGLGKGDRSFPRKSAILGLLSKARNKELEVGDVIA
FT                   REAFHLLPYAEAITSLGQAYGAFKAEHNLLDYDDLLFTLERLLADPAGPGALIRARHSH
FT                   VMVDEYQDTNKVQARLTRLLAPEGGNVMAVGDDAQSIYAFRGASVDNILDFPSLFPGTK
FT                   LIKLERNYRSTQPILNLTNAVLAGAGRKFEKHLFTTREDGPQPQCMRPFSDLTQASMVA
FT                   AKVKELSATFPLHEIAVLFRAGYQSYALEVELGKAGIPFQKYGGQKFSEAAHIKDVLAY
FT                   LRLARNTADFPAWSRVLAFVPGIGPKTATRIFEAIRAGDRAMLGKMAAKSGEFKALIEF
FT                   LDALRALPPSPQELLSKVIEAYAPLLTERYPDDYPRRQAGLDQLEQIAAAYADLDAFLA
FT                   DLVLENPDEDRKKAREGHLVLSTVHSSKGLEWSAVLIIDLVDERFPSRHALSRAEDLEE
FT                   ERRLLYVACTRARDYLGLFSPETLYQRQGGGCAPAMPSIFLRELPQGLLAERRERLGGS
FT                   GAASFACPAPTAASSSAQSFTRQPMRRATSAPLSARLPAREDAPAPRPAPDPSTLGYCR
FT                   HKIFGRGKVIGVLDDGKYRVNFPNFGPKVILAAFLEMEGAASPEA"
FT   CDS_pept        complement(788697..789965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07040"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74195"
FT                   /db_xref="GOA:C4XJ31"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ31"
FT                   /protein_id="BAH74195.1"
FT                   /translation="MQFERKITLVNFKNAFLIFVLAYLTIHTLSFMVNRWQCNDFNHYY
FT                   TSSLMLSQGVNPYVTPLKPLMDLLKMYHDSGIPYATNPPPLIYLFMPFAQYDPLAAFNL
FT                   WSTLQLLCFAANLYLVRKIINNKYFNSIFLEFTCLFAASFPVFLHFISAQVQFLILLFI
FT                   YLAYLLFTQKKYALTFLLLATAGAIKIYPLFLAPWFLLRAQCTLSRKALHALLMVSWIA
FT                   FLGYLTDLNLWRDFFQFSTPIIKNYIIGKGWNYGIPSFIGHLGVFFEFNKLFNSNIDKL
FT                   TTTADVFGILALALCFIYILRNKLSLVTEFSLVLIFMLLATPSCWAHYVVAAMLPIAVI
FT                   ITNIHRNGSFSQKCALGLALFFLLIDVSVYATKSSMIAYFTCLHMPLFSMLALAYLLIR
FT                   TDSPALHDTDCPHMPSFAKACAP"
FT   CDS_pept        complement(790014..791333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07050"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74196"
FT                   /db_xref="GOA:C4XJ32"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ32"
FT                   /protein_id="BAH74196.1"
FT                   /translation="MSQPRKRTVVLGLDGLPRTLAQSLAATGRLPNLARLLAIDAASIE
FT                   AELPELSPVNWTSFLTAANPGRHGVYGFVGIDPASYRLGPVDASTIAAPTLMTRATQAG
FT                   LVAKLVNIPCAAPVSPLRGAIIAGFPEIDLGRAVYPPELAQNLKLAGYRIEADTTKGAA
FT                   DFDTLARELRTTLASRRAALEMLWTGGDFDLFMIVLTETDRLFHFFFPAVARPEHRLHG
FT                   PALDLLADWDKVIGLVLDRYEALPEPKRFFALADHGFTELETEFDLNVWLAGKGLLRLE
FT                   PGATGEYDARIVPHHTAAFALDPGRVYINIKERFARGVFHEHVAEKLAEDLRGELLAIV
FT                   HDGRPLMEAVRLRGEIYAGPQVRRAPDVVCVPRPGVSLTAKFNRAELTGHYGRFGCHSP
FT                   HDALWCDSEGSRPQRTSDAGAVVAASLGLPLNDLEAMRPI"
FT   tRNA            791552..791638
FT                   /locus_tag="DMR_t00060"
FT                   /product="tRNA-Leu (TAA)"
FT   CDS_pept        791881..792282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07060"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74197"
FT                   /db_xref="GOA:C4XJ33"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ33"
FT                   /protein_id="BAH74197.1"
FT                   /translation="MSVIQWDNDLCIGHDLIDTQHKRLFELTTKLYDIALGSGDKANLK
FT                   LLLLDLYKYTLFHFDEEEVLMRKHNFPHYNDHKHEHEKFVATLDALAIKAREDTSALDI
FT                   EILNWLSSWLVTHISIKDKMIGQCLSRDS"
FT   CDS_pept        792370..792576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74198"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ34"
FT                   /protein_id="BAH74198.1"
FT                   /translation="MTKPVLAIRLHADQRERRFLLAAAAVLRRAGQNTQARELLRRGHG
FT                   VTCWRSLALLVAEYVDLDITIRG"
FT   CDS_pept        792581..792763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74199"
FT                   /db_xref="GOA:C4XJ35"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ35"
FT                   /protein_id="BAH74199.1"
FT                   /translation="MDLFTLGVIIAGIVIGAAVTVTILRAKRRRSPPVAGRFDSDGYKE
FT                   SELGKRGLIDRTKWH"
FT   CDS_pept        793735..793947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74200"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ36"
FT                   /protein_id="BAH74200.1"
FT                   /translation="MFEQLKKEKPWARLRMTRKQYEAKRPWAKSGLSREQWEAGLDYFP
FT                   DEAIDAIYREVEADILVEAIFGKVE"
FT   CDS_pept        793951..794124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74201"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ37"
FT                   /protein_id="BAH74201.1"
FT                   /translation="MEWIIAAALAGAVLAAAAIFVMKAKHRPGSVHGDFRFDRHKEGEL
FT                   SRRGLLDRTQWH"
FT   CDS_pept        794210..794428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74202"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ38"
FT                   /protein_id="BAH74202.1"
FT                   /translation="MTKPIFSIHIGQFASMYDLHLAAVVALRKAGLEDHARELRQRGMD
FT                   VPSWHDMLALIGEYLDVDLESCRRGRG"
FT   CDS_pept        794736..794948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74203"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ39"
FT                   /protein_id="BAH74203.1"
FT                   /translation="MAIEYLEWADKAFAFDRKAFKLFLMVGDKMEELSPKTFSSFTKVC
FT                   SSGDPITREEALEWAEEFAERRVAR"
FT   CDS_pept        complement(796083..796484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74204"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ40"
FT                   /protein_id="BAH74204.1"
FT                   /translation="MPTTILQANVIERALNEAARPFFSHTSRDIDPTKFKKSDVPHWEG
FT                   GAISWEELVEIEPDLRWMLQAIKLIRRPKAPASFCANRIWYCCFKPRLLQLVGHSCRRK
FT                   NSALRSSAAYDTAYQKLYNALPDCRNCGC"
FT   CDS_pept        complement(796844..799348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74205"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ41"
FT                   /protein_id="BAH74205.1"
FT                   /translation="MKKPPVAHTGGFKNGAGTTTRRKVNVPAPRHRVKEQNMLNCESSQ
FT                   DVTEIEITTASTCREWNWTRRMKMRPDQLGKVLTTSKVGTKDGDCFILGTLSGSKRTAA
FT                   NIEMMYCAGKDFDSGDRFADGVAAAERVGAQCWVYTTHSNKKTETEVNLEAWDKFLKSR
FT                   PGATVSEFLREHHGLRPWVVEGAEFIGDEIAAPDGRRTRIARHQPCEKFRLVWPLAKPW
FT                   RRSDYSTLAEAKASWKAIHAGLTQALGLEDDPTGWELARLFYPPRRPAEDSPFECRGLP
FT                   GPGLDVASLPVVEVKVETEVEPEFTPSGEASDYQRAEAQRILTLACARIAESAPGQQHS
FT                   TRLREARLVGGYLWALDPNEAVEALQSAVIESGAGDVDAAMRTVKDGLRYGQAKLLPIE
FT                   DELSPAERHAAAIEAFKEILEQIEAEGAKETGPDDSLVKLTKDRLRAGRFLDAAPPPLK
FT                   FIVDGVPENAVAILGGPEASLKTAFAVSLGLAVATGLPLTKGILEPMTQGPVLFIVAED
FT                   SEAVVHNKLHALFEAQRAATVGFDDDPALSGWPEYERRFREDVYVMTRADVGGPIHLGL
FT                   PEKNDVLKATPLFDQILRVSKSIEGLKLVVIDTRSRAWPGEENSNTLAAQVISQAERIC
FT                   DATGAAVVLIHHVSKAALPSPNRRSDNKDSWKAALDTAALRGGVALVNNSRGGIMMAKV
FT                   PAAVAKRLGHAGDQPLACLRVDKNSYGVEGWEVFMARTEGGGVRHFQPAKGGADPGAVE
FT                   QAINVVVDDIRQCQQEGRRFTSRELKRDRAAIYKEKLGKATQAVIQSALAEAIHRGLLV
FT                   EEAGVGGNGHKTKYLTAVEVTA"
FT   CDS_pept        complement(800497..800766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74206"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ42"
FT                   /protein_id="BAH74206.1"
FT                   /translation="MSSAITLDADQARKLRRKLDSAMYRVDAAQRAIMGLGALLKTALP
FT                   DPTGDGLRVLLDLLADDLDGAEHQLDLVFEGVGGQHTEEGYRLS"
FT   CDS_pept        complement(801228..801368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74207"
FT                   /db_xref="GOA:C4XJ43"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ43"
FT                   /protein_id="BAH74207.1"
FT                   /translation="MDQSDLLRVIYLVLLLAAIVAMRWWPGLNHRKFDWWLFKGEDKRD
FT                   K"
FT   CDS_pept        complement(801387..802622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07170"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74208"
FT                   /db_xref="GOA:C4XJ44"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ44"
FT                   /protein_id="BAH74208.1"
FT                   /translation="MAVTWIKTNFPGVRYYEHAARKHGVQRDRYFAIRFQTEGKRREEG
FT                   LGWASEGWTAAKAAQTLADLKKAATTGEGPATLAEKRELAEARRKAEQTAMERDARQGV
FT                   IFDAFWQDDYVIALRNRVKPESYQKEEAHFKFWLSPTLGKLPLREITEADLERVQDKIR
FT                   AAGLSDRSHEYIMGTFRRVWKHAFKRKIVAVECPVGKLDIPKPVNTRLRVLTPEEIQAL
FT                   LAELATVDQTAHDLTVFALLTGCRASEAFKLRWENVDFVREAALFPETKNREPREVFLA
FT                   ADVLDMLKRRGPGRPGEYVFTKRDGTPYDAAPSSFKTALERLGFNEGRALRDRATFHNL
FT                   RHSAATYAARRGVPVKDMQTIFGWKTPSMVFRYAKGSEDVQRRAMKGLASAFMEDKGGK
FT                   VVPFPAEKVSGE"
FT   CDS_pept        803032..803631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07180"
FT                   /product="haloacid dehalogenase-like hydrolase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74209"
FT                   /db_xref="GOA:C4XJ45"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ45"
FT                   /protein_id="BAH74209.1"
FT                   /translation="MLFDAFGTLCHIESPRLPYRSIMKRWEKGAVDCYQAIMTRDVSLA
FT                   EFAGEAGLSREETALLEAQVAKETDSVCLFPEVAQTLETLREHGVKIAVVSNLAQPYGA
FT                   SCLELLPFEPDVRAFSYEVGARKPEVPIYRYAWERLGCAPEELLMVGDSLQNDYQAPRD
FT                   LGLHALWLDRKAASLQGENGHVVNSLQGILGYLGIG"
FT   CDS_pept        803656..804678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74210"
FT                   /db_xref="GOA:C4XJ46"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ46"
FT                   /protein_id="BAH74210.1"
FT                   /translation="MATIRKRGAAQWEARIRKRGYPTTCKTFDTKVEAEAWAKDIETTM
FT                   NKSLFVSAKEAEQYTLSECLERYIEEYIPRLKHAKRETDRARFLQKRTLAHRIMATIRA
FT                   RDIADFRREREGEGGSGNTIRLDFALLSKLFNYARSDWGMESLQNPVELAAKPRPAKGR
FT                   DRRLEDGEEERLLAAASPRFRPVILFALETAMRREEIASLFWKNVNIRGRYVLLPETKN
FT                   SEARTVPLAEGALTVLRELSWITASVVRSAAVDDCRKLSLKASNCCRVRASNLCRSCSV
FT                   LARMRSAREAREASELPVLDIDSPFEAKLFAAGWVFDGDVVLARPVDFQVCLLKRRKEL
FT                   "
FT   CDS_pept        complement(804343..805299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74211"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ47"
FT                   /protein_id="BAH74211.1"
FT                   /translation="MYMKVFPHGQGTGDGPTRYLVLPDYPGRDNHPPEVLRGDPEQTRE
FT                   LIDSLDTKWKFTAGVLSWHPDEVVTPKQETRVMDDFEAVAFAGLEPDQRNILWVRHHHA
FT                   GHHELHFVIPRVELSSGKAFNPCPPGWQKHFDVFRDLHNHREGWARPDDPARARLRTPE
FT                   HADLHKARLLRWGTRPGKDERAEAKDAVHAFLLMKIEEGQVTNRSELLAALQEADLEIN
FT                   RAGKDYITVKDPASGEKLRLKGGIYVEHWQLTGLPGLPGRAHAGQDRAGPAEVRSPDPA
FT                   AIRRLERELAAVIDRRAAYNRSRYPGQLAQDSQRPFS"
FT   CDS_pept        complement(805865..807247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74212"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ48"
FT                   /protein_id="BAH74212.1"
FT                   /translation="MSSAIRGLPRAQLQIGATTDDPDDLALKEWPRFSFDACPGILGEF
FT                   VRLATRDSEADPAAVCITALVRFGAEVYGYAPNRGPHLYVGETIHPPRLFAVICGNSSK
FT                   ARKGTSRHPVTKLFERKHCLPIDLKTWGVPLPARESGGPLSTGEGLAHHVRDESDEERE
FT                   RRQRQNPAEPVREKGDKRLVIMDEELASAFACFKREGNTLSMGIRCFWDSGDYAPLTKN
FT                   NPILVRGAHISIIAHITMQELAVCLGEVQAVNGFGNRFLWICARRSKLVALPSRMPDAE
FT                   LAPLQRELWRRVGQAQQRGVMTMTANTLELWRHVYPELSQEHTGLAGSIINRAEAQTLR
FT                   LSLLYALLDAQGEIEEPHLQAALAMWRYAQDSALYIFGDRATDPLEDKILEALKTGPLT
FT                   ATELSSALSRHVPRDRLKPLLQQLEAQQRITITKVKNAGRPRIILALRELSEKSEQRRI
FT                   GA"
FT   CDS_pept        807910..808212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74213"
FT                   /db_xref="GOA:C4XJ49"
FT                   /db_xref="InterPro:IPR031451"
FT                   /db_xref="InterPro:IPR038493"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ49"
FT                   /protein_id="BAH74213.1"
FT                   /translation="MEKRKPTYDLGSFQDAARRGEVAVTRTAAQAAQRLGFDYDGMMVV
FT                   IESMNRRHFYKSMTAYADNAAWQDVYHVPTSAGILYVKFMAGRISAFDLLSFKEK"
FT   CDS_pept        808229..808636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07230"
FT                   /product="Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74214"
FT                   /db_xref="GOA:C4XJ50"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022452"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="InterPro:IPR032758"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ50"
FT                   /protein_id="BAH74214.1"
FT                   /translation="MCHEDGIEMVRDVRPVEFSYKGQTMTVAMPGWYCPKCGEGLYTRA
FT                   DMKVSDRALNAMKARCEGLLDGPQVKRIRKKLGLTQAAAGDLIGGGPKAFTKYEKGDAL
FT                   TSRAVTNLLKVLDAVPDALTILRENQGRPSC"
FT   CDS_pept        complement(808855..809088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74215"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ51"
FT                   /protein_id="BAH74215.1"
FT                   /translation="MSFIVMIGTALEQIIKATKKGLPTESAVPKIVVPEAGIEPARPEE
FT                   QGILSLKNRSILTVDYQEYSNNIRQMTAHDFS"
FT   CDS_pept        809145..809891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74216"
FT                   /db_xref="InterPro:IPR017031"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ52"
FT                   /protein_id="BAH74216.1"
FT                   /translation="MDIPRIFTITESAHRIHNPFTPDKFAVLGQALRLEPGTRILDLGS
FT                   GSGEMLCTWARDHGIRGVGVDMSSLFTEQARSRAVELGVADRVRFVHGDAAGYVADEKV
FT                   HVAACVGATWIGGGVAGTVELLARSLGEGGIILIGEPYWRQLPPTEDVAKGCLAGAVAD
FT                   FLALPELVASYGRLGCDVVEMVLADQDGWDRYEAAKWLTMHRWLQAHPDDELAGEVRAK
FT                   LTSEPVRYATYTREYLGWGVFALMLR"
FT   CDS_pept        810280..810537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74217"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ53"
FT                   /protein_id="BAH74217.1"
FT                   /translation="MRCLLFVLALSLVSATAFAADEAADTANRALFEKECAALIAPGGP
FT                   CADVQKGGGGRRGCVAKPENLDKASPACKKVIEEWKALPK"
FT   CDS_pept        complement(810786..812036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74218"
FT                   /db_xref="InterPro:IPR035235"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ54"
FT                   /protein_id="BAH74218.1"
FT                   /translation="MNNRLVCQHGKRSATLLASLFKPRRRVVPPGDAPMPTSVLPKPPL
FT                   TRAYTLKVSKIPDYFGVLLGNPIPEVFDTAFLAKSGFRYAIDRTFIDILAGLGFLTEAG
FT                   QPTRRYADFHGRRLSGTVLRQGLADAYAGLLAELPNAAVCPEREIMETVSRYFQGEIND
FT                   MAACGIAATFLALTRYAASLDNGAASADAAQQPAVTPDSASRPASSPPGANGPATASKP
FT                   AAAPHSGAAPAAAPELTAAPTSVAAGQPEATPKPEAASGSVAAGSPAVAVAPVAAPEPV
FT                   AQEQAASLQAAPAPKAGAHPEAFAPTTAEATSAPVAPAPEPVAPTASVAASLAAAPASA
FT                   VTKAPTPAKDMETAARPDAAPGIVIEAFPSEARGSSPAAPKHPTIHITLPASTDEAVYD
FT                   AIFASLKRHLLSPGENA"
FT   CDS_pept        812147..813733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74219"
FT                   /db_xref="GOA:C4XJ55"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ55"
FT                   /protein_id="BAH74219.1"
FT                   /translation="MRLPPESRERGCSYSSWRNIRKGEALSACPRRRWPVGHCFACQTQ
FT                   EASMTNGNAQEQTLGLFAADVAAQPGLTLVSTLFGHDTWLLDNAGQVVNSWTSDRVGAG
FT                   AAYLLDNGDLVRSAVAYRNAHVGIMNAPAGGLIEEFDWEGNLVWSYKYIGEDYSQHHDF
FT                   CVMPNGNLLLVAWEYKSPQEAYLAGRSPAFIPTKGLLVDYVVEVQKTGPNSGQVVWEWH
FT                   AWDHLVQDENPALPDYGQVSSHPERINLNSIGALVRETGKVDSDWTHINGIDYNAETDQ
FT                   IMLSVHTQSEVWIIDHGTTTAEAAGTTGGKAGHGGDLLYRFGNPQTYDAGAAADQTLYG
FT                   QHDALWIEDGLPGAGNVLVFNNGWQSPYGEYSHVQELVLPVDEDGTYRRNFDGSFAEPE
FT                   VVWSYPDGDVPGFYSAYVSGAQRLENGDTLVTLGATGNLLEITPAGQTVWNYVNPDTDQ
FT                   GLLRQGASAEAVGLGYANNVFRATRYAYDFEGFVGKSLVGGNLLVADPTPQASAVAGQT
FT                   GAGAALAFAAV"
FT   CDS_pept        813768..816137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74220"
FT                   /db_xref="GOA:C4XJ56"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ56"
FT                   /protein_id="BAH74220.1"
FT                   /translation="MIRARLTALLSCLILTASLAGPGRALAAPSAVGREGGRPILLVDG
FT                   KPATSGFVEIYYYPGRGNPMPGQPEYGDPRWVEAMKRAVDTALAQGVRLVMASVWWSDI
FT                   DRSPARPATLQAARYDFAPLDAVMDYAARRKAQVVLKTSANHFVPGWWLAEQGFPQGAG
FT                   YQEHSACRSCETDAYGTAYANPSMGSPEARRDFGAFIEALVGRYRTHPALVGWAFGLGP
FT                   TGEDGYGPNYIVVDAPGGGPGLGRRPMMFTDYSPDFTARFRSWLTARYGTDAGLRQAWG
FT                   DPKVSLTDFRVPPPAELVRDPALFSRRPFPDAANDRDGDPARWLTPKGMDFHAFRTWAR
FT                   DDETDYFGRLFKTLDKKHVLFLNARARASARAHPDIDGIFFNPNPRFGQPLFFENDQLD
FT                   LILRSVERIVAAGKLAWVAAENGHEPGRAPGAGESKEQINYLLAIGCGVKSLGGVMGYA
FT                   VDLLDPDTANAWLPTWRTAHALSAVKAIEAWKPAPGRGPCDTITELRRRNGCDAGASAP
FT                   AGCRLTELALINYCRTDLACDADRDGRVSEDEYAACRPGGQTPPPGAPGPAAGPAAGPA
FT                   GGPPPGTAGKCGDGVCDDFERARGVCPADCGASAPAGPAGATPPVSSGSPAGGPSPGAA
FT                   GKCGDGVCDDFERSRGVCPADCGASSSPTAPVGATPPVSSASPAGAPPPGAAGKCGDGV
FT                   CDDFERARGVCPQDCGPASGSSSSPAAPASSGIKPASPTLRVSSGSPGGSPGGPGGPPP
FT                   GAAGKCGDGVCDDFERSRGVCPADCSSASGASAGGS"
FT   CDS_pept        816341..817789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07300"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74221"
FT                   /db_xref="GOA:C4XJ57"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ57"
FT                   /protein_id="BAH74221.1"
FT                   /translation="MVLAASGLPWWSVLAGAGTLALFIACLASPFFGLCATAFCLILAS
FT                   PNIYTLVVNTLQLHLYPYVLPLVFTFLGMLVRAGQGRLSLRPRSAFLPVLLLVFVAEAA
FT                   SLLWTPHTAWGLANIARLTTNLLLYWTVMVLVDTPRRLDILFKTLFASAVMTAAGVLGA
FT                   LEWEYVLHVPLDRSLRLVFEIYFYTTRAGGIESWNQSAGFLSVASIIAAGYAVLARTRA
FT                   RRAGWGLGAMFFFCMMLLPASRGALLGFCGAAVLLILALPATRRLFLRKTTLFVVMVIV
FT                   GMLVTTPGYIDRMLVGFGYTGELLFSKKKSSSSSDSDATGISTRFKIWREGFKRVGESG
FT                   GTILGGLGTGGFMYRIKVFEVHNVYLAFYYDMGLAGIFLLFFLGFILIRRSFPIAMAYH
FT                   ARLARPPTAPDPAGPASADFVLVMFFAVLTAFTAEVAIHGLVDYDLTSFVSRYAFFYLA
FT                   LYDVVLGLAEAGPAVPLDAGAAKA"
FT   CDS_pept        817865..819088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07310"
FT                   /product="major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74222"
FT                   /db_xref="GOA:C4XJ58"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ58"
FT                   /protein_id="BAH74222.1"
FT                   /translation="MASEIFGNPSFTRFWTARSASGFAYHMTAVAVGWQVYAMTGSAFM
FT                   LGLVGLTEFLPQFLLTLVVGQVADRVDRRRIAGVCQLIEAVALLTLLAETAGGFLGLGG
FT                   MFACVGLIGAARAFETPSLQALLPSLVPLEALPRMLAWSGSVWKTAMILGPAAGGFLFA
FT                   LGPGVVYGLGAVFYVGAALAVLSIPAKPARRPPQAEGLWRSALDGLRYIKSRPVIFGAI
FT                   SLDLFSVLLGGAVGLLPVFASDILAVGPGGLGALRAAPSLGALAMSLCLTRFPLTRHAG
FT                   PAMFGAVIVFGLSTLVFGLSRSFPLSLAALTVLGAGDMVSVVIRSTLIQIDTPDSLRGR
FT                   VSAVNAVFIGASNQLGDFESGLLAALVGAVPAVIFGGVGAVALALMWMRLFPELRRRDR
FT                   LVPESVGA"
FT   CDS_pept        819186..820319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07320"
FT                   /product="putative cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74223"
FT                   /db_xref="GOA:C4XJ59"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ59"
FT                   /protein_id="BAH74223.1"
FT                   /translation="MNDNHPPNWRDEFAVTADTVFFNHAAISPLPRRACLAGDEIYAER
FT                   WRRASKDYMRWMGLVDEARDRAAWLLGTEPKRVAFTGNTSCGLSLVAAGLAWKPGDKVA
FT                   VAWPDFPSVRFPFDNLVRLGVELVELPKHDGILDMDAAAKLVPGCRLAVASTVDWLTGA
FT                   ALPTADFVRLCHEAGALCCLDAIQSLGAMPFDATALGVDFVAAGCHKWQFGPMGLGIFY
FT                   VSPEADAALATTLAGWRSVRDAEQLSEAFVLKDGAGRFEPGTQDIAAIAAYGEALSLLE
FT                   EVGMETVAKNIFGVTHSLAEGLAERDHKVVSPRTGGQHSGIVSFEHPDPAGLFAHLDAR
FT                   GVACSPRGGRIRLSPHFYNDATDVARFFTILDAFDQG"
FT   CDS_pept        complement(820394..820894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74224"
FT                   /db_xref="GOA:C4XJ60"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ60"
FT                   /protein_id="BAH74224.1"
FT                   /translation="MMDTLRALVRFFESVGQVAAVALLVAIVVGVAVFAWLGAVSRKMP
FT                   PLVSPTGGPLRADGQNPNWVSTTARKNDPLHYIAPRPCADNPLPALVEILRQQSGVTLV
FT                   DVAERYVHATAKSSRFGFVDDVELLYDPAAGLLQARSASRVGKSDLGVNRRRLEQLFKD
FT                   AGL"
FT   CDS_pept        complement(820891..822111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74225"
FT                   /db_xref="GOA:C4XJ61"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ61"
FT                   /protein_id="BAH74225.1"
FT                   /translation="MEQIVEALAALDAKTMILMAAVLYFSLTMVMFYTYFFRKTYPGFA
FT                   SLALGQLFWSLGVYLVFYRVLGDHLSLALSNGLLFLQAVCWHHGIAMYGGITPLRPRLL
FT                   TNVALAVLAELAILYYVYVDFNTCRRVVIFSAFSALLYSRIALEPYLVRRWKTYSMQGI
FT                   YSAIFLSVAVAFAVRAVQAVNATDCQVGGPDAIVKLLLLASMWIFAFLTFCVLSMTSSR
FT                   VEAELREARDALRQQAQTDALTGLSNRRHFLEQAQAVLEDLEAHGGRASLIMLDLDHFK
FT                   RINDVHGHQAGDLALQEAARHLRAALRDGDVIGRLGGEEFGVLLPGLEAGEALAVARQL
FT                   RRAVAASRPGGLRVTASFGLADGALRLDSLLAQADEYLYAAKEAGRDRIAWSGGLVADN
FT                   ESGEALA"
FT   CDS_pept        complement(822185..823009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="DMR_07350"
FT                   /product="shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74226"
FT                   /db_xref="GOA:C4XJ62"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ62"
FT                   /protein_id="BAH74226.1"
FT                   /translation="MQLFGIIGHPLGHTLSPLVHNWGFSRYGLDARYEAWPTPPEDLPA
FT                   FMERLRQTPIAGASVTIPHKTAVMAFVDEVTDLGQAAGAVNTLYWRDGRLVGDNTDVEG
FT                   FCRPLVMRGIAPRRALVLGAGGAARAAVLGLTRLDSGVVGVTARRFEQAQALAREFGVL
FT                   AVPWDERGAFGADFLTNATPMGMAGRFEGVSPYPAQALAPGVVAFDLVYNPYETRLAAD
FT                   AAAAGGTVVPGLEMFLYQALEQFRLWTGRLLPDDELRSLLLKTLYGQAVPRT"
FT   CDS_pept        complement(823237..823785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07360"
FT                   /product="ketoisovalerate oxidoreductase subunit VorA"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74227"
FT                   /db_xref="GOA:C4XJ63"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ63"
FT                   /protein_id="BAH74227.1"
FT                   /translation="MSLYQDVIIAGFGGQGVMLIGNLLAYAGMEHGLNVTYIPVYGPEM
FT                   RGGTANCTVVVSDDAIGSPIIRSPKSLIIMNRPSLDKFQPQLVDGGVLVVNSSLVDPAL
FT                   ADASRVRLVPVACNEIADGLGNTRMANMVALGAFIEATGVLPLSVVEESLSHVIAKHYS
FT                   HLIPKNAEALRAGAEAAKG"
FT   CDS_pept        complement(823788..824540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DMR_07370"
FT                   /product="ketoisovalerate oxidoreductase subunit VorA"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:DMR_07370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH74228"
FT                   /db_xref="GOA:C4XJ64"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4XJ64"
FT                   /protein_id="