(data stored in SCRATCH3701 zone)

EMBL: AP010935

ID   AP010935; SV 1; circular; genomic DNA; STD; PRO; 2106340 BP.
XX
AC   AP010935;
XX
PR   Project:PRJDA27849;
XX
DT   01-JUL-2009 (Rel. 101, Created)
DT   11-MAY-2017 (Rel. 132, Last updated, Version 6)
XX
DE   Streptococcus dysgalactiae subsp. equisimilis GGS_124 DNA, complete genome.
XX
KW   .
XX
OS   Streptococcus dysgalactiae subsp. equisimilis GGS_124
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
XX
RN   [1]
RP   1-2106340
RA   Akiyama T., Shimomura Y., Okumura K., Kirikae T.;
RT   ;
RL   Submitted (03-DEC-2008) to the INSDC.
RL   Contact:Tohru Miyoshi-Akiyama National Center for Global Health and
RL   Medicine, Department of Infectious Diseases; 1-21-1, Toyama, Shinjuku-ku,
RL   Tokyo 162-8655, Japan
XX
RN   [2]
RC   Publication Status: Online-Only
RX   DOI; 10.1186/1471-2164-12-17.
RX   PUBMED; 21223537.
RA   Shimomura Y., Okumura K., Yamagata Murayama S., Yagi J., Ubukata K.,
RA   Kirikae T., Miyoshi-Akiyama T.;
RT   "Complete genome sequencing and analysis of a Lancefield group G
RT   Streptococcus dysgalactiae subsp. equisimilis strain causing streptococcal
RT   toxic shock syndrome (STSS)";
RL   BMC Genomics 12:17-17(2011).
XX
DR   MD5; d83b47de8fd430b790e13752565c0eb6.
DR   BioSample; SAMD00060937.
DR   EnsemblGenomes-Gn; EBG00000622939.
DR   EnsemblGenomes-Gn; EBG00001090721.
DR   EnsemblGenomes-Gn; EBG00001090722.
DR   EnsemblGenomes-Gn; EBG00001090723.
DR   EnsemblGenomes-Gn; EBG00001090724.
DR   EnsemblGenomes-Gn; EBG00001090725.
DR   EnsemblGenomes-Gn; EBG00001090726.
DR   EnsemblGenomes-Gn; EBG00001090727.
DR   EnsemblGenomes-Gn; EBG00001090728.
DR   EnsemblGenomes-Gn; EBG00001090729.
DR   EnsemblGenomes-Gn; EBG00001090730.
DR   EnsemblGenomes-Gn; EBG00001090731.
DR   EnsemblGenomes-Gn; EBG00001090732.
DR   EnsemblGenomes-Gn; EBG00001090733.
DR   EnsemblGenomes-Gn; EBG00001090734.
DR   EnsemblGenomes-Gn; EBG00001090735.
DR   EnsemblGenomes-Gn; EBG00001090736.
DR   EnsemblGenomes-Gn; EBG00001090737.
DR   EnsemblGenomes-Gn; EBG00001090738.
DR   EnsemblGenomes-Gn; EBG00001090739.
DR   EnsemblGenomes-Gn; EBG00001090740.
DR   EnsemblGenomes-Gn; EBG00001090741.
DR   EnsemblGenomes-Gn; EBG00001090742.
DR   EnsemblGenomes-Gn; EBG00001090743.
DR   EnsemblGenomes-Gn; EBG00001090744.
DR   EnsemblGenomes-Gn; EBG00001090745.
DR   EnsemblGenomes-Gn; EBG00001090746.
DR   EnsemblGenomes-Gn; EBG00001090747.
DR   EnsemblGenomes-Gn; EBG00001090748.
DR   EnsemblGenomes-Gn; EBG00001090749.
DR   EnsemblGenomes-Gn; EBG00001090750.
DR   EnsemblGenomes-Gn; EBG00001090751.
DR   EnsemblGenomes-Gn; EBG00001090752.
DR   EnsemblGenomes-Gn; EBG00001090753.
DR   EnsemblGenomes-Gn; EBG00001090754.
DR   EnsemblGenomes-Gn; EBG00001090755.
DR   EnsemblGenomes-Gn; EBG00001090756.
DR   EnsemblGenomes-Gn; EBG00001090757.
DR   EnsemblGenomes-Gn; EBG00001090758.
DR   EnsemblGenomes-Gn; EBG00001090759.
DR   EnsemblGenomes-Gn; EBG00001090760.
DR   EnsemblGenomes-Gn; EBG00001090761.
DR   EnsemblGenomes-Gn; EBG00001090762.
DR   EnsemblGenomes-Gn; EBG00001090763.
DR   EnsemblGenomes-Gn; EBG00001090764.
DR   EnsemblGenomes-Gn; EBG00001090765.
DR   EnsemblGenomes-Gn; EBG00001090766.
DR   EnsemblGenomes-Gn; EBG00001090767.
DR   EnsemblGenomes-Gn; EBG00001090768.
DR   EnsemblGenomes-Gn; EBG00001090770.
DR   EnsemblGenomes-Gn; EBG00001090771.
DR   EnsemblGenomes-Gn; EBG00001090772.
DR   EnsemblGenomes-Gn; EBG00001090774.
DR   EnsemblGenomes-Gn; EBG00001090775.
DR   EnsemblGenomes-Gn; EBG00001090777.
DR   EnsemblGenomes-Gn; EBG00001090778.
DR   EnsemblGenomes-Gn; EBG00001090779.
DR   EnsemblGenomes-Gn; EBG00001090780.
DR   EnsemblGenomes-Gn; EBG00001090781.
DR   EnsemblGenomes-Gn; EBG00001090782.
DR   EnsemblGenomes-Gn; EBG00001090783.
DR   EnsemblGenomes-Gn; EBG00001090785.
DR   EnsemblGenomes-Gn; EBG00001090786.
DR   EnsemblGenomes-Gn; EBG00001090787.
DR   EnsemblGenomes-Gn; EBG00001090788.
DR   EnsemblGenomes-Gn; EBG00001090789.
DR   EnsemblGenomes-Gn; EBG00001090790.
DR   EnsemblGenomes-Gn; EBG00001090791.
DR   EnsemblGenomes-Gn; EBG00001090792.
DR   EnsemblGenomes-Gn; EBG00001090794.
DR   EnsemblGenomes-Gn; EBG00001090795.
DR   EnsemblGenomes-Gn; EBG00001090796.
DR   EnsemblGenomes-Gn; EBG00001090797.
DR   EnsemblGenomes-Gn; EBG00001090799.
DR   EnsemblGenomes-Gn; EBG00001090801.
DR   EnsemblGenomes-Gn; EBG00001090802.
DR   EnsemblGenomes-Gn; EBG00001090803.
DR   EnsemblGenomes-Gn; EBG00001090804.
DR   EnsemblGenomes-Gn; EBG00001090805.
DR   EnsemblGenomes-Gn; EBG00001090806.
DR   EnsemblGenomes-Gn; EBG00001090807.
DR   EnsemblGenomes-Gn; EBG00001090808.
DR   EnsemblGenomes-Gn; EBG00001090809.
DR   EnsemblGenomes-Gn; EBG00001090810.
DR   EnsemblGenomes-Gn; EBG00001090811.
DR   EnsemblGenomes-Gn; EBG00001090812.
DR   EnsemblGenomes-Gn; EBG00001090813.
DR   EnsemblGenomes-Gn; EBG00001090814.
DR   EnsemblGenomes-Gn; EBG00001090815.
DR   EnsemblGenomes-Gn; EBG00001090816.
DR   EnsemblGenomes-Gn; EBG00001090817.
DR   EnsemblGenomes-Gn; EBG00001090818.
DR   EnsemblGenomes-Gn; EBG00001090819.
DR   EnsemblGenomes-Gn; EBG00001090820.
DR   EnsemblGenomes-Gn; EBG00001090821.
DR   EnsemblGenomes-Gn; EBG00001090822.
DR   EnsemblGenomes-Gn; EBG00001090823.
DR   EnsemblGenomes-Gn; EBG00001090825.
DR   EnsemblGenomes-Gn; EBG00001090826.
DR   EnsemblGenomes-Gn; EBG00001090827.
DR   EnsemblGenomes-Gn; EBG00001090828.
DR   EnsemblGenomes-Gn; EBG00001090829.
DR   EnsemblGenomes-Gn; EBG00001090832.
DR   EnsemblGenomes-Gn; EBG00001090833.
DR   EnsemblGenomes-Gn; EBG00001090835.
DR   EnsemblGenomes-Gn; EBG00001090836.
DR   EnsemblGenomes-Gn; EBG00001090837.
DR   EnsemblGenomes-Gn; EBG00001090838.
DR   EnsemblGenomes-Gn; EBG00001090839.
DR   EnsemblGenomes-Gn; EBG00001090841.
DR   EnsemblGenomes-Gn; EBG00001090842.
DR   EnsemblGenomes-Gn; EBG00001090843.
DR   EnsemblGenomes-Gn; SDEG_0017.
DR   EnsemblGenomes-Gn; SDEG_0018.
DR   EnsemblGenomes-Gn; SDEG_0019.
DR   EnsemblGenomes-Gn; SDEG_0020.
DR   EnsemblGenomes-Gn; SDEG_0021.
DR   EnsemblGenomes-Gn; SDEG_0022.
DR   EnsemblGenomes-Gn; SDEG_0023.
DR   EnsemblGenomes-Gn; SDEG_0024.
DR   EnsemblGenomes-Gn; SDEG_0025.
DR   EnsemblGenomes-Gn; SDEG_0026.
DR   EnsemblGenomes-Gn; SDEG_0027.
DR   EnsemblGenomes-Gn; SDEG_0028.
DR   EnsemblGenomes-Gn; SDEG_0029.
DR   EnsemblGenomes-Gn; SDEG_0030.
DR   EnsemblGenomes-Gn; SDEG_0031.
DR   EnsemblGenomes-Gn; SDEG_0032.
DR   EnsemblGenomes-Gn; SDEG_0033.
DR   EnsemblGenomes-Gn; SDEG_0034.
DR   EnsemblGenomes-Gn; SDEG_0035.
DR   EnsemblGenomes-Gn; SDEG_0036.
DR   EnsemblGenomes-Gn; SDEG_0037.
DR   EnsemblGenomes-Gn; SDEG_0101.
DR   EnsemblGenomes-Gn; SDEG_0102.
DR   EnsemblGenomes-Gn; SDEG_0103.
DR   EnsemblGenomes-Gn; SDEG_0104.
DR   EnsemblGenomes-Gn; SDEG_0105.
DR   EnsemblGenomes-Gn; SDEG_0106.
DR   EnsemblGenomes-Gn; SDEG_0107.
DR   EnsemblGenomes-Gn; SDEG_0108.
DR   EnsemblGenomes-Gn; SDEG_0109.
DR   EnsemblGenomes-Gn; SDEG_0110.
DR   EnsemblGenomes-Gn; SDEG_0111.
DR   EnsemblGenomes-Gn; SDEG_0112.
DR   EnsemblGenomes-Gn; SDEG_0113.
DR   EnsemblGenomes-Gn; SDEG_0114.
DR   EnsemblGenomes-Gn; SDEG_0115.
DR   EnsemblGenomes-Gn; SDEG_0116.
DR   EnsemblGenomes-Gn; SDEG_0213.
DR   EnsemblGenomes-Gn; SDEG_0312.
DR   EnsemblGenomes-Gn; SDEG_0313.
DR   EnsemblGenomes-Gn; SDEG_0314.
DR   EnsemblGenomes-Gn; SDEG_0315.
DR   EnsemblGenomes-Gn; SDEG_0316.
DR   EnsemblGenomes-Gn; SDEG_0317.
DR   EnsemblGenomes-Gn; SDEG_0335.
DR   EnsemblGenomes-Gn; SDEG_0361.
DR   EnsemblGenomes-Gn; SDEG_0362.
DR   EnsemblGenomes-Gn; SDEG_0363.
DR   EnsemblGenomes-Gn; SDEG_0364.
DR   EnsemblGenomes-Gn; SDEG_0365.
DR   EnsemblGenomes-Gn; SDEG_0366.
DR   EnsemblGenomes-Gn; SDEG_0697.
DR   EnsemblGenomes-Gn; SDEG_0795.
DR   EnsemblGenomes-Gn; SDEG_0830.
DR   EnsemblGenomes-Gn; SDEG_1164.
DR   EnsemblGenomes-Gn; SDEG_1167.
DR   EnsemblGenomes-Gn; SDEG_1168.
DR   EnsemblGenomes-Gn; SDEG_1570.
DR   EnsemblGenomes-Gn; SDEG_1669.
DR   EnsemblGenomes-Gn; SDEG_1670.
DR   EnsemblGenomes-Gn; SDEG_1671.
DR   EnsemblGenomes-Gn; SDEG_1672.
DR   EnsemblGenomes-Gn; SDEG_1673.
DR   EnsemblGenomes-Gn; SDEG_1674.
DR   EnsemblGenomes-Gn; SDEG_1675.
DR   EnsemblGenomes-Gn; SDEG_1676.
DR   EnsemblGenomes-Gn; SDEG_1677.
DR   EnsemblGenomes-Gn; SDEG_1678.
DR   EnsemblGenomes-Gn; SDEG_1679.
DR   EnsemblGenomes-Gn; SDEG_1794.
DR   EnsemblGenomes-Gn; SDEG_2052.
DR   EnsemblGenomes-Gn; SDEG_2072.
DR   EnsemblGenomes-Gn; SDEG_2172.
DR   EnsemblGenomes-Gn; SDEG_2173.
DR   EnsemblGenomes-Gn; SDEG_2175.
DR   EnsemblGenomes-Tr; EBG00000622939-1.
DR   EnsemblGenomes-Tr; EBT00001545227.
DR   EnsemblGenomes-Tr; EBT00001545228.
DR   EnsemblGenomes-Tr; EBT00001545229.
DR   EnsemblGenomes-Tr; EBT00001545230.
DR   EnsemblGenomes-Tr; EBT00001545231.
DR   EnsemblGenomes-Tr; EBT00001545232.
DR   EnsemblGenomes-Tr; EBT00001545233.
DR   EnsemblGenomes-Tr; EBT00001545234.
DR   EnsemblGenomes-Tr; EBT00001545235.
DR   EnsemblGenomes-Tr; EBT00001545236.
DR   EnsemblGenomes-Tr; EBT00001545237.
DR   EnsemblGenomes-Tr; EBT00001545238.
DR   EnsemblGenomes-Tr; EBT00001545239.
DR   EnsemblGenomes-Tr; EBT00001545240.
DR   EnsemblGenomes-Tr; EBT00001545241.
DR   EnsemblGenomes-Tr; EBT00001545242.
DR   EnsemblGenomes-Tr; EBT00001545243.
DR   EnsemblGenomes-Tr; EBT00001545244.
DR   EnsemblGenomes-Tr; EBT00001545245.
DR   EnsemblGenomes-Tr; EBT00001545246.
DR   EnsemblGenomes-Tr; EBT00001545247.
DR   EnsemblGenomes-Tr; EBT00001545248.
DR   EnsemblGenomes-Tr; EBT00001545249.
DR   EnsemblGenomes-Tr; EBT00001545250.
DR   EnsemblGenomes-Tr; EBT00001545251.
DR   EnsemblGenomes-Tr; EBT00001545252.
DR   EnsemblGenomes-Tr; EBT00001545253.
DR   EnsemblGenomes-Tr; EBT00001545254.
DR   EnsemblGenomes-Tr; EBT00001545255.
DR   EnsemblGenomes-Tr; EBT00001545256.
DR   EnsemblGenomes-Tr; EBT00001545257.
DR   EnsemblGenomes-Tr; EBT00001545258.
DR   EnsemblGenomes-Tr; EBT00001545259.
DR   EnsemblGenomes-Tr; EBT00001545260.
DR   EnsemblGenomes-Tr; EBT00001545261.
DR   EnsemblGenomes-Tr; EBT00001545262.
DR   EnsemblGenomes-Tr; EBT00001545263.
DR   EnsemblGenomes-Tr; EBT00001545264.
DR   EnsemblGenomes-Tr; EBT00001545265.
DR   EnsemblGenomes-Tr; EBT00001545266.
DR   EnsemblGenomes-Tr; EBT00001545267.
DR   EnsemblGenomes-Tr; EBT00001545268.
DR   EnsemblGenomes-Tr; EBT00001545269.
DR   EnsemblGenomes-Tr; EBT00001545270.
DR   EnsemblGenomes-Tr; EBT00001545271.
DR   EnsemblGenomes-Tr; EBT00001545272.
DR   EnsemblGenomes-Tr; EBT00001545273.
DR   EnsemblGenomes-Tr; EBT00001545274.
DR   EnsemblGenomes-Tr; EBT00001545275.
DR   EnsemblGenomes-Tr; EBT00001545276.
DR   EnsemblGenomes-Tr; EBT00001545277.
DR   EnsemblGenomes-Tr; EBT00001545278.
DR   EnsemblGenomes-Tr; EBT00001545279.
DR   EnsemblGenomes-Tr; EBT00001545280.
DR   EnsemblGenomes-Tr; EBT00001545281.
DR   EnsemblGenomes-Tr; EBT00001545282.
DR   EnsemblGenomes-Tr; EBT00001545283.
DR   EnsemblGenomes-Tr; EBT00001545284.
DR   EnsemblGenomes-Tr; EBT00001545285.
DR   EnsemblGenomes-Tr; EBT00001545286.
DR   EnsemblGenomes-Tr; EBT00001545287.
DR   EnsemblGenomes-Tr; EBT00001545288.
DR   EnsemblGenomes-Tr; EBT00001545289.
DR   EnsemblGenomes-Tr; EBT00001545290.
DR   EnsemblGenomes-Tr; EBT00001545291.
DR   EnsemblGenomes-Tr; EBT00001545292.
DR   EnsemblGenomes-Tr; EBT00001545293.
DR   EnsemblGenomes-Tr; EBT00001545294.
DR   EnsemblGenomes-Tr; EBT00001545295.
DR   EnsemblGenomes-Tr; EBT00001545296.
DR   EnsemblGenomes-Tr; EBT00001545297.
DR   EnsemblGenomes-Tr; EBT00001545298.
DR   EnsemblGenomes-Tr; EBT00001545299.
DR   EnsemblGenomes-Tr; EBT00001545300.
DR   EnsemblGenomes-Tr; EBT00001545301.
DR   EnsemblGenomes-Tr; EBT00001545302.
DR   EnsemblGenomes-Tr; EBT00001545303.
DR   EnsemblGenomes-Tr; EBT00001545304.
DR   EnsemblGenomes-Tr; EBT00001545305.
DR   EnsemblGenomes-Tr; EBT00001545306.
DR   EnsemblGenomes-Tr; EBT00001545307.
DR   EnsemblGenomes-Tr; EBT00001545308.
DR   EnsemblGenomes-Tr; EBT00001545309.
DR   EnsemblGenomes-Tr; EBT00001545310.
DR   EnsemblGenomes-Tr; EBT00001545311.
DR   EnsemblGenomes-Tr; EBT00001545312.
DR   EnsemblGenomes-Tr; EBT00001545313.
DR   EnsemblGenomes-Tr; EBT00001545314.
DR   EnsemblGenomes-Tr; EBT00001545315.
DR   EnsemblGenomes-Tr; EBT00001545316.
DR   EnsemblGenomes-Tr; EBT00001545317.
DR   EnsemblGenomes-Tr; EBT00001545318.
DR   EnsemblGenomes-Tr; EBT00001545319.
DR   EnsemblGenomes-Tr; EBT00001545320.
DR   EnsemblGenomes-Tr; EBT00001545321.
DR   EnsemblGenomes-Tr; EBT00001545322.
DR   EnsemblGenomes-Tr; EBT00001545323.
DR   EnsemblGenomes-Tr; EBT00001545324.
DR   EnsemblGenomes-Tr; EBT00001545325.
DR   EnsemblGenomes-Tr; EBT00001545326.
DR   EnsemblGenomes-Tr; EBT00001545327.
DR   EnsemblGenomes-Tr; EBT00001545328.
DR   EnsemblGenomes-Tr; EBT00001545329.
DR   EnsemblGenomes-Tr; EBT00001545330.
DR   EnsemblGenomes-Tr; EBT00001545331.
DR   EnsemblGenomes-Tr; EBT00001545332.
DR   EnsemblGenomes-Tr; EBT00001545333.
DR   EnsemblGenomes-Tr; EBT00001545334.
DR   EnsemblGenomes-Tr; EBT00001545335.
DR   EnsemblGenomes-Tr; EBT00001545336.
DR   EnsemblGenomes-Tr; EBT00001545337.
DR   EnsemblGenomes-Tr; SDEG_0017-1.
DR   EnsemblGenomes-Tr; SDEG_0018-1.
DR   EnsemblGenomes-Tr; SDEG_0019-1.
DR   EnsemblGenomes-Tr; SDEG_0020-1.
DR   EnsemblGenomes-Tr; SDEG_0021-1.
DR   EnsemblGenomes-Tr; SDEG_0022-1.
DR   EnsemblGenomes-Tr; SDEG_0023-1.
DR   EnsemblGenomes-Tr; SDEG_0024-1.
DR   EnsemblGenomes-Tr; SDEG_0025-1.
DR   EnsemblGenomes-Tr; SDEG_0026-1.
DR   EnsemblGenomes-Tr; SDEG_0027-1.
DR   EnsemblGenomes-Tr; SDEG_0028-1.
DR   EnsemblGenomes-Tr; SDEG_0029-1.
DR   EnsemblGenomes-Tr; SDEG_0030-1.
DR   EnsemblGenomes-Tr; SDEG_0031-1.
DR   EnsemblGenomes-Tr; SDEG_0032-1.
DR   EnsemblGenomes-Tr; SDEG_0033-1.
DR   EnsemblGenomes-Tr; SDEG_0034-1.
DR   EnsemblGenomes-Tr; SDEG_0035-1.
DR   EnsemblGenomes-Tr; SDEG_0036-1.
DR   EnsemblGenomes-Tr; SDEG_0037-1.
DR   EnsemblGenomes-Tr; SDEG_0101-1.
DR   EnsemblGenomes-Tr; SDEG_0102-1.
DR   EnsemblGenomes-Tr; SDEG_0103-1.
DR   EnsemblGenomes-Tr; SDEG_0104-1.
DR   EnsemblGenomes-Tr; SDEG_0105-1.
DR   EnsemblGenomes-Tr; SDEG_0106-1.
DR   EnsemblGenomes-Tr; SDEG_0107-1.
DR   EnsemblGenomes-Tr; SDEG_0108-1.
DR   EnsemblGenomes-Tr; SDEG_0109-1.
DR   EnsemblGenomes-Tr; SDEG_0110-1.
DR   EnsemblGenomes-Tr; SDEG_0111-1.
DR   EnsemblGenomes-Tr; SDEG_0112-1.
DR   EnsemblGenomes-Tr; SDEG_0113-1.
DR   EnsemblGenomes-Tr; SDEG_0114-1.
DR   EnsemblGenomes-Tr; SDEG_0115-1.
DR   EnsemblGenomes-Tr; SDEG_0116-1.
DR   EnsemblGenomes-Tr; SDEG_0213-1.
DR   EnsemblGenomes-Tr; SDEG_0312-1.
DR   EnsemblGenomes-Tr; SDEG_0313-1.
DR   EnsemblGenomes-Tr; SDEG_0314-1.
DR   EnsemblGenomes-Tr; SDEG_0315-1.
DR   EnsemblGenomes-Tr; SDEG_0316-1.
DR   EnsemblGenomes-Tr; SDEG_0317-1.
DR   EnsemblGenomes-Tr; SDEG_0335-1.
DR   EnsemblGenomes-Tr; SDEG_0361-1.
DR   EnsemblGenomes-Tr; SDEG_0362-1.
DR   EnsemblGenomes-Tr; SDEG_0363-1.
DR   EnsemblGenomes-Tr; SDEG_0364-1.
DR   EnsemblGenomes-Tr; SDEG_0365-1.
DR   EnsemblGenomes-Tr; SDEG_0366-1.
DR   EnsemblGenomes-Tr; SDEG_0697-1.
DR   EnsemblGenomes-Tr; SDEG_0795.
DR   EnsemblGenomes-Tr; SDEG_0830.
DR   EnsemblGenomes-Tr; SDEG_1164-1.
DR   EnsemblGenomes-Tr; SDEG_1167-1.
DR   EnsemblGenomes-Tr; SDEG_1168-1.
DR   EnsemblGenomes-Tr; SDEG_1570-1.
DR   EnsemblGenomes-Tr; SDEG_1669-1.
DR   EnsemblGenomes-Tr; SDEG_1670-1.
DR   EnsemblGenomes-Tr; SDEG_1671-1.
DR   EnsemblGenomes-Tr; SDEG_1672-1.
DR   EnsemblGenomes-Tr; SDEG_1673-1.
DR   EnsemblGenomes-Tr; SDEG_1674-1.
DR   EnsemblGenomes-Tr; SDEG_1675-1.
DR   EnsemblGenomes-Tr; SDEG_1676-1.
DR   EnsemblGenomes-Tr; SDEG_1677-1.
DR   EnsemblGenomes-Tr; SDEG_1678-1.
DR   EnsemblGenomes-Tr; SDEG_1679-1.
DR   EnsemblGenomes-Tr; SDEG_1794-1.
DR   EnsemblGenomes-Tr; SDEG_2052-1.
DR   EnsemblGenomes-Tr; SDEG_2072.
DR   EnsemblGenomes-Tr; SDEG_2172-1.
DR   EnsemblGenomes-Tr; SDEG_2173-1.
DR   EnsemblGenomes-Tr; SDEG_2175-1.
DR   EuropePMC; PMC2863612; 20145082.
DR   EuropePMC; PMC2909212; 20668530.
DR   EuropePMC; PMC3027156; 21223537.
DR   EuropePMC; PMC3056289; 21282711.
DR   EuropePMC; PMC3091779; 21106082.
DR   EuropePMC; PMC3173452; 21824414.
DR   EuropePMC; PMC3538662; 22900646.
DR   EuropePMC; PMC3566888; 23400422.
DR   EuropePMC; PMC3571330; 23292771.
DR   EuropePMC; PMC3640971; 23521820.
DR   EuropePMC; PMC4249290; 25287924.
DR   EuropePMC; PMC4740735; 26843282.
DR   EuropePMC; PMC4988185; 27316956.
DR   EuropePMC; PMC5548910; 28790435.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01335; CRISPR-DR22.
DR   RFAM; RF01492; rli28.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01776; RatA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP010935.
DR   SILVA-SSU; AP010935.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2106340
FT                   /organism="Streptococcus dysgalactiae subsp. equisimilis
FT                   GGS_124"
FT                   /chromosome="1"
FT                   /sub_species="equisimilis"
FT                   /strain="GGS_124"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:486410"
FT   CDS_pept        225..1580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SDEG_0001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="similar to chromosomal replication initiator protein
FT                   dnaA [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80556"
FT                   /db_xref="GOA:C5WDU1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU1"
FT                   /inference="similar to AA sequence:RefSeq:YP_601495.1"
FT                   /protein_id="BAH80556.1"
FT                   /translation="MTENEQIFWNRVLELAQSQLKQATYEFFVHDARLLKVENHVATIY
FT                   LDQMKELFWEKNLKDVILTAGFEVYNAQIAVDYVFEEDLIIDQNQIPNSQSYNQQVITP
FT                   LPAVTSDLNPKYSFENFIQGDENRWAVAASIAVANTPGTTYNPLFIWGGPGLGKTHLLN
FT                   AIGNSVLLENPNARIKYITAENFINEFVIHIRLDTMDELKEKFRNLDLLLIDDIQSLAK
FT                   KTLSGTQEEFFNTFNALHNNNKQIVLTSDRTPDHLNDLEDRLVTRFKWGLTVNITPPDF
FT                   ETRVAILTNKIQEYNFIFPQDTIEYLAGQFDSNVRDLEGALKDISLVANFKQIDTITVD
FT                   VAAEAIRARKQDGPKMTVIPIEEIQTQVGKFYDVTVKEIKATKRTQDIVLARQVAMFLA
FT                   REMTDNSLPKIGKEFGGRDHSTVLHAYNKIKNMISQDESLRIEIETIKNKIK"
FT   CDS_pept        1734..2870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SDEG_0002"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80557"
FT                   /db_xref="GOA:C5WDU2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU2"
FT                   /inference="similar to AA sequence:RefSeq:YP_601496.1"
FT                   /protein_id="BAH80557.1"
FT                   /translation="MIQFSINRTLFIQALNATKRGISSKNAIPVLSTIKINVSSSDITL
FT                   TGSNGQISIENTIPVSNENAGLLITSPGSILLEANFFINIISSLPDVSLDFKEIEQHQV
FT                   VLTSGKSEITLKGKDVDQYPRLQEVSTENPLILKTKLLKSIIAETAFAASLQESRPILT
FT                   GVHIVLSNHKDFKAVATDSHRMSQRLITLDNTSADFDVVIPSKSLREFSAVFTDDIETV
FT                   EVFFSPSQILFRSEHISFYTRLLEGNYPDTDRLLMTQFETEVVFNTQSLRHAMERAFLI
FT                   SNATQNGTVKLEIAQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKA
FT                   IKSETVKIHFLSPVRPFTLTPGDDEESFIQLITPVRTN"
FT   CDS_pept        2944..3141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0003"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80558"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059321.1"
FT                   /protein_id="BAH80558.1"
FT                   /translation="MYQIGSLVEMKKPHACVIKETGKKSNQWKVLRVGADIKIQCTNCQ
FT                   HIIMMSRYDFDRKLKKVLQL"
FT   CDS_pept        3398..3640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0004"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs0005
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80559"
FT                   /db_xref="GOA:C5WDU4"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU4"
FT                   /inference="similar to AA sequence:RefSeq:NP_734475.1"
FT                   /protein_id="BAH80559.1"
FT                   /translation="MDNLVRLTEIFDVSLDELVLAKPHEVKVERIYENKPLDLQKYNKL
FT                   YWFIFRNIILSLLIILAILTILEVLGIPFVSNWLI"
FT   CDS_pept        3764..4879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0005"
FT                   /product="GTP-binding protein"
FT                   /note="similar to GTP-binding protein [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80560"
FT                   /db_xref="GOA:C5WDU5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU5"
FT                   /inference="similar to AA sequence:RefSeq:YP_279474.1"
FT                   /protein_id="BAH80560.1"
FT                   /translation="MALTAGIVGLPNVGKSTLFNAITKAGAEAANYPFATIDPNVGMVE
FT                   VPDERLQKLTELITPKKTVPTTFEFTDIAGIVKGASKGEGLGNKFLANIREVDAIVHVV
FT                   RAFDDENVMREQGREDAFVDPMADIDTINLELILADLESINKRYARVEKMARTQKDKDS
FT                   VAEFAVLEKIKPVLEDGKSARTIEFTEEEQRVVKQLFLLTTKPVLYVANVDEDKVADPD
FT                   DIDYVKQIREFAATENAEVVVISARAEEEISELEDEDKAEFLEAIGLTESGVDKLTRAA
FT                   YHLLGLGTYFTAGEKEVRAWTFKRGIKAPQAAGIIHSDFERGFIRAVTMSYDDLMTYGS
FT                   EKAVKEAGRLREEGKEYIVQDGDIMEFRFNV"
FT   CDS_pept        4950..5519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="SDEG_0006"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="similar to peptidyl-tRNA hydrolase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80561"
FT                   /db_xref="GOA:C5WDU6"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU6"
FT                   /inference="similar to AA sequence:RefSeq:NP_268428.1"
FT                   /protein_id="BAH80561.1"
FT                   /translation="MVKMIVGLGNPGSKYEKTKHNIGFMAVDKLVNKLDVTFTEDKNFK
FT                   AQIGSAFINHEKIYFVKPTTFMNNSGVAVKALLTYYNIAIEDLIVIYDDLDMEVGKLRL
FT                   RAKGSAGGHNGIKSIIAHLGTQEFDRIKVGIGRPLKGMTVINHVMGHFSTEDNIAIALT
FT                   LDKVVNAVNFYLQENNFEKTMQKFNG"
FT   CDS_pept        5522..9022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trcF"
FT                   /locus_tag="SDEG_0007"
FT                   /product="putative transcription-repair coupling factor"
FT                   /note="similar to putative transcription-repair coupling
FT                   factor [Streptococcus pyogenes SSI-1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80562"
FT                   /db_xref="GOA:C5WDU7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU7"
FT                   /inference="similar to AA sequence:RefSeq:NP_801268.1"
FT                   /protein_id="BAH80562.1"
FT                   /translation="MNILELFSQNKKIQAWHSGLASLDRQLVMGLSGSSKALAMASAFL
FT                   DSQEKIVVMTSTQNEVEKLASDLSSLLGEELVYQFFADDVAAAEFIFASMDKALSRIET
FT                   LQFLRNPKSQGVLIVSLSGLRTLLPNPDVFTKSQIQLTVGEDYDSDTLTKQLMTIGYQK
FT                   VSQVISPGEFSRRGDILDIYEITQELPYRLEFFGDDIDSIRQFHPETQKSFEQLEGIFI
FT                   NPASDLIFEASDFQRGIEQLEKALQTAQDDKKSYLEDVLAVSKNGFKHKDIRKFQSLFY
FT                   EKEWSLLDYIPKGTPIFFDDFQKLVDKNARFDLEIANLLTEDLQQGKALSNLNYFADNY
FT                   RELRHYKPATFFSNFHKGLGNIKFDQMHQLTQYAMQEFFNQFPLLIDEIKRYQKNQTTV
FT                   IVQVESQYAYERLEKSFQDYQFRLPLVSANQIVSRESQIVIGAISSGFYFADEKLALIT
FT                   EHEIYHKKIKRRARRSNISNAERLKDYNELAVGDYVVHNVHGIGRFLGIETIQIQGIHR
FT                   DYVTIQYQNSDRISLPIDQISSLSKYVSADGKEPKINKLNDGRFQKTKQKVARQVEDIA
FT                   DDLLKLYAERSQQKGFSFSPDDDLQRAFDDDFAFVETEDQLRSIKEIKADMESMQPMDR
FT                   LLVGDVGFGKTEVAMRAAFKAVNDHKQVAVLVPTTVLAQQHYENFKARFENYPVEVDVL
FT                   SRFRSKKEQAETLERVRKGQIDIIIGTHRLLSKDVVFSDLGLIVIDEEQRFGVKHKETL
FT                   KELKTKVDVLTLTATPIPRTLHMSMLGIRDLSVIETPPTNRYPVQTYVLENNPGLVREA
FT                   IIREMDRGGQVFYVYNKVDTIDKKVAELQELVPEASIGFVHGQMSEIQLENTLIDFING
FT                   DYDVLVATTIIETGVDISNVNTLFIENADHMGLSTLYQLRGRVGRSNRIAYAYLMYRPD
FT                   KVLTEVSEKRLEAIKGFTELGSGFKIAMRDLSIRGAGNILGASQSGFIDSVGFEMYSQL
FT                   LEQAIASKQGKTTVRQKGNTEINLQIDAYLPDDYISDERQKIDIYKRIREIQSREDYLN
FT                   LQDELIDRFGEYPDQVAYLLEIALLKHYMDNAFAELVERKNNQVIVRFEVTSLTYFLTQ
FT                   DYFEALSKTHLKAKISEHQGKIDIVFDVRYQKDYTILEELMLFGESLSEIKFRKTASTS
FT                   "
FT   CDS_pept        8970..10490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0008"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /note="similar to polysaccharide biosynthesis family
FT                   protein [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80563"
FT                   /db_xref="GOA:C5WDU8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU8"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122408.1"
FT                   /protein_id="BAH80563.1"
FT                   /translation="MEKALVRLNSEKQPQPLKQASLLIVVSGLVSKILAATYRIPYQNL
FT                   VGDRGFYAYQQIYPFLAIISALSLSALPNLIASMAQKKDEDQLTVFMTLQFMMSFGCFL
FT                   ILFLGHQQLAEWMGAPKLGTAISLTSIALLMTPFISFYRGLAQADLNMTPTAISQMLEQ
FT                   IIRVIIIVASAVCYLVFDWTIYTTANVAASGNVIASFTVLGYLAKKSSFSIKPYVRKFS
FT                   LPLRAYRQLGLSSLVFILFSIYLLLFQLVDALFIKNSLVSAGYSNQLAEITKGIFDRGQ
FT                   PLVQFGLIFSTAFFTSYLPKLTHLHQQKQQMYDQLSQDFLAFIFYFNVTLTAGFISILH
FT                   LMNRVLFEDNKGWEALVYYIITINLISLIQFFYQKCFIENRVRHSLMMLLIGLSCKLGL
FT                   TPVLTYHYGILGSSLSTVIPLGLVFICYAYTIPMSWNCAKNGKFWLTLTLMIGFVLTCQ
FT                   VMLPIEGRLSGFISIVLSSAVGVISFIMICWRYKVFDEKIWSFLPFKK"
FT   CDS_pept        10525..10797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0009"
FT                   /product="S4 domain protein"
FT                   /note="similar to S4 domain protein [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80564"
FT                   /db_xref="GOA:C5WDU9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDU9"
FT                   /inference="similar to AA sequence:RefSeq:NP_687046.1"
FT                   /protein_id="BAH80564.1"
FT                   /translation="MRLDKFLKVSRIIKRRPVAKEVADKGRIKVNGVLAKSSTDLKLND
FT                   HIEIRFGNKLLTVRVLEMKDSTKKEDALSMYEIISETRIEANEEA"
FT   CDS_pept        10784..11155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="SDEG_0010"
FT                   /product="putative cell division protein"
FT                   /note="similar to putative cell division protein
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80565"
FT                   /db_xref="GOA:C5WDV0"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV0"
FT                   /inference="similar to AA sequence:RefSeq:NP_606344.1"
FT                   /protein_id="BAH80565.1"
FT                   /translation="MKKPSIVQLNNHYINEENLKKRFEEEEIQKRNRFMGWILVSMMFL
FT                   FILPTYNLVKSYVDFEKQNQQVIKLQKEYEALEKNTKSEKKLAEQLKNDDFVKKYARAK
FT                   YYLSREGEVIYPVPGLLPK"
FT   CDS_pept        11155..11277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0011"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy0009
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80566"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV1"
FT                   /inference="similar to AA sequence:RefSeq:YP_059327.1"
FT                   /protein_id="BAH80566.1"
FT                   /translation="MMNDIITKIETFLAYSDEKLAELKKENQRLKEDNQYTETD"
FT   CDS_pept        11290..12576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0012"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="similar to beta-lactamase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80567"
FT                   /db_xref="GOA:C5WDV2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV2"
FT                   /inference="similar to AA sequence:RefSeq:YP_599606.1"
FT                   /protein_id="BAH80567.1"
FT                   /translation="MKKLLAAMLMTFFLTPLTVISTEKTGQFSKATIYQLRQDIVQSTS
FT                   YYNQLPVNPNLYQETQTYKDAELTLPAITLGPDHKLDIKSLVINEQAKPIFELADGTYL
FT                   EANREVVYEDIVLSQVDADLFFWTQKQVTLYSEPYVLGTKAIPSPFTFAQKVHASQMAQ
FT                   TEHGIYYLIDQKGWVSQEDLSRFDNRMQKVQEMLLQKYNNANYSIFVKQLDTQASAGIN
FT                   ADKEMYAASIAKLAPLYSVQKQLQEKKVTENKFLRYIDDVNHFYGDYDPSGSGKISKKA
FT                   DKEDYKVSTLLKAVAQNSDNVATNILGYYLCHQYDQAFQTEIKALSGSNWDMEKRFLSS
FT                   RAAANVMEAIYYQKGHIISYLSNTDFDQQRISKNIAVPVAHKIGDAYDYKHDVAIIYGD
FT                   TPFVLSIFTDKATYDDITAIADDVYAILK"
FT   CDS_pept        12573..13859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="SDEG_0013"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="similar to tRNA(Ile)-lysidine synthetase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80568"
FT                   /db_xref="GOA:C5WDV3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059329.1"
FT                   /protein_id="BAH80568.1"
FT                   /translation="MTTYQEIYNEIKKQAYFDNHRRVLIAVSGGVDSMNLLHFLHLFQE
FT                   DLQISIGIAHINHKQRIESEIEEDYLRQWANNHSVPIYISHFEGIFSEKAARDWRYHFC
FT                   RKIMQNEQYSALVTAHHLDDQAETVLMRLIRGSRLRHLSGIKPVQPFGNGQLIRPFLSF
FT                   SKGDLPNIFHFEDTSNEETTVFRNRVRNQYLPLLEKENPQLVQSLSQLAIENQLLFQAF
FT                   TELTTKITITHLAEFRAQTASVQYFLLQDYLENFPDLQLKKSQFNQLLHLLQKANQGNY
FT                   PLKNGYYLLINQSSFNITKIIPETEFLNDQKVIKYDNAIWYRNHHFLFTTEDLAHKDQK
FT                   SIPIYSLSPIILRHRQAGDRLSFGNFSKKLRRLFIDDKLSIAERQNAIVGEQDGEIIFV
FT                   LVGDKTYLRKACKHDIMLAKLYIDKLEKR"
FT   CDS_pept        13864..14406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="SDEG_0014"
FT                   /product="hypoxanthine-guanine phosphoribosyl transferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="similar to hypoxanthine-
FT                   guaninephosphoribosyltransferase [Streptococcus
FT                   pyogenesMGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80569"
FT                   /db_xref="GOA:C5WDV4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV4"
FT                   /inference="similar to AA sequence:RefSeq:NP_606347.1"
FT                   /protein_id="BAH80569.1"
FT                   /translation="MLEQDIQKILYSEEQIIQKTKELGEQLTKDYQGKNPLMVGVLKGS
FT                   VPFMAELMKHIDTHVEIDFMVVSSYHGGTSSSGEVKILKDVDTNIEGRDIIFIEDIIDT
FT                   GRTLKYLRDMFKYRKANTIKIATLFDKPEGRVVDIEADYICYNVPNEFIVGFGLDYAEN
FT                   YRNLPYVGVLKEEVYSK"
FT   CDS_pept        14428..16413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="SDEG_0015"
FT                   /product="cell division protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="similar to cell division protein [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80570"
FT                   /db_xref="GOA:C5WDV5"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV5"
FT                   /inference="similar to AA sequence:RefSeq:YP_279483.1"
FT                   /protein_id="BAH80570.1"
FT                   /translation="MKNNKNNGFVKNSFIYILMIIVVITGFQFYLKGTSTQSQQISYSK
FT                   LIKHLKAGDIKSLSYQPSGSIIEVKGKYEKAQKVSVDPGLSFLGGNASAQVTEFSSLVL
FT                   PSDSILKEMTSAADKNGTEITVKQESSSGTWITFLMSFLPIVIFAAFMMMMMNQGGGGA
FT                   RGAMSFGKNKAKSQSKGDVKVRFTDVAGAEEEKQELVEVVDFLKNPKKYKALGARIPAG
FT                   VLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAERA
FT                   IIFIDEIDAVGRRRGAGMGGGNDEREQTLNQLLIEMDGFEGNENIIVIAATNRSDVLDP
FT                   ALLRPGRFDRKVLVGRPDVKGREAILRVHAKNKPLADDVNLKVVAQQTPGFVGADLENV
FT                   LNEAALVAARRNKVKIDASDIDEAEDRVIAGPSKKDRTISQREREMVAYHEAGHTIVGL
FT                   VLSNARVVHKVTIVPRGRAGGYMIALPKEDQMLLSKDDLKEQLAGLMGGRVAEEIIFNA
FT                   QTTGASNDFEQATQMARAMVTEYGMSDKLGPVQYEGNHAMMPGQLSPEKSYSAQTAQMI
FT                   DDEVRELLNQARNQAADIIKENRETHKLIAEALLKYETLDAAQIKSIYETGKMPNNPED
FT                   DDKEVHALSYDEIKDKMTESETESAD"
FT   CDS_pept        16541..17956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0016"
FT                   /product="amino acid permease"
FT                   /EC_number="3.6.3.-"
FT                   /note="similar to amino acid permease [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80571"
FT                   /db_xref="GOA:C5WDV6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059333.1"
FT                   /protein_id="BAH80571.1"
FT                   /translation="MYYIGSDKMTIFRKKQKHANRTEMHRHLKVTDLVFLGLGSMVGTG
FT                   IFTITGIGAANYAGPALTISIVISAIAIGILALFYAEFASRIPSNGGAYSYVYATLGEF
FT                   PAWIVGWYIIMEFLTAVSSVAVGWGSYLKGLLANYGIALPTPLNGTFDPKNGTYIDLLP
FT                   VLVMIFVTGIVLMNSKAALRFNSFLVLLKFSALALFIVVGLFFINGENWNNFAPYGLGQ
FT                   IYGGQSGIFAGASVMFFAFLGFESISMTVDEVKEPQKTIPKGIVLSLTIVTILYIVVTM
FT                   ILTGIVHYTRLNVPDAVAFALRSIGLYWAADYVSIVAILTLITVCISMTYALARTVYSI
FT                   SRDGLLPKSLYSLTEKSKVPKNATILVGVLAMICAGLFPLASLAEFVNICTLAYLVIMS
FT                   IAIIRLRKNEGKPKAGEFKTPLMPFLPLLAIVICVSFMSQYMAFTWIAFTLTTVVGTLV
FT                   YIFYGYKHSKENS"
FT   rRNA            19553..21103
FT                   /locus_tag="SDEG_0017"
FT                   /product="16S rRNA"
FT   tRNA            21154..21228
FT                   /locus_tag="SDEG_0018"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:21188..21190,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            21535..24289
FT                   /locus_tag="SDEG_0019"
FT                   /product="23S rRNA"
FT   rRNA            24384..24500
FT                   /locus_tag="SDEG_0020"
FT                   /product="5S rRNA"
FT   tRNA            24516..24590
FT                   /locus_tag="SDEG_0021"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:24550..24552,aa:Val,seq:tac)"
FT                   /note="codon recognized: GTA"
FT   tRNA            24609..24681
FT                   /locus_tag="SDEG_0022"
FT                   /product="tRNA-Asp"
FT                   /anticodon="(pos:24642..24644,aa:Asp,seq:gtc)"
FT                   /note="codon recognized: GAC"
FT   tRNA            24713..24785
FT                   /locus_tag="SDEG_0023"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:24746..24748,aa:Lys,seq:ttt)"
FT                   /note="codon recognized: AAA"
FT   tRNA            24791..24872
FT                   /locus_tag="SDEG_0024"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:24825..24827,aa:Leu,seq:tag)"
FT                   /note="codon recognized: CTA"
FT   tRNA            24883..24955
FT                   /locus_tag="SDEG_0025"
FT                   /product="tRNA-Thr"
FT                   /anticodon="(pos:24916..24918,aa:Thr,seq:tgt)"
FT                   /note="codon recognized: ACA"
FT   tRNA            24966..25037
FT                   /locus_tag="SDEG_0026"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:24998..25000,aa:Gly,seq:gcc)"
FT                   /note="codon recognized: GGC"
FT   tRNA            25046..25130
FT                   /locus_tag="SDEG_0027"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:25080..25082,aa:Leu,seq:taa)"
FT                   /note="codon recognized: TTA"
FT   tRNA            25146..25219
FT                   /locus_tag="SDEG_0028"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:25180..25182,aa:Arg,seq:acg)"
FT                   /note="codon recognized: CGT"
FT   tRNA            25225..25300
FT                   /locus_tag="SDEG_0029"
FT                   /product="tRNA-Pro"
FT                   /anticodon="(pos:25260..25262,aa:Pro,seq:tgg)"
FT                   /note="codon recognized: CCA"
FT   tRNA            25304..25379
FT                   /locus_tag="SDEG_0030"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:25339..25341,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   tRNA            25399..25472
FT                   /locus_tag="SDEG_0031"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:25433..25435,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   tRNA            25485..25574
FT                   /locus_tag="SDEG_0032"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:25521..25523,aa:Ser,seq:tga)"
FT                   /note="codon recognized: TCA"
FT   tRNA            25583..25658
FT                   /locus_tag="SDEG_0033"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:25618..25620,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   tRNA            25674..25748
FT                   /locus_tag="SDEG_0034"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:25708..25710,aa:Phe,seq:gaa)"
FT                   /note="codon recognized: TTC"
FT   tRNA            25757..25827
FT                   /locus_tag="SDEG_0035"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:25789..25791,aa:Gly,seq:tcc)"
FT                   /note="codon recognized: GGA"
FT   tRNA            25853..25928
FT                   /locus_tag="SDEG_0036"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:25888..25890,aa:Ile,seq:gat)"
FT                   /note="codon recognized: ATC"
FT   tRNA            25934..26023
FT                   /locus_tag="SDEG_0037"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:25969..25971,aa:Ser,seq:gct)"
FT                   /note="codon recognized: AGC"
FT   CDS_pept        27115..28317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sibA"
FT                   /locus_tag="SDEG_0038"
FT                   /product="secreted protein"
FT                   /note="similar to secreted protein [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80572"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV7"
FT                   /inference="similar to AA sequence:RefSeq:YP_599614.1"
FT                   /protein_id="BAH80572.1"
FT                   /translation="MKKRILSAVLVSGVTLGTATVVSADNFDAKISDANSRISALTAEQ
FT                   QSAQNQVNALQAQVSSLQSEQDKLTAKNSELEELSKGFEQEIQSLTSQIIARNEKLKNQ
FT                   ARSAYKNNETSSYINALLNSNSISDVVTRLVAINKAVSANAKMLEQQKADKALLEEKQA
FT                   ANQEAINTIAANMTAIKENQNALRIQQADLEVAKVNLAIQLASAEDEKASLLNQQAAAQ
FT                   QAAAEALAAQQVAQAKAREEAAQQAASVEEAKAAIVAPAAMVAESPVTPAPASITAPSA
FT                   TPVASVARPQVSYSSVNNYPVGQCTWGAKSLAPWAGNNWGNGGQWAASAQAAGYSVGTT
FT                   PMVGAIAVWNDGGYGHVAVVVEVQSSSNIRVMESNYSGKQYIADHRGWFNPSGVVFIYP
FT                   H"
FT   CDS_pept        28471..29433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs1"
FT                   /locus_tag="SDEG_0039"
FT                   /product="ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /note="similar to ribose-phosphate pyrophosphokinase 1
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80573"
FT                   /db_xref="GOA:C5WDV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV8"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127619.1"
FT                   /protein_id="BAH80573.1"
FT                   /translation="MSYSDLKLFALSSNKELAEKVASAMGIQLGKSTVRQFSDGEIQVN
FT                   IEESIRGHHVFILQSTSSPVNDNLMEILIMVDALKRASAEKISVVMPYYGYARQDRKAR
FT                   SREPITSKLVANMLEVAGVDRLLTVDLHAAQIQGFFDIPVDHLMGAPLIADYFDRHGLV
FT                   GEDVVVVSPDHGGVTRARKLAQFLQTPIAIIDKRRSVDKMNTSEVMNIIGNVEGKKCIL
FT                   IDDMIDTAGTICHAADALAEAGATAVYASCTHPVLSGPALDNIQRSAIEKLIVLDTIYL
FT                   PEERLIDKIEQISIADLVAEAIIRIHEKRPLSPLFEMGK"
FT   CDS_pept        29658..30422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="SDEG_0040"
FT                   /product="DNA repair protein"
FT                   /note="similar to DNA repair protein RecO [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80574"
FT                   /db_xref="GOA:C5WDV9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDV9"
FT                   /inference="similar to AA sequence:RefSeq:NP_606352.1"
FT                   /protein_id="BAH80574.1"
FT                   /translation="MQLNESLGIVLFNRNYREDDKLVKIFTETAGKRMFFVKHISRSKL
FT                   SSVIQPLTAADFIFKLNESGLSYIDDYNHVDTYQQINQDLFRLSYASYVVALADAAISD
FT                   NEPDPHLFAFLKKTLDLMEEGLDYEVLTNIFEIQVLERFGIRINFHDCVFCHRVGLPFD
FT                   FSHHYSGVLCPEHYHKDDYRNHLDPNVIYLLDRFQTIQFDELRTISLNDEMKRKLRYFI
FT                   DELYHDYVGIKLKSKTFIDDLAKWGDIMKPKD"
FT   CDS_pept        30529..31536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SDEG_0041"
FT                   /product="fatty acid/phospholipid synthesis"
FT                   /note="similar to fatty acid/phospholipid synthesis protein
FT                   PlsX [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80575"
FT                   /db_xref="GOA:C5WDW0"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW0"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122421.1"
FT                   /protein_id="BAH80575.1"
FT                   /translation="MKKIAIDAMGGDNAPKAIIEGVNQAIETFPDIDIQLYGDQAQIEA
FT                   YLVPSDRVSIIHTDEKIYSEDEPAKAIRRKKNASMVLAAKAVKEGEVDAILSAGNTGAL
FT                   LAAGLFIVGRIKGVDRPGLLSTIPTTDGKGFDMLDLGANAENTAAHLHQYAILGSFYAK
FT                   NVRGVHKPRVGLLNNGAEATKGDSLRKETYNLLAADPNLTFVGNVEARDLMSGVADVVV
FT                   ADGFTGNAVLKAIEGTAISIMGQLKEAIKSGGLKAKIGALLLKDSLYDMKNSLDYSSAG
FT                   GAVLFGLKAPVVKSHGSSDAKAIFSTIKQVRTMLETQVVGQLVEEFAKEIETND"
FT   CDS_pept        31529..31771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP.1"
FT                   /locus_tag="SDEG_0042"
FT                   /product="acyl carrier protein"
FT                   /note="similar to acyl carrier protein [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80576"
FT                   /db_xref="GOA:C5WDW1"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW1"
FT                   /inference="similar to AA sequence:RefSeq:NP_663822.1"
FT                   /protein_id="BAH80576.1"
FT                   /translation="MTREAILERLIALIQKQRSHLELTITEQTSLKDDLAVDSIELVEF
FT                   VINIEDGFHIAIPDEDVDGMKSMGDMLDYLVNRLA"
FT   CDS_pept        31936..32646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="SDEG_0043"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="similar to phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase [Streptococcus thermophilus LMG
FT                   18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80577"
FT                   /db_xref="GOA:C5WDW2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW2"
FT                   /inference="similar to AA sequence:RefSeq:YP_138575.1"
FT                   /protein_id="BAH80577.1"
FT                   /translation="METNQLIYSGKAKDLYATEDEHMILSVYKDQATMLNGARKETING
FT                   KGRLNNAISSLIFEKLNTVGINTHFVKRLSETEQLVKKVTIIPLEVVLRNVAAGSFSKR
FT                   FGIEEGVVLETPIIEFYYKKDELDDPFLNEEHISLLKIASEEDIADIKQETRRINAYLK
FT                   TWFEQVGLRLVDFKLEFGFDKDGHILLADEFSPDNCRLWDEDGHHMDKDVFRRDLGSLT
FT                   AVYEVVLEKLKELD"
FT   CDS_pept        32855..36580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0044"
FT                   /product="phosphoribosyl formylglycin amidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="similar to phosphoribosyl formyl glycinamidine
FT                   synthase [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80578"
FT                   /db_xref="GOA:C5WDW3"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW3"
FT                   /inference="similar to AA sequence:RefSeq:YP_599620.1"
FT                   /protein_id="BAH80578.1"
FT                   /translation="MDKRIFVEKKANFQIKAESLVKELTHNLQLSTLKTLRMIQVYDVF
FT                   GLTAALFPRAEKHIFSEQVTDCILPEETINTELTNAAFFAIESLPGQFDQRAASAQEAL
FT                   LLLGASNDVMVNTAQLYLVNKDILETELEAIKRYLLNPVDSRFKDITRGIERHDFSESD
FT                   KVIPTLDFFETYTSNEFKIYKAEQGLAMEVDDLVFIQEYFKSIGRVPTETELRVLDTYW
FT                   SDHCRHTTFETELKHIDFSASKFQKQLQATYDKYIAMREELGRSDKPQTLMDMATIFGR
FT                   YERANGRLDDMEVSDEINACSVEIDVDVDGVKEPWLLMFKNETHNHPTEIEPFGGAATC
FT                   IGGAIRDPLSGRSYVYQAMRISGAGDITTPISDTRAGKLPQQVISKTAAHGYSSYGNQI
FT                   GLATTYVKEYFHPGFVAKRMELGAVVGAAPKGNVIREKPEAGDVVILLGGKTGRDGIGG
FT                   ATGSSKVQTVESVETAGAEVQKGNAIEERKIQRLFRNGEVTRLIKKSNDFGAGGVCVAI
FT                   GELADGLIIDLNKVPLKYQGLNGTEIAISESQERMAVVVRSKDAEEFITKCSKENIKAV
FT                   TVATVTEKPNLVMTWNGQTIVDIERSFLDTNGVRVVVDAKVVDKAVNLPESRITSVETL
FT                   EKDTLTVLSNLNHASQKGLQTLFDSSVGRSTVNHPIGGRYQLTPSEASVQKLPVQNGVT
FT                   TTASVIAQGYNPYIAEWSPYHGAAYAVIEATARLVASGANWSKARFSYQEYFERMDKQA
FT                   ERFGQPVSALLGSIEAQIQLGLPSIGGKDSMSGTFEELTVPPTLVAFGVTTAHTQDVLS
FT                   PEFKVAGETIYYLPGQTISEEIDFDLIKANFSNFESIQANHTISSASTIKYGGIIESLA
FT                   LASFGNHIGASVTLTELDNSLTGQLGGFIFTSAEEISGVTKIGKTHADFTVTVNGVILS
FT                   GAKLLTAFEGKLEDIYPTTFSQSQDIEDVPVVVSDAVITTQKIIDKPLVYIPVFPGTNS
FT                   EYDSAKAFEQAGAEVHLVPFVTLNEVAIAQSVDTMVDNISKANIIFFAGGFSAADEPDG
FT                   SAKFIVNILLNQKVRSAIDNFIEKGGLIIGICNGFQALVKSGLLPYGNFENVKESSPTL
FT                   FYNDANQHVAKMVETRIANTNSPWLSGVEVGDVHVIPVSHGEGKFVVSAEEFAELRDNG
FT                   QIFSQYVDFDSHPSMDSRYNPNGSVNAIEGITSKNGQIIGKMGHSERWEEGIFQNIPGN
FT                   KDQKLFESAVRYFTGK"
FT   CDS_pept        36699..38150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="SDEG_0045"
FT                   /product="amidophosphoribosyltransferase precursor protein"
FT                   /EC_number="2.4.2.14"
FT                   /note="similar to amidophosphoribosyltransferase precursor
FT                   protein PurF [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80579"
FT                   /db_xref="GOA:C5WDW4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW4"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122425.1"
FT                   /protein_id="BAH80579.1"
FT                   /translation="MYEVKSLNEECGVFGIWGHPQAAQITYFGLHSLQHRGQEGAGIIS
FT                   NDEGNLHQHRAIGLLSDVFKNQNDLTKLTGHAAIGHVRYATAGSASINNIQPFLYQFTD
FT                   AQFGLCHNGNLTNAISLKKELEREGAIFNASSDTEILMHLVRRSHQSNFIGKVKEALNT
FT                   VKGGFAYLLMTEKQLIAALDPNGFRPLSIGKMKNGAWVVSSETCAFEVIGAEWIRDVKP
FT                   GELIVIDDSGITYHQYTTDTQLAICSMEYVYFARPDSTIYGVNVHTARKEMGKRLAQEF
FT                   QHEADIVVGVPNSSLSAAMGFAEESGLPNEMGLVKNQYTQRTFIQPTQDLREQGVRMKL
FT                   SAVSGVVKGKRVVMVDDSIVRGTTSRRIVSLLREAGATEVHVAIGSPELKYPCFYGIDI
FT                   QTRRELISANHTVEEVCDIIGADSLTYLSLDAMIDAIDLETDAPKGGLCVAYFDGEYPT
FT                   PLYDYEDEYLRSLEEQTSFYIEKVK"
FT   CDS_pept        38300..39331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0046"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /EC_number="6.3.3.1"
FT                   /note="similar to phosphoribosylaminoimidazole synthetase
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80580"
FT                   /db_xref="GOA:C5WDW5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW5"
FT                   /inference="similar to AA sequence:RefSeq:NP_734496.1"
FT                   /protein_id="BAH80580.1"
FT                   /translation="MMIEKNAYAQSGVDVEAGYEVVERIKKHVARTERLGVMGALGGFG
FT                   GMFDLSQTAIKEPVLISGTDGVGTKLMLAIQYDKHDTIGQDCVAMCVNDIIAAGAEPLY
FT                   FLDYIATGKNEPAKLEQVVAGVAEGCVQAGCALIGGETAEMPGMYGEEDYDLAGFTVGI
FT                   AEKSQILDGSKVAEGDILLGLASSGIHSNGYSLVRRVFADYTGDDVLPELEGQKLKDVL
FT                   LEPTRIYVKAVLPLIKEGLVNGIAHITGGGFTENIPRMFADDLAAEIDENKVPVLPIFK
FT                   ALEKYGQIKHEEMFDIFNMGIGLVLAVTPENVDRVKKLLNEPVYDIGHIVTKRDASVVI
FT                   SNG"
FT   CDS_pept        39324..39878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="SDEG_0047"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="similar to phosphoribosylglycinamide
FT                   formyltransferase [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80581"
FT                   /db_xref="GOA:C5WDW6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW6"
FT                   /inference="similar to AA sequence:RefSeq:YP_138579.1"
FT                   /protein_id="BAH80581.1"
FT                   /translation="MAKKIAVFASGNGSNFQVIAEQFKVELVFSDRRDAYVLERAQKLG
FT                   VRAVTFELKEFETKAAYEKEIVQFLDKHDIDLICLAGYMKIVGPTLLDAYEGRMINIHP
FT                   AYLPEFPGAHGISDAWQAGVDQSGVTVHWVDSGVDTGDIIQQMRVSRLASDTIEDFETR
FT                   IHKAEYQLYPEVLDRLGVDRK"
FT   CDS_pept        39976..40497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0048"
FT                   /product="putative vanZ protein"
FT                   /note="similar to vanZ protein putative [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80582"
FT                   /db_xref="GOA:C5WDW7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW7"
FT                   /inference="similar to AA sequence:RefSeq:NP_344598.1"
FT                   /protein_id="BAH80582.1"
FT                   /translation="MLILLKSKKLTFILFYLYLFLLSWCILFKFETQLQFINCFQQERV
FT                   VNWVPFTQPVIVNGDIVFAEMGFNLLFFIPFGVCLPILAPNWTYKKIVSLGLLLSLLYE
FT                   TLQFILAIGISDVTDLLFNTLGVCCGILLYQLINNLFNNRITVLINTIGILFVAIPTIG
FT                   LLALVILGLK"
FT   CDS_pept        40516..42060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0049"
FT                   /product="bifunctional phosphoribosyl
FT                   aminoimidazolecarboxamide formyltransferase/IMP
FT                   cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="similar to phosphoribosyl aminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase [Streptococcus
FT                   pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80583"
FT                   /db_xref="GOA:C5WDW8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW8"
FT                   /inference="similar to AA sequence:RefSeq:YP_599624.1"
FT                   /protein_id="BAH80583.1"
FT                   /translation="MKRALISVSDKAGIVDFAKELKNLGWDIISTGGTKTALDAAGLET
FT                   IAIDDVTGFPEMMDGRVKTLHPNIHGGLLARRDRDSHLQSARENNIELIDLVVVNLYPF
FT                   KETILRPDVTYDLAVENVDIGGPSMLRSAAKNHASVTVIVYPSDYPLVLAELTETGNTT
FT                   YEMRQRLAAKVFRHTAAYDALIADYFTTQVGENKPEKLTLTYDLKQAMRYGENPQQAAD
FT                   FYQNAIPTEYAIASAKQLNGKELSFNNVRDADAAIRIIRDFKDQPTVVALKHMNPCGIG
FT                   QADTIETAWDYCYEADPVSIFGGIVVLNREVDAMTAQKMHPVFLEIIIAPSYTEEALAI
FT                   LTHKKKNLRLLELPFGAQDASELEKEYTGVVGGMLVQNQDVVSESPADWQIVTERQPSE
FT                   QEMTALEFAWKAIKYVKSNGILIANDHMTLGVGPGQTNRVASVRIAVEQAKKHLDGAVL
FT                   ASDAFFPFADNIEEIAASGIKAIIQPGGSVRDQDSIDAANKHGLTMVFTGVRHFRH"
FT   CDS_pept        complement(42140..43267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0050"
FT                   /product="autolysin"
FT                   /note="similar to autolysin [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80584"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDW9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281392.1"
FT                   /protein_id="BAH80584.1"
FT                   /translation="MKKIHQLLVSGAILLSVNGAVSSVASTLNAEHTGVVHAAVLGDNY
FT                   PSKWKKGSGIDSWNMYVRQCTSFVAFRLSSANGFQLPKGYGNACTWGHIAKKQGYTVNK
FT                   TPKVGAVAWFDTNAFQSHATYGHVAWVAEVRGDSVVIEEYNYNAGQGPEKYHKRQIPKN
FT                   HVSGYIHFKDLPSGEASKSQTKEQQVSKEAVKQGGTYHFTERTPVKAQAQLTSPDLAYY
FT                   NPGQSVHYDQAMTVDGHEWISYLSFSGNRRYIPIKKIEQKTQQVSETTSPINIGDRVTF
FT                   PGVFRVDRIVNNLLVSEELAGGGATSLNWIDPSPLDETDRKGVKAGNQILQAGEFFVIP
FT                   GNYRVLKVDRPSNGIYVKIGSRGTWLTADKASKLP"
FT   CDS_pept        43551..44813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="SDEG_0051"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="similar to phosphoribosyl glycinamide synthetase
FT                   (GARS), putative"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80585"
FT                   /db_xref="GOA:C5WDX0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX0"
FT                   /inference="similar to AA sequence:RefSeq:YP_001034054.1"
FT                   /protein_id="BAH80585.1"
FT                   /translation="MKLLVVGSGGREHAIAKKLLESDGVEAVFVAPGNDGMTLDGLQLV
FT                   DIAISEHSRLIAFAQENDIAWTFIGPDDTLAAGIVDDFNTAGLQAFGPSRLAAELEWSK
FT                   DFAKEIMVKYQVPTAAYGTFSDFEEAKAYILEKGAPIVVKADGLALGKGVVVAETVDQA
FT                   VEAAHEMLLDNKFGDSGARVVIEEFLEGEEFSLFAFVNGDKFYMMPTAQDHKRAYDGDK
FT                   GPNTGGMGAYAPVPHISQDVVDQAVESIVKPVLDGMIKEGRPYLGILYAGLILTAEGPK
FT                   VIEFNARFGDPETQIILPRLTSNFAQNITDILDQKDTTITWLEEGLTLGVVVASEGYPL
FT                   AYEKGVVLPAKREGEIVTYYAGAKFSADGQALLSNGGRVYMLVTTADDVSAAQTRIYQE
FT                   LDKQKRPGLFYRNDIGSKALK"
FT   CDS_pept        45452..45940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0052"
FT                   /product="phosphoribosyl carboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="similar to phosphoribosyl carboxyaminoimidazole
FT                   (NCAIR) mutase [Streptococcus suis 98HAH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80586"
FT                   /db_xref="GOA:C5WDX1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001199596.1"
FT                   /protein_id="BAH80586.1"
FT                   /translation="MEAIVSIIMGSSSDWTTMQKAADVLDKFGIAYEKKVVSAHRTPDL
FT                   MFKHAEEARGRGIKIIIAGAGGAAHLPGMVAAKTTLPVIGVPVKSRTLSGLDSLYSIVQ
FT                   MPGGVPVATMAIGEAGATNAALTALRILSIEDQNIADALADFQIEQGKIAEAMTDELK"
FT   CDS_pept        45927..47000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0053"
FT                   /product="phosphoribosyl aminoimidazole carboxylase"
FT                   /EC_number="4.1.1.21"
FT                   /note="similar to phosphoribosyl aminoimidazole carboxylase
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80587"
FT                   /db_xref="GOA:C5WDX2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX2"
FT                   /inference="similar to AA sequence:RefSeq:NP_344603.1"
FT                   /protein_id="BAH80587.1"
FT                   /translation="MNSSKTIGIIGGGQLGQMMAISAIYQGHKVITLDPSADCPAGRVS
FT                   QLIVAPYDDVAALTELAERCDVLTYEFENVDADGLDAVIKEGQLPQGTDLLRISQNRIF
FT                   EKEFLANKAKVTVAPYKVVKSAADLDSIDLSKKYVLKTATGGYDGHGQVVIASDADLAA
FT                   ARELADSADCVLEEFVAFDLEVSVIVSGNQKEFTVFPVQENIHRNNILSKTIVPARISE
FT                   ELAEKAKAMALEIAKQLNLAGTLCVEMFASKDDIIVNEIAPRPHNSGHYSIEACDFSQF
FT                   DTHILGVLGLPLPVITLHAPAVMLNVLGQHMDKAQAYVQENPSAHLHLYGKLEAKQNRK
FT                   MGHVTLFSDVPDEVEEF"
FT   CDS_pept        47010..48266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0054"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SGO 2086
FT                   [Streptococcus gordonii str. Challis substr. CH1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80588"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR025280"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX3"
FT                   /inference="similar to AA sequence:RefSeq:YP_001451334.1"
FT                   /protein_id="BAH80588.1"
FT                   /translation="MGLFNFGKPKDEVLESRLSNLKSEIEIEKAKLNDLKRQLKIGDEL
FT                   VTIETQISKKKIELEDIKKDIAVSNDVLELQEFGFFERKYNFTDSTQYKNKLDSLRTQQ
FT                   KQLIKDGEAALIIIPMTLDGSQAKGKTMQKQLIKAMIRGFNGEVDGHLVKVSASNLEKK
FT                   ITSVKKSFEQLNKMYERNQIRLANNYLALKIDELRLAAEYELKKQEEKEILREQRAKER
FT                   EDKKLQAEIAAKRKQVEKDRKHFSQMVNNVEKLLLTATDEEKIKLDAQLKEYQEKLAEI
FT                   EEMEEDIDYREGHATAGYVYVISNLGAFGEDVYKIGVTRRLEPLDRIRELGSASVPFQF
FT                   DVHALIFSENAFALEKELHDKFDKYKINKINSRKEYFKVPFSEIKSTLENHKELTIELA
FT                   EEAEAFEYRQGLLKGDMNV"
FT   CDS_pept        48517..49809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SDEG_0055"
FT                   /product="adenylosuccinate lyase"
FT                   /note="similar to adenylosuccinate lyase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80589"
FT                   /db_xref="GOA:C5WDX4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX4"
FT                   /inference="similar to AA sequence:RefSeq:NP_357650.1"
FT                   /protein_id="BAH80589.1"
FT                   /translation="MIERYSRPEMANIWSEENKYRAWLEVEILADEAWAELGEIPKEDV
FT                   AKIRANADFDVDRILEIEKETRHDVVAFTRAVSETLGDERKWVHYGLTSTDVVDTAYGY
FT                   LYKQANDIIRRDLENFTQIVADKAREHKMTIMMGRTHGVHAEPTTFGLKLATWYSEMKR
FT                   NQERFERAAAGVEAGKISGAVGNFANIPPFVEEYVCGKLGIRPQEISTQVLPRDLHAEY
FT                   FAVLASIATSIERMATEIRGLQKSEQREVEEFFAKGQKGSSAMPHKRNPIGSENMTGLA
FT                   RVIRGHMITAYENVPLWHERDISHSSAERIITPDTTILINYMLNRFGNIVKNLTVFPEN
FT                   MIRNMGSTFGLIFSQRVMLKLIEKGMTREGAYDLVQPKTAYSWDNQVDFKPLLEADEEV
FT                   TSRLTQEEIDELFNPVYYTQRVDDIFERLGL"
FT   CDS_pept        49951..50862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0056"
FT                   /product="transcriptional regulator"
FT                   /note="similar to transcriptional regulator [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80590"
FT                   /db_xref="GOA:C5WDX5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040799"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX5"
FT                   /inference="similar to AA sequence:RefSeq:YP_601530.1"
FT                   /protein_id="BAH80590.1"
FT                   /translation="MLEHFGEKVRGLRLEKGISREELCGDEAELSVRQLARIELGQSIP
FT                   SLAKVIFIAKALEVSVGYLTDGANLELPKRYKELKYLILRTPTYMDDRKLQVRESQFDE
FT                   IFENYYDQLPEEEQLIIECLQATLDTLLSENINFGVELLQEYFKQTKVKLRFKQNDLIL
FT                   IELYLAYLDIEGMYGEYSDKVFYDSLLDNLLKQFDDFELDELFIVNKIIIDISSLSIKT
FT                   NKLDNLEKTIAISQKIMAKIQDWNRMPILKLIEWKYFLIKQKNRKQAEESYTKACLFAQ
FT                   ITGDKYLEEQLIKEWEKDICAY"
FT   CDS_pept        51079..52095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="SDEG_0057"
FT                   /product="Holliday junction DNA helicase"
FT                   /EC_number="3.1.22.4"
FT                   /note="similar to Holliday junction DNA helicase ruvB
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80591"
FT                   /db_xref="GOA:C5WDX6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX6"
FT                   /inference="similar to AA sequence:RefSeq:YP_599633.1"
FT                   /protein_id="BAH80591.1"
FT                   /translation="MCYNTIMARILDNDVMGDEELVERTLRPQYLREYIGQDKVKEQLT
FT                   IFIEAAKLRDESLDHVLLFGPPGLGKTTMAFVIANELGVNLKQTSGPAIEKAGDLVAIL
FT                   NDLEPGDVLFIDEIHRLPMAVEEVLYSAMEDFYIDIMIGAGDTSRSVHLDLPPFTLIGA
FT                   TTRAGMLSNPLRARFGITGHMEYYQEADLTEIVERTADIFDMEIVHEAAQELACRSRGT
FT                   PRIANRLLKRVRDYAQIVGDGVITAQITDKALTMLDVDREGLDYVDQKILRTMIEMYQG
FT                   GPVGLGTLSVNIAEERDTVEDMYEPYLIQKGFLMRTRTGRVATEKAYRHLGYPCPSK"
FT   CDS_pept        52230..52661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0058"
FT                   /product="protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="similar to protein tyrosine phosphatase
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80592"
FT                   /db_xref="GOA:C5WDX7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX7"
FT                   /inference="similar to AA sequence:RefSeq:YP_597647.1"
FT                   /protein_id="BAH80592.1"
FT                   /translation="MKKVCFVCLGNICRSPMAEFVMKSLVSSDTVFVESRATSSWEQGN
FT                   PIHPGTQSILKAYQIDYDVAKRAQQITVADFEAFDVIIGMDSQNVKDLRDMSHHRWDAK
FT                   IKLFREGGVPDPWYTGDFEETYRLVTQGCQKWLKELGVD"
FT   CDS_pept        52690..53091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0059"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80593"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX8"
FT                   /inference="similar to AA sequence:RefSeq:YP_599635.1"
FT                   /protein_id="BAH80593.1"
FT                   /translation="MTNIQSMIKKWNITRAKLEIFSVIVILVCALSVFGVRLTHQTSLT
FT                   YEQGKMRYTGYVVNHKMNGKGKLIYPNGDTYVGTFKNGVFEGEGTFTAKTGWSYKGQFH
FT                   KGQADGKGVLKAKNAKVYKGTFKQGIFQK"
FT   CDS_pept        53088..54863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0060"
FT                   /product="acyltransferase family"
FT                   /EC_number="2.3.-.-"
FT                   /note="similar to acyltransferase family [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80594"
FT                   /db_xref="GOA:C5WDX9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDX9"
FT                   /inference="similar to AA sequence:RefSeq:YP_279507.1"
FT                   /protein_id="BAH80594.1"
FT                   /translation="MRIKWFSFVRVTGLLLVLLYHFFKNTFPGGFIGVDIFFTFSGYLI
FT                   TALLIDEYTKKESIDIIGFLRRRFYRIVPPLVLMILLTIPFTFLVKSDFIANLGSQIAA
FT                   VLGFTTNIYEILTGSSYESQFIPHLFVHTWSLAIEVHFYLIWGVLIWLLAKRQDSHKKL
FT                   RGLLFLISSGVFTVSFLSMFIRAFVTSNVSLIYFSSFSHSFPFFLGAMFATMTGIKETT
FT                   VRFQKNVRLWSRQQVIAVMVGAFALLLLLTITLNFNHIVTYLFGFALASLFASVMIYAA
FT                   RVLHEQTPDWQEPKVVTYLADISYGIYLFHWPFYIIFTQLMSNVLAVILTTFFSVLFAT
FT                   MSYYIVEPLIQGKKPNLLGLEIDLSPYYKWISGVSLALAFLALGTCVAAPKVGKFERQL
FT                   LVSSLQQAQNNIERTHTLAAGDANALSDVSIIGDSVALRSSAAFSKLMPQAQLDAAVSR
FT                   NFSEAFELFTNQINSNSLSKTVVLAVGVNSLDNYGQDVQSFIEALPKGHRLVLVSPYNA
FT                   KNAAQVAEARDYAIKLPKKYKYVTIADWYKVATDNPDIWYGSDGVHYSEDSQGAELYVS
FT                   TIQKAIEQAAKKAAK"
FT   CDS_pept        55184..57826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh2"
FT                   /locus_tag="SDEG_0061"
FT                   /product="bifunctional alcohol dehydrogenase/acetaldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="similar to alcohol dehydrogenase/acetaldehyde
FT                   dehydrogenase (acetylating) [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80595"
FT                   /db_xref="GOA:C5WDY0"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281403.1"
FT                   /protein_id="BAH80595.1"
FT                   /translation="MTEGHNTVETTSVSATIDTLVQKGLAALEEMRKLGQEQVDYIVAK
FT                   ASVAALDAHGELAKHAYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTG
FT                   LTLIAEPVGVICGITPTTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRD
FT                   AAIAAGAPENCVQWVETPSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGA
FT                   GNVPAYVEKSANIRQAAHDIVMSKSFDNGMVCASEQAVIVDKEIYDDFVAEFKSYHTYF
FT                   VNKKEKALLEEFCFGAKANSKNCAGAKLNPNIVGKAATWIAEQAGFTVPEGTNILAAEC
FT                   KEVSENEPLTREKLSPVIAVLKSESREDGVEKARQMVEFNGLGHSAAIHTADAELAKEF
FT                   GTRIRAIRVIWNSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVG
FT                   RRRNNMQWFKVPSKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRR
FT                   NKVVYQIFADVEPDPDITTVMKGTELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEV
FT                   DFHDLVQKFMDIRKRAFKFPELGKKTKFIAIPTTSGTGSEVTPFAVISDKVNNRKYPIA
FT                   DYSLTPTVAIVDPALVLTVPGFIAADTGMDVLTHATEAYVSQMANDFTDGLALQAIKIV
FT                   FETLEKSVKEADFESREKMHNASTMAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAI
FT                   LLPYVIRYNGTRPAKTATWPKYNYYRADEKYQDIAKLLGLPASTPEEAVESYAKAVYDL
FT                   GCRVGIKMNFKDQGIDENEWKEHSRALAYLAYEDQCSPANPRLPMVDHMQEIIEDAYYG
FT                   YAERPGRRK"
FT   CDS_pept        58119..59135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="SDEG_0062"
FT                   /product="alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="similar to alcohol dehydrogenase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80596"
FT                   /db_xref="GOA:C5WDY1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281404.2"
FT                   /protein_id="BAH80596.1"
FT                   /translation="MKAVVVNEASTGVEVVDHEMPSIGHGEALVKVEYCGVCHTDLHVA
FT                   HGDFGQVPGRILGHEGIGIVEEIGEGVTSLQVGDRVSIAWFFEGCGHCEYCTTGRETLC
FT                   RSVKNAGYSVDGGMSEYAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPG
FT                   QWIVIFGAGGLGNLAVQYAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPG
FT                   YIQEKTGGAHGVVVTAVSKVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKV
FT                   VGSLVGTRKDLEEAFAFGAEGLVVPVVEKVPVDTAPDVFDEMERGLIQGRKVLDFTR"
FT   CDS_pept        59327..60811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thnsl"
FT                   /locus_tag="SDEG_0063"
FT                   /product="threonine synthase-like protein"
FT                   /note="similar to threonine synthase-like protein
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80597"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY2"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122448.1"
FT                   /protein_id="BAH80597.1"
FT                   /translation="MPMMYQSTRDQENKVTASQAILQGLAADGGLFTPVSFPKLALSFN
FT                   KLKDESYQAIAKLVLSAFFDDFTEDEIEYCISSAYGDKFDTSLIAPVVSLTDSHHLELF
FT                   HGTTIAFKDMALSILPYLLTTAAKKQGVEQKIVILTATSGDTGKAAMAGFADVPGTEII
FT                   VFYPHAGVSKIQELQMTTQVGENTHVVAIEGNFDDAQTDVKRMFNDPDLAQKLAARGMQ
FT                   LSSANSMNIGRLIPQVVYYIYAYAQLVKAGQIEAGQNINITVPTGNFGNILAAYYAKKI
FT                   GLPVATFICASNENRVLTDFFTSGIYDKKRPFKITTSPSMDILVSSNLERLVFHLVGDN
FT                   AEKTKCLMDTLTRNGSYELQDSDEAIFSQFVAGFATEAETAAEIKRVFELDDYVMDPHT
FT                   AVASAVYQNYRHETGDDTPTLIASTASPYKFPSVVVEAITGEPVADDFEAVSQLKQLSH
FT                   VVQPKAVIGLQNARVRHRLLVKTADMQTAVENYLGL"
FT   CDS_pept        60851..62140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0064"
FT                   /product="Na+ driven multidrug efflux pump"
FT                   /note="similar to Na+ driven multidrug efflux pump
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80598"
FT                   /db_xref="GOA:C5WDY3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059409.1"
FT                   /protein_id="BAH80598.1"
FT                   /translation="MTYNRRKLLSLALPSMAENILQMVMGMVDNYLVAQIGLVAVSGVS
FT                   IANNIITIYQALYIALGAAISSLIARSIGEHNQNKQLNDIADALRLTLGVSILLGLFSV
FT                   LGRRQILKVLGADDSLTLIGSQYLAIVGGMIVSLGLLTILGAIVRAQGKPRIPMQVSFL
FT                   INLLNAVFSALSIYVWGFGLAGVAWATVLSRLVGVLLLCRFVPIKSVVRRLTRPIDKTI
FT                   FNLSLPTAGERLMMRVGDVLITIIIVHFGTTVLAGNAIGEALTQFNYMPGLAMSTATVI
FT                   LVAGQLGSGKGADIRCTIRESFLLSTLMMFTMGILTYLLGPLLLNMFTQNPHARDSAMI
FT                   VLLFSLLGAPATAGTLVYTAAWQGIGRPQLPFYATTIGMWLIRIVLGYLLGVVCQMGLM
FT                   GVWVATVLDNSARWLILSRQFKKYQQIAFH"
FT   CDS_pept        complement(62109..63032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0065"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80599"
FT                   /db_xref="GOA:C5WDY4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY4"
FT                   /inference="similar to AA sequence:RefSeq:YP_061096.1"
FT                   /protein_id="BAH80599.1"
FT                   /translation="MVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAI
FT                   EHYMRQNYSPEMMVKAKGVQVPVSTIYYWIHHGKLSLGKEVMLYPRKAKQARKHANPYF
FT                   KPVGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSA
FT                   QAVNEALTGILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRL
FT                   IRRWLPKATKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGLTSGTLVI
FT                   YEFVALDLTTCEKDYLSSEKQSAGIS"
FT   CDS_pept        complement(62861..63184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0066"
FT                   /product="putative truncated transposase"
FT                   /note="similar to putative transposase [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80600"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY5"
FT                   /inference="similar to AA sequence:RefSeq:NP_608135.1"
FT                   /protein_id="BAH80600.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPRPFI
FT                   MKSSEDWLGNRFVKESLKPFILLNMLSWSIKKIASVLLDPLDSVSKIGRLLNTTCVRTI
FT                   PLR"
FT   CDS_pept        63493..63801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="SDEG_0067"
FT                   /product="30S ribosomal protein S10"
FT                   /note="similar to 30S ribosomal protein S10 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80601"
FT                   /db_xref="GOA:C5WDY6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY6"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127641.1"
FT                   /protein_id="BAH80601.1"
FT                   /translation="MANKKIRIRLKAYEHRTLDTAAEKIVETATRTGATVAGPVPLPTE
FT                   RSLYTIIRATHKYKDSREQFEMRTHKRLIDIVNPTQKTVDALMKLDLPSGVNVEIKL"
FT   CDS_pept        63907..64533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="SDEG_0068"
FT                   /product="50S ribosomal protein L3"
FT                   /note="similar to 50S ribosomal protein L3 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80602"
FT                   /db_xref="GOA:C5WDY7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY7"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127642.1"
FT                   /protein_id="BAH80602.1"
FT                   /translation="MTKGILGKKVGMTQIFTESGEFIPVTVIEATPNVVLQVKTVETDG
FT                   YEAVQVGFDDKREVLSNKPAKGHVAKANTAPKRFIREFKNIEGLEVGAELSVEQFEAGD
FT                   VVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLAGRMG
FT                   GNRVTVQNLEIVQVIPEKNVILVKGNVPGAKKSLITIKSAVKAAK"
FT   CDS_pept        64557..65180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="SDEG_0069"
FT                   /product="50S ribosomal protein L4"
FT                   /note="similar to 50S ribosomal protein L4 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80603"
FT                   /db_xref="GOA:C5WDY8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY8"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127643.1"
FT                   /protein_id="BAH80603.1"
FT                   /translation="MANVKLFDQTGKEVSSVELNDAIFGIEPNESVVFDVVISQRASLR
FT                   QGTHAVKNRSAVSGGGRKPWRQKGTGRARQGSIRSPQWRGGGVVFGPTPRSYGYKLPQK
FT                   VRRLALKSVYSAKVAEDKFVAVEGLSFAAPKTAEFAKVLSALSIDTKVLVLVEEGNEFA
FT                   ALSARNLPNVTVATAATASVLDIVNADKLLVTKEAISTIEEVLA"
FT   CDS_pept        65180..65476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="SDEG_0070"
FT                   /product="50S ribosomal protein L23"
FT                   /note="similar to 50S ribosomal protein L23 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80604"
FT                   /db_xref="GOA:C5WDY9"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDY9"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127644.1"
FT                   /protein_id="BAH80604.1"
FT                   /translation="MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAA
FT                   FDGVKVASVNTVNVKPKAKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE"
FT   CDS_pept        65494..66327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="SDEG_0071"
FT                   /product="50S ribosomal protein L2"
FT                   /note="similar to 50S ribosomal protein L2 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80605"
FT                   /db_xref="GOA:C5WDZ0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ0"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127645.1"
FT                   /protein_id="BAH80605.1"
FT                   /translation="MGIKVYKPTTNGRRNMTSLDFAEITTSTPEKSLLVSLKSKAGRNN
FT                   NGRITVRHQGGGHKRHYRLIDFKRNKDGVEAVVKTIEYDPNRTANIALVHYTDGVKAYI
FT                   IAPKGLEVGQRIVSGPDADIKVGNALPLANIPVGTVVHNIELKPGKGGELVRAAGASAQ
FT                   VLGQEGKYVLVRLQSGEVRMILGTCRATIGTVGNEQQSLVNIGKAGRSRWKGIRPTVRG
FT                   SVMNPNDHPHGGGEGKAPVGRKAPSTPWGKPALGLKTRNKKAKSDKLIVRRRNEK"
FT   CDS_pept        66418..66744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="SDEG_0072"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="similar to SSU ribosomal protein S19P [Streptococcus
FT                   pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80606"
FT                   /db_xref="GOA:C5WDZ1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ1"
FT                   /inference="similar to AA sequence:RefSeq:YP_599648.2"
FT                   /protein_id="BAH80606.1"
FT                   /translation="MDSSRCGTLFKGENYKMGRSLKKGPFVDEHLMKKVEAQANDEKKK
FT                   VIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDK
FT                   KTRR"
FT   CDS_pept        66760..67104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="SDEG_0073"
FT                   /product="50S ribosomal protein L22"
FT                   /note="similar to 50S ribosomal protein L22 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80607"
FT                   /db_xref="GOA:C5WDZ2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281413.1"
FT                   /protein_id="BAH80607.1"
FT                   /translation="MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPN
FT                   KAARVIEKTLNSAIANAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRT
FT                   THVTVVVSEK"
FT   CDS_pept        67117..67770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0074"
FT                   /product="30S ribosomal protein S3"
FT                   /note="similar to 30S ribosomal protein S3 [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80608"
FT                   /db_xref="GOA:C5WDZ3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ3"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122458.1"
FT                   /protein_id="BAH80608.1"
FT                   /translation="MGQKVHPIGMRVGIIRDWDAKWYAEKEYADYLHEDLAIRKFINKE
FT                   LAEASVSTIEIERAVNKVIVSLHTAKPGMVIGKGGANVDALRAQLNKLTGKQVHINIIE
FT                   IKQPDLDAHLVGENIARQLEQRVAFRRAQKQAIQRTMRAGAKGIKTQVSGRLNGADIAR
FT                   AEGYSEGTVPLHTLRADIDYAWEEADTTYGKLGVKVWIYRGEVLPARKNTKGGK"
FT   CDS_pept        67774..68187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0075"
FT                   /product="50S ribosomal protein L16"
FT                   /note="similar to 50S ribosomal protein L16 [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80609"
FT                   /db_xref="GOA:C5WDZ4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ4"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122459.1"
FT                   /protein_id="BAH80609.1"
FT                   /translation="MLVPKRVKHRREFRGKMRGEAKGGKTVDFGEYGLQAATSSWITNR
FT                   QIEAARIAMTRYMKRGGKVWIKIFPHKSYTAKAIGVRMGSGKGAPEGWVAPVKRGKVMF
FT                   EIAGVSEEIAREALRLASHKLPVKCKFVKREAE"
FT   CDS_pept        68197..68403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0076"
FT                   /product="50S ribosomal protein L29"
FT                   /note="similar to 50S ribosomal protein L29 [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80610"
FT                   /db_xref="GOA:C5WDZ5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ5"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122460.1"
FT                   /protein_id="BAH80610.1"
FT                   /translation="MKLEEIKKFVAELRGLSQEELAKKENELKKELFDLRFQAAAGQLD
FT                   QTARLNEVKKQIARVKTVQSEMK"
FT   CDS_pept        68431..68691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0077"
FT                   /product="30S ribosomal protein S17"
FT                   /note="similar to 30S ribosomal protein S17 [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80611"
FT                   /db_xref="GOA:C5WDZ6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ6"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122461.1"
FT                   /protein_id="BAH80611.1"
FT                   /translation="MERNQRKTLVGRVVSDKMDKTITVVVETKRNHPVYGKRINYSKKY
FT                   KAHDEKNLAKEGDIVRIMETRPLSATKRFRLVEVVEEAVII"
FT   CDS_pept        68716..69084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="SDEG_0078"
FT                   /product="50S ribosomal protein L14"
FT                   /note="similar to 50S ribosomal protein L14 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80612"
FT                   /db_xref="GOA:C5WDZ7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281418.1"
FT                   /protein_id="BAH80612.1"
FT                   /translation="MIQQETRLKVADNSGAREILTIKVLGGSGRKFANIGDVIVASVKQ
FT                   ATPGGAVKKGDVVKAVIVRTKTGARRPDGSYIKFDDNAAVIIRDDKTPRGTRIFGPVAR
FT                   ELREGGYMKIVSLAPEVL"
FT   CDS_pept        complement(68721..68987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0079"
FT                   /product="truncated 50S ribosomal protein L14"
FT                   /note="similar to 50S ribosomal protein L14 [Staphylococcus
FT                   epidermidis ATCC 12228]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80613"
FT                   /db_xref="GOA:C5WDZ8"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ8"
FT                   /inference="similar to AA sequence:RefSeq:NP_765368.1"
FT                   /protein_id="BAH80613.1"
FT                   /translation="MSSRMITAALSSNLMYEPSGRRAPVFVRTITALTTSPFLTAPPGV
FT                   ACLTEATITSPMLANLRPEPPRTLIVKISRAPLLSATFKRVSC"
FT   CDS_pept        69168..69473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="SDEG_0080"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="similar to LSU ribosomal protein L24P [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80614"
FT                   /db_xref="GOA:C5WDZ9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C5WDZ9"
FT                   /inference="similar to AA sequence:RefSeq:YP_601553.1"
FT                   /protein_id="BAH80614.1"
FT                   /translation="MFVKKGDKVRVIAGKDKGTEAVVLKALPKVNKVVVEGVGMIKKHQ
FT                   KPNTENPQGAIVEKEAPIHVSNVQVLDKNGVAGRVGYKVVDGKKVRYNKKSGEVLD"
FT   CDS_pept        69497..70039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="SDEG_0081"
FT                   /product="50S ribosomal protein L5"
FT                   /note="similar to 50S ribosomal protein L5 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80615"
FT                   /db_xref="GOA:C5WE00"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE00"
FT                   /inference="similar to AA sequence:RefSeq:YP_281420.1"
FT                   /protein_id="BAH80615.1"
FT                   /translation="MANRLKEKYTNEVIPALTEKFNYTSVMAVPKVEKIVLNMGVGDAV
FT                   SNAKNLEKAAAELALISGQKPLITKAKKSIAGFRLREGVAIGAKVTLRGERMYEFLDKL
FT                   VSVSLPRVRDFHGVPTKSFDGRGNYTLGVKEQLIFPEINFDDVDKVRGLDIVIVTTANT
FT                   DEESRELLKGLGMPFAK"
FT   CDS_pept        70055..70240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="SDEG_0082"
FT                   /product="30S ribosomal protein S14"
FT                   /note="similar to 30S ribosomal protein S14 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80616"
FT                   /db_xref="GOA:C5WE01"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE01"
FT                   /inference="similar to AA sequence:RefSeq:YP_281421.1"
FT                   /protein_id="BAH80616.1"
FT                   /translation="MAKKSMIAKNKRPAKHSTQAYTRCEKCGRPHSVYRKFKLCRVCFR
FT                   ELAYKGQIPGVVKASW"
FT   CDS_pept        70448..70846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="SDEG_0083"
FT                   /product="30S ribosomal protein S8"
FT                   /note="similar to 30S ribosomal protein S8 [Streptococcus
FT                   thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80617"
FT                   /db_xref="GOA:C5WE02"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE02"
FT                   /inference="similar to AA sequence:RefSeq:YP_140333.1"
FT                   /protein_id="BAH80617.1"
FT                   /translation="MVMTDPIADFLTRIRNANQVKHEVLEVPASNIKKGIAEILKREGF
FT                   VKNVEVIEDDKQGIIRVFLKYGQNGERVITNLKRVSKPGLRVYAKREDVPKVLNGLGIA
FT                   IISTSEGLLTDKEARQKNVGGEVIAYVW"
FT   CDS_pept        71048..71584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="SDEG_0084"
FT                   /product="50S ribosomal protein L6"
FT                   /note="similar to 50S ribosomal protein L6 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80618"
FT                   /db_xref="GOA:C5WE03"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE03"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127657.1"
FT                   /protein_id="BAH80618.1"
FT                   /translation="MSRIGNKVITLPAGVEIINNDNVVTVKGPKGELTREFNKNIEIKV
FT                   EGTEITLARPNDSKEMKTIHGTTRANLNNMVVGVSEGFKKDLEMKGVGYRAQLQGTKLV
FT                   LSVGKSHQDEVEAPEGITFTVANPTSISVEGINKEVVGQTAAYIRSLRSPEPYKGKGIR
FT                   YVGEYVRLKEGKTGK"
FT   CDS_pept        71680..72045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="SDEG_0085"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="similar to LSU ribosomal protein L18P [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80619"
FT                   /db_xref="GOA:C5WE04"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE04"
FT                   /inference="similar to AA sequence:RefSeq:YP_601558.1"
FT                   /protein_id="BAH80619.1"
FT                   /translation="MKIVISKPDKNKIRQKRHRRVRGKLSGTAERPRLNVFRSNTGIYA
FT                   QVIDDVAGVTLASASTLDKDVSKGTKTEQAVVVGKLVAERAVAKGISEVVFDRGGYLYH
FT                   GRVKALADAARENGLKF"
FT   CDS_pept        complement(71857..72309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to conserved hypothetical protein [Listeria
FT                   monocytogenes str. 4b H7858]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80620"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE05"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00231726.1"
FT                   /protein_id="BAH80620.1"
FT                   /translation="MRDCCTNHWYFDHVFLSSFNCFTDSFWNFLSFTSTKSNTTISITN
FT                   NYKSCKAKTTSTFNNFCNAVNRNNAFFKFNCIIFKCHYFVSSLLEFQSVFTSCISQGFN
FT                   TSVIEISTAVKHHFRNTFSHCTFSNKFADYNGLFCFCSFRNVFIKS"
FT   CDS_pept        72064..72558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="SDEG_0087"
FT                   /product="30S ribosomal protein S5"
FT                   /note="similar to 30S ribosomal protein S5 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80621"
FT                   /db_xref="GOA:C5WE06"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE06"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127659.1"
FT                   /protein_id="BAH80621.1"
FT                   /translation="MAFKDNAVELEERVVAINRVTKVVKGGRRLRFAALVVVGDGNGRV
FT                   GFGTGKAQEVPEAIRKAVEAAKKNMIEVPMVGTTIPHEVYTNFGGAKVLLKPAVEGSGV
FT                   AAGGAVRAVIELAGIADITSKSLGSNTPINIVRATVEGLKQLKRAEEVAALRGISVSDL
FT                   A"
FT   CDS_pept        complement(72315..72629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0088"
FT                   /product="ribosomal protein"
FT                   /note="similar to ribosomal protein [Streptococcus
FT                   agalactiae CJB111]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80622"
FT                   /db_xref="GOA:C5WE07"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE07"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00788595.1"
FT                   /protein_id="BAH80622.1"
FT                   /translation="MFWLTSDWRLSQSNFNLSHDDPLSYAKSETEMPRSAATSSARLSC
FT                   FNPSTVARTMLIGVFEPRDFEVISAIPANSMTARTAPPAATPEPSTAGFNNTLAPPKLV
FT                   "
FT   CDS_pept        72573..72755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="SDEG_0089"
FT                   /product="50S ribosomal protein L30"
FT                   /note="similar to 50S ribosomal protein L30 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80623"
FT                   /db_xref="GOA:C5WE08"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE08"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127660.1"
FT                   /protein_id="BAH80623.1"
FT                   /translation="MAQIKITLTKSPIGRKPEQRKTVVALGLGKLNSSVVKEDNAAIRG
FT                   MVTAISHLVTVEDVK"
FT   CDS_pept        72970..73410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="SDEG_0090"
FT                   /product="50S ribosomal protein L15"
FT                   /note="similar to 50S ribosomal protein L15 [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80624"
FT                   /db_xref="GOA:C5WE09"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE09"
FT                   /inference="similar to AA sequence:RefSeq:NP_687113.1"
FT                   /protein_id="BAH80624.1"
FT                   /translation="MKLHELKAAEGSRKVRNRVGRGTSSGNGKTSGRGQKGQKARSGGG
FT                   VRLGFEGGQTPLFRRIPKRGFTNINAKEYALVNLDQLNVFEDGTEVTPVVLKEAGIVRA
FT                   EKSGVKVLGNGELTKKLTVKAAKFSKSAEAAITAKGGSIEVI"
FT   CDS_pept        73388..74731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="SDEG_0091"
FT                   /product="protein translocase subunit"
FT                   /note="similar to protein translocase subunit secY
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80625"
FT                   /db_xref="GOA:C5WE10"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE10"
FT                   /inference="similar to AA sequence:RefSeq:YP_601562.2"
FT                   /protein_id="BAH80625.1"
FT                   /translation="MVQSKSSNEGILIMFLKILKDALKIKTVRNKIFFTIFIILVFRIG
FT                   THITVPGVNAKSLEQLSELPFLNMLNLVSGNAMRNFSVFSMGVSPYITASIVVQLLQMD
FT                   ILPKFVEWGKQGEVGRRKLNQATRYISLVLAFAQSIGITAGFNTLSSVALVKTPDVKTY
FT                   LLIGALLTTGSVIVTWLGEQITDKGFGNGVSMIIFAGIISSIPNAIATIREDYFVNVKA
FT                   SDLQSSYLIVGILILAVLAIVFFTTYVQQAEYKIPIQYTKLMQGAPTSSYLPLKVNPAG
FT                   VIPVIFASSITTIPSTIIPFVQNGRDIPWLTRLQEIFNYQTPVGMMIYAVLIILFSFFY
FT                   TFVQVNPEKTAENLQKNSSYIPSVRPGRETEQFMSSLLKKLATVGAIFLAFISLAPIAA
FT                   QQALNLSSSIALGGTSLLILISTGIEGMKQLEGYLLKRKYVGFMNTAE"
FT   CDS_pept        74878..75519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="SDEG_0092"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="similar to adenylate kinase Adk [Streptococcus equi
FT                   subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80626"
FT                   /db_xref="GOA:C5WE11"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE11"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122473.1"
FT                   /protein_id="BAH80626.1"
FT                   /translation="MNLLIMGLPGAGKGTQAAKIVEAFGLIHISTGDMFRAAIANQTEM
FT                   GVLAKSYIDKGDLVPDEVTNGIVKERLSQDDVNEKGFLLDGYPRTIEQAHALDATLKAL
FT                   GLTLDGVINIDVDPTALVERLSGRIINKKTGETFHKVFNPPAGDYDENDFYQREDDKPE
FT                   TVKRRLDVNIAQGEPILNHYRQAGIVHDIDGNKDISEVFVDIDEVIKGLK"
FT   CDS_pept        75583..75855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="SDEG_0093"
FT                   /product="translation initiation factor 1"
FT                   /note="similar to bacterial protein translation Initiation
FT                   Factor 1 (IF-1) [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80627"
FT                   /db_xref="GOA:C5WE12"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE12"
FT                   /inference="similar to AA sequence:RefSeq:YP_601564.1"
FT                   /protein_id="BAH80627.1"
FT                   /translation="MLPLCSEDIKSKFRGYFCVAKEDVIEIEGKVVETMPNAMFTVELE
FT                   NGHQILATVSGKIRKNYIRILVGDRVTVEMSPYDLTRGRITYRFK"
FT   CDS_pept        75881..75997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="SDEG_0094"
FT                   /product="50S ribosomal protein L36"
FT                   /note="similar to 50S ribosomal protein L36 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80628"
FT                   /db_xref="GOA:C5WE13"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE13"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127665.1"
FT                   /protein_id="BAH80628.1"
FT                   /translation="MKVRPSVKPICEYCKVIRRNGRVMVICPTNPKHKQRQG"
FT   CDS_pept        76015..76380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="SDEG_0095"
FT                   /product="30S ribosomal protein S13"
FT                   /note="similar to 30S ribosomal protein S13 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80629"
FT                   /db_xref="GOA:C5WE14"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE14"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127666.1"
FT                   /protein_id="BAH80629.1"
FT                   /translation="MARIAGVDIPNDKRVVISLTYVYGIGLATSKKILAAAGISEDIRV
FT                   KDLTSDQEDAIRREVDAIKVEGDLRREVNLNIKRLMEIGSYRGIRHRRGLPVRGQNTKN
FT                   NARTRKGKAVAIAGKKK"
FT   CDS_pept        76398..76781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="SDEG_0096"
FT                   /product="30S ribosomal protein S11"
FT                   /note="similar to 30S ribosomal protein S11 [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80630"
FT                   /db_xref="GOA:C5WE15"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE15"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127667.1"
FT                   /protein_id="BAH80630.1"
FT                   /translation="MAKPTRKRRVKKNIESGVAHIHATFNNTIVMITDVHGNALAWSSA
FT                   GALGFKGSRKSTPFAAQMAAEAAAKSAQEHGLKTVEVTVKGPGSGRESAIRALAAAGLE
FT                   VTAIRDVTPVPHNGARPPKRRRV"
FT   CDS_pept        76827..77765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="SDEG_0097"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /note="similar to DNA-directed RNA polymerase alpha subunit
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80631"
FT                   /db_xref="GOA:C5WE16"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE16"
FT                   /inference="similar to AA sequence:RefSeq:YP_281434.1"
FT                   /protein_id="BAH80631.1"
FT                   /translation="MIEFEKPIITKIDENKDYGRFVIEPLERGYGTTLGNSLRRVLLSS
FT                   LPGAAVTSIKIDGVLHEFDTIPGVREDVMQIILNVKGLAVKSYVEDEKIIELEVEGPAE
FT                   VTAGDILTDSDIELVNPDHYLFTIAEGHSLRATMTVAKKRGYVPAEGNKKDDAPVGTLA
FT                   VDSIYTPVKKVNYQVEPARVGSNDGFDKLTIEIMTNGTIIPEDALGLSARVLIEHLNLF
FT                   TDLTDVAKATEVMKETEKVNDEKVLDRTIEELDLSVRSYNCLKRAGINTVFDLTEKSEP
FT                   EMMKVRNLGRKSLEEVKVKLADLGLGLKNDK"
FT   CDS_pept        77780..78166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="SDEG_0098"
FT                   /product="50S ribosomal protein L17"
FT                   /note="similar to 50S ribosomal protein L17 [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80632"
FT                   /db_xref="GOA:C5WE17"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE17"
FT                   /inference="similar to AA sequence:RefSeq:NP_268487.1"
FT                   /protein_id="BAH80632.1"
FT                   /translation="MAYRKLGRTSSQRKAMLRDLTTDLLINESIVTTEARAKEIRKTVE
FT                   KMITLGKRGDLHARRQAAAYVRNEIASENYDEATDKYTSTTALQKLFSEIAPRYAERNG
FT                   GYTRILKTEPRRGDAAPMAIIELV"
FT   CDS_pept        78646..79482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0099"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80633"
FT                   /db_xref="GOA:C5WE18"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE18"
FT                   /inference="similar to AA sequence:RefSeq:YP_061096.1"
FT                   /protein_id="BAH80633.1"
FT                   /translation="MVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAI
FT                   EHYMRQNYSPEMMVKAKGVQVPVSTIYYWIHHGKLSLGKEVMLYPRKAKQARKHANPYF
FT                   KPVGKSIEQRPDSINQRLEAGHYEIDTVILTRAKNQCLLTLTDRKTRHQLIRLIPDKSA
FT                   QAVNEALTGILKDYTVNSITADNGTEFSRLSDVFPASDIYYAHPYASWERGTNENHNRL
FT                   IRRWLPKGTKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFSLSIKM"
FT   CDS_pept        79570..80598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0100"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80634"
FT                   /db_xref="GOA:C5WE19"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE19"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH80634.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIARLLGRH
FT                   RSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLKLNGCSARFIA
FT                   QLESALTANIRLHSVDSFVQTYKVDHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI
FT                   RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLILGKKTKGEAVMLTLVERQT
FT                   RYALGVKLEDKQSQTINRAVTHLISQYPIASITADNGSEFSLLSTLEAVDVYFAHPYSS
FT                   HERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLLQYQSSTFLFELAR
FT                   TA"
FT   rRNA            80958..82507
FT                   /locus_tag="SDEG_0101"
FT                   /product="16S rRNA"
FT   tRNA            82558..82632
FT                   /locus_tag="SDEG_0102"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:82592..82594,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            82939..85694
FT                   /locus_tag="SDEG_0103"
FT                   /product="23S rRNA"
FT   rRNA            85789..85905
FT                   /locus_tag="SDEG_0104"
FT                   /product="5S rRNA"
FT   tRNA            85921..85995
FT                   /locus_tag="SDEG_0105"
FT                   /product="tRNA-Val"
FT                   /anticodon="(pos:85955..85957,aa:Val,seq:tac)"
FT                   /note="codon recognized: GTA"
FT   tRNA            86000..86072
FT                   /locus_tag="SDEG_0106"
FT                   /product="tRNA-Gly"
FT                   /anticodon="(pos:86033..86035,aa:Gly,seq:tcc)"
FT                   /note="codon recognized: GGA"
FT   tRNA            86099..86174
FT                   /locus_tag="SDEG_0107"
FT                   /product="tRNA-Ile"
FT                   /anticodon="(pos:86134..86136,aa:Ile,seq:gat)"
FT                   /note="codon recognized: ATC"
FT   tRNA            86189..86262
FT                   /locus_tag="SDEG_0108"
FT                   /product="tRNA-Glu"
FT                   /anticodon="(pos:86223..86225,aa:Glu,seq:ttc)"
FT                   /note="codon recognized: GAA"
FT   tRNA            86272..86361
FT                   /locus_tag="SDEG_0109"
FT                   /product="tRNA-Ser"
FT                   /anticodon="(pos:86308..86310,aa:Ser,seq:tga)"
FT                   /note="codon recognized: TCA"
FT   tRNA            86370..86445
FT                   /locus_tag="SDEG_0110"
FT                   /product="tRNA-Met"
FT                   /anticodon="(pos:86405..86407,aa:Met,seq:cat)"
FT                   /note="codon recognized: ATG"
FT   tRNA            86461..86535
FT                   /locus_tag="SDEG_0111"
FT                   /product="tRNA-Phe"
FT                   /anticodon="(pos:86495..86497,aa:Phe,seq:gaa)"
FT                   /note="codon recognized: TTC"
FT   tRNA            86554..86634
FT                   /locus_tag="SDEG_0112"
FT                   /product="tRNA-Tyr"
FT                   /anticodon="(pos:86588..86590,aa:Tyr,seq:gta)"
FT                   /note="codon recognized: TAC"
FT   tRNA            86641..86711
FT                   /locus_tag="SDEG_0113"
FT                   /product="tRNA-Trp"
FT                   /anticodon="(pos:86673..86675,aa:Trp,seq:cca)"
FT                   /note="codon recognized: TGG"
FT   tRNA            86721..86795
FT                   /locus_tag="SDEG_0114"
FT                   /product="tRNA-His"
FT                   /anticodon="(pos:86755..86757,aa:His,seq:gtg)"
FT                   /note="codon recognized: CAC"
FT   tRNA            86802..86875
FT                   /locus_tag="SDEG_0115"
FT                   /product="tRNA-Gln"
FT                   /anticodon="(pos:86835..86837,aa:Gln,seq:ttg)"
FT                   /note="codon recognized: CAA"
FT   tRNA            86894..86977
FT                   /locus_tag="SDEG_0116"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:86928..86930,aa:Leu,seq:caa)"
FT                   /note="codon recognized: TTG"
FT   CDS_pept        87208..87747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0117"
FT                   /product="putative nudix hydrolase"
FT                   /EC_number="3.6.-.-"
FT                   /note="similar to putative nudix hydrolase [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80635"
FT                   /db_xref="GOA:C5WE20"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE20"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122496.1"
FT                   /protein_id="BAH80635.1"
FT                   /translation="MMGEFWDIYTANRVKTGRVMERGSLFKQGDYHLVVHICLFNDRGE
FT                   MLIQQRQAEKAGWPGLWDVTVGGSALAGETAQQAAMRELKEELGLSLDLTGVRPHFTIN
FT                   FGEGFDDTFLVTVPYLVDLESLVLQEEEVQAVRWANRHEILRMIDEGSFIPYLKGKIDL
FT                   CFDMVGQYGAHQFQRK"
FT   CDS_pept        87882..88781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0118"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyl
FT                   transferase"
FT                   /EC_number="2.5.-.-"
FT                   /note="similar to 1,4-dihydroxy-2-naphthoate octaprenyl
FT                   transferase [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80636"
FT                   /db_xref="GOA:C5WE21"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE21"
FT                   /inference="similar to AA sequence:RefSeq:NP_688734.1"
FT                   /protein_id="BAH80636.1"
FT                   /translation="MTIPVFLELVEIKAKTASILPFLIGLCFSYYYYGTIHPWLVFLFF
FT                   SSMLLFNMFVDVWDNYNDYLHAHDSHYQRETNIIGREKLSLTIVRRLMLVLFVVSVVIG
FT                   FALAWLVGWPLLLMGGFCYAVGILYSAGPRPLSSLPLGEVFSGFTMGFMITLICVYLNT
FT                   YQQFSWDWQRLASIFLVSLPNTLWIANLMLANNLCDKEEDERNHRFTLVHYTGTRGGLI
FT                   LFSLSNILALCAIVLEFLFGLAPATILLTLLLIPFIYKQTKLLWLKQIKKETFSCAIRI
FT                   LALGSTLQALTYVIGIIL"
FT   CDS_pept        88778..90004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0119"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1788
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80637"
FT                   /db_xref="GOA:C5WE22"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE22"
FT                   /inference="similar to AA sequence:RefSeq:NP_736222.1"
FT                   /protein_id="BAH80637.1"
FT                   /translation="MRRHVTMQEVLVLGAGYAGLKAVRQLQKQKDDFHITLIDRNSYHY
FT                   EATELHEVAAGSHSKEKISYPILDVINPDKVTFLQDEVVQVNREAQTVTMKENGTLTYD
FT                   YLIVSLGFTSETFGIPGAQENALQMVNIETAEAVHEHILKTMASYRETKDETSLRLLIC
FT                   GAGFTGIELAGAFVDERQRYAKLAGVAPEQIEIICVEAANRILPMFDDALAQHGVNLLK
FT                   KLGVKLMLGCTIKEIQPGHVLYAVDSEDMASQSLAAGTIVWTTGVSGSPVMGQSGFNQR
FT                   RGRVVVGNDLRDPEHDNVYVIGDVSAFMDTSCNRPFPTTAQIATRMGTHAAKNVLHQLR
FT                   GEATEDFSYQPLGTVASVGNTRAFGLVGKLPVKSYPASVIKKSIMNKSLLDIGGLKELL
FT                   AKGRFDLYH"
FT   CDS_pept        90114..91541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="SDEG_0120"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="similar to cytochrome d ubiquinol oxidase subunit II
FT                   [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80638"
FT                   /db_xref="GOA:C5WE23"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE23"
FT                   /inference="similar to AA sequence:RefSeq:YP_330350.1"
FT                   /protein_id="BAH80638.1"
FT                   /translation="MTIEALARFQFAMTTIFHFFFVPFSIGMCLIVAILETCYVVTKNE
FT                   DYKKLTKFWGNMMLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFF
FT                   MESTFLGLWMFTWDNQKVSKKVHLSFIWLVVFGSLMSAMWILIANSFMQHPVGYTIENG
FT                   RAQMTDFFALITNPQFFYEYSHVITGAITMGGILVAGMSAFKLLKKETLKETTVSLYKK
FT                   SIRIGLVISLFGSLAVMGAGDLQMKALLHEQPMKFAAMEGDYEDSGDPAAWTVVAWANE
FT                   ADKKQVFGIKVPYMLSILSYGKPSGAVPGMNTANKDLVKKYGERNYFPMVNLLFYSFRL
FT                   MAGFGMLMLGVSVLGLFLTRKKKPVLYQHKWLLRIMALTTFAPFIANTLGWIITEQGRY
FT                   PWTVYGLFTIKDSVSPNVSVASLLISNSVYFVLFSGLGAMMVSLVIRELHKGPEHEEAH
FT                   LSVASQSSIDPFEKGAY"
FT   CDS_pept        91542..92561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="SDEG_0121"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="similar to cytochrome d ubiquinol oxidase subunit II
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80639"
FT                   /db_xref="GOA:C5WE24"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE24"
FT                   /inference="similar to AA sequence:RefSeq:NP_688731.1"
FT                   /protein_id="BAH80639.1"
FT                   /translation="MTALQFFWFFLIGLLFAGFFFLEGFDFGVGMAVQTLAHNEHEKDQ
FT                   IVETIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLVLLTILCGLIIRGVSFEFR
FT                   HKVPAEQKNIWNWTLTIGSALVPFFFGVMFISLIQGVPLDAKGNMMAHFGDYINLFSLV
FT                   GGVAVLLLSYLHGLNYISLKTTGPVRDRARNYAAFLYWVLYLGLLVFALLLFLKTDFFS
FT                   QHALGTLVLLVVIVALSLFAHASVFKQHEMSAFIASGLTFVALVALLFQGLFPRVMISS
FT                   ISSKYDLLIQNASSSPYTLKIMSIVAISLVPFVLAYTVWAYYIFRKRISLPVIVTGDK"
FT   CDS_pept        92561..94276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0122"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1785
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80640"
FT                   /db_xref="GOA:C5WE25"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE25"
FT                   /inference="similar to AA sequence:RefSeq:NP_736219.1"
FT                   /protein_id="BAH80640.1"
FT                   /translation="MLDKAVMRLSGIHKIMGLLVGLDVLQAIFIIGQAYFLSRTITGLW
FT                   QGDTLSVQWPAVCLFLLSYMGRHVITYIKDNRLDHFARRESSQLRKQLLGKLFELGPRI
FT                   VQEEGTGNVITMALDGIGLVENYLHLILSKMINMSIIPWFILAVVFYLDWESGLVLLLV
FT                   FPLIIIFMIILGFAAQAKADRQYASYQRLSNHFLDSLRGIDTLTFFGISKRYGKSIYRS
FT                   SEAFRKATMSSLRIGILSTFALDFFSTLSIAIVAVLLGLRLIKGEILLFPALTVLILSP
FT                   EYFLPVRDFSSDYHATLDGKNAFQAIQKILNRPSHRKAQLELPRWSADSQLVLDNIAIQ
FT                   YGDKGLLEGTYFAVSGFQKVGIIGMSGSGKTSLINLLSGFLETSAGQIRLGDQVLDNLD
FT                   QEAWRQQLLYIPQNPYVFETSLRNNITFYTPDASDQEVWEAIRVVGLEELVTALPDGLD
FT                   TRIGNGARPLSGGQAQRIALARAFLDKNRRVMIFDEPTAHLDIETELELKEKMIPLMEN
FT                   RLVFFATHRLHWLNQMDVILVLEDGHLVEMGDYNSLIAQKGKLYQLTAAMGGDV"
FT   CDS_pept        94273..96021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0123"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1784
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80641"
FT                   /db_xref="GOA:C5WE26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE26"
FT                   /inference="similar to AA sequence:RefSeq:NP_736218.1"
FT                   /protein_id="BAH80641.1"
FT                   /translation="MKKIPLRDALKHDDWVKPYLKQYRIPLVLALFLGFCTFFSAAALM
FT                   FNSGFLISKSASLPTNILLVYIPIVLTRAFGIGRPVFRYLERLTSHNWVLKMTSNLRLK
FT                   LYEAIEQDAVFMKRDYRLGDVMGLLAEDINHLQNLYLRTIFPTIIAWLLYFAIIIGLGF
FT                   FSPFFAIMMVLYFLIILVLFPLWSVVVNGARQKREKALKNALYTDLTDNVMGISDWIFS
FT                   QRGQDYVQLHEASQADLQAVQQQMRHFHHVRSLLFELVFGLLVVLTIIWTSMTFSGNHG
FT                   GQANWIAAFVLSVFPLVDAFAGLSVASQETNVYADSISRLNDLPHPKESETQALSPRVP
FT                   LDFHIENLTFRYGSEEKKVLDHFSLDIKTGEKLAILGRSGSGKSTLATLLRGDLLAEEG
FT                   QILLGGVPVTQLGDQVAEYIGVIQQAPYLFNTTLLNNLRLGNEDASLSQVWEVLDRVGL
FT                   RKMVEQLPDGLNTMVDEAGLRFSGGERHRLALARILLQESPIVILDEPTVGLDSITEKN
FT                   LLATFMEALEGKTLIWITHHLKGIEHADCVIFLEGGKLEMVGTPKQLYATSDRYRRLKA
FT                   IDDGKW"
FT   CDS_pept        complement(96086..97066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0124"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1783
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80642"
FT                   /db_xref="GOA:C5WE27"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE27"
FT                   /inference="similar to AA sequence:RefSeq:NP_736217.1"
FT                   /protein_id="BAH80642.1"
FT                   /translation="MSSFWSKNPRMQAKINQICALIDKRVAVRNPAIETAVVDLSTAGG
FT                   KYLRPAFFYLFSEFGQEESVDEDKLLKIATSLEILHMATLIHDDIIDDSPLRRGQETIQ
FT                   SQFGKDVAVYTGDLLFTVFFELILESMANTPYMTINAKTMKKILMGELNQMHLQFNQEQ
FT                   TIRSYLHSISGKTAELFRLASKEGAYFGGADGKIVALAGRIGFNIGMAFQILDDILDYT
FT                   ADQNTFNKPVLEDLTTGVYSLPLLFTLQKEPTSFKPLLDKGKAITLAERQLVSQKVIDL
FT                   GGIEASRQLARRFTEKAIIDIKQLPKIKAQKQLLQLTDHLLKRHI"
FT   CDS_pept        97322..98173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SDEG_0125"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="similar to 4-diphosphocytidyl-2-C-methyl-D-
FT                   erythritol kinase [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80643"
FT                   /db_xref="GOA:C5WE28"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE28"
FT                   /inference="similar to AA sequence:RefSeq:YP_002122497.1"
FT                   /protein_id="BAH80643.1"
FT                   /translation="MVTIIERAPAKINLGLDIQGKRSDGYHDLSMVMVSIDLCDYVTVD
FT                   HLDEDRIVFSSNCPKMPTNHNNDVYKAAQLMKDRFQIKTGVSLFLEKRIPVCAGMGGGS
FT                   SDAAATIRALNQLWHLDLSQKDMIEIGMQIGSDVPYCLVAGCAQVTGKGEVVSQLAGQL
FT                   SSWVVLVKPEFGISTRTVFPDINCDTISRVSIANLVAAIEAGDYNGILAEMGNSLEGIS
FT                   IAKRPFIQKIKDKMMQSGADIALMTGSGPTVFALCQTEKQANRVVNSLKGFCKEVYKVR
FT                   TL"
FT   CDS_pept        98242..98685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcR"
FT                   /locus_tag="SDEG_0126"
FT                   /product="putative repressor protein"
FT                   /note="similar to putative repressor protein [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80644"
FT                   /db_xref="GOA:C5WE29"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE29"
FT                   /inference="similar to AA sequence:RefSeq:NP_663873.1"
FT                   /protein_id="BAH80644.1"
FT                   /translation="MGTLEKKLDSLVNAILMKAENQHELLFGACQSDVKLTNTQEHILM
FT                   LLSQERLTNTDLARKLNISQAAVTKAIKSLVKQDMLAGTKDTVDARVTYFELTELAKPI
FT                   AKEHTHHHDETLNVYSRLLKKFSAEEQEVVDKFLTVFAEELEG"
FT   CDS_pept        98689..99408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcC"
FT                   /locus_tag="SDEG_0127"
FT                   /product="ABC transporter"
FT                   /note="similar to ABC transporter (ATP-binding protein)
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80645"
FT                   /db_xref="GOA:C5WE30"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE30"
FT                   /inference="similar to AA sequence:RefSeq:NP_663874.1"
FT                   /protein_id="BAH80645.1"
FT                   /translation="MRYISVENLSFQYESEPVLEGITYHLDSGEFVTMTGENGAAKSTL
FT                   IKATLGILKPKVGQVTIAKKNKDGKKLRIAYLPQQVASFNAGFPSTVYEFVKSGRYPRS
FT                   GWFRHLNKHDEEHVQASLEAVGMWESRHKRIGSLSGGQKQRVVIARMFASDPDIFVLDE
FT                   PTTGMDSGTTDTFYELMHHSAHKHGKSVLMITHDPEEVKSYADRNIHLIRNQKLPWRCF
FT                   NIHDVEADDDKGGHAHA"
FT   CDS_pept        99362..100213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adcB"
FT                   /locus_tag="SDEG_0128"
FT                   /product="high-affinity zinc uptake system membrane
FT                   protein"
FT                   /note="similar to high-affinity zinc uptake system membrane
FT                   protein znuB [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80646"
FT                   /db_xref="GOA:C5WE31"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE31"
FT                   /inference="similar to AA sequence:RefSeq:YP_599678.1"
FT                   /protein_id="BAH80646.1"
FT                   /translation="MMLKRTMIKEVMRMLDILSYDFMQRAVMAVVAISIFAPILGIFLI
FT                   LRRQSLMSDTLSHVSLAGVAFGVVLGISPTITTIIVVVLAAILLEYLRVVYKHYMEIST
FT                   AILMSLGLALSLIIMSKSNSSSNMSLEQYLFGSIITISMEQVIALFAIAVIILVLTILF
FT                   IRPMYILTFDEDTAFVDGLPVRLMSVLFNIVTGVAIALTIPAAGALLVSTIMVLPASIA
FT                   MRLGKNFKSVIFIGIAIGFVGMLCGIFLSYYWETPASATITMIFISIFLVVNLLALIRK
FT                   KL"
FT   CDS_pept        complement(100262..101518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="SDEG_0129"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="similar to tyrosyl-tRNA synthetase [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80647"
FT                   /db_xref="GOA:C5WE32"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE32"
FT                   /inference="similar to AA sequence:RefSeq:NP_663877.1"
FT                   /protein_id="BAH80647.1"
FT                   /translation="MNIFEELKARGLVFQTTDEQALVKALTEGQVSYYTGYDPTADSLH
FT                   LGHLVAILTSRRLQLAGHKPYALVGGATGLIGDPSFKDAERSLQTKETVLEWSDKIKGQ
FT                   LSTFLDFENGDNKAELVNNYDWFSQISFIDFLRDVGKYFTVNYMMSKDSVKKRIETGIS
FT                   YTEFAYQIMQGYDFYELNNKHNVTLQIGGSDQWGNMTAGTELLRRKADKAGHVMTVPLI
FT                   TDSTGKKFGKSEGNAVWLDADKTSPYEMYQFWLNVMDDDAVRFLKIFTFLSLDEIADIE
FT                   SQFNAARHERLAQKTLAREVVTLVHGEEAYKQALNITEQLFAGNIKNLSANELKQGLSN
FT                   VPNYHVQSADSLNLVDMLVTAGISPSKRQAREDVQNGAIYINGERVQELDYTLSDTDKI
FT                   DNQLTVVRRGKKKYAVLTY"
FT   CDS_pept        101613..103925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0130"
FT                   /product="multimodular transpeptidase-transglycosylase"
FT                   /EC_number="2.4.1.-"
FT                   /note="similar to multimodular
FT                   transpeptidase-transglycosylase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80648"
FT                   /db_xref="GOA:C5WE33"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE33"
FT                   /inference="similar to AA sequence:RefSeq:YP_059448.1"
FT                   /protein_id="BAH80648.1"
FT                   /translation="MRYFMVKWNTKRKRKGEQGLGLLDLGPVLLRTLKLMSNFFYIIIF
FT                   LFGMMGAGMALGYLASQIDSVKVPSKASLVKQVKSLTMISQMNYSDNSVIATLDTDLLR
FT                   TPVANEAISDNIKKAIVSTEDENFQGHQGVVPKAVFRATLASVLGFGESSGGSTLTQQL
FT                   VKQQVLGDDPTFKRKSKEIIYALALERYMSKDDILSNYLNVSPFGRNNKGQNIAGVEEA
FT                   ARGIFGVSAKDLTVPQAAFLAGLPQSPIVYSPYMSTGQMKSEEDMSYGIKRQQNVLYNM
FT                   YRIGVLTKKEYDDYKAYPISKDFIQPGSVTVTNHDYLYYTVLADAKKAMYSYLIKRNKV
FT                   SSRDLKNDATKAAYEERALTELQQGGYTITTTINKPIYNAMQTAAAQFGGLLDDGTGTV
FT                   QMGNVLTDNATGAILGFIGGRDYALNQNNHAFDTVRSPGSSIKPVISYGPAIDQGLMGS
FT                   ASVLSNYPTTYSSGQKIMHADSEGTAMMPLQEAINTSWNIPAFWTQKLLREKGVDVEDY
FT                   MTKMGYKIADYSIESLPLGGGIEVSVAQQTNAYQMISNNGMYQKQYLVDKITASDGTVV
FT                   YQHESKPVRVFSAPTATILQDLLRGPVSSGATTTFKSRLAAINPSLANADWIGKTGTTE
FT                   NYTDVWLVLATPRATLGGWAGHDDNTSLAPMTGYNNHSNYLAHLANAINQADPNVLGGG
FT                   QRFALDPGVVKASVLKSTGLQPGTVTVNGRAFSVGGEMTTSLWAQKGPGAMTYRFAIGG
FT                   TDADYQKAWASFGGKKN"
FT   CDS_pept        104189..107755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="SDEG_0131"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /note="similar to DNA-directed RNA polymerase beta subunit
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80649"
FT                   /db_xref="GOA:C5WE34"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE34"
FT                   /inference="similar to AA sequence:RefSeq:NP_663879.1"
FT                   /protein_id="BAH80649.1"
FT                   /translation="MAGHEVRYGKHRTRRSFSRIKEVLDLPNLIEIQTDSFQDFLDSGL
FT                   KEVFEDVLPISNFTDTMELEFVGYEFKEPKYTLEEARIHDASYSAPIFVTFRLVNKETG
FT                   EIKTQEVFFGDFPIMTEMGTFIINGGERIIVSQLVRSPGVYFNDKVDKNGKVGYGSTVI
FT                   PNRGAWLELETDSKDIAYTRIDRTRKIPFTTLVRALGFSGDDEIVDIFGESDLVRNTIE
FT                   KDIHKNPSDSRTDEALKEIYERLRPGEPKTADSSRSLLIARFFDARRYDLAAVGRYKVN
FT                   KKLNIKTRLLNQIIAENLVDAETGEILVEAGTEMTRSVIESIEEHLDGDLNKFVYTPND
FT                   YAVVTEPVVLQKFKVVSPIDPDRVVTIVGNANPDDKVRALTPADILAEMSYFLNLAEGL
FT                   GKVDDIDHLGNRRIRAVGELLANQFRIGLARMERNVRERMSVQDNDVLTPQQIINIRPV
FT                   TAAVKEFFGSSQLSQFMDQHNPLSELSHKRRLSALGPGGLTRDRAGYEVRDVHYTHYGR
FT                   MCPIETPEGPNIGLINNLSSFGHLNKYGFIQTPYRKVDRATGRVTNEIVWLTADEEDEY
FT                   TVAQANSKLNEDGTFAEEIVMGRHQGNNQEFSASVVDFVDVSPKQVVAVATACIPFLEN
FT                   DDSNRALMGANMQRQAVPLIDPKAPYVGTGMEYQAAHDSGAAVIAQHNGKVVFSDAEKV
FT                   EVRREDGSLDVYHITKFRRSNSGTAYNQRTLVKVGDIVEKGDFIADGPSMENGEMALGQ
FT                   NPVVAYMTWEGYNFEDAVIMSERLVKEDVYTSVHLEEFESETRDTKLGPEEITREVPNV
FT                   GEEALKDLDEMGIIRIGAEVKEGDILVGKVTPKGEKDLSAEERLLHAIFGDKSREVRDT
FT                   SLRVPHGGDGIVRDVKIFTRANGDELQSGVNMLVRVYIAQKRKIKVGDKMAGRHGNKGV
FT                   VSRIVPVEDMPYLPDGTPVDIMLNPLGVPSRMNIGQVMELHLGMAARNLGIHIATPVFD
FT                   GASSEDLWDTVREAGMDSDAKTVLYDGRTGEPFDNRVSVGVMYMIKLHHMVDDKLHARS
FT                   VGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGASNVLQEILTYKSDDVTGRLKAYE
FT                   AITKGKPIPKPGVPESFRVLVKELQSLGLDMRVLDEDDNEVELRDLDEGEDDDVMHVDD
FT                   LEKAREKQVQETQEVSETTDEK"
FT   CDS_pept        107851..111492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="SDEG_0132"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="similar to DNA-directed RNA polymerase beta subunit
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80650"
FT                   /db_xref="GOA:C5WE35"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE35"
FT                   /inference="similar to AA sequence:RefSeq:YP_279551.1"
FT                   /protein_id="BAH80650.1"
FT                   /translation="MVDVNRFKSMQITLASPSKVRSWSYGEVKKPETINYRTLKPEREG
FT                   LFDEVIFGPTKDWECACGKYKRIRYKGIVCDRCGVEVTRAKVRRERMGHIELKAPVSHI
FT                   WYFKGIPSRMGLTLDMSPRALEEVIYFAAYVVIDPMDTPLEPKSLLTEREYREKLQEYG
FT                   HGSFIAKMGAEAIQDLLKRVDLAAEIAELKEELKSASGQKRIKAVRRLDVLDAFHKSGN
FT                   KPEWMVMNILPVIPPDLRPMVQLDGGRFAASDLNDLYRRVINRNNRLARLLELNAPGII
FT                   VQNEKRMLQEAVDALIDNGRRGRPITGPGSRPLKSLSHMLKGKQGRFRQNLLGKRVDFS
FT                   GRSVIAVGPTLKMYQCGVPREMAIELFKPFVMREIVAKEYAGNVKAAKRMVERGDERIW
FT                   DILEEVIKEHPVLLNRAPTLHRLGIQAFEPVLIDGKALRLHPLVCEAYNADFDGDQMAI
FT                   HVPLSEEAQAEARLLMLAAEHILNPKDGKPVVTPSQDMVLGNYYLTMEDAGREGEGMIF
FT                   KDKDEAVMAYRNGYAHLHSRVGIAVDSMPNKPWKDSQRHKIMVTTVGKILFNDIMPEDL
FT                   PYLQEPNNANLTEGTPDKYFLEPGQDIQEVIDRLDINVPFKKKNLGNIIAETFKRFRTT
FT                   ETSAFLDRLKDLGYYHSTLAGLTVGIADIPVIDNKAEIIDAAHHRVEEINKAFRRGLMT
FT                   DDDRYVAVTTTWREAKEALEKRLIETQNPKNPIVMMMDSGARGNISNFSQLAGMRGLMA
FT                   APNGRIMELPILSNFREGLSVLEMFFSTHGARKGMTDTALKTADSGYLTRRLVDVAQDV
FT                   IIREDDCGTDRGLLIRAITDGKEVTETLEERLQGRYTRKSVKHPETGEVLIGADQLITE
FT                   DMARKIVDAGVEEVTIRSVFTCATRHGVCRHCYGINLATGDAVEVGEAVGTIAAQSIGE
FT                   PGTQLTMRTFHTGGVASNTDITQGLPRIQEIFEARNPKGEAVITEVKGNVVEIEEDAST
FT                   RTKKVYVQGKTGMGEYVVPFTARMKVEVGDEVNRGAALTEGSIQPKRLLEVRDTLSVET
FT                   YLLAEVQKVYRSQGVEIGDKHVEVMVRQMLRKVRVMDPGDTDLLPGTLMDISDFTDANK
FT                   DIVISGGIPATSRPVLMGITKASLETNSFLSAASFQETTRVLTDAAIRGKKDHLLGLKE
FT                   NVIIGKIIPAGTGMARYRNIEPQAINDVEVIDKPEVSEETVAATETE"
FT   CDS_pept        111695..112060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0133"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to putative DNA binding protein
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80651"
FT                   /db_xref="GOA:C5WE36"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE36"
FT                   /inference="similar to AA sequence:RefSeq:NP_606415.1"
FT                   /protein_id="BAH80651.1"
FT                   /translation="MYQVIKMYGDWEPWWFIDGWQDDILEEKKFDEWTEAFAYFEEEWQ
FT                   NMRNHFPSYHSQKNLLATFWEKKDTRWCEDCGEDLQQYHSILLLKNRDIVPNTHYMPDF
FT                   EQRNDSPQNASFCKLNL"
FT   CDS_pept        112141..113082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0134"
FT                   /product="ComG operon protein 1"
FT                   /note="similar to ComG operon protein 1 [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80652"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE37"
FT                   /inference="similar to AA sequence:RefSeq:YP_059452.1"
FT                   /protein_id="BAH80652.1"
FT                   /translation="MVQALARSILKEAEQIQAQDIYILPKEDQYELLIRVGDERRLVDV
FT                   YRGDRMAHLISHFKFVAGMTVGEKRRCQVGSCDYDIGGDTLLSLRLSSVGNYRGQESLV
FT                   IRLLHHQQRSLHYWFDGLKTVARQIGGRGLYLFAGPVGSGKTTLMHQLIADYYQGAQVI
FT                   SIEDPVEIKNHQALQLQVNDSIGMTYDNLIKLSLRHRPDILIIGEIRDSQTARAVIRAS
FT                   LTGVLVFSTVHAKSISGVYARLLELGVTRAELDNCLALVAYQRLLNGGALIDSTQTEFE
FT                   HYSPNQWNQKIDDLLAAGHLSPEQARFEKIIQ"
FT   CDS_pept        112958..114049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0135"
FT                   /product="putative competence protein, ABC transporter
FT                   subunit"
FT                   /note="similar to putative competence protein ABC
FT                   transporter subunit [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80653"
FT                   /db_xref="GOA:C5WE38"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE38"
FT                   /inference="similar to AA sequence:RefSeq:NP_606417.1"
FT                   /protein_id="BAH80653.1"
FT                   /translation="MTQLKQNLNTTHQTNGIRKLMTFLQRDISVRSKQGLKKLSSKEQY
FT                   KLIQLLANLLLTGFNLAEIIAFLTKSHLIPEPYVLRMEEALLKGRGLADMLAGIGFSDA
FT                   ILTQISLADGHGNIETTLVNIQGYLNQMAKLKRKTIEVVTYPIILLVFLFVMILGLRHY
FT                   VMPQLEAQNQLTIFLTHFPAIFFGIILFIGVLLGGIWLHWRSQSRLKLFTHFSAYPVLG
FT                   KLLQQYLTAYYAREWGTLIGQGLELPVILDIMAMEKSLFMQELAEDIRVSLLAGQAFHD
FT                   KVATYPFFKKELSLMITYGEIKSKLGSELEIYAQESWTQFFSQLHQATQFIQPIIFLVI
FT                   ALTIVMIYAAILLPIYQNMGGVL"
FT   CDS_pept        114051..114377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0136"
FT                   /product="putative competence protein"
FT                   /note="similar to putative competence protein
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80654"
FT                   /db_xref="GOA:C5WE39"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE39"
FT                   /inference="similar to AA sequence:RefSeq:NP_606418.1"
FT                   /protein_id="BAH80654.1"
FT                   /translation="MKNQWKPLRQYQLQAFTLLEMLLVILVISVLMLLFVPNLSKQKDR
FT                   VTETGNAAVVKLVENQAELYELSQGSKPSLSQLKTDGSITDKQVKAYTDYYGKHRDETQ
FT                   KLQP"
FT   CDS_pept        114337..114780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0137"
FT                   /product="putative competence protein"
FT                   /note="similar to putative competence protein
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80655"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE40"
FT                   /inference="similar to AA sequence:RefSeq:NP_663885.1"
FT                   /protein_id="BAH80655.1"
FT                   /translation="MENTEMRLKNCNLKAFTMLESLLTLSVTSFIVLGLSVPVTSSYRR
FT                   VQEQLFFTRFEHFYRHQQKLAILEHDQRVLTISSKQMLAAEESLTIPDLIRVKNSQQLV
FT                   IDQMGGNHSLAKIIFETTDQRVTYQFYLGSGNYQKTSQSLHRS"
FT   CDS_pept        114737..115033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0138"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM3 0082
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80656"
FT                   /db_xref="GOA:C5WE41"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE41"
FT                   /inference="similar to AA sequence:RefSeq:NP_663886.1"
FT                   /protein_id="BAH80656.1"
FT                   /translation="MEIIKKQVKAYIALESVMATGLLVAIVILVLTSLEQSQTRLTYYR
FT                   SQQEKLNLALMAVQTGQASLNMNDYRLTVLRTEKTLIVRDQEGEVIRIEKKDR"
FT   CDS_pept        115014..115454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comYD"
FT                   /locus_tag="SDEG_0139"
FT                   /product="comG operon protein 6"
FT                   /note="similar to comG operon protein 6 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80657"
FT                   /db_xref="GOA:C5WE42"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE42"
FT                   /inference="similar to AA sequence:RefSeq:YP_281455.1"
FT                   /protein_id="BAH80657.1"
FT                   /translation="MKKRTGRVQAFTFLEALIALLVISGSLLVYQGLTKTLLSHSRYLT
FT                   KNDQDHWLLFSQQLREELSGARFHKVENNKLYIEKGKKKLVLGQFKSHDFRKSAGNGQG
FT                   YQPMLFGLSHSHIQAEQSRIRITLHWKSGLERTFYYAFQDQP"
FT   CDS_pept        115432..115806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0140"
FT                   /product="comG operon protein 6"
FT                   /note="similar to comG operon protein 6 [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80658"
FT                   /db_xref="GOA:C5WE43"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE43"
FT                   /inference="similar to AA sequence:RefSeq:YP_601593.1"
FT                   /protein_id="BAH80658.1"
FT                   /translation="MRFKTNLKAGILLYSMFMACVFMLVLQVYLYQVSYCHKEYQAQTA
FT                   YVRARLMAEMVYQTQNQDLERVVFEEGVVTSRFNKHQHVMTVTLGQKKHYQFYYPRNTK
FT                   QPSKENASQAISLPDGTLSP"
FT   CDS_pept        115869..116822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0141"
FT                   /product="adenine-specific methyltransferase"
FT                   /EC_number="2.1.1.72"
FT                   /note="similar to adenine-specific methyltransferase
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80659"
FT                   /db_xref="GOA:C5WE44"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE44"
FT                   /inference="similar to AA sequence:RefSeq:YP_599692.1"
FT                   /protein_id="BAH80659.1"
FT                   /translation="MNFEKIEEAYQLLLENSQLIENDLKTHIYDAIVEQNSFYLGAEGA
FT                   SPQVAQNINKLKALHLTKEEWRRAYQFIFIKAAQTEQLQANHQFTPDAIGFILLYLLEQ
FT                   LSDKDSLEVLEIGSGTGNLAQTLLNNTSKKLDYVGIELDDLLIDLSASIAEVMDSSARF
FT                   IQEDAVRPQLLKESDVVISDLPVGYYPNDDIAKRYKVASSEEHTYAHHLLMEQSLKYLK
FT                   KDGFAIFLAPVNLLTSSQSQLLKNWLTGYAQVVALITLPDSIFGHPSNAKSIIVLQKQT
FT                   DHPMETFVYPIRDLKLAENIHDFMQNFKKWKQDNVN"
FT   CDS_pept        116881..118077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SDEG_0142"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="similar to acetate kinase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80660"
FT                   /db_xref="GOA:C5WE45"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE45"
FT                   /inference="similar to AA sequence:RefSeq:YP_599693.1"
FT                   /protein_id="BAH80660.1"
FT                   /translation="MSKTIAINAGSSSLKWQLYQMPEEEVLAQGIIERIGLKDSISTVK
FT                   YDGKKEEQILDIHDHAEAVKILLNDLIHFGIIAAYDEITGVGHRIVAGGEYFKESVVVN
FT                   DTVVEQVEELSALAPLHNPGAAAGIRAFRDILPDITSVCVFDTSFHTSMAKYTYLYPIP
FT                   QKYYTDYKVRKYGAHGTSHKYVAEEAAKMLGRPLEELKLITAHIGNGVSITANYHGKSV
FT                   DTSMGFTPLAGPMMGTRSGDIDPAIIPYLIEQDPELKDAADVVNMLNKKSGLGGVSGIS
FT                   SDMRDIEAGLQENNPDAVLAYNIFINRIKKFIGQYFAVLNGADALVFTAGMGENAPLMR
FT                   QDVIGGLTWFGMDIDPEKNVFGYRGDISTPESKVKVLVISTDEELCIARDVERLKNTK"
FT   CDS_pept        118384..118590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0143"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /note="similar to putative HTH-type transcriptional
FT                   regulator [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80661"
FT                   /db_xref="GOA:C5WE46"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE46"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124191.1"
FT                   /protein_id="BAH80661.1"
FT                   /translation="MDNRIQELRKARHISQAELADAMNVTRQTIISLEKGRYNASLELA
FT                   YKLAIFFQLSIEEIFLFDQEESD"
FT   CDS_pept        118693..119373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0144"
FT                   /product="hypothetical protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to membrane-bound protease CAAX family
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80662"
FT                   /db_xref="GOA:C5WE47"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE47"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124189.1"
FT                   /protein_id="BAH80662.1"
FT                   /translation="MTTGYITKLKAIFARLRWFLLALIVIVLEQLPTLWIRKGQPFGQV
FT                   LIITGILLLITTVVFYFGKRLGLLGNKRVPEDEYRWLWIGLGLVSLFAVQIIGKMILVI
FT                   EKGQQADTVNQSAILGVGMHPILLVTLVGLVAPIVEEIVFRGLLYDKLFGPKSYIGLMF
FT                   SSFMFGLIHVPTDFGSWIIYGGMGLILGLVYRKTQKLEHVMLVHFLNNGIALILIAFAT
FT                   KMIS"
FT   CDS_pept        119391..119828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0145"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein Sez 1851
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80663"
FT                   /db_xref="GOA:C5WE48"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE48"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124188.1"
FT                   /protein_id="BAH80663.1"
FT                   /translation="MKKEPSLKQKCQYWEKVYTRIGHVLVALGFLSATWGIWLMTRGNM
FT                   RQGTLFFFLAPLFLIASTFFFYVFTEPTDLKNYLVALHDERNRAIRKQTQVYCFYVIIN
FT                   LFIVLYFFFPQLTIRDLVSYKLPLILAYLYFFLRHWVSKKM"
FT   CDS_pept        complement(119967..120743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SDEG_0146"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="similar to pyrroline-5-carboxylate reductase
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80664"
FT                   /db_xref="GOA:C5WE49"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE49"
FT                   /inference="similar to AA sequence:RefSeq:NP_268508.1"
FT                   /protein_id="BAH80664.1"
FT                   /translation="MKIGIIGVGKMASAMITGLKKTPHELIISGSSLERSREIAEQLSL
FT                   SYASSHQELIDQVDLVILGIKPQLFKAVLHPLHFRQPIISMAAGISLQDLATLVGEDLP
FT                   LLRIMPNMNAQILQSSTALTGNALVSKELQASVQELTDSFGSTFIIDEKDFDTFTALAG
FT                   SSPAYIYLFIEALAKAGVNNGLPKPKALDIITQTVLASANNLLASQQSPNEFIDAICSP
FT                   GGTTIAGLMELERLGLTATVSSAIDKTIDKAKHLQK"
FT   CDS_pept        complement(120790..121857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="SDEG_0147"
FT                   /product="glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="similar to glutamyl aminopeptidase [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80665"
FT                   /db_xref="GOA:C5WE50"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017538"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE50"
FT                   /inference="similar to AA sequence:RefSeq:YP_601598.1"
FT                   /protein_id="BAH80665.1"
FT                   /translation="MTDLFSKIKEVTELDGIAGYEHSVRDYLRTKITPLVDRVETDGLG
FT                   GIFGIRDSKADQAPRILVAAHMDEVGFMVSDIKADGTLRVVGIGGWNPLVVSSQRFTLY
FT                   TRTGQAIPLISGSVPPHFLRGANGSASLPNIEDIVFDGGFTDKAEAESFGITPGDIIVP
FT                   QSETILTANQKNIISKAWDNRYGVLMVTEMLEALKGQDLNNTLIAGANVQEEVGLRGAH
FT                   VSTTKFDPELFFAVDCSPAGDIYGNPGTIGDGTLLRFYDPGHVMLKDMRDFLLTTAEEA
FT                   GVSFQYYCGKGGTDAGAAHLQNSGVPSTTIGVCARYIHSHQTLYAMDDFVEAQTFLQAI
FT                   VKKLDRSTVDLIKRY"
FT   CDS_pept        complement(122032..122220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0148"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0105
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80666"
FT                   /db_xref="GOA:C5WE51"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE51"
FT                   /inference="similar to AA sequence:RefSeq:YP_601599.1"
FT                   /protein_id="BAH80666.1"
FT                   /translation="MEGSFMTPLSLLFASGESFRIISAILFLLTSLCFIILIITLLPKK
FT                   TAYGKKASPLHRNPREF"
FT   CDS_pept        122407..122700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0149"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80667"
FT                   /db_xref="InterPro:IPR028105"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE52"
FT                   /inference="similar to AA sequence:RefSeq:YP_281463.1"
FT                   /protein_id="BAH80667.1"
FT                   /translation="MKSMNKKQTGILSGLLGAGLVLGLGLMINDYYQEKERQHITRDLR
FT                   AFFSDLGHIDVLYVTPKLPRVVQVSGGVVMADGRHYTYTYDRGQISIEEERI"
FT   CDS_pept        122697..123014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="SDEG_0150"
FT                   /product="putative thioredoxin"
FT                   /note="similar to putative thioredoxin [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80668"
FT                   /db_xref="GOA:C5WE53"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE53"
FT                   /inference="similar to AA sequence:RefSeq:NP_606430.1"
FT                   /protein_id="BAH80668.1"
FT                   /translation="MIVPSTYEELAGLIENEDKLVLFFTADWCPDCQFIYPVMPDIEAE
FT                   HTNMTFVRVNRDQFIEVAQKWDIFGIPSFVVIEKGQEVGRLVNKMRKTKTEIMHFLAAY
FT                   Q"
FT   CDS_pept        123032..123658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0151"
FT                   /product="tRNA binding domain protein"
FT                   /note="similar to tRNA binding domain protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80669"
FT                   /db_xref="GOA:C5WE54"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027855"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR037154"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE54"
FT                   /inference="similar to AA sequence:RefSeq:YP_059468.1"
FT                   /protein_id="BAH80669.1"
FT                   /translation="MIFAYNKEQVGDVLMVILQDTKDIKRQVERKGKVARVFAEENGKT
FT                   LAWNIFEASSLVTLTGNGQVFLTDEDVATLNDELAKEGFSERLEPTAGPVFVVGQIVEM
FT                   VAHPDSDHLNICQVAIGEDQTVQIVAGAPNAALGLKTIVALPGAMMPSGSLIFPGKLRG
FT                   EESYGMMCSPRELALPNAPQKRGIIELDESAVVGEAFDPAKHWKG"
FT   CDS_pept        123810..124205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0152"
FT                   /product="single-strand DNA-binding protein"
FT                   /note="similar to single-strand DNA-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80670"
FT                   /db_xref="GOA:C5WE55"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE55"
FT                   /inference="similar to AA sequence:RefSeq:YP_059469.1"
FT                   /protein_id="BAH80670.1"
FT                   /translation="MYNKVIVIGRLVAKPELVKTATDKHVARLSLAVNRRFKNASGERE
FT                   ADFISVVVWGKLAETLVSYASKGSLMSIDGELRTRKYDKDGQVHYVTEVLCQSFQLLES
FT                   RAQRAMRENNVTNDLVDLVLEEDTLPF"
FT   CDS_pept        complement(124465..125154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0153"
FT                   /product="deoxyadenosine kinase"
FT                   /EC_number="2.7.1.76"
FT                   /note="similar to deoxyadenosine kinase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80671"
FT                   /db_xref="GOA:C5WE56"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE56"
FT                   /inference="similar to AA sequence:RefSeq:YP_059470.1"
FT                   /protein_id="BAH80671.1"
FT                   /translation="MKPSSKQYANDIRRRHMLIVLAGTIGAGKSSLAAALGEHLGTDVF
FT                   YEAVDNNPVLDLYYQDPKKYAFLLQIYFLNKRFKSIKEAYQADNNILDRSIFEDELFLK
FT                   LNYKNGNVTKTELDIYQELLANMLEELEGMPKKRPDLLIYIDVSFDKMLERIEKRGRSF
FT                   EQVDGNPSLEQYYHQVHGEYPTWYEDYKVSPKMKIDGNSLDFVQNPDDLATVLQMVDDK
FT                   LKELHLL"
FT   CDS_pept        complement(125126..126190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0154"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="similar to tRNA-dihydrouridine synthase
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80672"
FT                   /db_xref="GOA:C5WE57"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE57"
FT                   /inference="similar to AA sequence:RefSeq:YP_599703.1"
FT                   /protein_id="BAH80672.1"
FT                   /translation="MTKIRVLRLFANFVVPSTNLMKVIWRPSSMIKLNSSFRIGDVEIP
FT                   HRTVLAPMAGVTNSAFRTIAKEFGAGLVVMEMISEKGLLYNNEKTLHMLHIDENEHPMS
FT                   IQLFGGDAEGLKRAADFIQTNTKADIVDINMGCPVNKVVKNEAGAKWLRDPDKIYHIVK
FT                   EVTSVLDIPLTVKMRTGWADSSLAVENALAAESAGVSALAMHGRTREQMYTGTCDHETL
FT                   ARVSKAITKIPFIGNGDVRSVQDAKFMIEEIGVDAVMIGRAAMNNPYLFTQINHFFETG
FT                   QELPDLPFAKKLDIAKDHLKRLINLKGETIAVREFRGLAPHYLRGTAGAAKVRGAVSRA
FT                   ETLAEVEAIFETVR"
FT   CDS_pept        complement(126090..126962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="SDEG_0155"
FT                   /product="Hsp33-like chaperonin"
FT                   /note="similar to Hsp33-like chaperonin [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80673"
FT                   /db_xref="GOA:C5WE58"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE58"
FT                   /inference="similar to AA sequence:RefSeq:NP_606435.1"
FT                   /protein_id="BAH80673.1"
FT                   /translation="MDKIIKSIAQSGAFRAYVLDSTETVALAQEKHNTLSSSTVALGRT
FT                   LIANQILAANQKGDSKITVKVIGDSSFGHIISVADTKGHVKGYIQNTGVDIKKTATGEV
FT                   LVGPFMGNGHFVTIIDYGTGNPYTSTTPLITGEIGEDFAYYLTESEQTPSAIGLNVLLD
FT                   ENDKVKVAGGFMVQVLPGASEEEIARYEKRLQEMPAISHLLASKNHVDALLEAIYGDEP
FT                   YKRLSEEPLSFQCDCSRERFEAALMTLPKADLQAMIDEDKGAEIVCQFCGTKYQFNESD
FT                   LEAIINDKA"
FT   CDS_pept        complement(127109..128701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rofA"
FT                   /locus_tag="SDEG_0156"
FT                   /product="transcriptional regulator"
FT                   /note="similar to transcriptional regulator RofA
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80674"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE59"
FT                   /inference="similar to AA sequence:RefSeq:YP_601607.1"
FT                   /protein_id="BAH80674.1"
FT                   /translation="MISIFSLDRIEIGEYTYQRLIWLSKCRKRGPLSLIEKYLESSIES
FT                   KCQLVVLFFKTSSLLITEVAEKTGLTFSQLNHYCEELNAFFPDSLSMTIQKRMISCQFT
FT                   HPFKETYLYQLYASSNVLQLLAFLIKNGSHSRPLTDFARSHFLSNSSAYRMREALIPLL
FT                   RNFELKLSKNKIVGEEYRIRYLIALLYSKFGIKVYDLTQQDKNTIHSFLSHSSTHLKTS
FT                   PWLSESFSFYDILLALSWKRHQFSVTIPQTRIFQQLKKLFVYDSLKKSSHDIIETYYQL
FT                   NFSAGDLDYLYLIYITANNSFASLQWTPEHIRQCCQLFEENDTFRLLLKPIITLLPNLK
FT                   EQKASLVKALMFFSKSFLFNLQHFIPETNLFVSPYYKGNQKLYTSLKLIVEEWMAKLPG
FT                   KRYLNHKHFHLFCHYVEQILRNIQPPLVVVFVASNFINAHLLTDSFPRYFSDKSIDFHS
FT                   YYLLQDNVYQIPDLKPDLVITHSQLIPFVQHELTKGIAVAEISFDESILSIQELIYQVK
FT                   EEKFQADLTKQLT"
FT   CDS_pept        128883..130817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0157"
FT                   /product="fimbrial subunit protein"
FT                   /note="similar to fimbrial subunit protein FszF
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80675"
FT                   /db_xref="GOA:C5WE60"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR032334"
FT                   /db_xref="InterPro:IPR032364"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE60"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124169.1"
FT                   /protein_id="BAH80675.1"
FT                   /translation="MKLSKKTLYSALALTMLTSASIAPVAQTISGMVVRAETVTLKENT
FT                   DVVPEDRISKTELPEKTTVNVHKIVAKKYNDGVPVTNENGLPLGQDSLNKLGTEVRGLK
FT                   GVTFSVYRVTEEGLSTLVDSTTGNASQELKNVGTIEAAQKLIESKKIEFVKNYTTSEDG
FT                   VAVASLNSQITQKDGKKASATYLFLETATPENISSALAVPFTLTLPSSTSSGTGYLKTI
FT                   DVYPKNIDGEKPKVGKDVSVLGNNIMPMNVNEEISFFLKGSVPTNIQDFTQYTFTDTLD
FT                   KAIKFVPNSVQVTLGKLTLDSKYYTVEAPSDTNNNTLKVNLTTKGIAYVSEQTTLKERQ
FT                   ASMALEIADVSENLDAKPFIQVEFKAKLDASKVIVGKAIENKTKISYNNRSGKGFDPNT
FT                   PITPPGENTPPTPPTPITPKESDESDKVIVVTGGKTFTKVDAISKDRGLHNAEFEIYPS
FT                   TENGEKSAKALTWTQELIDLNKAKANQENVSKFGGKVEVGEKIILKSNTDGNFEIAGIT
FT                   LGTVNQKTDREGVTSVTVNGKKIEAAGTQSAADSLPAGVYYLQEMRAPEGYAVNTTPIK
FT                   FEVTTTSYNKTPSTLTANAADAEPQKVENNKRPEIPNTGGIGTAIFVVIGVAIMAFAAK
FT                   GMKHHKEEN"
FT   CDS_pept        130900..131844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fszE"
FT                   /locus_tag="SDEG_0158"
FT                   /product="T-antigen-like fimbrial structural subunit
FT                   protein"
FT                   /note="similar to T-antigen-like fimbrial structural
FT                   subunit protein FszE [Streptococcus equi subsp.
FT                   zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80676"
FT                   /db_xref="GOA:C5WE61"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE61"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124168.1"
FT                   /protein_id="BAH80676.1"
FT                   /translation="MQKLLKYLCSFWLVLGLLGFHLPVLAQENQAQLTVVHLASRDIDR
FT                   PNPQLDLAPRSGKPVEGVTYRLYQFQLGQIVQPMSYWEKLALQELEEQAQAVFEAKTDA
FT                   QGHAAFLQLPVGIYYGVAVENQQRHAGVAGFLVDLTGDTGYVKTVYPKVIWPTGGFHLL
FT                   KRGVDGKEKKPLAGVSFELYEENGLTPLRVKNGLHSYDLDAQTVLNTDSEGHLDVAGLL
FT                   PGNYYLKEVATAKGYRLKTDAISVQIQAHQTKPLIVDNQKETPPPVKSSKRIWDWIPKT
FT                   GEEQARALIGIGLVLMVVAFVILYYHDRHREDK"
FT   CDS_pept        131849..132727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0159"
FT                   /product="sortase"
FT                   /note="similar to sortase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80677"
FT                   /db_xref="GOA:C5WE62"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE62"
FT                   /inference="similar to AA sequence:RefSeq:YP_597720.1"
FT                   /protein_id="BAH80677.1"
FT                   /translation="MARQTKKIGLRVWLSRFIFLVGLLVLAFPIASQLLYYQASHANIN
FT                   AFKKTVTTIDRTEIKRRLELARAYNASLSGGTNQTTKPVLKDPYSDHQKKAGRAEYARM
FT                   LEVREQIGHVTIPKINQDLPIYAGSGEENLQRGVGHLEGTTLPVGGASTHAVLTAHRGL
FT                   PTARLFTDLDKMRRGDRFYIEHLGGKLAYQVDDIKVITPDRLEELSIVPDEDYVTLLTC
FT                   TPYMINSHRLLVRGKRIPYKASLEHKDQQLGHRGQLITYGFVTLGLALVLGLLWYRQRK
FT                   KQKRRQNETKG"
FT   CDS_pept        132711..133568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0160"
FT                   /product="sortase"
FT                   /note="similar to sortase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80678"
FT                   /db_xref="GOA:C5WE63"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE63"
FT                   /inference="similar to AA sequence:RefSeq:YP_597725.1"
FT                   /protein_id="BAH80678.1"
FT                   /translation="MKQRVKQLYQFIMTNKLRSSLFVLGILVVLFPVVSQISYYYASHQ
FT                   QINQFEHKAAVIDRSAIERRISLAKAYNDAISRHPSLSDPFTSKEKAGLREYARMLEVN
FT                   EQIGHVAIPKIGVDLPIYAGTSAAILEKGSGHLEGTSLPIGGKTTHAVLTAHRGLPTAR
FT                   LFTDLDKMKKGDYFYVTNLKETLAYQVDRIMVIEPSQLDAVSIEEGKDYVTLLTCTPYM
FT                   INSHRLLVRGVRAPLTSRQAKKESLTAVRPYQYYRWLVYLAIAVLVILVMIVAKYYQKT
FT                   NKSS"
FT   CDS_pept        133629..138743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0161"
FT                   /product="fibronectin-binding protein"
FT                   /note="similar to fibronectin-binding protein
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80679"
FT                   /db_xref="GOA:C5WE64"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE64"
FT                   /inference="similar to AA sequence:RefSeq:YP_597726.1"
FT                   /protein_id="BAH80679.1"
FT                   /translation="MSIVSKDKIKKILLKLTVILAICQLLVPTSLTAITVLAEQIGTET
FT                   VSSGNDKLQDSDLDFEKAMTESGDVLKDASKTWLLLTYNKIEKDLPSQDLFLTLPAGMT
FT                   VDTVTKDKPLNLQNLSVPSQLAIDEGEETINNTDIISGFKQISESVYKISFKPTTQVVN
FT                   LVFQVTNHVSDAAVDLQLSDKQDVTQALLKKTLTLTSDLKDEETALSSASSNTIQPRAI
FT                   QSSPSTGNQDISNSLTLANQQLTLVDKDKNGIYNVGAPDSLSFKADLSLLDQRLIVAGN
FT                   YFNLKISDSIHYNMLNPTDINFPVLKQDGKVIAVPELTQDGPVDGLLRATGKTVRYSFT
FT                   DQVSGLTNLNLKLDLEHSVNPNVVQMNGKHDFSYQIGQQIIKQNYDVLYAKPKENDELN
FT                   IHQRLTYTDSKQNLKASSLIYVNPKQIAQAAGRQALTIDVAPKTYNVGGKLATNLLNLN
FT                   SQTDIKVYKLRNPKGITDAVNLDKQYWEEVKGLSITKGNNKIDIAFDYKQAENTAYAVE
FT                   VITTLNHEGGQPLLIAQRSSLQALTKSISEIDSIATVGSGGSAIGDQSPKGTLYLNKVD
FT                   SKNLHLANATFTLSGTTTAGQFLYRTLVTDTKEVAISDLPTGTYQLKEIAAPSTYVRVE
FT                   SPWTVTVDSSGKVSISGNDADTKKTQEAADIVILWEATKWHYGSSQFYQDRIKEFVDAI
FT                   GNPNARYTVVGYGGDTSVKAQILLQSVTESELKSAINKISLATSLPDSRNSMLNAYNLA
FT                   LQHFQESKVKQKYLLQLTEYPIYHNEKTLVPNSQATMDSMKSIGVIPYLLIARDPTQSR
FT                   SSYYLNPVEPSPSFGGLFAKDNIKVAWSKYTTTLFQPDSSDDSYTNQIQAIGSAIKQAI
FT                   PTSVLTITNKQGGQFSLKKIDENKNDLAGATFTLSKRTTVSSAYQVQGDFPSVSQVTSF
FT                   NRTTLTFDHLKPGVYNLRESKAPEAYAKEDKTYVVVVQNSGKTTIIDEASFKETDFSMA
FT                   DASTPTEYPTKEIENKPNHIQFFKVGDKGKELAGAEFALKKDNQTIQTVKSGSDGSFAF
FT                   TKLKAGNYELWETKVADSAYQLPKEAVATFNVTDDGVISEPIGRLFIQNAQKSNRYEIR
FT                   NKLINKTIGDQKIKVIKRDELTDLPLANTQFQLEASDGTIYLGLTDSKGEYTFDKLPYG
FT                   QYVLTEIEAPDGYILDRTPRKINITEASGSETEVVASSPAGTQPAPANTENGGVALTPT
FT                   VTGKDVSDKITIKKLKITSSNDETPTIVKPNSGENIVIRAEFTIQAGSGIKAGDTFTVT
FT                   LPNTIDPFGVSVPENVAFRVMGPHGTLALGSYDSTTRTITYTFTDYITRYAVSTFSMIS
FT                   PFFIDRHAVKYSRNIDIYFKIGNQSSQPQTFAINYDPYYGALDTHNPVNIGSMITSLDE
FT                   ATGDFVEYIYVNPLGKSLELSSLTLRGNGSTIFNQDTNVQVFGVIDRNLQMPPSWGIDE
FT                   RMLREIDYLITKEDGKISINFDNDLLLGKSYIIKVSGKSDLNNSDPIHTEAVLQQHYFN
FT                   DYPYWTQSGRYIPYGPYTESFKFTSGVIKKSGESNADGSIVVNLTNRKNYIDFTKTDAH
FT                   GNPLEATFELRRKSGSSDTVTVGSQVNSDKTTGKFYFEGLAMGDYEVWETKAPDGYVKP
FT                   VKAVATFRINDEGEVVEKSLEDGRIINYPRPELPATGGMGWIVYMVMGSAICFIAIFWN
FT                   RPFRFKK"
FT   CDS_pept        complement(138808..139485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0162"
FT                   /product="putative DNA-binding protein"
FT                   /note="similar to putative DNA-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80680"
FT                   /db_xref="GOA:C5WE65"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE65"
FT                   /inference="similar to AA sequence:RefSeq:YP_059487.1"
FT                   /protein_id="BAH80680.1"
FT                   /translation="MDKETLNYWKTVITFLHDVLGDNYEIILHVIDKNDIYIGELVNSH
FT                   ISGRSKNSPLTKFALDLITQKVYQEKDFVTNYKAIVSPLHKEVRGSTFFIKDKEGNLEG
FT                   MLCINLDISAYQGVASDLLKLANLNLGQLIPTAPETTSTVALQEEPVEILTSNIQDIIS
FT                   EIIDPSLLRHNVHLSQEVKIDIVTKLSEKGVFQLKGAVSKVADILCISEPSVYRYLKKI
FT                   ESD"
FT   CDS_pept        139658..140023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0163"
FT                   /product="translation initiation inhibitor"
FT                   /note="similar to translation initiation inhibitor
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80681"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE66"
FT                   /inference="similar to AA sequence:RefSeq:YP_059488.1"
FT                   /protein_id="BAH80681.1"
FT                   /translation="MNMNSYPQPMGPYSTYMIEGNLLYTAGQLPLDPVSGQLPDGFEAQ
FT                   CRQVFANLQAILAEQNRELTHICKLTVYLSDLVYFDTLNQVMMELLEEPYPIRTAVQVE
FT                   ALPLQALVEIEAVARVN"
FT   CDS_pept        140049..141080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0164"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM50119
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80682"
FT                   /db_xref="GOA:C5WE67"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE67"
FT                   /inference="similar to AA sequence:RefSeq:YP_001127715.1"
FT                   /protein_id="BAH80682.1"
FT                   /translation="MVENMDILLGTGLLVLVLAIFSLFNYKAPHGAKAMGALASAACAS
FT                   FLVEAFQDSFFGQVLGFQFLSEVGGANGALSGVAAAILVAIAIGVSPGYAVLIGLSVSG
FT                   TGIIPGFVAGYLVSFLIKWMEKNIPGGLDLIAIIIVGAPLTRFLAQLITPVINGTLLTI
FT                   GDILTSSANSNPIIMGMILGGTIVVVATAPLSSMALTAMLGLTGIPMAIGALSVFGSSF
FT                   MNGVLFHKLKLGERKDNIAFAIEPLTQADVTSANPIPIYLTNFVGGAACGVLIALMKLI
FT                   NDTPGTATPIAGFAVMFAYNSVTKVLMTAAGCIILSLIAGYIGGSVFKNYRLVTKQELQ
FT                   ARN"
FT   CDS_pept        complement(141382..142644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0165"
FT                   /product="tellurite resistance protein"
FT                   /note="similar to tellurite resistance protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80683"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE68"
FT                   /inference="similar to AA sequence:RefSeq:YP_059499.1"
FT                   /protein_id="BAH80683.1"
FT                   /translation="MAEFHFDIDQIADNAIVKTDKTTDIISELPTNTTGQISFFEKLSA
FT                   DQQTAITAKAPALVDTFLADQNALLDFGQSAVEGVNATVNHILAEQKKLQIPQVDDLLK
FT                   STNRELNGFIAKYKDATPADLEKKPNLIQKLFKQSRDTLQEFYFDSQNIEQKMDGMAAA
FT                   VVKQEDTLARNIVSAELLIEDNTKSIENLVGVIAFIEASQKEATTRALTLQQKLATLDS
FT                   ATPEYQVQTDLLARTTEVINTLEQQHTEYLSRLYVAWATTPQMRNLVKVSSDMRQKLGM
FT                   LRRNTIPTMKLSIAQLGMMQQSVKSGMTADAIVNANNAALQMLAETSKEAIPALEQSAQ
FT                   NPTLSMKSVTSLAESLVAQNNGIIAAIDQGRKERVQLESVIVKSAETINDSVKLRDQKI
FT                   VQALLNEGKETQRSVEKETAD"
FT   CDS_pept        complement(142657..143535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0166"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80684"
FT                   /db_xref="GOA:C5WE69"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE69"
FT                   /inference="similar to AA sequence:RefSeq:YP_059500.1"
FT                   /protein_id="BAH80684.1"
FT                   /translation="MMSKYDVIDKRKKPFKWVGPLILFVIMASFLGGSPLIEFIENVLP
FT                   PLILGGAAYGIYRFKSRQKRLAKATLAKQLEDLKANIQLADRKVNLLESYLENKDDAQY
FT                   TILAKQLLPQLSEIKAQAIALKEKMDPTIYRRITKKANTVESDVSLQLEKIQIATSLKT
FT                   QALEEATANPIHKAPELQVYYDNIQTDHQAILSKIQGADNQEELMALHESNMRRFQDIL
FT                   TGYLKIKENPKNYYNADVRLEQARQAIQQFDEDLDETLRQLNESDLKDFDISLRIMQGA
FT                   TQRRTTHHQKD"
FT   CDS_pept        143964..145256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SDEG_0167"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="similar to adenylosuccinate synthetase
FT                   [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80685"
FT                   /db_xref="GOA:C5WE70"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE70"
FT                   /inference="similar to AA sequence:RefSeq:YP_140353.1"
FT                   /protein_id="BAH80685.1"
FT                   /translation="MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVI
FT                   DGKKFKLHLIPSGIFFPEKISVIGNGVVVNPKSLVKELAYLHDEGVTTDNLRISDRAHV
FT                   ILPYHIQLDQLQEEAKGDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRIN
FT                   LAEKNRLFEKMYDSTPLDFDAIFEEYYAYGQEIKQYVTDTSVILNDALDAGKRVLFEGA
FT                   QGVMLDIDQGTYPFVTSSNPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTEL
FT                   FDEVGERIREVGHEYGTTTGRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTV
FT                   KICVAYDLDGERIDHYPASLEQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRR
FT                   VGELVGVRISTFSVGPGREQTNILESVWASI"
FT   CDS_pept        145582..146625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0168"
FT                   /product="nucleoside-binding protein"
FT                   /note="similar to nucleoside-binding protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80686"
FT                   /db_xref="GOA:C5WE71"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE71"
FT                   /inference="similar to AA sequence:RefSeq:YP_281501.1"
FT                   /protein_id="BAH80686.1"
FT                   /translation="MNKKVMSLGLVSTALLTLGACGNRSAQKEADNSLKVAMITNQTGI
FT                   DDKSFNQSAWEGLQAWGKENKLSKGKGYDYFQSANESEFTTNLDSAVSSGYSLVFGIGF
FT                   PLHDAVEKAATDNPDSQFAIVDDVIEGKKNVASITFSDHEAAYLAGVAAAKTTKTKQVG
FT                   FVGGMEGVVVKRFEKGFEAGVKSVDDTIKVRVSYAGSFADAAKGKTIAAAQYAEGADVI
FT                   YQAAGGTGAGVFNEAKSLNEKRDEADKVWVIGVDRDQSEDGKYTSKDGKSSNFVLTSSI
FT                   KEVGQALAKVATKTAKGKFPGGQVTTFGLKEAGVTLTTDALSDETKAAVEAAKKAIIEG
FT                   TVTVPEK"
FT   CDS_pept        complement(146829..147602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0169"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="similar to pyruvate formate-lyase activating enzyme
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80687"
FT                   /db_xref="GOA:C5WE72"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE72"
FT                   /inference="similar to AA sequence:RefSeq:YP_061067.1"
FT                   /protein_id="BAH80687.1"
FT                   /translation="MTDRGIVFNIQHFSIHDGPGIRTTVFLKGCPLRCPWCANPESQQK
FT                   APEQMLTSDGLNTKIVGEEKTVDEVIEEVLKDLDFYEESGGGMTLSGGEIFAQFDFALA
FT                   LLKAAKAAGLHTAIETTAFAKHEQFVTLIDYVDFIYTDLKHYNQLRHQKVTGVRNDLII
FT                   KNIHYAFQAGKEIVLRIPVIPQFNDSLDDAKAFSELFNQLDIDQVQLLPFHQFGENKYK
FT                   LLGREYEMAEVKAYHPEDLEDYQAVFLNHNIHCYF"
FT   CDS_pept        147725..148474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0170"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="similar to DeoR family transcriptional regulator
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80688"
FT                   /db_xref="GOA:C5WE73"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE73"
FT                   /inference="similar to AA sequence:RefSeq:YP_061066.1"
FT                   /protein_id="BAH80688.1"
FT                   /translation="MMNRLERIIQLVSQKKKIDVNSLSEQLEVSKVTIRKDLDKLESKG
FT                   LLRREHGYAVLNSGDDLNVRLSYNYNIKRRIAEKAAELVQDNDTIMIESGSTCALLAEV
FT                   LCQTKRNIKIITNSCFIANYIRQYSSCQIILLGGYYQPNSEVTVGPLLKEMISLFHVNR
FT                   VFVGTDGFNKDLGFMGKDMMRSEGVRYMADAAEEVVILTDSSKFSKTSLVHQLSLADVN
FT                   RVITDQALDKQTQELLSSGGLVLDFVS"
FT   CDS_pept        148490..149470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0171"
FT                   /product="sorbitol operon regulator"
FT                   /note="similar to sorbitol operon regulator [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80689"
FT                   /db_xref="GOA:C5WE74"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE74"
FT                   /inference="similar to AA sequence:RefSeq:YP_061065.1"
FT                   /protein_id="BAH80689.1"
FT                   /translation="MKEERRRLLAKVAYLHYVQGKSQTLISKEMNIYRTTVCRMLAKAK
FT                   EEGIVRIEIADYDADLFALEEYVRKQYGLEKLDLVPNQVEDTPMDTLTNVAKTAAEVFR
FT                   HVVKDGDKIGLSWGATLSCLMDELNPKAMKDVFIYPLAGGPSHINAKYHVNTLVYRLAR
FT                   IFHGNSAFINAMVIQEDKQLTKGIIQSKYFESILASWDQLDLALVGIGGEPNSREESQW
FT                   RDLLTDADYAQLKQEEAVGEVCCRFFDQAGHPVYKGLQDRTIGISLEQLGRVRKTIAVA
FT                   TGKYKAKAILAALKAGVINYLVTDKETMLAVLALDEDIDLNNVLL"
FT   CDS_pept        149750..150070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0172"
FT                   /product="PTS system, cellobiose-specific IIA component"
FT                   /note="similar to PTS system, cellobiose-specific IIA
FT                   component [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80690"
FT                   /db_xref="GOA:C5WE75"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE75"
FT                   /inference="similar to AA sequence:RefSeq:YP_283109.1"
FT                   /protein_id="BAH80690.1"
FT                   /translation="MELIVPDQIIMGLILNAGDAKQHIYQALKCAKAEDYDTSEKEMAL
FT                   ADDALLEAHNLQTQFLAQEASGNKSEITALFIHSQDHLMTTITEINLIKEIIDLRKELA
FT                   TK"
FT   CDS_pept        150098..150406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0173"
FT                   /product="PTS system, cellobiose-specific IIB component"
FT                   /note="similar to PTS system, cellobiose-specific IIB
FT                   component [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80691"
FT                   /db_xref="GOA:C5WE76"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE76"
FT                   /inference="similar to AA sequence:RefSeq:YP_603333.1"
FT                   /protein_id="BAH80691.1"
FT                   /translation="MIKIGLFCAAGFSTGMLVNNMKVAAEKKGIDCQIDAYSQGKLAEY
FT                   APLIDVALLGPQVAYTLDKSEAICKENGIPIAVIPMADYGMLDGNKVLDLALSLVKE"
FT   CDS_pept        150416..151720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0174"
FT                   /product="PTS system, cellobiose-specific IIC component"
FT                   /note="similar to PTS system, cellobiose-specific IIB
FT                   component [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80692"
FT                   /db_xref="GOA:C5WE77"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE77"
FT                   /inference="similar to AA sequence:RefSeq:YP_603333.1"
FT                   /protein_id="BAH80692.1"
FT                   /translation="MAKMNMQNIIMPIMKFVNMRGIIALKDGMLAILPLTVVGSLFLIA
FT                   GQIPFQGINDAIAGVFGADWTEPFMQVYHGTFAIMGLISCFAIGYSYAKNSGVEPLPSG
FT                   VLSLSAFFILLRSSYVPAEGEPIGDAISKAWFGGQGIIGAIVIGLTVGAIYTAFIRRHI
FT                   VIKMPEQVPQAIAKQFEAMIPAFVIFTLSMLVYIIAKSVTGGGTFIEMIYDVIQVPLQG
FT                   LTGSLYGALGIAFFISFLWWFGVHGQSVVNGIVTALLLSNLDANKALMAAGELSLDKGA
FT                   HIVTQQFLDSFLILSGSGITFGLVVAMIFAAKSKQYKALGKVAAFPALFNVNEPVVFGF
FT                   PIVMNPVMFLPFILVPVLAALTVYGAIAIGFMQPFAGVTLPWSTPAIISGFMVGGWQGA
FT                   IVQILILIMSTLVYFPFFKIQDNMAYQNEQASEES"
FT   CDS_pept        151931..154348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0175"
FT                   /product="formate acetyltransferase"
FT                   /note="similar to formate acetyltransferase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80693"
FT                   /db_xref="GOA:C5WE78"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE78"
FT                   /inference="similar to AA sequence:RefSeq:YP_061061.1"
FT                   /protein_id="BAH80693.1"
FT                   /translation="MTETKSPYFGHLTDRMTHYREAVLDKKPYIDAERAILATEAYQKH
FT                   QNKPANLKRAYMLQTILENMTIYIEDESLIAGNQASSNKDAPIFPEYTLEFVLNELDLF
FT                   EKRDGDVFYITEETKQQLRDIAPFWENNNLRARCGVLLPEEVQVYMETGFFGMEGKMNS
FT                   GDAHLAVNYQKLLEHGLKGFEERARAAKAALDLTIPENIDKYHFYDSVFIVIDAVKTYA
FT                   KRYAQLARELAETASPERQAELLEIARICDKVPYEPAKTFAEAVQSVWFIQCILQIESN
FT                   GHSLSYGRFDQYMYPYVKADLEAGRETEDTIVERLTNLWIKTLTINKVRSQAHTFSSAG
FT                   SPLYQNVTIGGQTRDKKDAVNPLSYLVLRSVAQTKLPQPNLTVRYHKGLDNTFMNECIE
FT                   VMKLGFGMPAMNNDEIIIPSFIKKGVSEEDAYDYSAIGCVETAVPGKWGYRCTGMSYIN
FT                   FPKILLITMNDGIDPASGKRFAKGHGHFKDMTSYEELKAAWDATLREITRMSVIVENAI
FT                   DLGLEREVPDILCSALTDDCIGRGKTLKEGGAVYDYISGLQVGIANLSDSLAALKKLVF
FT                   EEGRLTPEELWHALESDFAGERGEEIRQMLINDAPKYGNDDDYADSLVVEAYDTYIDEI
FT                   AKYPNTRYGRGPIGGIRYSGTSSISANVGQGKGTLATPDGRHAGTPLAEGCSPEHSMDK
FT                   KGPTSVLKSVAKLPTDEIVGGVLLNQKVNPQTLAKEEDKLKLMALLRTFFNRLHGYHIQ
FT                   YNVVSRETLIDAQKHPEKHRDLIVRVAGYSAFFNVLSKATQDDIIERTEHTL"
FT   CDS_pept        154361..155029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mipB"
FT                   /locus_tag="SDEG_0176"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="similar to fructose-6-phosphate aldolase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80694"
FT                   /db_xref="GOA:C5WE79"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE79"
FT                   /inference="similar to AA sequence:RefSeq:YP_061060.1"
FT                   /protein_id="BAH80694.1"
FT                   /translation="MEYMLDTLDLEAIKKWHHILPLAGVTSNPSIAKKEGDIDFFERIR
FT                   EVRAIIGDKASIHVQVIAQDYEGILKDAAEIRRQCGDSVYVKVPVTTEGLAAIKTLKAE
FT                   GYHITATAIYSTFQGLLAIEAGADYLAPYYNRMENLNIDPEAVIGQLAEAIDRECSDSK
FT                   LLAASFKNVAQVNKSFALGAQAITAGPDVFEAGFAMPSIQKAVDDFGKDWEAIHHRKSI
FT                   "
FT   CDS_pept        155071..156159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="SDEG_0177"
FT                   /product="glycerol dehydrogenase"
FT                   /EC_number="1.1.1.6"
FT                   /note="similar to glycerol dehydrogenase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80695"
FT                   /db_xref="GOA:C5WE80"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE80"
FT                   /inference="similar to AA sequence:RefSeq:YP_061059.1"
FT                   /protein_id="BAH80695.1"
FT                   /translation="MKVFASPSRYIQGKNALFSNAETLKQLGDNPILLCDDVVYGIVGK
FT                   TFEAYLADNGMTPVHVAFNGEASDNEINRVVAIAKDNGSNVIIGLGGGKTIDSAKAIAD
FT                   VLTVPVIIAPTIASTDAPTSALSVIYTDEGAFEKYIFYSKNPELVLVDTQVICQAPKRL
FT                   LASGIADGLATWVEARAVMQKNGDTMAGGNQTLAGVAIAQACERTLFADGLKAMASCDR
FT                   QVVTPALENVIEANTLLSGLGFESAGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLT
FT                   QLFLENRSREEIDRYIDFYQAIGMPTTLKEMHLDTASQDDFLKVGRQATMAGETIHQMP
FT                   FVISPEDVAAALVAVDAYVTSR"
FT   CDS_pept        156347..156658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0178"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SsuiDRAFT 0887
FT                   [Streptococcus suis 89/1591]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80696"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE81"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00875377.1"
FT                   /protein_id="BAH80696.1"
FT                   /translation="MIYDMFKRQQKRAEFMSCLQSLYNEKELNLSQSFREKLIWAAKGL
FT                   DSGDRLSYLAYQLYPYLMEEMKREEANHNPQFLKAKKYLEKIRWRYNVGSVWGWPFSS"
FT   CDS_pept        complement(156731..157240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0179"
FT                   /product="putative low temperature requirement C protein"
FT                   /note="similar to putative low temperature requirement C
FT                   protein [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80697"
FT                   /db_xref="GOA:C5WE82"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE82"
FT                   /inference="similar to AA sequence:RefSeq:NP_608065.1"
FT                   /protein_id="BAH80697.1"
FT                   /translation="MTTDHQLREVSYQLLAERGVSLEAIAELVLFLQNNYIPNLTMAEC
FT                   LESVEAVLEKREVQNAIITGVELDKLAETDQLSEPLLTILKTDQGLYGIDEILALSIVN
FT                   LYGSIGFTNYGYLDKTKPGIVDKLNHKDGKSCHTFLDDIVSAIAAAAASRIAHNDPAKS
FT                   AITNQQ"
FT   CDS_pept        157414..157965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0180"
FT                   /product="hypothetical protein"
FT                   /note="no hit"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80698"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE83"
FT                   /protein_id="BAH80698.1"
FT                   /translation="MTKRQLRWLLLVIFGLIVLVFWWHSRAVTPDKPHPSALSAHQTIV
FT                   FPKETNGLPGQAQLKSGQLVEKDGKQYRTLSASLPQQSGKIYFYCQVSEIGDKKGIKKL
FT                   LAAGYQAGKNHVFDGQLQFYLPEENRIHFTVSGRVFSQTKLKKVTAQSKPTDEVGVYEI
FT                   QVVAKNALIDSLLDHQDLVY"
FT   CDS_pept        158072..159097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0181"
FT                   /product="MccC family protein"
FT                   /note="similar to MccC family protein [Streptococcus
FT                   pneumoniae D39]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80699"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE84"
FT                   /inference="similar to AA sequence:RefSeq:YP_815692.1"
FT                   /protein_id="BAH80699.1"
FT                   /translation="MIQKVGIVSLSSGILGEEMVKHELDLGVKRLKALGLDPVFLPNAL
FT                   KGLEYVKDHPEARAADLLEAFADSSIDMILCAIGGDDTHRLLPYLFSDRQLEKVARQKI
FT                   FLGFSDTTMNHLMLHKLGLKTFYGQSFLADICELEEEMLPYSLAYFKELIETGSIAAIR
FT                   PSDVWYDERTDFSQAALGTKRVVHSNQGFKLLRGPAQFSGEILGGCLESLYQLFDGSRY
FT                   ADSVTLCQQYALFPSLADWEGKILLLETSEEKPSPELYRLMLETLKETGIFDVISGVLV
FT                   GKPMDETYDDDYQNILLEVIDTDIPILANLSIGHATPRAIVPFGVKAFVDADQQEIYFD
FT                   N"
FT   CDS_pept        complement(159237..160535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0182"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein PsycPRwf 0104
FT                   [Psychrobacter sp. PRwf-1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80700"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE85"
FT                   /inference="similar to AA sequence:RefSeq:YP_001279014.1"
FT                   /protein_id="BAH80700.1"
FT                   /translation="MVYVSNPIEMTKALSSGETVIDITRSMAFANPIYLPNGIQLSAIP
FT                   QENGVLPTIFFSHSDGFILTGSSRLQNLSVVTLQDKKAIQLTSQQVAESFGTIHLENLT
FT                   VDGQISLIFRTPTLKAHVVTKNVHVASSDTRTYLEQPQKYGVNVLQGAYTLYNFNANKD
FT                   SLITASIDNLSIGSEGHPAIGSGVFISGFNDQGGRVDIDQMTLGDVYSTGLIPQGVADF
FT                   ITGAVFVVYGAHISHLIQNGKTVTYGVNDMVLDAWGQVDEWVVNDDVISYGQSGVGFVN
FT                   FGTVNHFKANKAIFTYGTGARAYNQYDGTLKEGYFAGIQTFNNGAVGIQISKKVGKLVV
FT                   DGDIVTQDGLGQSLVKGVNVDLPAYALSMKDGGQLESLTVTGNIISHGDKVTTVTMEDG
FT                   ALIHHIEVTGQIEANGQDSQAFDTDQTKALFKG"
FT   CDS_pept        160732..161220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0183"
FT                   /product="putative YbaK/prolyl-tRNA synthetases associated
FT                   domain"
FT                   /note="similar to YbaK / prolyl-tRNA synthetases associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80701"
FT                   /db_xref="GOA:C5WE86"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE86"
FT                   /inference="similar to AA sequence:RefSeq:YP_001450137.1"
FT                   /protein_id="BAH80701.1"
FT                   /translation="MDLYTPVIDKLTDLGIAFEVVEHEPALTTEQADSFIEGIDGVRTK
FT                   TMFLTNKKKTQYYLLIMDDQKQLDMDRFKELAGANRIRMASADSLYDKMLLPPGVVSPF
FT                   GLLNNRDKDILVYIDQDIMSEKRMSFHPNTNEKTIFVETPDLVRFIESLGYDVHVINL"
FT   CDS_pept        complement(161359..161628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0184"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to predicted transcriptional regulator
FT                   [Streptococcus suis 98HAH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80702"
FT                   /db_xref="GOA:C5WE87"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE87"
FT                   /inference="similar to AA sequence:RefSeq:YP_001199861.1"
FT                   /protein_id="BAH80702.1"
FT                   /translation="MANCQKMIQKVLFNMDDIHVTLDSLLKAKGITSKELAEKIGITEA
FT                   NLSILRTGKAKGIRFGTLSKICKVLDCQPGDLLEYTPPTDEKPL"
FT   CDS_pept        complement(162212..163639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0185"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0685
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80703"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE88"
FT                   /inference="similar to AA sequence:RefSeq:NP_687701.1"
FT                   /protein_id="BAH80703.1"
FT                   /translation="MGVSGLAVLLALSHQSEDVLATMEIFCFDDSHHFGKGIPFQEDAA
FT                   LALINSPIDDISFDYRNMSDFMVWLRENGYSTDQSYVARALYGKYLSERAKSLLNQLPV
FT                   RVVTSRVEDIHYFPQQQQWQVELEEGATPNGLPVFFDEIHLACGALPVLDPYELEGALG
FT                   YHADPYPLKQFARDEFDGQTVAVIGTGLAAIDVIKWLVSDTKASIQAFSWSNVFPTVRI
FT                   LEGPVIDWQFFTDETLNQLLNQAEHSFTLTTFDNLLSSELQALGFKSWKEATKQVLAPG
FT                   QEGIALAFEHPKELYLLQQLASRITVWLTDLWPYMSLDDRKAYQETYGKAIVNLRNPMP
FT                   DDSAKVLLEAFKQNKLKTIADVSDITSTDQGFTIITKSDKFFVNHIINATGYHLTPANL
FT                   SSATPLLQSLINQRLCQLDAQGGLTILPETAQVLSPKYGVMPNLYAHGALVNGVIYQNN
FT                   STIKIQRMAERAFKGRG"
FT   CDS_pept        complement(163782..165293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0186"
FT                   /product="putative ATPase components of ABC transporters"
FT                   /note="similar to ATPase components of ABC transporters
FT                   with duplicated ATPase domains, multidrug transport system
FT                   [Streptococcus sanguinis SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80704"
FT                   /db_xref="GOA:C5WE89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE89"
FT                   /inference="similar to AA sequence:RefSeq:YP_001035321.1"
FT                   /protein_id="BAH80704.1"
FT                   /translation="MLKTTMVTLTHHKDLKNLVKDVTFTVRPGDKMAIIGDEGTGKSTL
FT                   LQAFLDPELINDYATLSGQVQLEFDRVAYLPQVIPQHQLDMTVADFIYTDLDNNTVDFN
FT                   IFYQLAQQFHLAIEPMLTENLHLKDLSGGQQLKLYLLTLLANQPDCLFLDEPSNNLDLD
FT                   SLNWLAQFIAKTQQTVIFISHDEHFLSQTATAILHLELLKKRQKPRATYFKGSYDSYKA
FT                   WRQETFERQTQLALKERSEHAAKLAKSHRIHQSVEHQLRHTKNDVAGRLLAKKLKNVLS
FT                   QEKRYEKERQGFHDIPENPDHINLFFSDIHPLASNKVILKWQEQLVPFAHQSIDLTIWG
FT                   QDKLVITGANGIGKSNLLSIILNDLSRQYPVGFMPQTYAEDLNPDQTALTFLSDHASSS
FT                   SSTEIRTLLASLQFTRQEIGHPIGNLSGGQQGKLFLAKMVLAKYPILILDEPTRHFSPT
FT                   SQPLIRQLLREYSGAIISVSHDQCFIDEVCQKVFELEKDGLRRIR"
FT   CDS_pept        complement(165566..166186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0187"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="similar to cyclic nucleotide-binding domain protein
FT                   [Lactococcus lactis subsp. cremoris MG1363]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80705"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE90"
FT                   /inference="similar to AA sequence:RefSeq:YP_001032544.1"
FT                   /protein_id="BAH80705.1"
FT                   /translation="MTESIYSLVSKEVIAKSRVQIFQHNTAIIKANQTLTHLYYILDGR
FT                   AKIYHSTEHGKDIFIHFLSANDWIGELTFLGIEEETKQVISIGETCVLAIPKHLVENHL
FT                   FSDKQFLIELNRFIGKKLLDRTHHFVKNQSYDLKYRLATFMIDMSHKAVYSEKHVNVVD
FT                   YLGTSYRHLLQVLKDFQDENYIEKIGQSTYRLNKAKLQDYYIH"
FT   CDS_pept        166263..166859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0188"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein llmg 1236
FT                   [Lactococcus lactis subsp. cremoris MG1363]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80706"
FT                   /db_xref="GOA:C5WE91"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE91"
FT                   /inference="similar to AA sequence:RefSeq:YP_001032545.1"
FT                   /protein_id="BAH80706.1"
FT                   /translation="MVKKVFLSLGCYLLIAFGISLTIKAAIGVSSFNALNVALSEWSHL
FT                   EVGTVTGCLNSFFLVVSYLLDDKKSKKEYSLMILSVCCLSYAINLFVYGMLPYLKVTSY
FT                   GVKLCLFLVGICLAGYGTGKILYYGVLTFPIEKCCQLLEYRLQKPFSYFRYGIDMICVT
FT                   LSLLISLTAQLPLFVREGTIISLVLLSYVIGKAKE"
FT   CDS_pept        166869..167519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0189"
FT                   /product="nucleotide-binding protein"
FT                   /note="similar to nucleotide-binding protein implicated in
FT                   inhibition of septum formation [Streptococcus suis
FT                   98HAH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80707"
FT                   /db_xref="GOA:C5WE92"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE92"
FT                   /inference="similar to AA sequence:RefSeq:YP_001200570.1"
FT                   /protein_id="BAH80707.1"
FT                   /translation="METVVTYEKQGMLPKVDKYILLSTSPRRKDLLTFLNPEIMSVDVD
FT                   ERAIQDHYMKVFNDEPFLMRAAKSCCELAKAKSQTTIAKGPLYLSADTIIVSEDRVCHK
FT                   PQTTAEAVATLRSYFGKSHYAVTGVCLKAKDYQEVFYTLAKIDFVDYYDALDEAITTYV
FT                   SRYQPFDKAGAYSIRDIDPRFIKGITGDMNTILGLPVAELSQRLFGKTGETIK"
FT   CDS_pept        complement(167648..168001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0190"
FT                   /product="hypothetical protein"
FT                   /note="no hit"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80708"
FT                   /db_xref="InterPro:IPR015046"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE93"
FT                   /protein_id="BAH80708.1"
FT                   /translation="MIDDDTTIKTLERSFAILKNKEVTEWVKQIDTILTTDDIRHNNAL
FT                   VKIFLKARASMEEGERDALARLSNDISWYLVLNKYEAPQPVIDFAQQIAKEPHKERGKL
FT                   AFLQSLALSLIHR"
FT   CDS_pept        168818..169204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0191"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="similar to phosphoglycerate mutase family protein
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80709"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE94"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124144.1"
FT                   /protein_id="BAH80709.1"
FT                   /translation="MANSRSKSITTLTDLRERKLSDEWVKDFNEIAQKQWEDFNFKLPN
FT                   GESLKEVQERNIKTLDHILSESKNQTVVIGTHGTALSTIINDYKPEFRYEAFNAIKHVF
FT                   PWVVRFEFEGEALRKLGISLGIGK"
FT   CDS_pept        complement(169256..169762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaR"
FT                   /locus_tag="SDEG_0192"
FT                   /product="topology modulation protein"
FT                   /note="similar to topology modulation protein
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80710"
FT                   /db_xref="GOA:C5WE95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE95"
FT                   /inference="similar to AA sequence:RefSeq:YP_281151.1"
FT                   /protein_id="BAH80710.1"
FT                   /translation="MKIAIIGHSGSGKSTLARFLGQHYHCEVVHLDQLHFSSNWQERSD
FT                   HDMIADLSTCLLKQDWIIEGNYANCLYEERMSEANHIIYVNFSRFHCLYRAFKRYLNYR
FT                   GKTRPDMADNCQEKFDVAFVKWILLDGRSRNQLKKYQSVVQKYPHKTIVLTNQKQLSHY
FT                   MNTIN"
FT   CDS_pept        complement(169817..170299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0193"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="similar to acetyltransferase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80711"
FT                   /db_xref="GOA:C5WE96"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE96"
FT                   /inference="similar to AA sequence:RefSeq:YP_061025.1"
FT                   /protein_id="BAH80711.1"
FT                   /translation="MIPIKGLKIKVETVMKIIEYKGNYRDDLIFMVLEAKNALGKIPSI
FT                   NPDLLTIETSYLEKEDCFWLAVNDENRVIGSIAYSSIPKTNEVFLHCLFIKPSLKHQGI
FT                   GSQLLAFAEDYLRKIGKSHVRIHLGQPKEQWFESYQFYPKHGYQFYDDTHLIKKLI"
FT   CDS_pept        170671..171699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0194"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80712"
FT                   /db_xref="GOA:C5WE97"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE97"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH80712.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIARLLGRH
FT                   RSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLKLNGCSARFIA
FT                   QLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI
FT                   RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWESDLILGKKTKGEAVMLTLVERQT
FT                   RYALGVKLEDKQSQTINRAVTHLISQYPIASITADNGSEFSLLSTLEAVDVYFAHPYSS
FT                   HERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLLQYQSSTFLFELAR
FT                   TA"
FT   CDS_pept        171832..173145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0195"
FT                   /product="putative transcriptional regulator"
FT                   /note="similar to putative transcriptional regulator
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80713"
FT                   /db_xref="GOA:C5WE98"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE98"
FT                   /inference="similar to AA sequence:RefSeq:YP_002123093.1"
FT                   /protein_id="BAH80713.1"
FT                   /translation="MMRQRGVAMKMSPRIISYDISEGTVFFNTKTNDSFLITNELIKKV
FT                   DEDEETEKQYESYLEQHNYFLEEDEVDKYLTQISEADKERLGLTVLTHGDCNFRCKYCY
FT                   EHFTNISMSLETENAIFYFVEEKIKTGQFKYLTVAWFGGEPLLGFKTIVSLGKRLISLC
FT                   NKYNVNYDSSLTTNGFLLDKKKFVTLVTDLRVTSYQITLDGNQESHDRQRISRTGKGTY
FT                   DRILKNLIDMRQTKLDFECIIRFNITKENYPNICSFLKHDGLIFKEDERFLLFYCNVGD
FT                   WGKGDRVENSLTLVNRSTAFELSKRAVKEGYSLFASRYNTSHFFSCYANKKNHYAFNVN
FT                   GIVQSCTVALYDKKNIFGNINTGFVNQNKIDKWVINVDDSCSDCPYLLICKSGNCPMVK
FT                   RINGVSFKRICESMKNTIYENLALFALDGQYNDILDVE"
FT   CDS_pept        173214..174878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0196"
FT                   /product="putative bacteriocin ABC-type exporter, ATP
FT                   binding/permease protein"
FT                   /note="similar to bacteriocin ABC-type exporter ATP
FT                   binding/permease protein putative [Streptococcus sanguinis
FT                   SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80714"
FT                   /db_xref="GOA:C5WE99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C5WE99"
FT                   /inference="similar to AA sequence:RefSeq:YP_001034395.1"
FT                   /protein_id="BAH80714.1"
FT                   /translation="MQNVNKIILHVIKKLGRGASLLFYDCEETMKSIFNYLDKKTKWLV
FT                   ITGSLANSFAALGQPFVLSKALDLKEKIFDFNVILQFTIYGFSVYMTLYALMLFANHTT
FT                   NVFRREIHKNMRLALFKKLLVNKRFTDDEKISILTQDMEYLGDNYLICFVTMLTWGILC
FT                   LVTASYIILQDYVLGSMFVLFSIIRPIPQFILSHKLTDNGEKMNTDRGHLYTVVSDNIR
FT                   GSQTIINNQVVGEAIGHFHQTHTTYQESLQKYAFTHNIIYFFNGFMLFLSQVVPLALGF
FT                   YFTLQGNVVSVAKLIAMYIASNQLVNPIQTIMYNVASIQGSKPLADKIFSILNEEEMEG
FT                   TAVSKATVANIEQLVVADVTKSYGSKTLFSQLSFTCKMGDKVLIRGASGSGKSTLFRVI
FT                   SQLDSPDNGEIFVKTRDGLTFNNFRGNISHITQSPFLFNDTIRYNLALGQSFSDEELLE
FT                   VLEAVGLVDEMDHILDVMIVDNGTNISGGQRVRLEIARFLLRKKDILLADEVTASLDAT
FT                   NSQKVRDILLSLPILVLEIAHYVDDDSRYDKTIYLTK"
FT   CDS_pept        174898..175101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0197"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M28 Spy1333
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80715"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA0"
FT                   /inference="similar to AA sequence:RefSeq:YP_280798.1"
FT                   /protein_id="BAH80715.1"
FT                   /translation="MNDIEIYSILVSRIEYSDGTGLKVRPAVVVKFNDEVIKALRLTTK
FT                   YENESDYIKGQYLEVIDWAKAN"
FT   CDS_pept        175341..176195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0198"
FT                   /product="streptomycin resistance protein"
FT                   /note="similar to streptomycin resistance protein
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80716"
FT                   /db_xref="InterPro:IPR007530"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA1"
FT                   /inference="similar to AA sequence:RefSeq:NP_689015.1"
FT                   /protein_id="BAH80716.1"
FT                   /translation="MRDEQEIYNLVLNIANRDKRIEAVLLNGSRANPDVPKDDFQDYDI
FT                   VFVTSFIEDIISDTNYHKKFGDILIMQKPDEVRNKTEYNCFAYLMQFQDMTRIDLRLIK
FT                   PEFLEDYLDDAFSKVLLDKKNKYLDYSFERSSLYETKQLSEDEINKILNEIYWVSTYVV
FT                   KGIARNDIIYSEFMISNPIKNAFIKLLKQKILIERELDSLSFGKLDKDILQYITDKDQL
FT                   LKIFSNKSLKDIETNLRFLLDETNQMAKYISINRKLNLNQGEYQSAMKFMNNILSNSHQ
FT                   DFN"
FT   CDS_pept        176218..176778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0199"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="similar to phosphoglycerate mutase family protein
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80717"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA2"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124144.1"
FT                   /protein_id="BAH80717.1"
FT                   /translation="MKTTFYFIRHAEPNYNNHDDVLRELTEKGIVSSKKLVNQFSSITI
FT                   DKFYSSPYKRSIDTIKPLADSKNKQITTIEGLRERKLSEGWIDNFNEVARKQWEDFNYK
FT                   LPNGESLKEVQERNILAVNTILETSRNETVVIGTHGTALSTIINYYQEDFKYEMFNKYK
FT                   HEFPWIVKFEFNESRKKNIEIII"
FT   CDS_pept        177881..178147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0200"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80718"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA3"
FT                   /inference="similar to AA sequence:RefSeq:YP_599751.1"
FT                   /protein_id="BAH80718.1"
FT                   /translation="MSHLQYTAKSHHLQWSIAQLTQICSQCYRDYCPKSIKHRKNVGLS
FT                   KVSDVSLLVLLLLQAELGITSQRRFYRICHLFFCGNLLEEKSL"
FT   CDS_pept        178226..178744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0201"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80719"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA4"
FT                   /inference="similar to AA sequence:RefSeq:YP_600353.1"
FT                   /protein_id="BAH80719.1"
FT                   /translation="MIMDSFPMPLCQPIRNHKAKVFKGLADIGYNASKHLWFYGFKVHM
FT                   LVTLSGVMLNYIVTPASVHDIKVVDELLEGCKQTVVLADLGYLSQELKDKLGHKGYHLW
FT                   TPLRQNMVGAKQHNNRQLLAWRRTIETRFSELCSLFDIEQTLARGLSGLQLRLEQFILA
FT                   YNLKYFEIN"
FT   CDS_pept        178798..179526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0202"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1981
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80720"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA5"
FT                   /inference="similar to AA sequence:RefSeq:NP_736414.1"
FT                   /protein_id="BAH80720.1"
FT                   /translation="MKKTKVILAACIVGMSFLVTENSSIHSVNANEVVNSNDSSQTSNI
FT                   VISSEKISPYVIEFVTQQETNNIASYARSLSSHNDENYTTVRFDFSQAEFYDDNGNLLD
FT                   KDTIMETIRPEKLLARSAGTSGGTWSSGSGYSVCKGMLVSGNAGLVGLQATYYVDFQKV
FT                   QGGYDRLDRVYGATVNGAGSWAFLANGVFRASEAPGASAYGGIKGQWTVSPGLGLPSGT
FT                   STKHLYFRVGNDTFWLDTNF"
FT   CDS_pept        179957..180193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0203"
FT                   /product="truncated hypothetical protein"
FT                   /note="similar to hypothetical protein M28 Spy1332
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80721"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA6"
FT                   /inference="similar to AA sequence:RefSeq:YP_280797.1"
FT                   /protein_id="BAH80721.1"
FT                   /translation="MATIKGDKGYVESEGGYSIKIDSELKIIESKFGSEKYSYKDGKLT
FT                   TNFTGVESDFYKKGSKACEEALKKYGYKEVGKE"
FT   CDS_pept        180639..181442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0204"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M28 Spy1308
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80722"
FT                   /db_xref="InterPro:IPR041219"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA7"
FT                   /inference="similar to AA sequence:RefSeq:YP_280773.1"
FT                   /protein_id="BAH80722.1"
FT                   /translation="MLISIPFFIVVIITTIFSSSQGDCQVTPELSTQFVTSSDSASQTD
FT                   WTKKGSIANITAGKVFDAWVTKGLSGASAAGIVGWVNSEGGFAMIGRAEGHYGNDLRTN
FT                   SIAFGVKPVGLSYYTTEAGGGIYQFTPYTKYAPLGDPKWEDADAMNAFVAKAILVGDWN
FT                   ASMDLTGGNHTFKQMAQMTDPKQATLVWQAYERGSTAHINPFQKQADAQKAYELFDGAK
FT                   YSYNEATFHKSFGISGPLKPGEGESKETVLSLCESGSYSKGAFGK"
FT   CDS_pept        complement(181483..182262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0205"
FT                   /product="ISSdy1, transposase OrfB"
FT                   /note="similar to ISSdy1 transposase OrfB [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80723"
FT                   /db_xref="GOA:C5WEA8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA8"
FT                   /inference="similar to AA sequence:RefSeq:NP_688236.1"
FT                   /protein_id="BAH80723.1"
FT                   /translation="MCRWLNIPRSSYYYQAVDPVSEADLEDKITYIFFESKSRYGARKI
FT                   KKCLEKDGIILSRRRIRRIMERLHLVSVYQKAAFKPHSKGKNEAPIPNRLDRQFDQERP
FT                   LEALVTDLTYVRVDRRWAYVCLVIDLFNREIIGLSVGWHKTAELVKQAIQSIPYALTKV
FT                   KMFHSDRGKEFDNQLIDEMLEAFGITRSLSQAGCPYDNAVAESTYRSFKLEFINQETFQ
FT                   SLEELALKTKDYVHWWNYHRIHGSLNYQTPMTKRIIA"
FT   CDS_pept        complement(182298..182588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0206"
FT                   /product="ISSdy1, transposase OrfA"
FT                   /note="similar to ISSdy1 transposase OrfA [Streptococcus
FT                   agalactiae 515]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80724"
FT                   /db_xref="GOA:C5WEA9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEA9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00790839.1"
FT                   /protein_id="BAH80724.1"
FT                   /translation="MSRKIRRHFTDDFKQQIVDLHNAGMKRSELIKEYELTPSTFDKWV
FT                   RQAKLTGSFKSVDNMTDEQRELIQLRKRNKELEMQLDILKQAAVIMARKDK"
FT   CDS_pept        complement(182811..184145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0207"
FT                   /product="putative protein kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to protein kinase, putative [Streptococcus
FT                   pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80725"
FT                   /db_xref="GOA:C5WEB0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB0"
FT                   /inference="similar to AA sequence:RefSeq:NP_345535.1"
FT                   /protein_id="BAH80725.1"
FT                   /translation="MNFTTNYYMYQNNKKLVQKNYMDFLKKKLKSSSKDEYWNYSITKP
FT                   ISKKGFKIHLSGTTLNAFDIASKFFSFLSKKNIEINFKIISSLNVLELENAGNLGYSQI
FT                   GKFITIYPTDENELLYLLEELDKLYKLDKSIPIPSDFKYCLSEVVYYRYGEFIVDPNYH
FT                   DERKQTIPKNVSVPIEDYFIPRFNKIPKNYVIIEIISRTAKGGVYKALNIKTKKIVILK
FT                   EAKNLADLDSKMNDAITRLKNEKKILILIEKENFSPNFYCDFYVENSYFIEIEYIEGQS
FT                   LLKELPKSSLKNWGTKLANIFRTLNTKYKISYRDISFSNILYNNERFFLIDFEYSINTL
FT                   EVTNEQPIPLYGTPLFYETDLTVISDQPEDIYGLVSLFYWSINKNKYDEWSTLNYEKIL
FT                   LKSDQINKNKKINCTSNIILQNIFDNTFNHKYKNFELLIKDLSEL"
FT   CDS_pept        complement(184142..184435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0208"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SP 1060
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80726"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB1"
FT                   /inference="similar to AA sequence:RefSeq:NP_345534.1"
FT                   /protein_id="BAH80726.1"
FT                   /translation="MEIIERKIPTELQQELNKFILRYKEDGLSEQNTYLFYKFILKSYS
FT                   LSRENRYSIRLLAQELQKHELKVSLLINIYYHSLNCIALSNGFEIYGEGFNI"
FT   CDS_pept        complement(184498..184737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0209"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SP 1059
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80727"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB2"
FT                   /inference="similar to AA sequence:RefSeq:NP_345533.1"
FT                   /protein_id="BAH80727.1"
FT                   /translation="MSNQLKNLINALQGNMEVVGEFFDNPSLVIENYGITGMEKEALLT
FT                   RDLNALDKIALSIKQKALSPSGAHSSGCHIIDPE"
FT   CDS_pept        184881..185789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="similar to ABC transporter ATP-binding protein
FT                   [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80728"
FT                   /db_xref="GOA:C5WEB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB3"
FT                   /inference="similar to AA sequence:RefSeq:NP_345536.1"
FT                   /protein_id="BAH80728.1"
FT                   /translation="MINVLDIKNLNVSFKSKKALNNINVEINNGDFIGLLGSNGAGKST
FT                   FINSITGLQKIDSGEINYSDAIIKNKKLPFSSIGFSPQITVMDFYTTVKDNVILGLNLA
FT                   GITGKEAENLCEKALKTVFLYEKKDKIVDTLSGGQLQRVQIARAIAHEPSLYILDEPTS
FT                   GLDAESSEAFLTFLKNEVNNGKTVIISSHDIQLLELFCNKILFIKNGVMEFFGPIEEFL
FT                   DNDSYEVTLTFKDKITEKQKDWIKENKYIMEICNDFSCLIKLPKEISILDIISEFEKEF
FT                   VINDFSIKTTQLREIYLNKVK"
FT   CDS_pept        185816..186616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0211"
FT                   /product="putative ABC-2 transporter, permease protein"
FT                   /note="similar to ABC-2 transporter permease protein
FT                   putative [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80729"
FT                   /db_xref="GOA:C5WEB4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB4"
FT                   /inference="similar to AA sequence:RefSeq:NP_345537.1"
FT                   /protein_id="BAH80729.1"
FT                   /translation="MEVEKLRKESNLGLNGIRIVGKNEIIAFFRSKGLVASQLLQPILY
FT                   VVFIVVGLNNSIGSVNYNGLIVPYSNYTIVGIFSLLIVGQMTQVIYRVTIDKRYGLLAL
FT                   KLSSGVKPFYYILGMSLYSILGLGIQEIVIYLIGLLFNINISFPLFLYIMLLSFVVLLF
FT                   WTSLGVLITMFINDYQKRDIVIRFLITPLGFTAPVFYLYDTAPRVVQIFGAINPLSYQL
FT                   AVLRDTFFGIQSSLQIFLLILASLLSIVVTAIIIPKINLVLVER"
FT   CDS_pept        186743..187378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0212"
FT                   /product="transposase"
FT                   /note="similar to transposase IS204/IS1001/IS1096/IS1165
FT                   [Streptococcus suis 89/1591]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80730"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00875692.1"
FT                   /protein_id="BAH80730.1"
FT                   /translation="MTVNMSGAYIPIIKQLFPKARIVLDRFHIVQHLGRAMMTTRIAIM
FT                   KTFDKKSLPYRAIKNHWRLFQKDSRKLSNNRFYSKTFRQTLQPQEIVDKTLQFSDELRY
FT                   YYDLYQLLLFHFQEKRTEVFFEIIEDNMELVTLNFKKVFVTFRKLKPYIENALQFDYSN
FT                   AKLEATNKLIKDIKRAAFGFRNFKNFRSKILLALNIQKERANLVLSRV"
FT   tRNA            complement(187481..187555)
FT                   /locus_tag="SDEG_0213"
FT                   /product="tRNA-Lys"
FT                   /anticodon="(pos:187519..187521,aa:Lys,seq:ctt)"
FT                   /note="codon recognized: AAG"
FT   CDS_pept        complement(187517..187747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0214"
FT                   /product="truncated hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy1706
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80731"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB6"
FT                   /inference="similar to AA sequence:RefSeq:YP_061024.1"
FT                   /protein_id="BAH80731.1"
FT                   /translation="MLWHTNPHLSVDRLFLCIFGKQRLFLVCKPFHADATSKKERVTHL
FT                   LILRGLNTKSGSPVPIQHSCLLSSVGRAVDS"
FT   CDS_pept        complement(187820..189109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cshA"
FT                   /locus_tag="SDEG_0215"
FT                   /product="recombination factor protein"
FT                   /note="similar to recombination factor protein RarA
FT                   [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80732"
FT                   /db_xref="GOA:C5WEB7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB7"
FT                   /inference="similar to AA sequence:RefSeq:YP_140366.1"
FT                   /protein_id="BAH80732.1"
FT                   /translation="MPDHLALRMRPKTISEVIGQEHLVGEGKIIRRMVEANMLSSMILY
FT                   GPPGIGKTSIASAIAGTTKYAFRTFNATVDSKKRLQEIAEEAKFSGGLVLLLDEIHRLD
FT                   KTKQDFLLPLLENGTIIMIGATTENPFFSVTPAIRSRVQIFELEPLSNEDIKRALRTAI
FT                   TDKERGFAFDVMLDDNALDFIATATNGDLRSAYHSLDLAVMSTKPDSDGKRHITLDTVE
FT                   NSLQRSYITMDKDGDGHYDVLSALQKAIRGSDVNASLHYAARLVEAGDLPSLARRLIVI
FT                   AYEDIGLANPDAQVHTVTALDAAQKIGFPEARILIANVVIDLALSPKSNSAYLAMDAAL
FT                   SDLRTSGNLPIPRHLRDGHYAGSKELGNAKDYLYPHAYPKKWVKQQYLPDKLIGKQYFS
FT                   PNETGKYERALGANKERIDKLSSHSTGIPK"
FT   CDS_pept        complement(189142..189708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0216"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="similar to anthranilate synthase component II
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80733"
FT                   /db_xref="GOA:C5WEB8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB8"
FT                   /inference="similar to AA sequence:RefSeq:YP_061022.1"
FT                   /protein_id="BAH80733.1"
FT                   /translation="MILLIDNYDSFTYNLAQYLSEFDETIVLYNQDPHLYDMAKKADAL
FT                   VFSPGPGWPKEANQMPKLIQDFYQTKPILGVCLGHQAIAETLGGNLRLAKRVMHGRQST
FT                   IETQGPVSLFRSLPKQVTVMRYHSIVVDQLPKDFIVTARDCDDQEIMAFEHRSLPLFGL
FT                   QFHPESIGTPDGMTMIANFIAAIPH"
FT   CDS_pept        complement(189741..191504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0217"
FT                   /product="para-aminobenzoate synthetase
FT                   componentI/4-amino-4-deoxychorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="similar to para-aminobenzoate synthetase component
FT                   I/4-amino-4-deoxychorismate lyase [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80734"
FT                   /db_xref="GOA:C5WEB9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEB9"
FT                   /inference="similar to AA sequence:RefSeq:YP_283060.1"
FT                   /protein_id="BAH80734.1"
FT                   /translation="MGMHRKTIIDFKELGHRFLFEKPLLELVAKSLDQVGPVIQQVQHY
FT                   QELGYYVVGYLSYEAAAFFDNALQTHNDRLGNEYLAYFTVHKTCQKEDLPLDYDSITIP
FT                   NQWVSATQKEAYQKAIETIHHEMRQGNTYQVNYTLQLTQELNAADSLAIYNKLVVEQAA
FT                   GYNAYIAHDEFAVISASPELFFKQEGNQLTTRPMKGTTKRGVNSWLDQQEHDWLQADGK
FT                   NRSENMMIVDLLRNDMGKICQTGSVCVDKLCEVEQYSTVWQMTSTIIGDLKADCDLIDI
FT                   LTALFPCGSITGAPKVSTMAIITSLEPNPRGIYCGTVGICLPDGRRLFNVPIRTIQLSH
FT                   NQATYGVGGGITWQSKWEDEYEEVHQKTAFLYRHKQSFNLKTTAKVEQKKIAFLEQHLN
FT                   RLKEAATYFAYPYDEKALQKQLATYLEDKDDAAYRLTISLSKDGKMRLSDQPLEPLSAD
FT                   FLTAQLSLQDKDVTASPFTYFKTSYRPHIEQKSYEQVFYNQAGQLLETSIGNLFVQLNH
FT                   TLYTPPVAVGILPGLFRQELLASGQVQEKELTLTDLKEASAIFGGNAVRGLYPLNLELT
FT                   HLNALLASDQA"
FT   CDS_pept        191698..192168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0218"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS2096 Spy1717
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80735"
FT                   /db_xref="InterPro:IPR021380"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC0"
FT                   /inference="similar to AA sequence:RefSeq:YP_601313.1"
FT                   /protein_id="BAH80735.1"
FT                   /translation="MAKYGFLSVLEEEMDKHFQYDYAMDWDKKNHAVEVTFVLEAQNKE
FT                   AIKTIDDSGEVTQDDIVFEDYVLFYNPAKSQFDAADYLVTIPFDAKKGFSREFLAYFAQ
FT                   FLNDVAIEGHSDLMDFLADDSKADFFLEWNAQAFEEGQQGLEEAASYPYPRY"
FT   CDS_pept        192239..193192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0219"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="similar to ribosomal protein L11 methyltransferase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80736"
FT                   /db_xref="GOA:C5WEC1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC1"
FT                   /inference="similar to AA sequence:RefSeq:YP_283058.1"
FT                   /protein_id="BAH80736.1"
FT                   /translation="METWQEVTVHVHRDAQEAVSNLLIETGSQGVAIADSADYIGQEDR
FT                   FGELYPDVEQSDMIAITAYYPSSTNLADVTVTINEQLAELASFGLQVGQVTVDSQELAE
FT                   EDWADNWKKYYEPARITHDLTIVPSWTDYEASAGEKVIKLDPGMAFGTGTHPTTKMSLF
FT                   ALEQVLRGGETVIDVGTGSGVLSIASSLLGAKTIYAYDLDDVAVRVAQENIDLNQGTDN
FT                   IHVAAGDLLKGVGQEADVIVANILADILVLLTDDAYRLVKKEGYLILSGIISEKLDMVL
FT                   EAAFSAGFFLETHMVQGEWNALVFKKTDDISGVIGG"
FT   CDS_pept        193192..193950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0220"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51663
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80737"
FT                   /db_xref="GOA:C5WEC2"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC2"
FT                   /inference="similar to AA sequence:RefSeq:YP_001129180.1"
FT                   /protein_id="BAH80737.1"
FT                   /translation="MQQYFIKGKAEKEVTITDKDTIKHMFQVMRLTDEAEVVLVFDDGI
FT                   KYLAKVTNSMAHELEIIEALPDQVELPVKVTIASGFPKGDKLDTIAQKVTELGASALWG
FT                   YPADWSVVKWDGKKLAKKEDKLAKIVLGAAEQSKRNVVPEVHLFEQKAEFLKSLSSFDH
FT                   IFIAYEETAKAGQLATLAREVKEVKPGAKLLFIFGPEGGISPAEITQFEAAGAIKVGLG
FT                   PRIMRTETAPLYALSAISYALELQVTSDDN"
FT   CDS_pept        194102..195124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0221"
FT                   /product="HTH-type transcriptional regulator"
FT                   /note="similar to HTH-type transcriptional regulator
FT                   MalR-like [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80738"
FT                   /db_xref="GOA:C5WEC3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC3"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124124.1"
FT                   /protein_id="BAH80738.1"
FT                   /translation="MREEDLVTIKDVAKLAGVSASTASRAINDNHMISQATKERVRKAM
FT                   EALDYSPNYSAQNLVKRQSNAVGIILPVRVIQDSLGNNPFFMQIIQGIAGVCTDNGYMV
FT                   SLATGRSDDELLKNVQNMIRSGHIGKLIFLYSKTDDKVFDFVKKQAVDCVVVGQSYATD
FT                   NGNAKFVDNDNRQAGYDAAAFLLERGFKQITYAYTDMDELVQAERFIGYAEKMTSQGLT
FT                   AQTINLSSETEQDIGQRIQKFLANHPQPAFVTCDDMLAIHLQRLLKQNHPNPKVPMISF
FT                   NNSILAELATPSLTSVEIFPYQLGEKAATLVLATDHIQDTIHLISHQIVERESTQPITP
FT                   "
FT   CDS_pept        195394..197580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0222"
FT                   /product="PTS system, glucose-specific IIABC component"
FT                   /note="similar to PTS system glucose-specific IIABC
FT                   component [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80739"
FT                   /db_xref="GOA:C5WEC4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011300"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC4"
FT                   /inference="similar to AA sequence:RefSeq:YP_061016.1"
FT                   /protein_id="BAH80739.1"
FT                   /translation="MKTSFKQLFSFEFWQKFGKCLMVVIAVMPAAGLMISIGNSIPMIN
FT                   HNSAFLASLGNIIAQIGWAIIVNLHLLFALAIGGSWAKERAGGAFASGLAFVLINRITG
FT                   AFYGVSGAMLADPEAKITSLLGTQMIVKDYFTSVLESPALNTGVFVGIIAGFVGATAYN
FT                   KYYNYRKLPEVLTFFNGKRFVPFVVILRSILVALVLVVVWPVIQSGINGFGMWIASSQD
FT                   SAPILAPFLYGTLERLLLPFGLHHMLTIPMNYTALGGTYEVMTGAAAGTKVFGQDPLWL
FT                   AWVTDLVHLKGSDASAYHQLMDGVTPARFKVGQMIGATGTLMGVALAMYRNVDADKKHK
FT                   YKMMFISAAAAVFLTGVTEPLEYMFMFAAMPLYLVYALVQGASFAMADLVNLRVHSFGN
FT                   IELLTRTPMALKAGLGMDLINFVWVSILFAVIMYFIADMMIKKMHLATAGRLGNYEADM
FT                   LDDNKAKSSGAPMADSNSQVVQIVNLLGGRDNIDDVDACMTRLRVTVKDPAKVGAEDDW
FT                   KKAGAMGLITKGSGVQAVYGPKADILKSDIQDLLDSGAIIPEVNMSKVADKPMPAKDFR
FT                   HVTEEVLSVADGTVLQITGVKDQVFAAKMMGDGFAVEPTNGNIYAPVSGLVTSVFPTKH
FT                   AFGLLTDSGLEVLVHVGLDTVALNGVPFSVKVTEGQRIEAGDLLVVADLAAIQSAERET
FT                   TIVVAFTNTAEIQDVTLTSLGVQPAKTPVATVEL"
FT   CDS_pept        197659..198483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rgfB"
FT                   /locus_tag="SDEG_0223"
FT                   /product="putative RgfB protein"
FT                   /note="similar to putative RgfB protein [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80740"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC5"
FT                   /inference="similar to AA sequence:RefSeq:NP_665511.1"
FT                   /protein_id="BAH80740.1"
FT                   /translation="MTKLLTLNTHSWMEANALKKLVDLAEHILAEKYDIICLQEINQLI
FT                   ESELAMELPSYQPIPGTPTIHKDHFALLLIHYLKKRGQHYYWSWAYNHIGYDIYHEGVA
FT                   ILSKQPIHVSDILVSAMDDETDYHTRRSLVAKTTLDGKEVAVVNVHLSWFDKGFLGEWE
FT                   KLEKELLTLNCPLLLMGDFNNPTNQEGYQVIMGSPLNLQDSHKVADHVFGDHSIVADID
FT                   GWEDNKEAFKVDHVFTSKDFDIKASHITFEGGDAPVVSDHYGLEVTLDWVEK"
FT   CDS_pept        complement(198492..199004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0224"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1944
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80741"
FT                   /db_xref="GOA:C5WEC6"
FT                   /db_xref="InterPro:IPR012853"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC6"
FT                   /inference="similar to AA sequence:RefSeq:NP_688932.1"
FT                   /protein_id="BAH80741.1"
FT                   /translation="MTKLILIRGNAASGKTSLANALQSQFGENTLLLSQDKLRREMLLA
FT                   HDGFDAPTIPLLKHLITFGMANCDYIILEGILKADWYAPVWDFISQQSRLQVFAYYYDI
FT                   PFEETLKRHSSRSKVEEFGEEALRKWWNEKDYIKIISETSFDKTVTLQEALNYILQDIT
FT                   KRSGLTS"
FT   CDS_pept        complement(199028..200128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0225"
FT                   /product="glucanase; deblocking aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /note="similar to glucanase; deblocking aminopeptidase
FT                   [Bacillus cereus E33L]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80742"
FT                   /db_xref="GOA:C5WEC7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC7"
FT                   /inference="similar to AA sequence:RefSeq:YP_082403.1"
FT                   /protein_id="BAH80742.1"
FT                   /translation="MCLEKCYNRRTIWIFSKNGVLMKTTVDYLTKLANIPSPTGFTRKI
FT                   MDYVHDELSQFGYEPVRTHKGGIMVSIKGKNDDKHRVVTAHLDTLGAMVRAIKPDGRLK
FT                   MDLVGGFVYNSIEGENCTVHLAKSGKEISGTILLHQTSVHVYKDAGSAERNQANMEVRL
FT                   DEKVTTADETRALGIEVGDFISFDPRVIVTESGFIKSRHLDDKVSAAILMELLKCYKEE
FT                   QVELPYTTHFYFSAFEEVGHGANSSLPAQVVEYLAVDMGAMGDDQATDEYTVSICVKDG
FT                   SGPYHYELRQHLVALCQDHQIPYQLDIYPYYGSDASAAMRAGAEVRHALLGAGIESSHS
FT                   YERTHTDSIEATERLVDTYLKSTMID"
FT   CDS_pept        complement(200136..200687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0226"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs0573
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80743"
FT                   /db_xref="GOA:C5WEC8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC8"
FT                   /inference="similar to AA sequence:RefSeq:NP_735037.1"
FT                   /protein_id="BAH80743.1"
FT                   /translation="MTKIKTQVLTFIAAAIALNYLGANIALFLKLPLYLDMIGTLLIAL
FT                   LFGPWLGAVTAIVSALLSWMTTDIFALFYAPVAIITALTAGVFMRQNSKAKDLIWKALC
FT                   ISFPGTLVASIITVILFKGITSSGSSLLVQMLHGLGLDLTVSVIVIQAGTDYLDRLVSL
FT                   LLVLMISKALRKQLPHLFQI"
FT   CDS_pept        complement(200691..201671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0227"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /EC_number="3.2.2.-"
FT                   /note="similar to inosine-uridine preferring nucleoside
FT                   hydrolase [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80744"
FT                   /db_xref="GOA:C5WEC9"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEC9"
FT                   /inference="similar to AA sequence:RefSeq:NP_687557.1"
FT                   /protein_id="BAH80744.1"
FT                   /translation="MTKQPIIIDCDPGIDDSLALLYALKHPKLEVIAITLVQGNVPVPI
FT                   GLQNTILLLERVNRLDIPIYLGRGIPLERDYVSAQDTHGIDGLGDSLLQPSVIKEAEAL
FT                   PAADFLAQHFAEPSETAIIALGPLTNVAEALGQNPNMGKHCQRFVSMGGAFKAHGNCSP
FT                   VAEYNYWCDPHAARLTFQQLGRKLEMVGLDVTRQIVLTPNHLSYMARLNPEETAFIESI
FT                   TRFYFDFHWEYEHLIGCVINDPLAVVYFLAPTICQGFDSYTDVATEGITLGQTVVDQYD
FT                   FYHKKANSHILTTVNSKAFWSEFIATILEVPLHQVVQDLDHLQLG"
FT   CDS_pept        complement(201952..202419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SDEG_0228"
FT                   /product="ribonucleotide reduction protein NrdI"
FT                   /EC_number="1.17.4.-"
FT                   /note="similar to ribonucleotide reductase-like (Nrd-like)
FT                   protein [Streptococcus dysgalactiae subsp. equisimilis]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80745"
FT                   /db_xref="GOA:C5WED0"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED0"
FT                   /inference="similar to AA sequence:INSD:CAB70606.1"
FT                   /protein_id="BAH80745.1"
FT                   /translation="MSDLTIVFISLSGNTLSFVKRLSLYLEEKQGIHTNPINIKNLKHE
FT                   TFPVEDDFVAILPTYLEGGNGIDSGEVEILTNPLGDFIAAHDNYKHCMGIIGSGNKNFN
FT                   NQYCLTAKQYAKRFGFPMLGDFELRGTNDDIERLAKIILERRDAFRASSED"
FT   CDS_pept        202906..204447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgg"
FT                   /locus_tag="SDEG_0229"
FT                   /product="trans-acting positive regulator"
FT                   /note="similar to trans-acting positive regulator
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80746"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR013236"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED1"
FT                   /inference="similar to AA sequence:RefSeq:YP_061038.1"
FT                   /protein_id="BAH80746.1"
FT                   /translation="MTHASKLFTKQQWRELELIAHLTEHSDRMGYKDRELCKVLDSTMS
FT                   TLQACVANLHFMESLGRVTYQDGYLAIDYNDHCGLQEVYQRALRESQSLQLLSALFFNE
FT                   FDSLEELAEALFISLSTLKRLITKTNSYLKKEFDIMISTRPVMVVGDEHHIRLFYLKYF
FT                   SEAYTISEWPFAEIINQNNLERLIALMVKQTDVPVNFALFQHLKILSGVNLIRFQKGFT
FT                   LNRKDKGLEHLFMKVLEDSLEMKDLSALFALKYNQPLDARALAEIFSNYLNPALELGKL
FT                   LQSDDSAREQTLSSHQIVPWIALLDKIEKSLQLSISNKYELARHLQTTVILAEEDISAN
FT                   FLIYDYKKEYLKFFHKHYRVIYDTFLTYVEDLFALDHQEFNEGIRNHLLYCLFITWENL
FT                   FLKISQSRRKLKLLVIERSYSNVGNFLKEYFGGFFEIISFDDLGNLKIDLLPLAKEYDV
FT                   IVTDVILEQNNHSEILFFNQMIPSVVADKLTDFLKVKVGEDKLFESIALNQMSTS"
FT   CDS_pept        204718..206343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stg480.0"
FT                   /locus_tag="SDEG_0230"
FT                   /product="antiphagocytic M protein"
FT                   /note="similar to M protein"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80747"
FT                   /db_xref="GOA:C5WED2"
FT                   /db_xref="InterPro:IPR003345"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR019950"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED2"
FT                   /inference="similar to AA sequence:RefSeq:P12379.1"
FT                   /protein_id="BAH80747.1"
FT                   /translation="MARKNTNKHYSLRKLKTGTASVAVALTVVGAGLVAGQTVKANNSE
FT                   DITSMMPILSGVGSSNAVDSNFTADQLAKRMNNPKAIEKTIQVGREYKQGLYDQLVRNK
FT                   KLEEDLRVKNLLADAASLRAESAERELQELEDKYKQVETEKTALKSRQAELESALQGAM
FT                   NFSAEDSAKIKALEAEKTALKSRQAELESALQGAMNFSAEDSAKIKALEAEKTALKSRQ
FT                   AELESALQGAMNFSAEDSAKIKALEAEKTALESRQAELEHQTQVLNANRQSLRRDLDAS
FT                   REAKKQLEAEYQKLEEEKQISDASRQGLRRDLNASREAKKQLEAEHQKLEEQNKISEAS
FT                   RKGLRRDLNASRAAKKQVEKDLANLTAELDKVKEEKQISDASRQGLRRDLDASREAKKQ
FT                   VEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEKLAKQAEELA
FT                   KLRAGKASDSQTPDAKPGNKVVPGKGQAPQAGTKPNQNKEPMKETKRQLPSTGEATNPF
FT                   FTAAALAVMATAGVAAVAKRKEEN"
FT   CDS_pept        206884..209103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0231"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="similar to GTP pyrophosphokinase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80748"
FT                   /db_xref="GOA:C5WED3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED3"
FT                   /inference="similar to AA sequence:RefSeq:YP_061012.1"
FT                   /protein_id="BAH80748.1"
FT                   /translation="MAKEINLTGEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRK
FT                   SGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDG
FT                   VTKLGKVEYKSHEEQLAENHRKMLMAMSKDIRVILVKLADRLHNMRTLKHLRKDKQERI
FT                   SRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIV
FT                   TKIKSYTTEQGLFGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAM
FT                   VGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVA
FT                   AHWAYKKGVRGKVNQAEQKVGMNWIKELVELQDASNGDAVDFVDSVKEDIFSERIYVFT
FT                   PTGAVQELPKDSGPIDFAYAIHTQVGEKAIGAKVNGRMVPLTAKLKTGDVVEIVTNPNS
FT                   FGPSRDWIKLVKTNKARNKIRQFFKNQDKELSVNKGRDMLVSYFQEQGYVANKYLDKKR
FT                   IEAILPKVSVKSEESLYAAVGFGDISPISVFNKLTEKERREEERAKAKAEAEELVNGGE
FT                   IKHENKDVLKVRSENGVIIQGASGLLMRIAKCCNPVPGDPIEGYITKGRGIAIHRADCN
FT                   NIKSQDGYQERLIEVEWDLDNSSKDYQAEIDIYGLNRSGLLNDVLQILSNSTKSISTVN
FT                   AQPTKDMKFANIHVSFGIPNLTHLTTVVEKIKAVPDVYSVKRTNG"
FT   CDS_pept        209117..209560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0232"
FT                   /product="D-tyrosyl-tRNA deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="similar to D-tyrosyl-tRNA deacylase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80749"
FT                   /db_xref="GOA:C5WED4"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED4"
FT                   /inference="similar to AA sequence:RefSeq:YP_061011.1"
FT                   /protein_id="BAH80749.1"
FT                   /translation="MKIVIQRVKEASVSIDGKIAGAINQGLLLLVGVGPDDAAEDLAYA
FT                   VRKIVNMRIFSDADGKMNQSIQDIKGSILSVSQFTLYADTKKGNRPAFTGAAKPDLARQ
FT                   LYDSFNEQLADFVPVERGVFGADMQVSLINDGPVTIILDTKCH"
FT   CDS_pept        complement(209658..210980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0233"
FT                   /product="streptokinase"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to streptokinase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80750"
FT                   /db_xref="GOA:C5WED5"
FT                   /db_xref="InterPro:IPR004093"
FT                   /db_xref="InterPro:IPR008124"
FT                   /db_xref="InterPro:IPR036120"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED5"
FT                   /inference="similar to AA sequence:RefSeq:YP_061010.1"
FT                   /protein_id="BAH80750.1"
FT                   /translation="MKNYLSFGMFALLFALTFGTVNSVQAIAGPEWLLDRPSVNNSQLV
FT                   VSVAGTVEGTNQDISLKFFEIDLTSRPAHGGKTEQGLSPKSKPFATDSGAMPHKLEKAD
FT                   LLKAIQEQLIANVHSNDDYFEVIDFASDATITDRNGKVYFADKDGSVTLPTQPVQEFLL
FT                   KGHVRVRPYKEKPVQNQAKSVDVEYTVQFTPLNPDDDFKPVLKDTKLLKTLAIGDTVTS
FT                   QELLAQAQSILNESHPDYTIYERDSSIVTHDKDIFRTILPMDQEFTYRVKNREQAYEIN
FT                   KKSGLNEEINNTDLISEKYYVLKKGEKPYDPFDRSHLKLFTIKYVDVNTNELLKSEQLL
FT                   TASERNLDFRDLYDPRDKAKLLYNNLDAFGIMDYTLTGKVEDNHDDTNRIITVYMGKRP
FT                   EGENASYHLAYDKDRYTEEEREVYSYLRYTGTPIPDNPNDK"
FT   CDS_pept        211267..212157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0234"
FT                   /product="leucine rich protein"
FT                   /note="similar to leucine rich protein [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80751"
FT                   /db_xref="GOA:C5WED6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED6"
FT                   /inference="similar to AA sequence:RefSeq:YP_061009.1"
FT                   /protein_id="BAH80751.1"
FT                   /translation="MCYNGLKTVMKGMAMELKDYFPEMQVGPHPLGDKEWMSIKEGDQY
FT                   VHFPKSCLSEKERLLLEVGLGQYEVLQPLGSPWQRYLLDHQGNPPQLFETSQFIYLNHQ
FT                   QALPDDLVELLQQMIAGLEVILPISTTQTAFLCRQATSIKVLRSLEGLLPTLESDFGLA
FT                   LTMFVGNAWYQVAAGTLRECFEEECQLLTAYLKQKSGGKLLTFAEVMLWSILSHQSFPA
FT                   LTRQFHQFLNPQSDMADVVHALWSEHGNLVQTAQRLYIHRNSLQYKLDKFAQQSGLHLK
FT                   QLDDLAFAYLFLLKY"
FT   CDS_pept        212455..213588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0235"
FT                   /product="multiple sugar transport ATP-binding protein"
FT                   /note="similar to multiple sugar transport ATP-binding
FT                   protein [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80752"
FT                   /db_xref="GOA:C5WED7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED7"
FT                   /inference="similar to AA sequence:RefSeq:YP_061008.1"
FT                   /protein_id="BAH80752.1"
FT                   /translation="MVELNLNHIYKKYPNTTHYAVEDFDLDIKDKEFIVFVGPSGCGKS
FT                   TTLRMIAGLEDISEGELKIDGEVVNDKSPKDRDIAMVFQNYALYPHMTVYDNMAFGLKL
FT                   RKYKKDDIDRRVKEAAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPL
FT                   SNLDAKLRVSMRAEIAKIHRRIGSTTIYVTHDQTEAMTLADRIVIMSATKNPQGNGTIG
FT                   KIEQVGSPQELYNLPANKFVAGFIGSPAMNFFEVEVKDGRIVSEDGLDIAIPEGQAKML
FT                   ETAGYKGKKVTFGIRPEDISSNQIVHDTYPNANVTAEVLVSELLGSETMLYVKLGQTEF
FT                   ASRVDARDFHSPGEQVSLTFNVAKGHFFDLDTEQAIR"
FT   CDS_pept        213664..215283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0236"
FT                   /product="glucan 1,6-alpha-glucosidase"
FT                   /EC_number="3.2.1.70"
FT                   /note="similar to glucan 1,6-alpha-glucosidase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80753"
FT                   /db_xref="GOA:C5WED8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED8"
FT                   /inference="similar to AA sequence:RefSeq:YP_061007.1"
FT                   /protein_id="BAH80753.1"
FT                   /translation="MTMQKQWWHKATIYQIYPRSFKDTSGNGIGDLKGITSQLDYLQKL
FT                   GITAIWLSPVYQSPMDDNGYDISDYEAIAEVFGNMDDMDDLLAAANERGIKIIMDLVVN
FT                   HTSDEHAWFVEARENPNSPERDYYIWRDEPNNLMSIFSGSAWELDEASGQYYLHLFSKK
FT                   QPDLNWENAQLRQKIYDMMNFWIAKGIGGFRMDVIDLIGKIPDSEITGNGPRLHDYLKE
FT                   MNQATFGNHDVMTVGETWGATPEIARQYSRPENKELSMVFQFEHVGLQHKPNAPKWDYA
FT                   EELDVPALKTIFSKWQTELKLGEGWNSLFWNNHDLPRVLSIWGNDSIYREKSAKALAIL
FT                   LHLMRGTPYIYQGEEIGMTNYPFKDLTEVDDIESLNYAKEAMENGVPAAHVMSSIRKVG
FT                   RDNARTPMQWSKDTHAGFSEAQETWLPVNPNYQEINVADALANQDSIFYTYQQLIALRK
FT                   EQDWLVEADYHLLPTADKVFAYQRQFGEETYVIVVNVSDQEQVFAKDLAGAEVVITNTD
FT                   VDKVLETKHLQPWDAFCVKLSV"
FT   CDS_pept        215449..219072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0237"
FT                   /product="pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /note="similar to pullulanase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80754"
FT                   /db_xref="GOA:C5WED9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011838"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR040806"
FT                   /db_xref="UniProtKB/TrEMBL:C5WED9"
FT                   /inference="similar to AA sequence:RefSeq:YP_061005.1"
FT                   /protein_id="BAH80754.1"
FT                   /translation="MIKRVTQGSKQYKYAIKKLSIGVVSVATGASILLYSPQVMAQESS
FT                   PETGVTQTQVEHEKQATEQADSVVNEAVNASVGLTPESSEKRTEAVGDSSQATEPQLST
FT                   NQADASQADKISESAKPLATDAAAKAPVIADNHLRLHLKALPKDQSLDSLGLWVWDDVD
FT                   QPSKDWPNGAIPLATAKKDDYGYYLDVKLAEKQRKQISYLINNKAGENLSKDQHFQLLT
FT                   PKMNEVWIDENYHAHAYRPLKKGYLRINYHNQSGHYDNLAVWTFKDVKTPTTDWPNGLD
FT                   LSHKGPHGAYVDVPLKEGAKEIGFLILDKSKSGDAIKVQPKDYLFKDLDNHTQIFVKDT
FT                   DPKVYNNPYYIDQVSLKGAEQTTPNEIKAIFTTLDGLDEDTVKQNIKITDKAGKAVAID
FT                   ELTLDKDKSVMTLKGDFKAQGAVYTVTFGEVSQVARQSWQLKDKLYAYDGELGATLAKD
FT                   GSVDLALWSPSADSVKVVVYDKQDQTKVVGQADLTKSDKGVWRTHLTSDSIKGISDYTG
FT                   YYYLYEITRGQEKVMVLDPYAKSLAAWNNATANDQIKTAKAAFVNPSLAGPKDLDFAKI
FT                   NNFKKREDAIIYEAHVRDFTSDPSLDGKLRNEFGTFAAFIEKLDYLKELGVTHVQLLPV
FT                   LSYFYVNELDKSRSTAYTSSDNNYNWGYDPQHYFALSGMYSANPNDPALRIAELKQLVN
FT                   EIHKRGMGVIFDVVYNHTARTYLFEDLEPNYYHFMNADGTARESFGGGRLGTTHAMSRR
FT                   ILVDSITYLTREFKVDGFRFDMMGDHDAAAIEQAFKAAKAINPNTIMIGEGWRTYQGDE
FT                   GKKETAADQDWMKATNTVGVFSDDIRNTLKSGFPNEGTAAFITGGAKNLEGLFKTIKAQ
FT                   PGNFEADAPGDVVQYIAAHDNLTLHDVIDKSINKDPKVAEEEIHKRIRLGNTLILTAQG
FT                   TAFIHSGQEYGRTKHLLNPDYKTKVADDKVPNKATLIDAVAEYPYFIHDSYDSSDAVNH
FT                   FDWAKATDGQVNPISYQTQAYTKGLIALRRSSDAFRKASMADVNRDVTLITQAGQGDIQ
FT                   KDDLIIGYQTIASNGDRYAVFVNADSKARTVVLPDRYRHLLGAQVLVDAEQAGVTAIAK
FT                   PKGVQFTKEGLTIDGLTAIVLKVAAGVVEAPSQTQQARSEQSVRPVSTAVSKASPLMTP
FT                   YQKPQQASLPQTGEMTSKGLLATGMTMLIAVFGLFTKRQKD"
FT   CDS_pept        complement(219225..219515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0238"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SPCG 1675
FT                   [Streptococcus pneumoniae CGSP14]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80755"
FT                   /db_xref="GOA:C5WEE0"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE0"
FT                   /inference="similar to AA sequence:RefSeq:YP_001836392.1"
FT                   /protein_id="BAH80755.1"
FT                   /translation="MLAQFRPLINRYAKPYLVLVCLLWLAMFFVRWDTMVLGYNLYFLV
FT                   MQKGFLILGILTILMGAISKRWGLILFGLLFCGAFWINLFIFFGILPVFGN"
FT   CDS_pept        219671..220021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0239"
FT                   /product="thioredoxin"
FT                   /note="similar to thioredoxin [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80756"
FT                   /db_xref="GOA:C5WEE1"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE1"
FT                   /inference="similar to AA sequence:RefSeq:YP_601297.1"
FT                   /protein_id="BAH80756.1"
FT                   /translation="MTFEETIAQFTTVEIGEVKQAIENGKDMIVFLGRSTCPFCRLFAP
FT                   KLAQVAEDHQKKVFFVNSENPIDAEALQAFRQEYHLATVPALLVIHSGQVRAVCDSSLT
FT                   ESEILDFLTTRE"
FT   CDS_pept        220128..220487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SDEG_0240"
FT                   /product="protein translocase subunit"
FT                   /note="similar to protein translocase subunit YajC
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80757"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE2"
FT                   /inference="similar to AA sequence:RefSeq:YP_603265.1"
FT                   /protein_id="BAH80757.1"
FT                   /translation="MGFPTILMFVVMLALIWFMQRQQKKQAQERQNQLNAIEKGDEVVT
FT                   IGGMFAIVDEVDSAAKKIVLDVDGVFLTFELSAIKRIVTKATTDLTPVEADEVVVVDEP
FT                   AVEATDDTESAIERN"
FT   CDS_pept        220715..221464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0241"
FT                   /product="undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="similar to undecaprenyl pyrophosphate synthetase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80758"
FT                   /db_xref="GOA:C5WEE3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE3"
FT                   /inference="similar to AA sequence:RefSeq:YP_061002.1"
FT                   /protein_id="BAH80758.1"
FT                   /translation="MFGLKAKSKKVVLDKIPKHIGIIMDGNGRWAKKRLKPRVFGHKAG
FT                   MDALQDVTIAASDLGVKVLTVYAFSTENWSRPQDEVSFIMNLPVEFFDKYVPTLHKNNV
FT                   KVQMIGETHRLPADTLTALNAAIDKTKRNTGLILNFALNYGGRAEITSAVRLIAQDVLD
FT                   AKLNPGDITEDLIANYLMTDHLPYLYRDPDLIIRTSGELRLSNFLPWQSAYSEFYFTPV
FT                   LWPDFKKAELLKAIADYNRRQRRFGKV"
FT   CDS_pept        221477..222271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0242"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="similar to phosphatidate cytidylyltransferase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80759"
FT                   /db_xref="GOA:C5WEE4"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE4"
FT                   /inference="similar to AA sequence:RefSeq:YP_061001.1"
FT                   /protein_id="BAH80759.1"
FT                   /translation="MKERVVWGGVAVAIFLPFLIIGNLPFQLFVGVLAMIGVSELLKMK
FT                   RLEVFSFEGVFAMLAAFVLTVPMDHYLTFLPIDASFAGYGLLVFFLLAGTVLNNRAYSF
FT                   EDATFPIAASLYVGIGFQNLVNARMSGIDKVLLALFIVWATDIGAYMIGRQFGKRKLLP
FT                   SVSPNKTIEGSLGGIACAVLVSFVFMLVDRAVYAPHHFLVMLVLVALFSIFAQFGDLVE
FT                   SAIKRHFGVKDSGKLIPGHGGILDRFDSMIFVFPIMHLFGLF"
FT   CDS_pept        222369..223082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0243"
FT                   /product="pheromone-processing membrane metalloprotease"
FT                   /note="similar to pheromone-processing membrane
FT                   metalloprotease [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80760"
FT                   /db_xref="GOA:C5WEE5"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE5"
FT                   /inference="similar to AA sequence:RefSeq:YP_061000.1"
FT                   /protein_id="BAH80760.1"
FT                   /translation="MLGIITFIIIFGILVIVHEFGHFYFAKKSGILVREFAIGMGPKIF
FT                   SHVDQEGTLYTLRILPLGGYVRMAGWGDDKTEIKTGTPASLTLNEQGLVKRINLSQSKI
FT                   DPTSLPMNVTSYDLEDDLSITGLVLDETKTYAVDHNATIVEEDGTEIRIAPLDVQYQNA
FT                   SIGGRLITNFAGPMNNFILGIVVFILLVFYKVVCQILVAIRSVCKKMVPLLKLVSATMT
FT                   GLSLSMVIRSRIGQI"
FT   CDS_pept        222956..223627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0244"
FT                   /product="truncated pheromone-processing membrane
FT                   metalloprotease"
FT                   /note="similar to pheromone-processing membrane
FT                   metalloprotease [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80761"
FT                   /db_xref="GOA:C5WEE6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE6"
FT                   /inference="similar to AA sequence:RefSeq:YP_061000.1"
FT                   /protein_id="BAH80761.1"
FT                   /translation="MPDFSSNQVRVQENGAAAKAGIRDNDRIVTINGHKVKDWADLTEA
FT                   VQASTRNLGASETIKVTYKSGQTLKTVAVKPQKQGNQYALGVKARLKTGFVDKLLGGLE
FT                   LAWNGAFAILNTLKGLITAFSLNKLGGPVAMYQMSNQAAQNGLDSVLSLMAMLSINLGI
FT                   FNLIPIPALDGGKILMNIIEAIRRKPLKQETETYITLVGVAIMVVLMIAVTWNDIMRAF
FT                   F"
FT   CDS_pept        223818..225674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0245"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="similar to prolyl-tRNA synthetase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80762"
FT                   /db_xref="GOA:C5WEE7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE7"
FT                   /inference="similar to AA sequence:RefSeq:YP_060999.1"
FT                   /protein_id="BAH80762.1"
FT                   /translation="MKQSKMLIPTLREMPSDAQVISHALMVRAGYVRQVSAGIYAYLPL
FT                   ANRTIEKFKTIMREEFEKIGAVEMLAPALLTADLWRESGRYETYGDDLYKLKNRDKSDF
FT                   ILGPTHEETFTTLVRDAVKSYKQLPLNLYQIQAKYRDEKRPRNGLLRTREFIMKDGYSF
FT                   HPNYDDLDVTYEDYRQAYEAIFTRAGLDFKGIIGDGGAMGGKDSQEFMAITPERTDLDR
FT                   WVVLDKSIPSLADIPEEVLEEIKAELTAWMISGEDTIAYSSESSYAANLEMATNEYKPS
FT                   SKVAAEDALTEVETPNCKTIDEVADFLSVDETQTIKTLLFMADNEPVVALLVGNDQVND
FT                   VKLKNYLGADFLEPASEDDARAFFGAGFGSLGPVNLAEGSRIVADRKVQDLANAVAGAN
FT                   KDGFHLTGVNPGRDFQAEYVDIREVKEGEMSPDGHGILQFARGIEVGHIFKLGTRYSDS
FT                   MGATILDENGRAVPIVMGCYGIGVSRILSAVIEQHARLFVNKTPKGDYRYAWGINFPKE
FT                   LAPFDVHLITVNVKDQAAQDLTATLEADLMAKGYEVLTDDRNERVGSKFSDSDLIGLPI
FT                   RVTVGKKAADGIVEIKIKATGDSIEVTADNLIETLEILTKEQ"
FT   CDS_pept        225727..226284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0246"
FT                   /product="hypothetical protein ProS"
FT                   /note="similar to hypothetical protein ProS [Streptococcus
FT                   equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80763"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE8"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124104.1"
FT                   /protein_id="BAH80763.1"
FT                   /translation="MTDNRFKELIAADKDMMTILTIIASLPLRDAWLAAGAIRNFIWNQ
FT                   LAYGIGFDADTDIDVVFFDPSLPYEANQVVEDFLNKKFPNYRWEVRNQAYMHSHCPNTE
FT                   PYLSTCDAISKYPERCTAIALRRIDDQLELFAPYGLADVLAFECHPTPHFLSDKERLLL
FT                   YQKRLVAKNWKEKWPKLRYFLD"
FT   CDS_pept        226401..230798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0247"
FT                   /product="DNA polymerase III subunit alpha"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to DNA polymerase III subunit alpha
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80764"
FT                   /db_xref="GOA:C5WEE9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEE9"
FT                   /inference="similar to AA sequence:RefSeq:YP_060998.1"
FT                   /protein_id="BAH80764.1"
FT                   /translation="MSDLFVKLMEQIEMPLDMRRSSAFSSADIIEVKVHSVSRLWEFHF
FT                   AFAEILPIAIYRELHDRLIRTFEAADIKVTFDIQAAQVDYSDDVLQAYYQEAFEHAPCN
FT                   GASFKSSFAKLKVTYENDKLIIAAPRFVNNDHFRKNHLPNLVKQFEAFGFGTLTIDMVS
FT                   DQEMTEHLTKDFVSSRQALVEKAVQDNLEAQKSLEAMMPPVEEATPAPKFDYKERAAKR
FT                   QAGFEKATITPMIEIETEENRIVFEGMVFDVERKTTRTGRHIINFKMTDYTSSFALQKW
FT                   AKDDEELRKFDMIAKGAWLRVQGNIETNPFTKSLTMNVQQVKEIVHHERKDLMPEGQKR
FT                   VEFHAHTNMSTMDALPTVESLIDTAAKWGHKAVAITDHANVQSFPHGYHRARKAGIKAI
FT                   FGLEANIVEDKVPISYDPVDMDLHEATYVVFDVETTGLSAMNNDLIQIAASKMFKGNIV
FT                   EQFDEFIDPGHPLSAFTTELTGITDKHLQGAKPLVTVLKAFQDFCKDSILVAHNASFDV
FT                   GFMNANYERHNLPKITQPVIDTLEFARNLYPEYKRHGLGPLTKRFQVSLDHHHMANYDA
FT                   EATGRLLFIFLRDAREKHGIKNLLQLNTDLVAEDSYKKARIKHATIYVQNQVGLKNMFK
FT                   LVSLSNIKYFEGVPRIPRTVLDAHREGLLLGTACSDGEVFDAVLTKGIDAAVDLARYYD
FT                   FIEIMPPAIYQPLVVRELIKDQAGIEQVIRDLIEVGKRAKKPVLATGNVHYLEPEEEIY
FT                   REIIVRSLGQGAMINRTIGRGEGAQPAPLPKAHFRTTNEMLDEFAFLGKDLAYQVVVQN
FT                   TQDMADRIEEVEVVKGDLYTPYIDKAEETVAELTYQKAFEIYGNPLPDIIDLRIEKELT
FT                   SILGNGFAVIYLASQMLVNRSNERGYLVGSRGSVGSSFVATMIGITEVNPMPPHYVCPS
FT                   CQHSEFITDGSVGSGYDLPNKPCPKCGTPYQKDGQDIPFETFLGFDGDKVPDIDLNFSG
FT                   DDQPSAHLDVRDIFGAEYAFRAGTVGTVAEKTAYGFVKGYERDYGKFYRDAEVDRLAAG
FT                   AAGVKRTTGQHPGGIVVIPNYMDVYDFTPVQYPADDVTASWQTTHFNFHDIDENVLKLD
FT                   ILGHDDPTMIRKLQDLSGIDPITIPADDPGVMALFSGTEVLGVTPEQIGTPTGMLGIPE
FT                   FGTNFVRGMVNETHPTTFAELLQLSGLSHGTDVWLGNAQDLIKEGIATLKTVIGCRDDI
FT                   MVYLMHAGLQPKMAFTIMERVRKGLWLKISEEERNGYIDAMRENNVPDWYIESCGKIKY
FT                   MFPKAHAAAYVLMALRVAYFKVHHPLMYYCAYFSIRAKAFELKTMSGGLEAVKARMEDI
FT                   SIKRKNNEATNVENDLFTTLEIVNEMLERGFKFGKLDLYKSKATEFQIEGDTLIPPFVA
FT                   LEGLGENVAKQIVKARQEGEFLSKMELRKRGGASSTLVEKMDDMGILGNMPDDNQLSLF
FT                   DDFF"
FT   CDS_pept        230964..231392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0248"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="similar to MarR family transcriptional regulator
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80765"
FT                   /db_xref="GOA:C5WEF0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF0"
FT                   /inference="similar to AA sequence:RefSeq:NP_269932.1"
FT                   /protein_id="BAH80765.1"
FT                   /translation="MSNLDKNSALKAMVVFRKAQRTLDAFGSDVFKNANLTPTQFSVLE
FT                   VLHTKGSMRINNLIDSLLATSGNMTVVLRNMERNGWISRCKDDKDKRAYLVELTDQGRA
FT                   LIEDALPKHIKRVEQAFSVLTEAEQKELITLLKKFKNL"
FT   CDS_pept        231478..232029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0249"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="similar to NADPH-dependent FMN reductase putative
FT                   [Streptococcus sanguinis SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80766"
FT                   /db_xref="GOA:C5WEF1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001035334.1"
FT                   /protein_id="BAH80766.1"
FT                   /translation="MSKKILFIVGSLRQNSFNKQMAQIAEEMIGDRAEVSYLDYADLPL
FT                   FNEELEAQGVPAMDRIRKELEAADLVWIFSPVYNWAIPGTVKNLLDWASRSLDPSDHAA
FT                   ASSIHDKFFTVSSLANGESPKAVFKHYRELLPFIRTNVIGEFAGGPINPEAWATGKITL
FT                   SESLHEKLANQVEEVLQELR"
FT   CDS_pept        complement(232097..232711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="SDEG_0250"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="similar to peptide deformylase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80767"
FT                   /db_xref="GOA:C5WEF2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF2"
FT                   /inference="similar to AA sequence:RefSeq:YP_060995.1"
FT                   /protein_id="BAH80767.1"
FT                   /translation="MSAQDKIIKSSHLITMDDIIREGNPTLRAVAKEVTLPLSDEDILL
FT                   GEKMMQFLKHSQDPVMGEKLGLRAGVGLAAPQIDVSKRIIAVLVPNLPDQEGNPPKEAY
FT                   SLQEVLYNPKIVSHSVQDAALADGEGCLSVDRVVEGYVVRHARVTVEYFDKTGEKHKIK
FT                   LKGYNAIVVQHEIDHINGVMFYDRINPTAPFKADDNLLLLD"
FT   CDS_pept        complement(233011..233676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0251"
FT                   /product="Crp-like transcriptional regulator"
FT                   /note="similar to Crp-like transcriptional regulator
FT                   [Streptococcus thermophilus LMD-9]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80768"
FT                   /db_xref="GOA:C5WEF3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF3"
FT                   /inference="similar to AA sequence:RefSeq:YP_819723.1"
FT                   /protein_id="BAH80768.1"
FT                   /translation="MKTISDTKLLAYYLTKYRLEEFFPKNSHPHLQLTHYLKGEAICVQ
FT                   DQELKALYYLVQGNIKIVRRLFNGKEHILETHNGPILIGDIELMTDQKAVTSVIVLDEA
FT                   YVVQLSLTHKESLLTDADFLYHIGRGLAQNFYKQNITSTTNITYTVKERLASYLIAHEN
FT                   QQKVHLNLTLLADRFGTSYRHLHRVVHQLILQGMIERTSFKTYRIIDQQGLLQLSAND"
FT   CDS_pept        233764..234948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0252"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SMU.145
FT                   [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80769"
FT                   /db_xref="GOA:C5WEF4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF4"
FT                   /inference="similar to AA sequence:RefSeq:NP_720617.1"
FT                   /protein_id="BAH80769.1"
FT                   /translation="MMVSQKSLIEKISLLSLSLMMVSPFAVSPALPKMIAYYQAQGYQA
FT                   QSVEILFSLSSFAILGVLLIMPFLNRFLSERTTVVVGLLLLAGGGSFPVLNQAYPLVFG
FT                   SRILLGLGIGLINARAINIISERFSGKERITMLGYRGSAEVLGSAFLTFLAGYLIPFGW
FT                   SLAYLIYGFGFVILALYLLFVPPMISPQAPVASQGRQNLSLNQLWQILGLAGYAGFVIL
FT                   VNTSNTLRIPQVIDQGQMGSATQASLILSLMMLMGILAGISFGPLLMLLKDRLMAWVAF
FT                   VLGLGMLVLWQGDNLFLVAIGALSTGFVYSIGVTYVFHTLSERIPSHQLTSATTLVLIG
FT                   CNLGGGGAALVLQLLSHLSSDLKAAYLIFALASLGLATGLAGYIWFFKKLNKTT"
FT   CDS_pept        235096..235365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="SDEG_0253"
FT                   /product="30S ribosomal protein S15 RpsO"
FT                   /note="similar to 30S ribosomal protein S15 RpsO
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80770"
FT                   /db_xref="GOA:C5WEF5"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF5"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124098.1"
FT                   /protein_id="BAH80770.1"
FT                   /translation="MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNNHIKE
FT                   HKKDHATYRGLMKKIGHRRNLLAYLRRTDVNRYRELIQSLGLRR"
FT   CDS_pept        235349..235480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0254"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy1673
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80771"
FT                   /db_xref="GOA:C5WEF6"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF6"
FT                   /inference="similar to AA sequence:RefSeq:YP_060991.1"
FT                   /protein_id="BAH80771.1"
FT                   /translation="MDFVVNFKFKKSSAYAVGFFIFDMLFVSLHIWLEWSKAVFVSS"
FT   CDS_pept        235616..237778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0255"
FT                   /product="PTS system, mannitol (cryptic)-specific IIA
FT                   component"
FT                   /note="similar to PTS system mannitol (Cryptic)-specific
FT                   IIA component [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80772"
FT                   /db_xref="GOA:C5WEF7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF7"
FT                   /inference="similar to AA sequence:RefSeq:YP_060990.1"
FT                   /protein_id="BAH80772.1"
FT                   /translation="MSPIAVKNDYGQLDSICLENENASFYTDIIGGDDMLSHELIRNYQ
FT                   LFSKYKGHSLEAFESILKTSKRHILADIAKINDTLSLYQLPLIALDRQLVYPPDLTEKD
FT                   LLNRMLPTLDDYLFQDERLDMIIIYIMMAKEFISINHLESLLRLSRNSVIADLNLVRDR
FT                   VQAFQVTLAYNRQDGYFFEGEPLALRRLLESAVSSLLQVTSGPWVFSYLLHKLGLPDQK
FT                   KVMAATLEELSRENHLTFISEKLRDLIYFFCLLAHRPFSRNVRAEAVDTFPLASPAVET
FT                   MVDQLLVNFPSLTEEKYLVQSRLLGCIQGDLELVFQQPIYDIMEEIINSVAVNTGLSIT
FT                   DTPELRQNLYSHLLPAYYRLYYDINLTNPLKEQIKQDYESLFYLVKRSLSPLEKQLGKS
FT                   VNEDEVAYFTIHFGRWLQAPKKRPSNQLVALSVCPNGISSSLMLEATLKELFPQLQFIR
FT                   IHQLDKIKLLDPASFDLIFSTVAFDCAKPVYVTQALMGPVEKMMLKKMVCDDFHLPLSE
FT                   QFALDDLLSIIHKHTTITNKEGLVSDLSRYLIGNHLTLEKGGLGLLDLLTADFIRQADA
FT                   VSDWQEAIRLAAQPLLEHQMIETSYIDGMIDSVNELGAYIVLAPKVAVPHAAPKKGTRQ
FT                   LGMSLLQLKEPVSFDLKQEGDPDKQVQLIFVLSAVDSSSHLKALQELSLILDDDEHIEQ
FT                   LIEAKNTEEIMSLISHMIEKGDESHD"
FT   CDS_pept        237750..238055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0256"
FT                   /product="PTS system, IIB component"
FT                   /note="similar to PTS system IIB component [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80773"
FT                   /db_xref="GOA:C5WEF8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281116.1"
FT                   /protein_id="BAH80773.1"
FT                   /translation="MKKEMNHMIKIVTVCGNGIGSSLLLRMKVEAIASSLGIDVDAESC
FT                   DSNAAVGKGADLFVTVKEFKDIFPEDAKVCIVKSYTNRKKIEEDLVPVFKEMSGKE"
FT   CDS_pept        238082..239461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ulaA"
FT                   /locus_tag="SDEG_0257"
FT                   /product="ascorbate-specific PTS system enzyme IIC"
FT                   /note="similar to ascorbate-specific PTS system enzyme IIC
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80774"
FT                   /db_xref="GOA:C5WEF9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEF9"
FT                   /inference="similar to AA sequence:RefSeq:YP_060988.1"
FT                   /protein_id="BAH80774.1"
FT                   /translation="MEALLSFIRDILKEPAFLMGLIAFAGLVALKTPAHKVLTGTLGPI
FT                   LGYLMLAAGAGVIVTNLDPLAKLIEHGFSITGVVPNNEAVTSVAQKILGVETMSILVVG
FT                   LLLNLAFARFTRFKYIFLTGHHSFFMACLLSAVLGAVGFKGSLLIILGGFLLGAWSAIS
FT                   PAIGQQYTLKVTDGDEIAMGHFGSLGYYLSAWVGSKVGKDSKDTEDLQISEKWSFLRNT
FT                   TISTGLIMVIFYLVATVASVLRNASVTEELAAGQNPFIFAIKSGLTFAVGVAIVYAGVR
FT                   MILADLIPAFQGIANKLIPNAIPAVDCAVFFPYAPTAVIIGFASSFVGGLLGMLILGVA
FT                   GGVLIIPGMVPHFFCGATAGIFGNSTGGRRGAMIGAFANGLLLAFLPAMLLPVLGKLGF
FT                   SNTTFGDVDFGVLGILLGRLGTSIGQIGIYLVVAVLAIVLVLPNFLSKSQEAINNVSEE
FT                   I"
FT   CDS_pept        239471..240202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0258"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="similar to transaldolase [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80775"
FT                   /db_xref="GOA:C5WEG0"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR011861"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG0"
FT                   /inference="similar to AA sequence:RefSeq:YP_283024.1"
FT                   /protein_id="BAH80775.1"
FT                   /translation="MMTKKLNVKVFSDGAVLETMLKDLQTGLVTGFTTNPSLMKKAGIS
FT                   SYIGFAKEVLAKITDYPVSFEVFADDLASIEKEAEKIASLGDNVYVKIPVTTSTGESTC
FT                   PLIQKLSAKGIKLNVTAIFTIEQTQAVVDHLTAGVPAIVSVFAGRIADIGVDPMPIMEE
FT                   ALRICRQKEGVELLWASPRETYNIYQADQLGVDIITCTTDLIAKLPLQGKDLEDYSLET
FT                   VQMFLKDSTSLGFKILEDANH"
FT   CDS_pept        240482..242626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0259"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="similar to Polyribonucleotide nucleotidyltransferase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80776"
FT                   /db_xref="GOA:C5WEG1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG1"
FT                   /inference="similar to AA sequence:RefSeq:YP_060986.1"
FT                   /protein_id="BAH80776.1"
FT                   /translation="MSKQTFTTTFAGKPLVVEVGQVAKQANGATVVRYGESTVLTAAVM
FT                   SKKMATGDFFPLQVNYEEKMYAAGKFPGGFMKREGRPSTDATLTARLIDRPIRPMFAEG
FT                   FRNEVQVINTVLSYDENASAPMAAMFGSSLALSISDIPFNGPIAGVQVGYIDGEFIINP
FT                   DKEQMEASLLELTVAGSKEAINMVESGAKELSEDIMLEALLKGHQAIQELIAFQEQIVA
FT                   VVGKEKAEVELLQVDADLQADIVAKYNAQLQKAVQVEEKKAREAATEAVKEMVKAEYEE
FT                   RYAEDENLATIMRDVAEILEQMEHAEVRRLITEDKIRPDGRKIDEIRPLDAEVDFLPKV
FT                   HGLGLFTRGQTQALSVLTLAPMGETQIIDGLAPEYKKRFLHHYNFPQYSVGETGRYGAA
FT                   GRREIGHGALGERALEQVLPSLEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGV
FT                   PIKAPVAGIAMGLISDGTNYTVLTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIAGI
FT                   TPQILEEALAQAKKARFEILDVIEETIAEPRPELAPTAPKIDTIKIDVDKIKVVIGKGG
FT                   ETIDKIIAETGVKIDIDDEGNVSIYSSDQAAIDRTKEIIAGLVREAKVGEVYHAKVVRI
FT                   EKFGAFVNLFDKTDALVHISEIAWTRTTNVSDVLEVGEDVDVKVIKIDEKGRVDASMKA
FT                   LIPRPPKPEKKEMKKEENHD"
FT   CDS_pept        242619..243371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0260"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy1667
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80777"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG2"
FT                   /inference="similar to AA sequence:RefSeq:YP_060985.1"
FT                   /protein_id="BAH80777.1"
FT                   /translation="MTKLNELDVRLRAFINAPDNFLDSVALVNAFHNFPVWATKEPYVI
FT                   EVEGVKVTPVFTDKEDMALFKEEQKSAQGQYWLERSALAVLEEVITSGAAGLAFNLKKK
FT                   GDFGNSTIFKSSDMIQFMNHYTTVLNALMSDDNVAADTMDKVYLVPAFVYPKDDNHYDR
FT                   LFPTMSTPEGKSYVPAFSNLQSFAKWYNQDDFGGLFRKAEGVILTWTIDDIYQPRNGEN
FT                   ELDETFGVAINPFDDQQILVDWSDLDQA"
FT   CDS_pept        243380..243964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0261"
FT                   /product="serine acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="similar to serine acetyltransferase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80778"
FT                   /db_xref="GOA:C5WEG3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG3"
FT                   /inference="similar to AA sequence:RefSeq:YP_060984.1"
FT                   /protein_id="BAH80778.1"
FT                   /translation="MGWWKESIAIVKALDPAARSSLEVILTYPGIKALAAHRLSHFLWQ
FT                   HHFKLLARMHSQFWRFWTQIEIHPGAQIAPGVFIDHGAGLVIGETAIVEKGVMLYHGVT
FT                   LGGTGKDRGKRHPTVRQGALVSAHAQVIGPIEIGANAKVGAAAVVLSDVPEDVTVVGVP
FT                   AKIVRVHGQKDSLQIQSLQEQRETSYYSSKL"
FT   CDS_pept        244215..244445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0262"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 1656
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80779"
FT                   /db_xref="GOA:C5WEG4"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG4"
FT                   /inference="similar to AA sequence:RefSeq:YP_283019.1"
FT                   /protein_id="BAH80779.1"
FT                   /translation="MKKVTVGIYVIIGLSILVASITLIAGLVFLLRQEMVKAVVYFILT
FT                   LFWLIGLAINMKLLQKWNTISEKDSNYQDED"
FT   CDS_pept        244473..245816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="SDEG_0263"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="similar to cysteinyl-tRNA synthetase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80780"
FT                   /db_xref="GOA:C5WEG5"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG5"
FT                   /inference="similar to AA sequence:RefSeq:YP_060981.1"
FT                   /protein_id="BAH80780.1"
FT                   /translation="MIKIYDTMTRSLREFVPLTEKTVNMYVCGPTVYNYIHIGNARSAV
FT                   AFDTIRRYFEYAGYRVNYISNFTDVDDKIIKAAAQAGVSPKELSDRFIAAFMEDTKALG
FT                   VKPATQNPRVMDYMTEIISFVQVLIGKGFAYEVAGDVYFRVEKSEHYAQLANKTLSELE
FT                   VGASGRTDAETSLKENPLDFALWKSAKTGEVSWDSPWGSGRPGWHIECSVMATEILGDT
FT                   IDIHGGGADLEFPHHTNEIAQSEAKTGKTFANYWMHNGFVTVDNEKMSKSLGNFVTVHD
FT                   MLQTVDGQVLRFFLATQQYRKPINFTEKAIHDAEINLKYLKNTLQQPLTETANEQELKR
FT                   FVTAFQDAMDDDFNTANGITVVFDMAKWINSGSYTGMVKEAFEKILAVFGIVFEEEVLD
FT                   ADIEALIAKRQEARTNRDFATADAIRDQLAAQGIKLLDTKDGVRWTRD"
FT   CDS_pept        245809..246210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0264"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51627
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80781"
FT                   /db_xref="GOA:C5WEG6"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG6"
FT                   /inference="similar to AA sequence:RefSeq:YP_001129146.1"
FT                   /protein_id="BAH80781.1"
FT                   /translation="MTNPVDVNLINGIALAFEGDAVYSYYIRRHLIFQGKTKPSQLHHL
FT                   ATRYVSAKAQANLIQAMLEAQLLTEKEEDIYRRGRNTNSHTKAKNADVVTYRMSTGFEA
FT                   VMGYLDMTDQKARLEELITWCITYVEKNA"
FT   CDS_pept        246327..246653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0265"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein
FT                   [Enterococcus faecium DO]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80782"
FT                   /db_xref="GOA:C5WEG7"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG7"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00604231.1"
FT                   /protein_id="BAH80782.1"
FT                   /translation="MQASYLKPIGAALSTGIVMMIAVLIHNLTLGTLGVLGAFAFLVFQ
FT                   DRSVYYNVKAISLHGLALLVAFFLGASTAYSPWLLPFVTASLSFGAFLITKLYQIPKPD
FT                   YFLC"
FT   CDS_pept        246845..247357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0266"
FT                   /product="truncated hypothetical protein"
FT                   /note="similar to hypothetical protein EF3281 [Enterococcus
FT                   faecalis V583]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80783"
FT                   /db_xref="GOA:C5WEG8"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG8"
FT                   /inference="similar to AA sequence:RefSeq:NP_816878.1"
FT                   /protein_id="BAH80783.1"
FT                   /translation="MLTKDPTVLVKASHFSSILFVTSYIAYLLIDKGGYWVLISSAAVL
FT                   SGEHLEHIKKRTIGRVLGTIVGIVIGLGIIQLHVSVTYLILLLVLFNFLTEYYMPRQYT
FT                   IANFFTNPQVIILMALSNSFRHSVLTIRFLGVFIGSLLTLFIILILEYALQSMIDHKAT
FT                   IKEWVDD"
FT   CDS_pept        247768..248493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0267"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80784"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEG9"
FT                   /inference="similar to AA sequence:RefSeq:YP_601272.1"
FT                   /protein_id="BAH80784.1"
FT                   /translation="MTSIKKSLGLISTTLLIASVLSVSSPYAVYAEDSQPDKVTAETKT
FT                   NQVNVDASMRGNEPYIDATIATEQPVSQSAQATVMLQDANGNTITSWVYTMTPGQRRFT
FT                   AWFDLTGLKSNDYRVAVSVQDKEAVASGQSTAVHFDQTKAKKSPTSNDKKTTTPNQNNQ
FT                   STASTTTDGQQSDLASGTNGNANQQITRTTQGNTSQKAASAKVTSGTHEDKNQGTKMLA
FT                   DREEEKTEPKKDFLGFYQV"
FT   CDS_pept        248600..249346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0268"
FT                   /product="23S rRNA Gm2251 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="similar to 23S rRNA Gm2251 methyltransferase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80785"
FT                   /db_xref="GOA:C5WEH0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH0"
FT                   /inference="similar to AA sequence:RefSeq:YP_060978.1"
FT                   /protein_id="BAH80785.1"
FT                   /translation="MKDKDTIETNDIVYGVHAVTESLHANTGNKLYIQEDLRGKNVDNI
FT                   KRLATEKKVSISWTPKKTLSEMTEGAVHQGFVLRVSAFAYTELDVILEKAEQEDNPLIL
FT                   ILDGLTDPHNLGSILRTADATNVCGVIIPKHRAVGVTPVVSKTSTGAVEHVPIARVTNL
FT                   SQTLDKLKAKGFWTYGTDMNGTPSHRWNTSGKLALIIGNEGKGISANIKKQVDEMITIP
FT                   MNGHVQSLNASVAAAILMYEVFRNRL"
FT   CDS_pept        249350..249868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0269"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51624
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80786"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001129143.1"
FT                   /protein_id="BAH80786.1"
FT                   /translation="MKKRILLVDGYNMIAFWQSTRQLFKTNQLDQARNILLTKLNHYAH
FT                   FENINIICVFDAQYVPGLRQRYDQYKISVVFTEEEETADAYIERMAAELNTAIHLVEVA
FT                   TSDLNEQWTIFSQGALRVTARELEQRVNTVKADLDKMAQAIDLKTPKLRPFDQSQMNQL
FT                   KDFMTHLED"
FT   CDS_pept        249952..250827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0270"
FT                   /product="DegV family protein"
FT                   /note="similar to DegV family protein [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80787"
FT                   /db_xref="GOA:C5WEH2"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH2"
FT                   /inference="similar to AA sequence:RefSeq:YP_060976.1"
FT                   /protein_id="BAH80787.1"
FT                   /translation="MRRDAMTFTLMTDSTADLCPSWADDHNIVLMGLTITCDGKVYETV
FT                   GPGRLRSDSLLEKMKAGSHPQTSQINVGEFEAVFREHAKHQKPLLYLAFSSVLSGTYHS
FT                   AMMARDMVLDDYPDAVIEVVDTLAASGGEGYLTILAAEARDSGKTISETKVLIEDILPR
FT                   LRTYFLVDDLFHLMRGGRLSKSSAFLGSLASIKPLLWIDAQGKLVPIAKIRGRQKAIKE
FT                   MVAQVEKDIADSTVIVSYTSDQEGAEKLREQLLAREAIRDVLMMPLGPVISAHVGPNTL
FT                   AVFVIGQNPR"
FT   CDS_pept        250962..251660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0271"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80788"
FT                   /db_xref="GOA:C5WEH3"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH3"
FT                   /inference="similar to AA sequence:RefSeq:YP_060975.1"
FT                   /protein_id="BAH80788.1"
FT                   /translation="MLDSKQNLVKSQWGFIVITAVMDLVVIVATLLATTSFQRYLFGSA
FT                   AVILTSFLILLVWGLKTAKKLQTGLDSKEVLDSKVKEDQKLPKYDERQKQILLKGYTIG
FT                   FWFMIVVVWLSLFISRFTEGVVSASFLFTLALWGGLAVQTTYCNLNGASPFVDRRFGKQ
FT                   GVLIGTIATGMSLVVIGLAVREMMTGPFKMGSFFKAGDSGSLMVLGITLLSMGASILYR
FT                   HYLDAKEADE"
FT   CDS_pept        251657..251863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0272"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="similar to Cro/CI family transcriptional regulator
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80789"
FT                   /db_xref="GOA:C5WEH4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH4"
FT                   /inference="similar to AA sequence:RefSeq:YP_281101.1"
FT                   /protein_id="BAH80789.1"
FT                   /translation="MKNLKLKAARAGKDLSQQALADLVGVSRQTIAAVEKGDYNPTINL
FT                   CIAICRVLDKTLDDLFWEVDDTH"
FT   CDS_pept        251995..252114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0273"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80790"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH5"
FT                   /inference="similar to AA sequence:RefSeq:YP_061201.1"
FT                   /protein_id="BAH80790.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIA"
FT   CDS_pept        252188..252280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0274"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80791"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH6"
FT                   /inference="similar to AA sequence:RefSeq:YP_283226.1"
FT                   /protein_id="BAH80791.1"
FT                   /translation="MENKPSSMPILLIVDNVSMKPIVKRVLTSN"
FT   CDS_pept        252277..252507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0275"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80792"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH7"
FT                   /inference="similar to AA sequence:RefSeq:YP_603470.1"
FT                   /protein_id="BAH80792.1"
FT                   /translation="MNGCSARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTK
FT                   TIYRYIKEGLLAIKPSICLKWLVSENVLRKS"
FT   CDS_pept        252596..253021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0276"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80793"
FT                   /db_xref="GOA:C5WEH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH8"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH80793.1"
FT                   /translation="MILGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLI
FT                   SQYPIASITADNGSEFSLLSTLEAVDVYFAHPYSSHERGTNENFNGLLREYVPKGISLN
FT                   PLTSEELDNYLTAINERPRRLLQYQSSTFLFELARTA"
FT   CDS_pept        253152..253703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0277"
FT                   /product="50S ribosomal protein L13"
FT                   /note="similar to 50S ribosomal protein L13 [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80794"
FT                   /db_xref="GOA:C5WEH9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEH9"
FT                   /inference="similar to AA sequence:RefSeq:YP_060973.2"
FT                   /protein_id="BAH80794.1"
FT                   /translation="MFTPFERPRNLPNTFDGTEHPSPCKQILRIRIGEIMNKTTFMAKP
FT                   GQVERKWYVVDATDVPLGRLSAVVASVLRGKNKPTFTPHTDTGDFVIVINAEKVKLTGK
FT                   KATDKVYYTHSMYPGGLKSITAGELRSKNAVRLIEKSVKGMLPHNTLGRAQGMKLKVFV
FT                   GGEHTHAAQQPEVLDISGLI"
FT   CDS_pept        253724..254116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SDEG_0278"
FT                   /product="30S ribosomal protein S9 RpsI"
FT                   /note="similar to 30S ribosomal protein S9 [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80795"
FT                   /db_xref="GOA:C5WEI0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI0"
FT                   /inference="similar to AA sequence:RefSeq:NP_269909.1"
FT                   /protein_id="BAH80795.1"
FT                   /translation="MAQAQYAGTGRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLR
FT                   LIINQPFAVTSTEGSYDVFVNVVGGGYGGQSGAIRHGIARALLQVDPDFRDSLKRAGLL
FT                   TRDARMVERKKPGLKKARKASQFSKR"
FT   CDS_pept        complement(254244..255398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0279"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="similar to phage integrase family site specific
FT                   recombinase [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80796"
FT                   /db_xref="GOA:C5WEI1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI1"
FT                   /inference="similar to AA sequence:RefSeq:YP_328946.1"
FT                   /protein_id="BAH80796.1"
FT                   /translation="MSIHKYPSKKAKNGYLYLVKVYMTRDAQRADHIKRGFRTRKEAKD
FT                   YEARLIYLKASGRLEEFIKPTHKTYNEIFEKWYQAYQDTVEPTTASRTLDIFRLHILPV
FT                   MGDLPISKISPLDCQNFITEKAKVFKNIKQIKSYTRKVFDFAIKMKLLKHNPMTEIIMP
FT                   KRKKTRIENYWTVQELQEFLAIVLQEEPYKHYALFRLLAYSGLRKGELYALKWADIDFQ
FT                   SETLSVNKSLGRLDGQAIEKSTKNDFSVRKIKLDSETISILQEWKSINQKEKAQLAVAP
FT                   LSIKQDFIFTYCTRTGSIEPLHADYINNVLSRIIRKHSLRKISPHGFRHTHATLMIEIG
FT                   VDPVNTAKRLGHASSQMTLDTYSHSTNNGEDRSIKQFADYLKAK"
FT   CDS_pept        complement(255462..256052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0280"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /note="similar to transcriptional regulator Cro/CI family
FT                   [Streptococcus agalactiae CJB111]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80797"
FT                   /db_xref="GOA:C5WEI2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI2"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00787271.1"
FT                   /protein_id="BAH80797.1"
FT                   /translation="MTNFQLLVKESNKSLTEISQETGISYSTLGNYNQGTRTPKKENAK
FT                   ILADYFDVSVPYLLGLDDNRQILDFAGEGIAKGIIEKIKGRKTLDMLLTSTPYLEENVD
FT                   IMNDIINKKVLDSYIDFLYEGKYPPAVIVFIKDVIKNRFDDIPALANRSSDKNSEYHFL
FT                   WEAWEKEPRKKERTEQTRKKWKEQGIPIFKSWK"
FT   CDS_pept        256207..256512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0281"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0219
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80798"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI3"
FT                   /inference="similar to AA sequence:RefSeq:NP_687254.1"
FT                   /protein_id="BAH80798.1"
FT                   /translation="MAYTLEERETIVRYDEMDNCWYFESNVRKHITKIMKTIDSCQILG
FT                   QEKEDDRIIWIHAKLTNLDDYMVSPFVRKRVKREMTEEQREEARKRMARLHSKSEI"
FT   CDS_pept        256649..256927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0282"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0220
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80799"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI4"
FT                   /inference="similar to AA sequence:RefSeq:NP_687255.1"
FT                   /protein_id="BAH80799.1"
FT                   /translation="MTEGFTIQLPKVTEKKLLARYDTMVQKAIEKALEDKELYKPMVRM
FT                   AGLCRFLDVSTTTIVKWQKAGMPHMVIDGVTLYDKRKVAQWLQQFER"
FT   CDS_pept        256938..257168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0283"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0221
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80800"
FT                   /db_xref="GOA:C5WEI5"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI5"
FT                   /inference="similar to AA sequence:RefSeq:NP_687256.1"
FT                   /protein_id="BAH80800.1"
FT                   /translation="MDKNNLEDLTGKKILRNGFGGLRLEYGTIFLDVGLFTYIVLILSI
FT                   FFFLVERWFLGALTFVLHVPLLLLGIWCGER"
FT   CDS_pept        257181..257507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0284"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0222
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80801"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI6"
FT                   /inference="similar to AA sequence:RefSeq:NP_687257.1"
FT                   /protein_id="BAH80801.1"
FT                   /translation="MDYDNDSYLIPKVLLQDDFYSSLSARDILVYAVLKDRQIEAPEKG
FT                   WIDTDGSIYLNFKLIELAKMFSCSRTTMIDIMQRLEEVNLIERERVDVFYGYSLPYKTY
FT                   INEV"
FT   CDS_pept        257511..258140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="similar to conserved hypothetical protein
FT                   [Streptococcus agalactiae CJB111]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80802"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI7"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00787283.1"
FT                   /protein_id="BAH80802.1"
FT                   /translation="MIKIYFGKDITLNQAIQSRLDSYQIDYQAFSSKDIDAKTLMEWLF
FT                   RSTDIFELLSTKMLKYKLNTQITLSQFVRKILKDVNSTLKLPIVVTDEVIYSNMSLDYV
FT                   TVLLPKEYRKIERIQLMRKMEQLDEGRLFWKNFESLRKQSELRWFELNELLFADMSDDL
FT                   GENKKAKDRFFSYKKNKQVPPDDIIEKILKIFLVDREDFFKKSVLD"
FT   misc_feature    258330..259329
FT                   /locus_tag="SDEG_0286"
FT                   /note="frame shift mutation"
FT                   /note="similar to putative replication initiation protein
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /inference="similar to AA sequence:RefSeq:NP_687259.1"
FT   CDS_pept        259365..259799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0287"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0225
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80803"
FT                   /db_xref="GOA:C5WEI8"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI8"
FT                   /inference="similar to AA sequence:RefSeq:NP_687260.1"
FT                   /protein_id="BAH80803.1"
FT                   /translation="MRIKDYADSLGVSSQSIYKRIRSPKYKERLKGHLYRDNQKVENLD
FT                   LIGIKILEDYHFENDVIELEKTLGDIQEEFEQEKKGMQYRIDRLADKLTPLLEDNQNLV
FT                   QKNYELLNYVRSLERQKLLLIIALAVMVITLLVAIWLAIF"
FT   CDS_pept        260115..261371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0288"
FT                   /product="recombination protein"
FT                   /note="similar to recombination protein [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80804"
FT                   /db_xref="GOA:C5WEI9"
FT                   /db_xref="InterPro:IPR001668"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEI9"
FT                   /inference="similar to AA sequence:RefSeq:NP_687261.1"
FT                   /protein_id="BAH80804.1"
FT                   /translation="MSYVVARMAKYKSGQLTAIYNHNERIFKNHSNKEIDVEKSHLNYE
FT                   LTNRDQAQNYHKQIKEHINENRLSTRGVRKDAILCNEWIITSDKTFFDSLDEKQTREFF
FT                   ETAKDYFAEKYGDANIAYARVHLDESTPHMHLGIVPMKNGKLSSKALFGNKEKLVAIQD
FT                   ELPKYLNEHGFNLQRGEIGSKKKHLETAEFKEKQRLLDNADRKLADKHEELKALDDKIS
FT                   NVNDTIADKESRLKELEAKEWDAVGDLKQYELEKQSLAESIEDIKDIELLQLDRIQKED
FT                   LVKQSFDGKLKMDKETYNRLFQTASKHASSNAELKRDLVKAQSQNNHLSRELLNHRKTA
FT                   DKNIKLSQENRKLKDKVKMLDEQVKILNKNLSVWKEKAKEFMPKQVYRETLSIINSLNP
FT                   IGLAKTAIRQVKKMVDSNS"
FT   CDS_pept        261539..262009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0289"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0227
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80805"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ0"
FT                   /inference="similar to AA sequence:RefSeq:NP_687262.1"
FT                   /protein_id="BAH80805.1"
FT                   /translation="MTDKKIVYYFDHDLSKKDMGGVGPTYTGKNLLFLLWWTYSYVAED
FT                   NLDIDTSLFEVPEFNDFYNNGLELYRIKNELANYNIRFGYEVNPKDSTKMLIGILPTDE
FT                   EDYVKGYRNFIADISNPDTRYAIYHRLIKTMDTMLPIEQINVYKSLAKGNKK"
FT   CDS_pept        complement(262314..262649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0290"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0228
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80806"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ1"
FT                   /inference="similar to AA sequence:RefSeq:NP_687263.1"
FT                   /protein_id="BAH80806.1"
FT                   /translation="MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDI
FT                   EKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKDYIVLYHIEEEENRVVIDYLLPTRS
FT                   DYMKLFK"
FT   CDS_pept        complement(262639..262926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0291"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0229
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80807"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ2"
FT                   /inference="similar to AA sequence:RefSeq:NP_687264.1"
FT                   /protein_id="BAH80807.1"
FT                   /translation="MVTAEKNRAVTFQANKELVSEAMTVLNKKNLTLSSALRLFLQNVV
FT                   VTNEVDLLTEEELEKEKLFKQFQAEINKNIEDVRQGKFYTSEEVRSELGL"
FT   CDS_pept        complement(263330..264040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SDEG_0292"
FT                   /product="truncated integrase/recombinase, phage integrase
FT                   family"
FT                   /note="similar to phage integrase family
FT                   integrase/recombinase [Streptococcus thermophilus LMG
FT                   18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80808"
FT                   /db_xref="GOA:C5WEJ3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ3"
FT                   /inference="similar to AA sequence:RefSeq:YP_138646.1"
FT                   /protein_id="BAH80808.1"
FT                   /translation="MRKTISRIKANKKILLKENKREEDLALDQEELRIWLQAFDSDLKK
FT                   GLIELKDYTLFYTTFFLSDRKSETYALQWKHINFETNEILIEQALDRFGNVKSTKGNKK
FT                   TIFKAPSELMELLTKWKIQQQKELKLFGLRQSQKQFVFTYNDRSNNINIPLHTDYLNYR
FT                   MNSVRRRHPELSPASPHKLRHTGATLARKSGVPLEVISEALTHSDKEITKSYVNTKDIV
FT                   KQTAGDIAFRSLKI"
FT   CDS_pept        complement(264073..264459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0293"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80809"
FT                   /db_xref="GOA:C5WEJ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ4"
FT                   /inference="similar to AA sequence:RefSeq:YP_596473.1"
FT                   /protein_id="BAH80809.1"
FT                   /translation="MLVTLSGVMLNYIVTPASVHDIKVVDELLEGCKQTVVLADLGYLS
FT                   QELKDKLGHKGYHLWTPLRQNMVGAKQHNNRQLLAWRRTIETRFSELCSLFDIEQTLAR
FT                   GLSGLQLRLEQFILAYNLKYFEIN"
FT   CDS_pept        complement(264511..264933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0294"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80810"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ5"
FT                   /inference="similar to AA sequence:RefSeq:YP_599751.1"
FT                   /protein_id="BAH80810.1"
FT                   /translation="MSHLQYTAKSHHLQWSIAQLTQICSQCYRDYCPKSIKHRKNVGLS
FT                   KVSDVSLLVLLLLQAELGITSQRRFYRICHLFFCGNLLERSRFNRRTRQLIGVVQLIRQ
FT                   ALNKPISSDTIVIMDSFSYAFVPTYSQSQSEVLKVS"
FT   CDS_pept        265043..266161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="labC"
FT                   /locus_tag="SDEG_0295"
FT                   /product="truncated lantibiotic biosynthesis protein"
FT                   /note="similar to lantibiotic biosynthesis protein
FT                   [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80811"
FT                   /db_xref="GOA:C5WEJ6"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR033889"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ6"
FT                   /inference="similar to AA sequence:RefSeq:YP_138643.1"
FT                   /protein_id="BAH80811.1"
FT                   /translation="MINCDNKEYSKLLYNRVNYYLQELLNSIKLNSTNNISLCYGFMGY
FT                   VYTLEFLSKNCKEYDKLLDTLETILLALTKDRLREIKSSNIVKEEYFDIIQGVSSVARY
FT                   LLSKEESTSEQELLVKEILNYLADLIINEPTIYVEYMPNEKLRKRFPSGYINLGVAHGI
FT                   LGPLYVLALGFEKFNITKHLLSIEKGLSYYENAFFTNKIGKIIGWNGRVSDNVDNEEFR
FT                   FNISWCYGSLGMARVLYNIAKIIDSQKLREMATNVFTSSIDYLNSSEILNNAICHGRSG
FT                   IMLLFNLMYLDTGKIQFKVISDHLFKEIVNEASNSEYIFVERDIYFRGVNFDEVIDYID
FT                   FGLLNGVSGIVLALMAQRTGNAYPLDRMLFMQ"
FT   CDS_pept        266191..267456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="labT"
FT                   /locus_tag="SDEG_0296"
FT                   /product="lantibiotic efflux protein"
FT                   /note="similar to lantibiotic efflux protein [Streptococcus
FT                   thermophilus CNRZ1066]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80812"
FT                   /db_xref="GOA:C5WEJ7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ7"
FT                   /inference="similar to AA sequence:RefSeq:YP_140531.1"
FT                   /protein_id="BAH80812.1"
FT                   /translation="MRKIFKNKLYLKVLISDLISNFGDTLYFIALMTYVTEIKESNLAI
FT                   SIVNISETLPILFTIFFGIIADRTLNKVEMIIKTLWLRVLLYLLVAVAMNFKPSIIVVI
FT                   IASLVNLVADTLGQFENGLFYPISNRIVKKSDREETMAFRQTVVSTMNIVNQSLGAFLI
FT                   TFFSFSHLAFINSLTFAISLLIILAIRNQINSYYDETISTSKISQFDFKASFSEIISNL
FT                   KLSINHLFSIGNMKEALLVIPILNGSLAILIPLVVVNLSKDSNLTIVNSAITISLLGIS
FT                   TVSGGILGGTLILISKKFKSLSIGTLLKMNLTTVLLSFVAFYFQNIYLIILSSFLSSVL
FT                   VSALNPKMGTIIFNNIDETKLATIFGGMVTYFQIGDIVSRLLFSTLVIYLPYGYIALIY
FT                   MTVVFVAILYTLKSSNHVDREF"
FT   CDS_pept        267515..267952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0297"
FT                   /product="putative truncated ATP-dependent DNA helicase"
FT                   /note="similar to putative ATP-dependent DNA helicase recG
FT                   [Streptococcus agalactiae 515]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80813"
FT                   /db_xref="GOA:C5WEJ8"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00791064.1"
FT                   /protein_id="BAH80813.1"
FT                   /translation="MITKVRDFVRTQLREFQYLDNDGQFKTLPEYPEFAWFEGIVNAVT
FT                   HRNYSIFGDYIRIMMFDDRLEIHSPGKLPNIVTVENIKHERFSRNPRIARTLTEFGWVR
FT                   EMNEGVKRIYSEMESYFLHEPKYTELGNKVVLTLENNIVSR"
FT   CDS_pept        268034..268201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0298"
FT                   /product="putative truncated transcriptional regulator
FT                   containing HTH domain"
FT                   /note="similar to predicted transcriptional regulator
FT                   containing HTH domain [Streptococcus thermophilus LMD-9]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80814"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEJ9"
FT                   /inference="similar to AA sequence:RefSeq:YP_819678.1"
FT                   /protein_id="BAH80814.1"
FT                   /translation="MYNSGQKMTTLRASELTGRSRRFSGKLLQRLVEQEVLEWHGTSRN
FT                   DRNQYYTLVK"
FT   CDS_pept        complement(268695..269963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0299"
FT                   /product="5-methylcytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="similar to 5-methylcytosine methyltransferase
FT                   [Lactococcus lactis subsp. lactis bv. diacetylactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80815"
FT                   /db_xref="GOA:C5WEK0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK0"
FT                   /inference="similar to AA sequence:INSD:AAF75616.1"
FT                   /protein_id="BAH80815.1"
FT                   /translation="MKILELFAGVGGFRVGLENADKDLFQTKWANQWEPSRKSQDAFEV
FT                   YDYHFSDSQNINISISDITDEDFEKMDADMIVGGFPCQDYSVARTKKNEMGIQGKKGVL
FT                   FWEIIRATRIIKPKYLILENVDRLLKSPSKQRGRDFAIMLASFNELGYSVEWRVINAAE
FT                   YGRSQRRRRVFFFVYQNDTDFAKKIDKQFENDNSVFEENKYDDYIFYDGLFANQFPIKN
FT                   MVVKNRRAYYNLDDDIVTVSDNFTGKVWNTGIMRHGKYYTIETEEAYQGKSLTLGDILQ
FT                   DESLVDEKYYLTDKAKLEKFKYLRGPKRIERTSSDGFSYIFSEGSMSPFDNENLPGRTM
FT                   LTSEGSINRSTHLIFRNNRYRLLTPIEAERLQDFPDNWTALKKLDSGEVIPVTDRMRMF
FT                   FMGNALVTEIVKEIGIFISTIEK"
FT   CDS_pept        270078..271568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0300"
FT                   /product="restriction enzyme"
FT                   /EC_number="3.1.21.-"
FT                   /note="similar to restriction enzyme [Lactococcus lactis
FT                   subsp. lactis bv. diacetylactis]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80816"
FT                   /db_xref="GOA:C5WEK1"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK1"
FT                   /inference="similar to AA sequence:INSD:AAF75614.1"
FT                   /protein_id="BAH80816.1"
FT                   /translation="MADYLFDYDDSKVESVMNYSQNLLNKPFSQIVEEYTLSPYKTRQD
FT                   FQEKVISEIIDKEISMKSKGQYGNYIEKYFYGYQPNSDSSADFDKIGVELKVTPFKVNK
FT                   NGSISAKERLVLTILNYMEENLDDFYQTHLWEKCSKILLLFYNGLIPNQTLADYIIEKV
FT                   FLYEWFEEDMELILEDYKRITDKIKQGRAHELSESDGNYLSTCTKGAGKGKDFRSQPFS
FT                   DELAKQRAWELKSSYMTYLINHKIFSQSEQESVLATVREDKKSFTEIVADKILAYKGFS
FT                   EEELYNRFDINPNAKSKNSTLVRKILGLTGDIDKTQEFQKANMNLRVIRVNKNGLPKED
FT                   SPFKNYKFQELANTEEWEESHPYLEIFSKKFLFVVFKEVEPKLFVLDSIKFWGFPDRLL
FT                   NEVQRVWKETQIIIQTGVELSQNGNKVSTNFPQSRANKILFTKIHAQNTLYEIEPNKFV
FT                   GKGKDSDTDTLPDGRRITKHSFWMPKKFLKEVLDGEWD"
FT   CDS_pept        271580..271930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0301"
FT                   /product="hypothetical protein"
FT                   /note="no hit"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80817"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK2"
FT                   /protein_id="BAH80817.1"
FT                   /translation="MMMLQKDELEKKIQDLDEYIISLWHNKTVLSEAYKQEYGRYKDSI
FT                   FNDLEGTFKFSSITFEELFNKVICFLNKQKCILEKYSELKEVTKDNKISKYYNNILKEF
FT                   NFPYDTSILVNI"
FT   misc_feature    272004..273544
FT                   /locus_tag="SDEG_0302"
FT                   /note="possible frame shift mutation"
FT                   /note="similar to ABC transporter ATP-binding
FT                   protein-related protein [Leuconostoc citreum KM20]"
FT                   /inference="similar to AA sequence:RefSeq:YP_001728112.1"
FT   CDS_pept        273732..274301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0303"
FT                   /product="hypothetical protein"
FT                   /note="no hit"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80818"
FT                   /db_xref="GOA:C5WEK3"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK3"
FT                   /protein_id="BAH80818.1"
FT                   /translation="MYLIENLLLPILSNIISPIILFLLASLVMRNNAMSRFIAKIYTTV
FT                   KEGLELNTEEVPDAEDTEQFESAGIQSVKVVPKGENKESCILQRTSKNYGADSKNGWKI
FT                   RTFYIFTKKQLFDKEFIHFEVKDKGFDIYLKTADLIKHFNLNDPQEEITDGADKIRAYI
FT                   FQNNNDENYIVRFGKNILANPIKIVS"
FT   CDS_pept        275079..277028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0304"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CLOSS21 00385
FT                   [Clostridium sp. SS2/1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80819"
FT                   /db_xref="GOA:C5WEK4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK4"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02437947.1"
FT                   /protein_id="BAH80819.1"
FT                   /translation="MNHRQIGVLRLLLRSRDYQSGQVLADCFEVLVKTIYSDLLVLQEF
FT                   LTPYDLVLKKVPRHGVCILGPDSLKESLCQALDHQVQATDKDHSFWEREDVYLKSLFLL
FT                   GHSLSILDLSLDLFVSETSIRRDLEKLDMQLADYNCQLIRHNGFVSLEGDELACRHFFR
FT                   NRLIEKYAEQLNSHQSDGLLAFFFDQENVEGIIKAVQEASDLYAYTISEQYRIYLILDL
FT                   LIATRRYQQGYLLRPQPLPIGQDMALFGVYPFAGDLLSYSLNRPVDTLLPEEVKQLSLT
FT                   ILSVGYESFPSENQQFVQLTKQLIKRVGQLSGLDLSHDTDLVKMISNYLRPMIYRLKNG
FT                   INIANQTTEEIKKRYSILFHVVWLASKVLSDQYQLELLDAEIAFLTIYFEIAVEKLEPP
FT                   LTIVIVCPHGLAASELIISSLRRLISHYDHLVTVDLSELDSSVARQADILISSIQLKDF
FT                   PRPYVLVSPVLTNDELDNIQKLYLDLTKGNRKVLSIVHDDYDAKQALLKDLIQHEVYLH
FT                   QALTSQEDCLRFLAQHAFSENRDNPGYLTSILQREKMGSTSVYTGIALPHANPEMVGRS
FT                   QLSLLTLKEPVIWGKNRVKVVMLISIKEGEEELYKEALVHLYSKIDNEAFIDSLTQTAD
FT                   EKAFIELLLKKEED"
FT   CDS_pept        277030..277488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0305"
FT                   /product="putative PTS system, galactitol-specific IIA
FT                   component"
FT                   /note="similar to PTS system galactitol-specific IIA
FT                   component putative [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80820"
FT                   /db_xref="GOA:C5WEK5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK5"
FT                   /inference="similar to AA sequence:RefSeq:YP_329161.1"
FT                   /protein_id="BAH80820.1"
FT                   /translation="MQEEVVCLQVDNIKNAEQALAYLGNQLVATGAVKDSYVKAVIDRE
FT                   AIFPTGLQFEDYGVAIPHTDSEHVNHTQLALMTLTEPVSFTQMATNDQPVSVRLIIMLA
FT                   IKDSHEQVDMLQKLITLLQNPDVVHDLLAYGPDQKESVLQLLSRHHII"
FT   CDS_pept        277498..278838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0306"
FT                   /product="PTS system, galactitol-specific IIC component"
FT                   /note="similar to PTS system galactitol-specific IIC
FT                   component [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80821"
FT                   /db_xref="GOA:C5WEK6"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK6"
FT                   /inference="similar to AA sequence:RefSeq:YP_329162.1"
FT                   /protein_id="BAH80821.1"
FT                   /translation="MFDLLQHFIDLGAIVVLPILIFIFGMLLGTPARKAFNADLTVGIG
FT                   FVGLNLVVELLSGSLGKAAQAMVERFSLQLTTLDVGWPAAAAISYGTLLGSLAIPIGIA
FT                   INIFLLFIGWTKTLMVDMWNFWHAAFVASLVYAVTQHFALGLYAMLAYQVMIYLLADII
FT                   ASAIKKFYGFPNITFPHGTSAPGFLVAIPLNWIFDRIPGFNKIEADPESIQKKFGIFGE
FT                   STVMGLIIGIVIGILAGYDVQGILQLGVKTAAVMLLMPRMVSILMEGLAPISGAANSFV
FT                   QKHFPGREVNIGMDSALSVGHPAVLSSSLLLVPITILLAVILPGNTNLPFGDLATIPFV
FT                   VCLMAAVFRGNIVRTVIGGAIYMVSILYLTSWAAPLVTASAKAAEFNLDGHSSITAMAE
FT                   GGLWPTGLFVFAANHLPWLVITLILVVSLAGLFYVNKGSNSKSEVIK"
FT   CDS_pept        278835..279119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0307"
FT                   /product="putative PTS system, galactitol-specific IIB
FT                   component"
FT                   /note="similar to PTS system galactitol-specific IIB
FT                   component putative [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80822"
FT                   /db_xref="GOA:C5WEK7"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK7"
FT                   /inference="similar to AA sequence:RefSeq:YP_329163.1"
FT                   /protein_id="BAH80822.1"
FT                   /translation="MKKLLVMCGSGIATSTVVMGKVKAWVAENGYTDKVQLFQSKIAEE
FT                   INHIDDYDVVISTTVVPDSVKDKVIMGLPLLTGIGTEQLWEEVKKEIEA"
FT   CDS_pept        279121..279960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0308"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein ANACAC 03037
FT                   [anaerostipes caccae DSM 14662]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80823"
FT                   /db_xref="GOA:C5WEK8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02420420.1"
FT                   /protein_id="BAH80823.1"
FT                   /translation="MKADMSQVLQAAKACHYAVPAMNYIDFASAKAYAKTSEKRKLPLI
FT                   LAFAQSHSQWLSLEDAALIGRYFQQTLSTPVVLHLDHGQDSAFIKKAIDLGFNSVMIDA
FT                   SLDSFDDNVKKTREIVDYARARGVAVEAEIGFVSANANQENHRVTDSIYTSLEDAKLFY
FT                   EQTLVDALSISIGTVHGIYRGQPKLNFERLTEIAAALSIPLVLHGGSSSGDDNLARCAR
FT                   EGIAKINIFSDVIAAAYQHRLDSKITDYPSLMSTMQVAMEKVLDHYYDVFGTTRGGS"
FT   CDS_pept        279960..280637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0309"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein ANACAC 03039
FT                   [anaerostipes caccae DSM 14662]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80824"
FT                   /db_xref="GOA:C5WEK9"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEK9"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02420422.1"
FT                   /protein_id="BAH80824.1"
FT                   /translation="MKANLNRHFFIFNPKSYLYGEQLYQLAELADSLVTDDISIFMTAP
FT                   YAELAELSKRTKHIIVTAQHMDRISPSRGMGKVLPESLVVNGVRAVFLNHAENPMTLTE
FT                   LVQALERAKALELITIVCADSVAEARAIAVLNPNIILCEPTALIGTGQTSDLSYIQETN
FT                   AAVKAINPDILMMQAAGVSQADDVYQVIKAGADGTGCTSGIVKATSPKQMFQDMIAALQ
FT                   KAL"
FT   CDS_pept        280649..281170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0310"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein ANACAC 03038
FT                   [anaerostipes caccae DSM 14662]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80825"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL0"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02420421.1"
FT                   /protein_id="BAH80825.1"
FT                   /translation="MTVYQKEFSVETVANRDSYHDISEVVKQVIAASSIQTGICVVTTP
FT                   HTTCSVFFEEYTHDKDDEGDDFLNLDLSEQLERIIPRHLAKESYHYPGPAHYQAVLAWE
FT                   NPEDWLPNGDKRALRNADAHLKASLLGSSQTIAVTSGKWNVGKTGYLYLVDFDRTRERK
FT                   RHYHITVIGD"
FT   CDS_pept        281418..282233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0311"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein CLOL250 01537
FT                   [Clostridium sp. L2-50]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80826"
FT                   /db_xref="GOA:C5WEL1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL1"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02074761.1"
FT                   /protein_id="BAH80826.1"
FT                   /translation="MYQLIAFDMDGTLLTSQQTISTVSLKAINQAIQAKKQVVLATGRP
FT                   LSEIKPYRQDLASLQYAILESGAVIYDLQEERMIHQVSLPLIFLQQLLQSTEGLDVMVV
FT                   VMSESQSYIQESHFLSIENYYMDQYQMLYQATAVFVDDIHSLLADKKEKIEKVNLYFKT
FT                   VKTRDHYLESMDYLQVAAIKAEKTGIEITARGVNKGQALIFLVNYLQLEIEQTIAVGDG
FT                   DNDRQMIAEAGLGIAMGNANTTIKTLAKAEVASNDKDGCAQAIYQFLLK"
FT   rRNA            282530..284083
FT                   /locus_tag="SDEG_0312"
FT                   /product="16S rRNA"
FT   tRNA            284134..284208
FT                   /locus_tag="SDEG_0313"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:284168..284170,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            284515..287269
FT                   /locus_tag="SDEG_0314"
FT                   /product="23S rRNA"
FT   rRNA            287364..287480
FT                   /locus_tag="SDEG_0315"
FT                   /product="5S rRNA"
FT   tRNA            287486..287559
FT                   /locus_tag="SDEG_0316"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:287520..287522,aa:Asn,seq:gtt)"
FT                   /note="codon recognized: AAC"
FT   tRNA            287643..287716
FT                   /locus_tag="SDEG_0317"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:287677..287679,aa:Arg,seq:acg)"
FT                   /note="codon recognized: CGT"
FT   CDS_pept        287809..288291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX.2"
FT                   /locus_tag="SDEG_0318"
FT                   /product="putative competence protein ComX1"
FT                   /note="similar to putative competence protein ComX1
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80827"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL2"
FT                   /inference="similar to AA sequence:RefSeq:NP_665444.1"
FT                   /protein_id="BAH80827.1"
FT                   /translation="MSLETGEVFEKVKPIILKLKRHYYLQLWETDDWLQEGHLVLVKLL
FT                   ERHPELVGDEARLYRYFKTKFSSYLKDVLRRQESQKRQFDKMAYEEIGDVAHAIPAGGL
FT                   WLDDYVAYREVLVQVEEALSEADRKQFQALVRGERFKGRQALLRKVRPYFSGFDQG"
FT   CDS_pept        complement(288523..289872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0319"
FT                   /product="aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="similar to aspartokinase [Streptococcus equi subsp.
FT                   zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80828"
FT                   /db_xref="GOA:C5WEL3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL3"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124071.1"
FT                   /protein_id="BAH80828.1"
FT                   /translation="MKVVKFGGSSLASAQQLKKVLAIVKEDKNRKVVVVSAPGKRTPDD
FT                   TKVTDALIAYYKAYKSGKDFQEPLNWISQRYQTICQDLGIDSQVGTDITQSLEALAKLP
FT                   IDHNPFLYDTFLAAGEDNNAKLIAAYFQASGLTATYLHPKDVGLFVSQEPQNARVLPVS
FT                   YDHIEKLNQLEGILVIPGFFGVTQDGQICTFSRGGSDITGSLIAAGMAAELYENFTDVD
FT                   GIFAAHPGIVHNPHSIKELTYREMRELAYAGFSVLHDEALLPAYRAKIPIVIKNTNNPS
FT                   HPGTKIVLKHETDTPSVVVGISADDQFVSINMSKYLMNREVGFGRQVLQILEDLNIRWE
FT                   HMPTGIDDLSIVIRQRELTPIKEDEILHRLIHELEVDHASITKNLSIIMIVGENMKSHI
FT                   GVTATATKALSDSHINLAMISQESSEVSVMFVIDSQDEHKAIKALYNTFF"
FT   CDS_pept        290018..290767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="SDEG_0320"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="5.4.99.12"
FT                   /note="similar to tRNA pseudouridine synthase A TruA
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80829"
FT                   /db_xref="GOA:C5WEL4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL4"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124069.1"
FT                   /protein_id="BAH80829.1"
FT                   /translation="MTRYRATISYDGTLFSGFQRQSHARTVQEEIEKTLQKLASVQPVP
FT                   IHGAGRTDAGVHAYGQVIHFDLPQKRDLEKLRFALDTQTPADIDVVDLAIVADDFHCRY
FT                   QKHSKTYEFLVDNGRPKNPMMRHYATHYPYPLDINKMQEAIKDLVGTHDFTGFTAAGTS
FT                   VENKVRTITEATLVQDDKTGFLVFTFSGNGFLYKQVRNMVGTLLKIGNGRMPVEQIKVI
FT                   LDSKNRQLAGPTPAGNGLYLKEIRYED"
FT   CDS_pept        290757..291524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0321"
FT                   /product="pyridoxine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="similar to pyridoxine kinase [Streptococcus gordonii
FT                   str. Challis substr. CH1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80830"
FT                   /db_xref="GOA:C5WEL5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL5"
FT                   /inference="similar to AA sequence:RefSeq:YP_001449725.1"
FT                   /protein_id="BAH80830.1"
FT                   /translation="MKTNYVLAMSGNDIFSGGGLYADLATYTRHDLHGFVAVTCLTAMT
FT                   DKGFDVFPTSADQFRYQLNSLKDVPFAAIKIGLLPNAAICQLALDFIKSHPNIPVVLDP
FT                   VLVCKETHDVEVATLREELVSFFPYVTIITPNLLEAQLLSQKTINSLEDMKEVAKDLYQ
FT                   LGAKHVVIKGGNRFSQEKAIDLFYDGQSFEILDNPVLEQNNVGAGCTFASSIASQLVEG
FT                   RTALEAVQASKEFVYQAILKSDKYGVKQGDAKK"
FT   CDS_pept        291508..291984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0322"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80831"
FT                   /db_xref="GOA:C5WEL6"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL6"
FT                   /inference="similar to AA sequence:RefSeq:YP_282978.1"
FT                   /protein_id="BAH80831.1"
FT                   /translation="MMQKSKTRQMSLLAVLTALTIVLGRFVMVPTPTGFLTLLDAGIYF
FT                   TSFYLGATQGAIVGGLSGFLIDLIAGYPQWMIHSLIAHGAQGYFAGWTGYKRWLGILLG
FT                   SVIMVVWYFLGSLMLGYGLAGSLAGIWGNVMQNTFGLLVGYLIFRAMIAFQKNK"
FT   CDS_pept        291995..292558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0323"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M28 Spy1603
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80832"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="InterPro:IPR028345"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281068.1"
FT                   /protein_id="BAH80832.1"
FT                   /translation="MNLQDLEEQTRAIVSDIIERSAIKPGQVFVLGLSSSEIIGGRIGQ
FT                   QSSLEVGQVVVKSVLEELHKRGIHLAVQGCEHVNRALVVESQVAEEKQLEIVNVIPNLH
FT                   AGGSGQVAAFRYMSDPVQVESIVAHAGLDIGDTSIGMHVKRVQVPLIPCQRELGAAHVT
FT                   ALASRPKLIGGARADYYQDPIRKH"
FT   CDS_pept        complement(292621..293466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0324"
FT                   /product="potassium efflux system/small-conductance
FT                   mechanosensitive channel"
FT                   /note="similar to conserved hypothetical protein possible
FT                   mechanosensitive ion channel [Streptococcuspyogenes NZ131]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80833"
FT                   /db_xref="GOA:C5WEL8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL8"
FT                   /inference="similar to AA sequence:RefSeq:YP_002286519.1"
FT                   /protein_id="BAH80833.1"
FT                   /translation="MTVIFRYLEQFHIEDISLAIFSKLVSLVLLLVFFAILKRVSNYLF
FT                   EKTIAKSFSYSRQSEARQKTLSKLTHNILNYVLYFLLIYWLLSLFGIPVSSLLAGAGIA
FT                   GVAIGLGAQGFLSDVVNGFFILFENQFEVGDYVAISGIEGTISGVGIRTTQVRGFDGTL
FT                   HYIPNRSITVVSNKSRGNMRALIEIPLYSTVDLSQVTKIIEAVNERELPNYPQIVGKPN
FT                   ILGPQTNPNGQFTFRVTIFTDNGQQFMIYHTFYRLYQEALIKEGISLPTAISYPTAPQS
FT                   "
FT   CDS_pept        293860..295263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /locus_tag="SDEG_0325"
FT                   /product="alpha-amylase precursor"
FT                   /EC_number="3.2.1.1"
FT                   /note="similar to alpha-amylase precursor AmyE
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80834"
FT                   /db_xref="GOA:C5WEL9"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEL9"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124064.1"
FT                   /protein_id="BAH80834.1"
FT                   /translation="MVAQKTKGLFTKLSIAGLIFGLSNTSLVPLISTQVVSAESNQIAM
FT                   KDGAILHAWCWSFNTIKQNMKAIKDADYTSIQTSPINAVIPGDNGSKDLKNWYFHYQPT
FT                   DYTIGNYQLGTEDEFKAMAAEADKYGINIIVDAVLNHTTTDINAVSEKIKAIPDWTHGN
FT                   QGITNDYDRYQVTQHALLGLYDLNTQNKAVQEYLLNYLKQAVADGADGFRFDAAKYIEL
FT                   PGEFNSDFWTNILANSGAKFQYGEVLQGAASRESDYGKLMGVTASHYGEFIRKVIGQGY
FT                   VKDGDLVNYQVPGVSEDNLITWVESHDNYANDSEESTKLTDQDIILGWSIIGARKEGVP
FT                   LFFSRPVGGGGQHGRFPGTTKIGDAGSDLFKDPTIVAINKFRNAMNGQSEYTRNPNMDQ
FT                   GLVMIERGGKGAVITNLTSEEKRIHSETTLADGQYKDTITGHIFEVSNKQISGKMAPRT
FT                   VAVLYPITQ"
FT   CDS_pept        295486..296892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyE"
FT                   /locus_tag="SDEG_0326"
FT                   /product="alpha-amylase precursor"
FT                   /EC_number="3.2.1.1"
FT                   /note="similar to alpha-amylase precursor AmyE
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80835"
FT                   /db_xref="GOA:C5WEM0"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM0"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124064.1"
FT                   /protein_id="BAH80835.1"
FT                   /translation="MQTFTFKGEDSMVSSRRKKITVASLVTGVMLGTAGLGWFWSQHTQ
FT                   KVEMKDGAILHAWCWSFDTIKDNLPAIKKAGYTSIQTSPINQVVEGENGSKALTNWYYH
FT                   YQPTDYTIGNYQLGTEADFKALTKEADKYGLHIIVDAVVNHTTSDVAAVSPKIKALGKW
FT                   THGNEGIKDFGDRYQLTQKSLLGLYDLNTQNKAVQEYLLAYLKRAVADGADGFRYDAAK
FT                   HIELPKEYGSDFWSVILNNGAQFQYGEILQGSTSKEADYAKLMGVTASDYGEFIRNSLR
FT                   QEEAYAEDLMDFQAPGVPEDRFVTWVETHDTYANDNGESTNLTDQDIILGWSLIASRKE
FT                   GAPLFYSRPVGGGGQNDRFPGQSEIGDAGSDLFKNKTIVAINHFRNTMNGRDEYLHNIG
FT                   DDQGLVMVERGGKGAIITNLASENKTFSTSTKLADGSYKDAVSGKIYKVSGKILKGKLP
FT                   KKSVLVLLPA"
FT   CDS_pept        297013..298383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ropA"
FT                   /locus_tag="SDEG_0327"
FT                   /product="trigger factor, PPIase"
FT                   /note="similar to trigger factor [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80836"
FT                   /db_xref="GOA:C5WEM1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM1"
FT                   /inference="similar to AA sequence:RefSeq:YP_603161.1"
FT                   /protein_id="BAH80836.1"
FT                   /translation="MISRIKNFKNALNYDRMNCIEIILRRNDLMSTSFENKATNRGVIT
FT                   FTIGQDKIKPALDQAFNKIKKDLNAPGFRKGHMPRPVFNQKFGEEVLYEDALNIVLPEA
FT                   YEAAVTELGLDVVAQPKIDVVSMEKGQEWTLTAEVVTKPEVKLGDYKNLAVEVEASKEV
FT                   TDEEVDAKVERERANLAELVVKEDAAALGDTVVIDFVGSVDGVEFDGGKGDNFSLELGS
FT                   GQFIPGFEDQLVGAKAGDEVEVNVTFPEAYQAEDLAGKDAKFVTTVHEVKTKEVPELDD
FT                   ELAKDIDEEVETLADLKAKYRKELEAAKEIAYDDAVEGAAIELAVANAEIVELPEEMVH
FT                   DEVHRSMNEFMGNMQRQGISPEMYFQLTGTSQEDLHNQYQADADKRVKTNLVIEAIAKA
FT                   EGFEATEEEIEQEINDLATEYNMPVEQVRSLLSADMLKHDITMKKAVEAITSSAIVK"
FT   CDS_pept        298597..299175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0328"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein STRINF 00061
FT                   [Streptococcus infantarius subsp. infantarius ATCC
FT                   BAA-102]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80837"
FT                   /db_xref="GOA:C5WEM2"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM2"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02919232.1"
FT                   /protein_id="BAH80837.1"
FT                   /translation="MKLDVFAGQEKSELSMIEVARAILEERGRDHEMYFSDLVNEIQNY
FT                   LGKSDADIRHALPFFYTDLNTDGSFIPLGDNKWGLRSWYAIDEIDEEIITLEDDEDGAQ
FT                   KRKKKRVNAFMDGDEDAIDYSDDDPEDEDFTEESADIEYDEEDPDDEKSEVESYDSELN
FT                   EIIPEDDFEEVDINEEDEEEEEDEDEDEE"
FT   CDS_pept        299458..301062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SDEG_0329"
FT                   /product="CTP synthetase"
FT                   /EC_number="6.3.4.2"
FT                   /note="similar to CTP synthetase [Streptococcus pyogenes
FT                   MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80838"
FT                   /db_xref="GOA:C5WEM3"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM3"
FT                   /inference="similar to AA sequence:RefSeq:NP_665436.1"
FT                   /protein_id="BAH80838.1"
FT                   /translation="MTKYIFVTGGVVSSIGKGIVAASLGRLLKNRGLKVTIQKFDPYIN
FT                   IDPGTMSPYQHGEVYVTDDGAETDLDLGHYERFIDINLNKYSNVTTGKIYSEVLRKERK
FT                   GEYLGATVQVIPHITDALKEKIKRAASTTDSDVIITEVGGTVGDIESLPFLEALRQMKA
FT                   DVGSENVMYIHTTLLPYLKAAGEMKTKPTQHSVKELRGLGIQPNMLVIRTEEPVEQGIK
FT                   NKLAQFCDVNPEAVIESRDVEHLYQIPLNLQAQSMDQIVCDHLKLNVPKADMTEWSAMV
FT                   DKVMNLRKTTKIALVGKYVELPDAYLSVVEALKHSGYANDTAIDLKWVNANDVTVDNAA
FT                   DLLGDADGIIVPGGFGQRGTEGKIQAIRYARENDVPMLGICLGMQLTCVEFARHVLNME
FT                   GANSFELEPSTKYPIIDIMRDQIDIEDMGGTLRLGLYPCKLKPASKAAAAYNHQEVVQR
FT                   RHRHRYEFNNKFRPEFEAAGFVFSGVSPDNRLVEIVELPEKKFFVAAQYHPELQSRPNR
FT                   PEELYTAFVTAAVQNSK"
FT   CDS_pept        301138..302898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytS"
FT                   /locus_tag="SDEG_0330"
FT                   /product="autolysin sensor kinase protein"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to autolysin sensor kinase protein
FT                   [Staphylococcus aureus subsp. aureus MRSA252]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80839"
FT                   /db_xref="GOA:C5WEM4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM4"
FT                   /inference="similar to AA sequence:RefSeq:YP_039720.1"
FT                   /protein_id="BAH80839.1"
FT                   /translation="MMSLLLPLLERVGLIILLANLLMISPFYKRLMHDRQSIKVRWILI
FT                   MTFSVFAIISNFTGVLISQQVGVDNGGLVNLSSHNSIANTRTLTIGMSGLIGGPFVGFF
FT                   VGLISGAVRWLQGGSAPYTYFISSLLIGGLSGLVGRVSLTHKRYPQVWQGSLCGALMEV
FT                   IQMLCILIFLPDKEQAWTLIQTIALPMVFVNALGTGIFLSIILGTLRQEESMKAVQTHD
FT                   VLELANKTLPYFRQGLTEASAQKAALEIKKFMRVSAVSVTNRHAILAHVGAGSDHHIPT
FT                   REIITDLSREAIETGRIQVVRQKAQIGCSHPDCPLEAAVVVPLFVKKGVVGSFKLYFTD
FT                   ASNLTYVDEQLASGLGHIFSSQLELGQMALEQGLLKDAEIKSLQAQVNPHFLFNAINTI
FT                   SALIRVDSEKARHLLLQLGHYFRANLNSTRQNVISVDSELKHLEAYLTIEQARFPNRYE
FT                   VIIDIPEALKSAAIPPFMIQILVENALKHAFTGRKKDNKVWVMARQKASGYLRLTVKDN
FT                   GQGIAPEKLALLGKTVVTSEKGTGSALENLNKRLMSLYGNQAIFEVTSDQSGTSFVLQI
FT                   PFNQLKETTT"
FT   CDS_pept        302895..303623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytR"
FT                   /locus_tag="SDEG_0331"
FT                   /product="two-component response regulator"
FT                   /note="similar to two-component response regulator LytR
FT                   [Carnobacterium sp. AT7]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80840"
FT                   /db_xref="GOA:C5WEM5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02184454.1"
FT                   /protein_id="BAH80840.1"
FT                   /translation="MKVVIIDDEPLARMELAYLVEETQMVSAIYQGESIEDAFQLILTH
FT                   QPDLLFLDIHLTDESGLDLAKRLSQIPNAPLIIFATAYDNHAVEAFEVNAIDYVLKPFE
FT                   QARIQKAIAKAKMTLDRQQTNHSKEAEVPQTKRLTLEVDERIYLLPFSDILYCEVQGKE
FT                   TTVYTKTAHYTSHTSLSAIEKVLTTESFLKVHRSYLINTQAIKEIQPWFNQTYQVTMIN
FT                   GGKVPVSRSYLKTFRQRLGL"
FT   CDS_pept        303719..304204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgA"
FT                   /locus_tag="SDEG_0332"
FT                   /product="murein hydrolase regulator"
FT                   /note="similar to murein hydrolase regulator LrgA
FT                   [Staphylococcus aureus subsp. aureus JH9]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80841"
FT                   /db_xref="GOA:C5WEM6"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM6"
FT                   /inference="similar to AA sequence:RefSeq:YP_001245630.1"
FT                   /protein_id="BAH80841.1"
FT                   /translation="MYQKRESKEMIHMTKTYSMIYQSVVIGTIVLISKVLETLSPIKLP
FT                   ASVIGLVLLFIAVTTKVISLSQVEKVADLLVGNIGLFFVPAGISVINSLGILKEHFILN
FT                   MLLIFISTLLLLVGTGWMTQLLMGADVKKPALGKPGLLVKGSFQDERHLVASKVLAK"
FT   CDS_pept        304222..304929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrgB"
FT                   /locus_tag="SDEG_0333"
FT                   /product="antiholin-like protein"
FT                   /note="similar to antiholin-like protein LrgB
FT                   [Staphylococcus saprophyticus subsp. saprophyticus
FT                   ATCC15305]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80842"
FT                   /db_xref="GOA:C5WEM7"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM7"
FT                   /inference="similar to AA sequence:RefSeq:YP_300551.1"
FT                   /protein_id="BAH80842.1"
FT                   /translation="MAAFIDILRVSPIFGVLLSVGTFFIGQILFKKSKGFFLFAPLFVA
FT                   MILGIATLSATGISFAEYNKGGQIISFFLEPATICFAIPLYRKREVLKQYWLQIIGGIT
FT                   LGSVVAVYGIYLVSSLFHLGRVVVASMLPQAATTAIAMPTSVAMGGSAELTSLACILNG
FT                   VIIYALAKPLIQLFKIKDPIARGLALGTAGHALGVSAAKDFGQVEESMGSIALVVVGII
FT                   VTVVVPIMGSILL"
FT   CDS_pept        305089..306015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0334"
FT                   /product="alpha/beta hydrolase"
FT                   /EC_number="3.2.-.-"
FT                   /note="similar to alpha /beta hydrolase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80843"
FT                   /db_xref="GOA:C5WEM8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM8"
FT                   /inference="similar to AA sequence:RefSeq:YP_060935.1"
FT                   /protein_id="BAH80843.1"
FT                   /translation="MKTIRLSKYLGILFLLVTLASVGASFYFFHVAQVRDEKTFINNKK
FT                   RSTDNPLYPAEKAFDALPREKRYITHRGFNQVAWYLPAAKETQKTAVVVHGFANNKSNM
FT                   KPYAMLFHDLGYNVLMPDNEAHGESQGNLIGYGWNDRLNVMAWTDQLIKEKPDSQITLF
FT                   GLSMGAATVMMASGEKLPEQVTSIIEDCGYTSVWDELKFQAKAMYNLPAFPLLYEVSAL
FT                   SKIRAGFSYAEASSVKQLAKNKRPTLFIHGDKDDFVPTKMVYDNYKATKGPKEILIVKG
FT                   AKHARSFETNPVQYQKKIAAFLEKIDK"
FT   tRNA            306069..306154
FT                   /locus_tag="SDEG_0335"
FT                   /product="tRNA-Leu"
FT                   /anticodon="(pos:306103..306105,aa:Leu,seq:aag)"
FT                   /note="codon recognized: CTT"
FT   CDS_pept        306360..307241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0336"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="similar to fructose-bisphosphate aldolase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80844"
FT                   /db_xref="GOA:C5WEM9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEM9"
FT                   /inference="similar to AA sequence:RefSeq:YP_060934.1"
FT                   /protein_id="BAH80844.1"
FT                   /translation="MAIVSAEKFVQAARENGYAVGGFNTNNLEWTQAILRAAEAKQAPV
FT                   LIQTSMGAAKYMGGYKVCQSLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIM
FT                   FDGSHLPVEENLAKTAEVVKIAHAKGVSVEAEVGTIGGEEDGIIGKGELAPIEDAKAMV
FT                   ETGIDFLAAGIGNIHGPYPENWEGLALDHLEKLTAAVPGFPIVLHGGSGIPDDQIKEAI
FT                   RLGVAKVNVNTESQIAFSNATREFARNYEANEAEYDGKKLFDPRKFLAPGMKAVQGAVE
FT                   ERIDVFGSANKA"
FT   CDS_pept        307765..308049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0337"
FT                   /product="putative truncated transposase"
FT                   /note="similar to putative transposase [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80845"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN0"
FT                   /inference="similar to AA sequence:RefSeq:NP_665666.1"
FT                   /protein_id="BAH80845.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIARLLGRH
FT                   RSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLN"
FT   CDS_pept        308046..308792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0338"
FT                   /product="truncated transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80846"
FT                   /db_xref="GOA:C5WEN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN1"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH80846.1"
FT                   /translation="MNGCSARFIAQLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTK
FT                   TIYRYIKEGLLAIKPIDLPKMVSIRKRSKKVMKTNKKTLGKSIEERPEYINDGSEFGHW
FT                   KIDLILGKKTKGEAVMLTLVERQTRYALGVKLEDKQSQTINRAVTHLISQYPIASITAD
FT                   NGSEFSLLSTLEAVDVYFAHPYSSHERGTNENFNGLLREYVPKGISLNPLTSEELDNYL
FT                   TAINERPRRLLQYQSSTFLFELARTA"
FT   CDS_pept        308963..309151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SDEG_0339"
FT                   /product="50S ribosomal protein L28"
FT                   /note="similar to 50S ribosomal protein L28 [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80847"
FT                   /db_xref="GOA:C5WEN2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN2"
FT                   /inference="similar to AA sequence:RefSeq:NP_269878.1"
FT                   /protein_id="BAH80847.1"
FT                   /translation="MAKVCYFTGRKTVSGNNRSHAMNQTKRTVKPNLQKVTILVDGKPK
FT                   KVWASARALKSGKVERI"
FT   CDS_pept        309305..309670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0340"
FT                   /product="alkaline-shock protein"
FT                   /note="similar to putative alkaline-shock protein
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80848"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN3"
FT                   /inference="similar to AA sequence:RefSeq:NP_269877.1"
FT                   /protein_id="BAH80848.1"
FT                   /translation="MTVKINTKDGLIELSDDVIATVVGGSATEIFGVVGMASKSAIKDN
FT                   FQSLLRKENYAKGVVVKSTDMGISVDVYTVMSYGVKISEVSKNIQERVKFNLESQLGLT
FT                   ADMVNVYVQNIKVVGEN"
FT   CDS_pept        309670..311334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0341"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spyM18 1950
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80849"
FT                   /db_xref="GOA:C5WEN4"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR019986"
FT                   /db_xref="InterPro:IPR033470"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN4"
FT                   /inference="similar to AA sequence:RefSeq:NP_607946.1"
FT                   /protein_id="BAH80849.1"
FT                   /translation="MSNITTSLFQEMVQAAATRLGKQAEYVNSLNVFPVPDGDTGTNMS
FT                   MTMDNGAKEVADKPASTVGEVGQILSKGLLMGARGNSGVITSQLFRGFGQSVKGKNELT
FT                   GKDLAQAFQMGVEVAYKAVMKPVEGTILTVSRGAATAALKKADLTDDAVEVMQAALDGA
FT                   KGALAKTPDLLPVLKEVGVVDSGGQGLVFIYEGFLSALNGDYVASEDFKATPANMSEMI
FT                   NAEHHKSVVGHVATEDITYGYCTEIMVALKQGPTYVKEFNYDEFQGYLSGLGDSLLVVN
FT                   DDEIVKVHVHTEDPGLVMQEGLKYGSLIKIKVDNMRNQHEAQVQKTDAEESKAEAKDFG
FT                   LIAVVAGEGLSAIFKAQGVDYVISGGQTMNPSTEDIVKAIEAVNAKQVIILPNNKNIFM
FT                   AAQSAAEVVDIPAAVVETRTVSQGFTSLLAFDPSKSLEDNVADMSASLSDVVSGSVTLA
FT                   VRDTTIDGLEIHENDFLGMVDGKIVVSNPDMEATLKAAFEKMIDEDSEIVTIFVGEEGD
FT                   QDLAEELAEYLEETYEDVEVEIHQGDQPVYPYLMSVE"
FT   CDS_pept        311570..312460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0342"
FT                   /product="membrane protease protein family"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to membrane protease protein family
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80850"
FT                   /db_xref="GOA:C5WEN5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN5"
FT                   /inference="similar to AA sequence:RefSeq:YP_060930.1"
FT                   /protein_id="BAH80850.1"
FT                   /translation="MLGPFIFIAFGVIIILAIVASTLYVVRQQSVAIVERFGRYQKTAT
FT                   SGIHIRLPFGIDKIAARVQLRLLQSEIIVETKTKDNVFVTLNVATQYRVNEQNVTDAYY
FT                   KLMKPESQIKSYIEDALRSSVPKLTLDELFEKKDEIALEVQHQVAEEMSTYGYIIVKTL
FT                   ITKVEPDAEVKQSMNEINAAQRKRVAAQELANADKIKIVTAAEAEAEKDRLHGVGIAQQ
FT                   RKAIVDGLAESIQELKEANISLNEEQIMSILLTNQYLDTLNTFAAKGNQTLFLPNTPNG
FT                   VDDIRTQVLSALKTK"
FT   CDS_pept        complement(312856..313665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0343"
FT                   /product="amino acid transport ATP-binding protein"
FT                   /note="similar to amino acid transport ATP-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80851"
FT                   /db_xref="GOA:C5WEN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059585.1"
FT                   /protein_id="BAH80851.1"
FT                   /translation="MNAVSMPILTPLEQTKCRLRRSQMSNSIIEIKNLKKSYGSNEVLK
FT                   DISLSVNKGEVISIIGSSGSGKSTLLRSINLLEEPSAGQILFHGEDVLAEHYNLTHYRE
FT                   KLGMVFQSFNLFENLNVLENAIVAQTTVLKRDRAEAEQIAKENLNAVGMTEQYWQAKPK
FT                   QLSGGQKQRVAIARALSVNPEAMLFDEPTSALDPEMVGEVLKTMKDLAKSGLTMIIVTH
FT                   EMEFARDVSNRIIFMDKGLIAEEGSPQQIFENPTQDRTKEFLQRFLK"
FT   CDS_pept        complement(313589..315175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0344"
FT                   /product="ABC transporter amino acid-binding protein"
FT                   /note="similar to ABC transporter amino acid-binding
FT                   protein [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80852"
FT                   /db_xref="GOA:C5WEN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059586.1"
FT                   /protein_id="BAH80852.1"
FT                   /translation="MKQETYMKKLILSCLVALALLFGGMSQAQADQYLRVGMEAAYAPF
FT                   NWTQDDASNGAVPIEGTSQYANGYDVQVAKKIAKAMNKELLVVKTSWTGLIPALTSGKI
FT                   DMIAAGMSPTDERRKEITFSNSYYTSEPVLVVAADGKYAGATSLDDFANAKVTAQQGVW
FT                   HVNLLTQLKDAKLQTPMGDFSQMRQALSSGVIDAYISERPEAMTAEAADSHFKMITLKK
FT                   GFTVSESDAAIAVGMKKNDNRIATVNQVLEGFSQTDRMALMDDMVTKQPMEKKAEDAKA
FT                   SFLGQMWAIFKGNWKQFLRGTGMTLLISMVGTITGLFIGLLIGIFRTAPKAKHKVAVLG
FT                   QKLFGWLLTIYIEIFRGTPMIVQSMVIYYGTAQAFGISIDRTLAAIFIVSINTGAYMSE
FT                   IVRGGIFAVDKGQFEAATALGFTHGQTMRKIVLPQVVRNILPATGNEFVINIKDTSVLN
FT                   VISVVELYFSGNTVATQTYQYFQTFTIIAIIYFVLTFTVTRILRHIERRFDADTYTTGA
FT                   NQMQIAEVSNV"
FT   CDS_pept        315356..317281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0345"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80853"
FT                   /db_xref="GOA:C5WEN8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN8"
FT                   /inference="similar to AA sequence:RefSeq:YP_599852.1"
FT                   /protein_id="BAH80853.1"
FT                   /translation="MKKILMMFVLCFSFLGMRVTAADVDYSITNYEGLLALSKENTARF
FT                   EQKVTYQFDTSYNGQYISLGRAGNLPDGFAIDQNPKVEVYHNGQQVPVNQEFSDLGDGY
FT                   RLKLYNAGQAGDKVDVKVIWQLHHLLTAYQDVAELNWTPISDWDKTLEKVSLTVTTPTD
FT                   IQDSNLWAHRGYYQKKPQVLKEGNSRYQINAKNVSGQLELHAYWDKKALLGEEPVDVST
FT                   SKKNKIVALETKISRRRALLQLLFGKVIPLIEVGFLLWQLIQFIRLKKQFNRYHLANHT
FT                   DHSYEVPEDLSPLVLTQAIYGQSFAYLSPTASESQKLLIPKGVTFEALVQATLLDLIDQ
FT                   KVLLLTKEEGKAYLEISQLDRVTDEEAAFLDMAFGNKVTLPVDQLFSQYHYDADTIKQL
FT                   KKTYKGKKLEQEVRQSSEQVIKAMKKASAAITNNVLETIKKLNLPDTYRQMTPAEKRKS
FT                   HSVQGLGCLLVVLNSSLLIYLTMKGSGLALIYLALLGLTTCLSFYINLQLSPYRKLGIE
FT                   TPEGAVRLHQWQSFKNMMRDINKFDDVPIDGLVVWNRILVYATLFGYAKQIERYLKVHR
FT                   IALPEVYQAVRPGELSTIMYATTPAFVSSLSSATTSSNFSVSSGSGVSGGGGFSGGGGG
FT                   GGGGAF"
FT   CDS_pept        317347..318186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SDEG_0346"
FT                   /product="bacitracin resistance protein"
FT                   /note="similar to bacitracin resistance protein
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80854"
FT                   /db_xref="GOA:C5WEN9"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEN9"
FT                   /inference="similar to AA sequence:RefSeq:YP_601729.1"
FT                   /protein_id="BAH80854.1"
FT                   /translation="MLIIELLKAIFFGIIEGITEWLPVSSTGHLILVQEFIRLNQDKAF
FT                   IEMFNIVIQLGAIIAVMLIYFERLNPLQPGKTAREVQLTWQLWLKVVIACIPSILIAVP
FT                   LDNWFEAHFYFMVPIAIALIVYGIAFIWIEKRNAQQEPAVTDLARMSYKTAFFIGCFQV
FT                   LSIVPGTSRSGATILGAIILGTSRTVAADFTFFLAIPTMFGYSGLKAVKFFLDGHHLDF
FT                   AQVLILLVASLTAFAVSLLAIRFLTDYVKKHDFTIFGKYRIVLGSLLLIYSFFKFVF"
FT   CDS_pept        318324..319091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mecA"
FT                   /locus_tag="SDEG_0347"
FT                   /product="negative regulator of genetic competence"
FT                   /note="similar to negative regulator of genetic competence
FT                   mecA [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80855"
FT                   /db_xref="GOA:C5WEP0"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP0"
FT                   /inference="similar to AA sequence:RefSeq:YP_601730.1"
FT                   /protein_id="BAH80855.1"
FT                   /translation="MIMEMKQISETTLKITISMDDLEERGMELKDFLIPQEKTEEFFYS
FT                   VMDELDLPDNFKDSGMLSFRVTPRKDRLDVFVTKSELNEDLNLEDLADLGDISQMTPED
FT                   FFKSLEQSMREKGDVNAHEKLEKIEEMMEDVVEATLASQTEETAEEVGQEPELLDYVHY
FT                   VLDFATLSEAVAFSQTIDFPVEASELYKGDSRYHMTILLDVQQQPSYFANVMYARLIEH
FT                   ASPGTKTRAYLQEHGVQLILDGAVEQLRKIELG"
FT   CDS_pept        319098..320267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0348"
FT                   /product="undecaprenyl-phosphatealpha-N-acetylglucosaminephosphotransferase"
FT                   /EC_number="2.7.8.-"
FT                   /note="similar to undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80856"
FT                   /db_xref="GOA:C5WEP1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP1"
FT                   /inference="similar to AA sequence:RefSeq:YP_601731.1"
FT                   /protein_id="BAH80856.1"
FT                   /translation="MFSFTIDYVLVLIGALLISLVLTPIVRFLAFRVGAVDNPNARRVN
FT                   KVPMPTSGGLAIFTSFMVASLIFMPLASKGVLLGGQSYFAYILPVVIGALMITLTGFLD
FT                   DLYELSPKLKMLGIVAGAIIIWAFTDFKFDSFKIPFGGPLLAFGPFLTFFLTVLWIISI
FT                   TNAINLIDGLDGLVSGVSIISLVTMAIVSYFFLPQTDFFLTLTILVLIASIAGFFPYNY
FT                   HPAIIYLGDTGALFIGFMIGVLSLQGLKNSTAVAVVTPVIILGVPIMDTIVAIIRRSLS
FT                   GKKFYEPDKMHLHHRLLSLGFTHRGAVLVVYGIAMLFSLISLLLNVSSRIGGILLLLGL
FT                   LFGLEVFIEGLEIWGEKRTPLFNVLKFIGNSDYRQATLLKCKEKNDLKR"
FT   CDS_pept        320380..321150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="SDEG_0349"
FT                   /product="ATP-dependent transporter"
FT                   /note="similar to ATP-dependent transporter sufC
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80857"
FT                   /db_xref="GOA:C5WEP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP2"
FT                   /inference="similar to AA sequence:RefSeq:YP_599857.1"
FT                   /protein_id="BAH80857.1"
FT                   /translation="MSVLEINNLHVSIEDKEILKGVNLTLKTGEIAAIMGPNGTGKSTL
FT                   SAAIMGNPNYEVTQGEILLDGVNILELEVDERARMGLFLAMQYPSEIPGITNAEFMRAA
FT                   MNAGKADEDKISVRDFITKLDDKMALLGMKEEMAERYLNEGFSGGEKKRNEILQLLMLE
FT                   PKFALLDEIDSGLDIDALKVVSKGVNEMRGKDFGAMIITHYQRLLNYITPDLVHVMMDG
FT                   RIVLSGDASLAVRLEKEGYAGIAQELGIEYKEEN"
FT   CDS_pept        321246..322508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="SDEG_0350"
FT                   /product="iron-sulfur cluster assembly protein"
FT                   /note="similar to SufD protein [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80858"
FT                   /db_xref="GOA:C5WEP3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP3"
FT                   /inference="similar to AA sequence:RefSeq:YP_597852.1"
FT                   /protein_id="BAH80858.1"
FT                   /translation="MTKEKLVAFSQAHAEPAWLQERRLEALKAMPNLELPAIERVKFHR
FT                   WNLGDGTLTENDELANVPDFMAIGDNPTLVQVGTQTVLEQLPMELINQGVVFTDFYTAL
FT                   EEIPEVIATHFGQAVAFDEDKLAAYHTAYFNSAAVLYVPDHLEITAPIEAIFLQDSDSD
FT                   VPFNKHVLVIAGKESKFTYLERFESIGNGSQKASANISVEVIAQAGSQIKFSAIDRLGS
FT                   SVTTYMSRRGRLDKDASIDWALSIMNEGNVVADFDSDLVGQGSQADLKVVAVSSGRQVQ
FT                   GIDTRVTNYGQHTIGHILQHGVILERGTLTFNGIGHILKGAKGADAQQESRVLMLSDQA
FT                   RSDANPILLIDENEVTAGHAASIGQVDPEDMYYLMSRGLDQDIAERLVIRGFLGAVIAE
FT                   IPIPSVRQEIIKGLDGKLRNR"
FT   CDS_pept        322539..323765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="SDEG_0351"
FT                   /product="putative aminotransferase"
FT                   /note="similar to putative aminotransferase [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80859"
FT                   /db_xref="GOA:C5WEP4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP4"
FT                   /inference="similar to AA sequence:RefSeq:NP_664014.1"
FT                   /protein_id="BAH80859.1"
FT                   /translation="MLDANHIKQDFNILDQLVNDEPLVYLDNAATTQKPTVVLEALRSY
FT                   YETDNANVHRGVHTLAERATSQYEASRQLVADFIKAKSSKEVIFTRGTTTSLNWVARFA
FT                   EQVLTAGDEVLVSVMEHHANIIPWQQVCQKTGAKLVYAYLKHGQLDMTDLAQKLTPKTK
FT                   FVSLAHVSNVLGCINPIKEIAELVHANGAYLVVDGAQSIPHMPIDVQELDCDFFAFSAH
FT                   KMYGPTGLGILYGKEELLHQMEPIEFGGEMIDFVYEQSATWKGLPWKFEAGTPHIAGAI
FT                   GLAAAVSYLQDIGMTEVQAHEADLVAYILPKLRAIEGLTLYGPEQPENRAGVIAFNLDG
FT                   LHPHDLATALDYEGVAVRAGHHCAQPLLSYLNVSATVRASFSLYNTREDCDRLVDAILK
FT                   AKEFFNGTL"
FT   CDS_pept        323752..324228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="SDEG_0352"
FT                   /product="iron-sulfur cluster assembly scaffold protein"
FT                   /note="similar to IscU [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80860"
FT                   /db_xref="GOA:C5WEP5"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP5"
FT                   /inference="similar to AA sequence:RefSeq:YP_059594.1"
FT                   /protein_id="BAH80860.1"
FT                   /translation="MALSKLNHLYMAVVADHSKHPHHYGQLEGVEAVQLNNPTCGDVIS
FT                   LTVTFNGDKIEDIAFAGNGCTISTASSSMMTDAVIGKSKSEALALADIFSEMVQGKEDP
FT                   SQKELGEAELLAGVAKFPQRIKCSTLAWNALKEAIQRSDAEKITDKNIKEEKDV"
FT   CDS_pept        324221..325639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0353"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spyM18 0278
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80861"
FT                   /db_xref="GOA:C5WEP6"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP6"
FT                   /inference="similar to AA sequence:RefSeq:NP_606554.1"
FT                   /protein_id="BAH80861.1"
FT                   /translation="MSDINEKVEPQPIDLGDYQFGFHDDVEPIYSTGKGLSEAVVRELS
FT                   AAKNEPEWMLEFRLKSLETFNKMPMQTWGADLSDINFDDIIYYQKASDKPARSWDDVPD
FT                   KIKETFERIGIPEAERAYLAGASAQYESEVVYHNMKDEFEKLGIIFTDTDSALKEYPDL
FT                   FKQYFAKLVPPTDNKLAALNSAVWSGGTFIYVPKGVKVDIPLQTYFRINNENTGQFERT
FT                   LIIVDEGASVHYVEGCTAPTYSSNSLHAAIVEIFALDGAYMRYTTIQNWSDNVYNLVTK
FT                   RARALADATVEWIDGNLGAKTTMKYPSVYLDGPGARGTMLSIAFANAGQHQDTGAKMIH
FT                   NAPHTSSSIVSKSIAKGGGKVDYRGQVTFNKQSKKSVSHIECDTILMDDISKSDTIPFN
FT                   EIHNSQVALEHEAKVSKISEEQLYYLMSRGLSESEATEMIVMGFVEPFTKELPMEYAVE
FT                   LNRLISYEMEGSVG"
FT   CDS_pept        complement(325815..326996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0354"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="similar to D-alanyl-D-alanine carboxypeptidase
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80862"
FT                   /db_xref="GOA:C5WEP7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP7"
FT                   /inference="similar to AA sequence:RefSeq:YP_597856.1"
FT                   /protein_id="BAH80862.1"
FT                   /translation="MIKRIALVIFTVMCFLIMPVSHAEDIMDITRQAGYTISEVNRPKA
FT                   SIVVDANTSDILWQDNIDIPRDPASMSKMFTLYVLFEELAKGKITMDTTVTATETDQAI
FT                   AKIYEISNNNIVAGVAYPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAK
FT                   KLGMTNTHFSNASGAAAQAFQGYYNPTKYDLSAANITTARDLAKLLYAFLKKYPQIIDF
FT                   TNQSVVHTMVGTPYEEEFHTYNHSLPNNQFGMEGVDGLKTGSSPSAAFNAMVTAKRGNT
FT                   RLITIVMGVGDWSDQNGEFYRHPFVNALTEKGFSDSKSLTKAARKKLEKLVPQKKKENL
FT                   PKQHRTKPAKNYSTLEKVEQFINHNHTFFIICLGIFMVVILLLAIIAYTMGRQ"
FT   CDS_pept        complement(327140..328378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="SDEG_0355"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="similar to putative D-alanyl-D-alanine
FT                   carboxypeptidase [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80863"
FT                   /db_xref="GOA:C5WEP8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP8"
FT                   /inference="similar to AA sequence:RefSeq:NP_664018.1"
FT                   /protein_id="BAH80863.1"
FT                   /translation="MIKRLFVVLLITLAFGATPVNSDDFSVAAKQAIAVEVDSGKILYE
FT                   KEADKAVPVASITKLLTTYLVYKEIANGKLEWGSSVTISNYPYELTTNYSISNVPLDAR
FT                   KYTVKELLKALIVTNANSPAIALAEKIGGTEPKFVDKMSQQLKEWGISDAKLVNATGLP
FT                   NHFLGENKYPKTEDDDENLFSARDLAIIARHLLTEFPEVLKITSKPSANFAGQTIYSYN
FT                   YMLKDMPYYRDGVDGLFVGYSEKGGASFVATSVENRMRVITVVLNADQAQEDEFAVFSA
FT                   TNQLLQYLLTNFQKVQVLNKSKSGQVKAFPILDSPNKSVPLVAEKNLSLIKPANSKIKK
FT                   ALHITKDSSIISAPVKKGQVLAKATLQDQHLIGQGYLGETPSVNLVAQKDTPRSFFLRV
FT                   WWNHFVRYVNNSL"
FT   CDS_pept        328700..330679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="SDEG_0356"
FT                   /product="oligopeptide-binding protein"
FT                   /note="similar to oligopeptide-binding protein
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80864"
FT                   /db_xref="GOA:C5WEP9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEP9"
FT                   /inference="similar to AA sequence:RefSeq:YP_279713.1"
FT                   /protein_id="BAH80864.1"
FT                   /translation="MTFMKKSRWLATLGVAVLSVSVLAACGGKNASGGSDATKAYKYVF
FT                   VNDPKSLDYILTNGGGTTDVTTQMVDGLLENDEYGNLVPSLAKDWKVSKDGLTYTYTLR
FT                   DGVSWYTADGEEYAPVTAEDFVTGLKHAVDDKSDALYVVEDSIKNLKAYQNGEVDFKEV
FT                   GVKALDDKTVQYTLNKPESYWNSKTTYSVLFPVNAKFLKSKGKDFGTTDPSSILVNGAY
FT                   FLSAFTSKSSMEFHKNENYWDAKNVGIESVKLTYSDGSDPGSFYKNFDKGEFSVARLYP
FT                   NDPTYKSAKKNYADNITYGTLTGDIRHLTWNLNRTSFKNTKKDPAQQDAGKKALNNKDF
FT                   RQAIQFAFDRASFQAQTAGQDAKTKALRNMLVPPTFVTIGENDFGSEVEKDLATMGDEW
FT                   KDVNLKDAQDGFYNPEKAKAEFAKAKEALTAEGVTFPVQLDYPVDQANAATVQEAQSFK
FT                   QSVEASLGKENVIVNVLETETSTHEAQGFYAETPEQQDYDIISSWWGPDYQDPRTYLDI
FT                   MSPVGGGSVIQKLGIKAGQNQDVVAAAGLDTYQTLLDEAAAITDDNDARYKAYAKAQAY
FT                   LTDSAVDIPVVALGGTPRVSKAIPFSGGFSWAGAKGPLAYKGMKLQDKPVTAKQYEKAK
FT                   EKWLKAKAKSNADYAEKLADHVEK"
FT   CDS_pept        330733..332247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="SDEG_0357"
FT                   /product="oligopeptide transport system permease protein"
FT                   /note="similar to oligopeptide transport system permease
FT                   protein oppB [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80865"
FT                   /db_xref="GOA:C5WEQ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ0"
FT                   /inference="similar to AA sequence:RefSeq:YP_601741.1"
FT                   /protein_id="BAH80865.1"
FT                   /translation="MRITMKKYILNRILRSLVSVVLVTALTYTIVYTLVPVGLIFKQDP
FT                   NYNKMTTTPDKKAAYESLTFQRMGYINYFSSKELKDNASKIDSSVTTEATSANKVIYEK
FT                   YIHSLGNGWQLKRFPVSKKFYATRKIPIYERVWNFFSNLVVIDHPWKIQDKNNPNLARY
FT                   VRLENDKSIGWSLVGSGTQHKYLVYANGKFPYLHQNLVTLNLGTSYPTYSNIPVLQVIS
FT                   QGQGRTALQDVTFPSGVTKKSSVDIYSRTYKNPKSMDDITKANYGKGDSYTKTINNYVD
FT                   PSMIHNSFVIGFFGVLIAYVIGLPLGLFMARFKNTYFDRFSTATMTFMLALPSIAVIYV
FT                   VRFLGSMVGLPDSFPMLGASSPKSYVLPALILGILSIPSTVIWFRRYLVDLQASDWVRF
FT                   ARSKGLSESEIYRDHLFKNAMVPIVSGIPASIILAIGGATLTETVFAFPGMGKMLIDSI
FT                   KSANNSMIVGLTFIFTVLSIVSLLLGDIAMTIVDPRIKLSTKKGGK"
FT   CDS_pept        332247..333173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="SDEG_0358"
FT                   /product="oligopeptide permease"
FT                   /note="similar to oligopeptide permease [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80866"
FT                   /db_xref="GOA:C5WEQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ1"
FT                   /inference="similar to AA sequence:RefSeq:NP_606559.1"
FT                   /protein_id="BAH80866.1"
FT                   /translation="METIDKSKFRFVERDSRASEVIDTPAYSYWKSVFRQFFSKKSTIF
FT                   MLMILVTILLMSFIYPMFANYDFGDVSNINDFSKRYIWPNAEYWFGTDKNGQSLFDGVW
FT                   YGARNSILISVIATLINVTIGVILGAIWGVSKAFDKVMIEIYNVISNIPSMLIIIVLTY
FT                   SLGAGFWNLILAFCITGWIGVAYSIRVQILRYRDLEYNLASQTLGTPMYKIAIKNLLPQ
FT                   LVSVIMTMLSQMLPVYVSSEAFLSFFGIGLPTTTPSLGRLIANYSSNLTTNAYLFWIPL
FT                   VTLILVSLPLYIVGQNLADASDPRSHR"
FT   CDS_pept        333182..334252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="SDEG_0359"
FT                   /product="oligopeptide transport ATP-binding protein"
FT                   /note="similar to oligopeptide transport ATP-binding
FT                   protein [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80867"
FT                   /db_xref="GOA:C5WEQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ2"
FT                   /inference="similar to AA sequence:RefSeq:YP_279716.1"
FT                   /protein_id="BAH80867.1"
FT                   /translation="MTKENNVILTAKDVVVEFDVRDRVLTAIRNVSLELIEGEVLAFVG
FT                   ESGSGKSVLTKTFTGMLESNGRIANGSIVYRGQELTGLKTNKEWAKIRGSKIATIFQDP
FT                   MTSLSPIKTIGSQITEVIIKHQKVSHSKAKELALDYMNKVGIPNATKRFDDYPFEYSGG
FT                   MRQRIVIAIALACRPDILICDEPTTALDVTIQAQIIELLKSLQKEYHFTIIFITHDLGV
FT                   VASIADKVAVMYAGEIVEFGTVEEIFYDPRHPYTWSLLSSLPQLANESGELYSIPGTPP
FT                   SLYSPIVGDAFALRSEYAMVLDFEETPPAISVSDTHWAKTWLLHPEAPKVQKPAVIQDL
FT                   HQKILKKMSRQEEGNV"
FT   CDS_pept        334245..335168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="SDEG_0360"
FT                   /product="putative oligopeptide ABC transporter,
FT                   ATP-binding protein"
FT                   /note="similar to putative oligopeptide ABC transporter,
FT                   ATP-binding protein [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80868"
FT                   /db_xref="GOA:C5WEQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ3"
FT                   /inference="similar to AA sequence:RefSeq:NP_664023.1"
FT                   /protein_id="BAH80868.1"
FT                   /translation="MSEKLVEVKDLEISFGEGKKKFVAVKNANFFIKKGETFSLVGESG
FT                   SGKTTIGRAIIGLNDTSSGDILYDGKVINRRKSKSESNELIRKIQMIFQDPAASLNERA
FT                   TVDYIISEGLYNFNLFKTEEERKEKIKNMMAEVGLLSEHLTRYPHEFSGGQRQRIGIAR
FT                   ALVMNPEFVIADEPISALDVSVRAQVLNLLKRMQAEKGLTYLFIAHDLSVVRFISDRIA
FT                   VIHKGVIVEVAETEELFNNPIHPYTKSLLSAVPIPDPILERQKELIVYNPEQHDYTEDK
FT                   PTMVEIKPNHFVWANQAEVEKYKAEQ"
FT   rRNA            336540..338089
FT                   /locus_tag="SDEG_0361"
FT                   /product="16S rRNA"
FT   tRNA            338140..338214
FT                   /locus_tag="SDEG_0362"
FT                   /product="tRNA-Ala"
FT                   /anticodon="(pos:338174..338176,aa:Ala,seq:tgc)"
FT                   /note="codon recognized: GCA"
FT   rRNA            338521..341275
FT                   /locus_tag="SDEG_0363"
FT                   /product="23S rRNA"
FT   rRNA            341370..341486
FT                   /locus_tag="SDEG_0364"
FT                   /product="5S rRNA"
FT   tRNA            341492..341565
FT                   /locus_tag="SDEG_0365"
FT                   /product="tRNA-Asn"
FT                   /anticodon="(pos:341526..341528,aa:Asn,seq:gtt)"
FT                   /note="codon recognized: AAC"
FT   tRNA            341649..341722
FT                   /locus_tag="SDEG_0366"
FT                   /product="tRNA-Arg"
FT                   /anticodon="(pos:341683..341685,aa:Arg,seq:acg)"
FT                   /note="codon recognized: CGT"
FT   CDS_pept        343571..344155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0367"
FT                   /product="putative lipase"
FT                   /note="similar to putative lipase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80869"
FT                   /db_xref="GOA:C5WEQ4"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ4"
FT                   /inference="similar to AA sequence:RefSeq:YP_059606.1"
FT                   /protein_id="BAH80869.1"
FT                   /translation="MLFELKYGKIESTNYFGDDMSIDDYRPTYTVEAVYDLRANDLLRQ
FT                   GISAVLVDLDNTLIAWNNPDGTPEVRAWLDEMTIADISVVVVSNNNHARVERAVSRFGV
FT                   DFISRAMKPFAYGIDKAIDRYGFDREEVIMVGDQLMTDIRASHRAGIKSVLVKPLVASD
FT                   AWNTKINRWRERRVMAKLEEKYGKLSYQKGI"
FT   CDS_pept        344155..345273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0368"
FT                   /product="GTP-binding protein"
FT                   /note="similar to GTP-binding protein [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80870"
FT                   /db_xref="GOA:C5WEQ5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019988"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ5"
FT                   /inference="similar to AA sequence:RefSeq:YP_059607.1"
FT                   /protein_id="BAH80870.1"
FT                   /translation="MEELFCIGCGIQIQTEDKEKAGFTPAAALKKGMETGELYCQRCFR
FT                   LRHYNEITDVHITDDEFLRLLHEVGDSDALVVNVIDIFDFNGSIIPGLSRFISGNDVLL
FT                   VGNKKDILPKSVKDGKVTQWLTERAHEEGLRPLDVMLTSAQNKYAIKDLIERINELRNG
FT                   RDVYVVGVTNVGKSTLINAIIQEITGDKDVITTSRFPGTTLDKIEIPLDDGSFIFDTPG
FT                   IIHRHQMAHYLSPKELKIVSPKKEIKPKTYQLNPEQTLFLGGLSRFDFINGERQGFTAF
FT                   FDNQLELHRTKLAGADAFYDKHVGTLLTPPGKKELTAFPKLVRHEFTIDQKMDIVFSGL
FT                   GWIRVNVQKDSKAIVAAWAPEGVAVIVRKAII"
FT   CDS_pept        345218..345607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0369"
FT                   /product="hypothetical RNA binding protein"
FT                   /note="similar to hypothetical RNA binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80871"
FT                   /db_xref="GOA:C5WEQ6"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059608.1"
FT                   /protein_id="BAH80871.1"
FT                   /translation="MLHGLLKASLSLFVKRLFKNKKRSWKKMLTSKQRAFLKSEAHSLK
FT                   PIIQIGKNGLNDHIKTSIRQALDARELIKVTLLQNTDEDIHEVAEILEEEIGCDTVLKI
FT                   GRILILYKVSAKKENRKLSPKVKAI"
FT   CDS_pept        345676..346308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="SDEG_0370"
FT                   /product="nicotinic acid mononucleotide adenyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="similar to nicotinic acid mononucleotide
FT                   adenyltransferase [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80872"
FT                   /db_xref="GOA:C5WEQ7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059609.1"
FT                   /protein_id="BAH80872.1"
FT                   /translation="MALELLTPFTKVELEEEKKESNRKQIGILGGNFNPIHNAHLVVAD
FT                   QVRQQLGLDQVLLMPECKPPHVDAKETIDEKHRLRMLELAIEDVEGLAIETCELERQGI
FT                   SYTYDTMLYLTEQHPDVDFYFIIGADMVDYLPKWHRIDELVKLVQFVGVQRPKYKAGTS
FT                   YPVIWVDLPLMDISSSMIRDFIKKGRQPNYLLPKRVLDYITQEGLYQ"
FT   CDS_pept        346305..346898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0371"
FT                   /product="HAD superfamily hydrolase"
FT                   /note="similar to hydrolase (HAD superfamily)
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80873"
FT                   /db_xref="GOA:C5WEQ8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ8"
FT                   /inference="similar to AA sequence:RefSeq:YP_059610.1"
FT                   /protein_id="BAH80873.1"
FT                   /translation="MTYEDYLPYSRTELLAKIAEQMSPKRFKHVLGVEKAALSLAECYG
FT                   CNPDKAGLAALLHDYAKECSDQVFLDLIDKYQLSPELAKWNNNVWHGMVGIYKIQEDLG
FT                   LQDKEILRAIEIHTVGAAEMTLLDKILYVADYIEEGRIFPLVDDARKIAQLDLDKAVAY
FT                   ETVNTVAYLASKAQPIFPQTLDTYNAFCSYLKEK"
FT   CDS_pept        346874..347134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0372"
FT                   /product="isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="similar to isochorismatase [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80874"
FT                   /db_xref="GOA:C5WEQ9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEQ9"
FT                   /inference="similar to AA sequence:RefSeq:YP_601753.1"
FT                   /protein_id="BAH80874.1"
FT                   /translation="MQLFKGEVIEKGIDNLVMIGMLTNYCMDMTVRVAFELGYEVSVIE
FT                   HGSTTFDDEDIQASLLIDYHESLWDGNFARVEPLDVILNEE"
FT   CDS_pept        347124..347489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0373"
FT                   /product="iojap protein family"
FT                   /note="similar to iojap protein family [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80875"
FT                   /db_xref="GOA:C5WER0"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER0"
FT                   /inference="similar to AA sequence:RefSeq:YP_059611.1"
FT                   /protein_id="BAH80875.1"
FT                   /translation="MRNKMKKEELLEIVVKAADEKRAEDMLALDLEGLTSLTDYFVIAS
FT                   ATNSRQLEAIADNIREKVKEAGGDASHIEGDSQAGWVLLDLTDVVVHIFSEDERYHYNL
FT                   EKLWHEAPAVALDAYLA"
FT   CDS_pept        347525..348280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0374"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="similar to methyltransferase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80876"
FT                   /db_xref="GOA:C5WER1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER1"
FT                   /inference="similar to AA sequence:RefSeq:YP_059612.1"
FT                   /protein_id="BAH80876.1"
FT                   /translation="MRMIMEHNYEKFASVYDAVMDDSLYDLWTDFSLRHLPKSKGRNRL
FT                   LELACGTGIQSVRFAQAGFDVTGLDLSQDMLTIAEKRAQSAKKKIDFIQGNMLDLSQVG
FT                   QFDFVTCYSDSICYMQDEPEVGDVFKEVYDVLADDGIFIFDVHSTYQTDECFPGYSYHE
FT                   NADDFAMVWDTYADEAPHSVVHELTFFIQEDDGRFSRFDEVHEERTYELLTYDILLEQA
FT                   GFKSFKVYADFEDKEPTETSRRWFFVAQK"
FT   CDS_pept        348355..349452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0375"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein stu1615
FT                   [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80877"
FT                   /db_xref="GOA:C5WER2"
FT                   /db_xref="InterPro:IPR008513"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER2"
FT                   /inference="similar to AA sequence:RefSeq:YP_140033.1"
FT                   /protein_id="BAH80877.1"
FT                   /translation="MTVTGIIAEFNPFHNGHKYLLEQAQGLTVVAMSGNFMQRGEPALV
FT                   DKWTRAQMALANGADLVVELPFLVSVQSADYFAQGAVAILEKLGIDQLMFGTEDYLDYQ
FT                   SLATIYEAKAEQMAAYVADLPEYLSYPQKTQHMWQAFADVSFTGDKPNHILALAYTKAC
FT                   AGKGIALTPIKRQGAGYHSKNKLHQFASATAIRKHLSDKAFVDKSVPDASLLLTSPQVS
FT                   WDNYFQLLTYQILTHADLTQIVQVNEELANRISAAIRTVETIDELIDQVATKRYTKARV
FT                   RRVLTYILVNAMETSLPEAVHVLGFSDKGRVHLKSLKQRVSIVSRIGSEPWDALTQQAD
FT                   AIYQLGNPAMAEQTWGRWPIMRTEK"
FT   CDS_pept        349555..350268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0376"
FT                   /product="transcriptional regulator MerR family"
FT                   /note="similar to transcriptional regulator MerR family
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80878"
FT                   /db_xref="GOA:C5WER3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER3"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124024.1"
FT                   /protein_id="BAH80878.1"
FT                   /translation="MKTVKEVSQLVGLSVRTLHYYDEIDLLKPTLVGDNGYRFYDDYAL
FT                   AQLQDILLFRELDFPLKTIKTLLYSPAYVQGAALADQIRLLEMRQQHLQELIQHARALQ
FT                   EGGEQMGFKAYDHSHIQAFEEEVKERWGKTDAYVAYATKTAMRPEQLWQDMREIFRGFG
FT                   DIKDQAVSSQAAQKQVAKLQDYISQNLYPCEMEILESLGLMYVSDQRFKETIDQMVGIG
FT                   TATFVSRAISHYCQS"
FT   CDS_pept        350879..352300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0377"
FT                   /product="internalin A-like histidine triad lipoprotein"
FT                   /note="similar to internalin A-like histidine triad
FT                   lipoprotein [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80879"
FT                   /db_xref="InterPro:IPR006270"
FT                   /db_xref="InterPro:IPR023832"
FT                   /db_xref="InterPro:IPR037228"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER4"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124130.1"
FT                   /protein_id="BAH80879.1"
FT                   /translation="MTDESQIESKTATGIIVKHDGHSHFFFYSDLKGSKWDYLIPKGYK
FT                   DTSRQETTSAATSKASTTGHHGDAHASDGYVFNPNDIVSEDVNGYTVRHGDHYHYIWKK
FT                   DLVVTARPTVQQGPQQSPSTNSSSAHHKDNKQSNGSENGNHHDNIGSQHNHVDPLGAYR
FT                   VNAEGKKEFSGIHYATSDDFLFDGKHIIGNTADGLLVAHNGRKEDVHLVPYAQLVDSKW
FT                   AHLIPEDKRQQAEKHYHGEADETPKTSEKGQVMTGEDFVNQAKDLDPKLQRIILDKIER
FT                   VFRTNAGRSKEELLPLIKIDLENNLFTYPHDDHSHMEPIDASKPFGNGDKIYDFVDYNL
FT                   PGKPELEKHDVIGPISTNTNSSRDLDKKKLLETHPELKEQILDINSFYTLSFLAQDSGG
FT                   QEGYIKQPGSLRVGSQETQAVTYLIKKGQTINNLKIEVPTPLAKEQYFFKKWSSQLPTD
FT                   GKLEKDLVLTAALPS"
FT   CDS_pept        352353..353300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0378"
FT                   /product="hypothetical protein"
FT                   /note="no hit"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80880"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER5"
FT                   /protein_id="BAH80880.1"
FT                   /translation="MNIGDYSVVNFTTLNHGKLNYKGNSLAGFSFRVRNDLTWKSVLDS
FT                   GFIFPTPVPNDDNIEFIRWGGSVDFPEGAAVNNKVEASIFLAKFGLKRPIIGAYVPSDA
FT                   KNPTKTDDPKRLHPNSVTDPYDESKYMTIVIDAGEHATLRTYSTESRQLAFVVRQGTTW
FT                   DEFAKTLVKVAVIPEKGYVYKGHDLALSKGSDKVQPGVYKEIVVEQASDKDKKPSQDNW
FT                   LDEFTKAEEKDTPEKTDGAKPGKEAEAEKPVGPKSETNSPEKADKEPQNATPISPSTDQ
FT                   EKPNKWHLGDDEPVSGEPPPLPPVSEEDGDDLLP"
FT   CDS_pept        353464..354390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="SDEG_0379"
FT                   /product="biotin synthetase"
FT                   /EC_number="2.8.1.6"
FT                   /note="similar to biotin synthetase [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80881"
FT                   /db_xref="GOA:C5WER6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER6"
FT                   /inference="similar to AA sequence:RefSeq:NP_687494.1"
FT                   /protein_id="BAH80881.1"
FT                   /translation="MNKTEALAILTSGADWWQYYAQAILVKQEKSGNRIRLNTLLNAKS
FT                   GLCSEDCGYCAQSKDSKAPINRYGLLPKDEIIRKALIAKKNKSSIFCIALSGTRPITRE
FT                   IALLCDAIQEIKHAMDMEICLSIGLVTKEQIQLLKEAGVDRLNHNINTPRENYDKITTT
FT                   HTYQDRVDTLEMLNEIGVDTCSGFICGMGETDQQLVDMAFELKALGPYSVPVNFLLPID
FT                   GTKLEGHHQLTPTKCLKILVMLRLLFPETELRVSAGREYHLGELQQMALLIVDSIFLGN
FT                   YLTEKGADISDDQKMIDQLGLAVEGVC"
FT   CDS_pept        354559..355275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0380"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy0297
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80882"
FT                   /db_xref="GOA:C5WER7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026562"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059615.1"
FT                   /protein_id="BAH80882.1"
FT                   /translation="MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGDPDPELNT
FT                   ALKFVIDRAKQAQVPKHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVN
FT                   RTAANVRTAYGKNGGNMGAAGSVSYMFDKKGVIVFAGDDADSIFELLLEADVEVDDVEA
FT                   EEGTITVYTAPTDLHKAILALRESGIAEFQVTELEMIPQSEVTLEGDDLATFEKLVDAL
FT                   ESDDDVQKVYHNVADF"
FT   CDS_pept        355483..356325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0381"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="similar to ABC transporter substrate-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80883"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER8"
FT                   /inference="similar to AA sequence:RefSeq:YP_059616.1"
FT                   /protein_id="BAH80883.1"
FT                   /translation="MIKKQYLGMATITLASTLVLAACGSSKTAESGNQGSSKEVLFATV
FT                   GTTAPFSYEKGGQLTGYDIEVAKAVFKGSDDYKVSFKKTEWSSIFTGLDSGKYQMGGNN
FT                   ISFTKERSAKYLFSYPIGSTPSVLVVPKDSDIKSFDDIQGHTTQVVQGTTSVAQLEDFN
FT                   KKHSDNPVTLKFTNENITQMLTNLSEGKADFKIFDAPTVNAIIKNQGLDNLKTIELTST
FT                   EQPFIYFIFSQDQEKLQSFVNKRIKELTADGTLSKLAKEHLGGDYVPSDKELKLPTAN"
FT   CDS_pept        356480..357334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0382"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="similar to ABC transporter substrate-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80884"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C5WER9"
FT                   /inference="similar to AA sequence:RefSeq:YP_059617.1"
FT                   /protein_id="BAH80884.1"
FT                   /translation="MTIKRFVTILGVTACAGLVLTACPGKKEDAKTVTVGLMTKTASDE
FT                   ARWDKIEETLKKDGIKLVYKEFTDYSQPNKAVASGEVDINAFQTYNYQDNWNKENKGNL
FT                   VTIAETYISPLNLFSGTDQAGKAKYQSVDDLPKGAQIAIQNDATNASRALFVLQGAGLI
FT                   TLNVSSDKLASQANIVENKKDITIKELDASQTARALKSVDAAIVNNNYAVPAKLDYKSS
FT                   LYKEKADENAKQWFNILTGKKGWEKSPKAKAIKALVKAYQTDEVKKIIIKTSNGVDLPV
FT                   WDK"
FT   CDS_pept        357512..358357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0383"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="similar to ABC transporter substrate-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80885"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES0"
FT                   /inference="similar to AA sequence:RefSeq:YP_059617.1"
FT                   /protein_id="BAH80885.1"
FT                   /translation="MTLKKVIGLVGIALASTVLVACSGQQDDKNTLTIGVMTKTSSDQA
FT                   RWDKVEELLKKDKITLKYKEFTDYSQPNKAVANGEVDINAFQHYNFLNNWNKENKEHLV
FT                   AIADTYISPINLFSGTSQDGKAKYKSVADLPNGAQIAVPNDATNESRALYVLQSAGLIK
FT                   LNVSGDQLATIANISENKKKLDIKELDASQTARALVSADAAIVNNSYAVPAKIDYKTSL
FT                   FKEKADDNSKQWINIIAGQKDWEKSEKADAIKKLIKAYQTDDVKKVVDKTSNGVDVPVW
FT                   "
FT   CDS_pept        358432..359805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="SDEG_0384"
FT                   /product="acetylornithine deacetylase"
FT                   /function="amino acid transport and metabolism"
FT                   /EC_number="3.5.1.18"
FT                   /note="similar to acetylornithine deacetylase
FT                   /succinyl-diaminopimelate desuccinylase (M20/M25/M40 family
FT                   peptidase), putative [Streptococcus sanguinis SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80886"
FT                   /db_xref="GOA:C5WES1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001034582.1"
FT                   /protein_id="BAH80886.1"
FT                   /translation="MEMSTIEEQLKDCWEHPITKDYLVVLRQLIAHRSIFAQQLGLEET
FT                   AQFLKEIFSAAGAQVIVDQSYAAPFVLATFKSPRPDAKTVIFYQHYDTVPADSDQKWSS
FT                   DPFTLTEREGHLYARGVDDDKGHIIARLTALVKYLSQAQTLPVTIVFMMEGAEESASVD
FT                   LEKYLKKYARNLQEADLLIWEQGIRNEQDQLELTGGNKGILTFDMTVESAKLDIHSKYG
FT                   GVIDSATWYLLEAIASLRDRNGRLLVPAIYEQVQEPTKRELDLIEIYAIELLDDLKKLY
FT                   GLELPMLQSERRDFLKTYYYQPSIGIQGIQSGYQGQGVKTIIPSQASAKMEVRLVPGLD
FT                   PKIVFEQIQTHLLDKGFDKVNVTYTLGEKSYRSDLSAPAIQQVIDVAKPLYPKGLSLLP
FT                   TSAGTGPMHTVFEALGVPIVAFGLGHTNSRDHAGDENIAIADYCRHIVLIEELLKSYE"
FT   CDS_pept        359798..360862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0385"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="similar to ABC transporter ATP-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80887"
FT                   /db_xref="GOA:C5WES2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES2"
FT                   /inference="similar to AA sequence:RefSeq:YP_059618.1"
FT                   /protein_id="BAH80887.1"
FT                   /translation="MNEAIIQLDHIDITFHQKKRVIEAVKDVTVHINQGDIYGIVGYSG
FT                   AGKSTLVRVINLLQAPTNGKITVDGDVTFEQGKVQLSANALRQKRRDIGMIFQHFNLMA
FT                   QKTAKENVAFALRHSSLSKTEKEHKVIELLELVGLSERADNYPAQLSGGQKQRVAIARA
FT                   LANDPKILISDEATSALDPKTTKQILALLQELNRKLGLTIVMITHEMQIVKDICNRVAV
FT                   MQNGVLIEEGSVLDIFSDPKEALTQEFITTATGIDEALEKINQQDIVKHLPADALLAQL
FT                   KYAGTSTDEPLLNSIYRQFEVTANILYGNIEILDHVPVGEMIVVLEGNAANIAAAEKAL
FT                   HEAGVDVSILKRGA"
FT   CDS_pept        360863..361555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0386"
FT                   /product="ABC transporter permease protein"
FT                   /note="similar to ABC transporter permease protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80888"
FT                   /db_xref="GOA:C5WES3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059619.1"
FT                   /protein_id="BAH80888.1"
FT                   /translation="MTQLIQTYLPNVYELGWSGDAGWGLAIWNTLYMTIVPFIVGGTIG
FT                   LFVGLLLVLMGPGGVIENKLACWIIDKITSIFRAIPFIILIAILASFTYLIMGTILGAT
FT                   AALVPLTFATFPFFARQVQVVFSELDKGVIEAAQASGATFWDIVKVYLSEGLPDLIRVS
FT                   TVTLISLVGETAMAGAIGAGGLGNVAISYGYNRFNNDVTWVATIIILLIIFAIQFIGDS
FT                   LTRRFSHK"
FT   CDS_pept        complement(361609..362979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0387"
FT                   /product="branched-chain amino acid transport system
FT                   carrier protein"
FT                   /note="similar to Branched-chain amino acid transport
FT                   system carrier protein [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80889"
FT                   /db_xref="GOA:C5WES4"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES4"
FT                   /inference="similar to AA sequence:RefSeq:YP_059620.1"
FT                   /protein_id="BAH80889.1"
FT                   /translation="MKQKNVYIVIGFMLFALFFGAANLIYPAFLGIYSGHNILWSIIGF
FT                   CLTGVSLPLLGVIAVAKSGSDDVESLARPISKWYAIFYSSVLYLSIGPFFAIPRTGATS
FT                   FSVGIAPILGDNFTNKAIYAVLFFGLSYFLAIRPSKLAENIGKFLTPTLLVVIAILVIA
FT                   SFVHSAGDYGNAFNAGIGVNNAFKDLPFIAGLIQGYGTMDALASLVFAILVIEATKQFG
FT                   AKTDKEVTKVTLISGTIAIFLLAFVYIFVGRIGATSQSLFPFIDGSFTLDGSPVNGGQI
FT                   LSHASRFYLGSIGQAFLAIVIFLACLTTSTGLITSSAEYFHKLVPALSHIVWSTIFTLV
FT                   SAFFYFGGLSVIINWSAPVLFLLYPLTVDLIFLVLAQKYFNNDPIVYRTTIGLTIIPAI
FT                   FDALSTLSQMTGLFNLPEPVTTFFQKTVPLGQFSMGWIIFAIIGFLLGLILSKTKKS"
FT   CDS_pept        363220..364434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0388"
FT                   /product="serine/threonine sodium symporter"
FT                   /note="similar to serine /threonine sodium symporter
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80890"
FT                   /db_xref="GOA:C5WES5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES5"
FT                   /inference="similar to AA sequence:RefSeq:YP_059621.1"
FT                   /protein_id="BAH80890.1"
FT                   /translation="MKKVCELWVRVSLIKKIGIGVVIGVILGLLVPDFTGLSILGKLFV
FT                   GGLKAIAPLLVFALVSQAISHQKKGKETNMTLIIVLYLFGTFAAALVAVLTTYLFPLTL
FT                   ILNTPVNTEFSAPQGVAEVFQTLLLKLVDNPINALATANYIGVLSWALVFGLALKAASK
FT                   ETKHLIKTAAEVTSQIVVWIINLAPIGIMSLVFATISENGIGILSDYALLILVLVGTMA
FT                   FIALVINPLIGFVVMRQNPYPLVLRCLRESGITAFFTRSSAANIPVNMQLCEDLGLSKD
FT                   TYSVSIPLGATINMGGAAITINVLTLAAVHTFGIQIDFLTALLLSVVAAVSACGASGVA
FT                   GGSLLLIPVACSLFGISNDLAMQVVGVGFIVGVIQDSCETALNSSTDVLFTAIAENAFW
FT                   KRKQA"
FT   CDS_pept        complement(364492..365166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrA"
FT                   /locus_tag="SDEG_0389"
FT                   /product="potassium uptake protein"
FT                   /note="similar to KtrA [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80891"
FT                   /db_xref="GOA:C5WES6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059622.1"
FT                   /protein_id="BAH80891.1"
FT                   /translation="MLKRKTVGVLGLGIFGRTVARELSNFDQDVIAIDIRESHVKEVAD
FT                   LVTKAAVGDITDKEFLLAVGIEHCDTVVIASGNNLESSVLAVMHCKKLGVPTIIAKAKN
FT                   KIFEEVLYGIGATKVITPERDSGKRVASNLLRRHIESIIYLEHGISMIEFVIPKSWEGQ
FT                   SLSELDVRRKYELNVIGMRQKEVKTLDTNVKPFEPLEPNTIIVAIANDHTFEKFDYLGY
FT                   LK"
FT   CDS_pept        complement(365176..366552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB"
FT                   /locus_tag="SDEG_0390"
FT                   /product="potassium uptake protein"
FT                   /note="similar to KtrB [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80892"
FT                   /db_xref="GOA:C5WES7"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059623.1"
FT                   /protein_id="BAH80892.1"
FT                   /translation="MKRSFIKSLSVTQRLTFSFAIVILIGTLLLSMPFTHYQNGPETVY
FT                   LDHFFNVVSMVCVTGLSVVPVAEVYNGIGQTITMMLMQIGGLGLVTLIAMSTFALKRKM
FT                   RLSDQTLLQSALNRGDSKDLKHYLFFAYKVTFGLEAIAALVIMTDFIPRFGWKNGIFNS
FT                   IFLAISAFCNAGFDNLGNSSLKDFVLNPTLNLIVTFLIISGGLGFAVWVDLGLAVKKFF
FT                   FERPHCYGATFRKLSNQSRLVIQTTTVILVLGTFLSWFLEKDNSKTIANYNLFQQFMVS
FT                   FFQTVTMRTAGFATISYNDTLAPTNILYMIQMVIGGAPGGTAGGIKVTTAAITFLLFKA
FT                   ELSGQSEVTFRNRIIANKTIKQTMTVLIFFFAVLMTGYILLLSVEPNIAPIPLLFESIS
FT                   AIATVGVSMDLTPQLSTAGRLIIIVLMFVGRVGPITVLISLIQRKEKTIQYATTDILVG
FT                   "
FT   CDS_pept        complement(366636..367349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SDEG_0391"
FT                   /product="glucose-inhibited division protein B"
FT                   /note="similar to glucose-inhibited division protein B
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80893"
FT                   /db_xref="GOA:C5WES8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES8"
FT                   /inference="similar to AA sequence:RefSeq:YP_279739.1"
FT                   /protein_id="BAH80893.1"
FT                   /translation="MTPQEFYHTLEEDGFPLTMKQKEQFDTYFKLLVEWNNKINLTAIT
FT                   EENDVYLKHFYDSIAPILQGFLANEPIRLLDIGAGAGFPSLPMKILFPNLEVTIIDSLN
FT                   KRIAFLTHLAESLALDKVHFFHGRAEDFGQDKDFRAQFDVVTARAVARMQVLAELTIPF
FT                   LKIGGRLIALKAQAADQELEDAKTALSLLFGKVTTNHHYQLPNGDARYITVVEKKKETP
FT                   NKYPRKAGLPNKKPL"
FT   CDS_pept        367502..368059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="SDEG_0392"
FT                   /product="putative cytoplasmic membrane protein"
FT                   /note="similar to LemA [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80894"
FT                   /db_xref="GOA:C5WES9"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C5WES9"
FT                   /inference="similar to AA sequence:RefSeq:YP_059625.1"
FT                   /protein_id="BAH80894.1"
FT                   /translation="MPTVLIILVVLGLLALWLMVSYNSLVKSRMHTKEAWSQIDVQLKR
FT                   RNDLIPNLIETVKGYANYEQKTFEKITDLRARVANASTPQETMAASNELSKQVTHLFAV
FT                   AENYPDLKANENFLKLQEELTNTENKISYSRQLYNSTTSNYNLKLESFPSNIAGKLFGF
FT                   KPSEFLQTPEAEKEVPKVEFNF"
FT   CDS_pept        368106..368999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0393"
FT                   /product="heat shock protein"
FT                   /note="similar to heat shock protein HtpX [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80895"
FT                   /db_xref="GOA:C5WET0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET0"
FT                   /inference="similar to AA sequence:RefSeq:YP_059626.1"
FT                   /protein_id="BAH80895.1"
FT                   /translation="MLYQQISQNKQRTVVLLVVFFALLALIGASAGYLLVDNYVIGVTL
FT                   ALIIGAIYAVSMIFQSTTLVMSMNSAREISESEAPDFYHIVEDMAMVAQIPMPRVFIIE
FT                   DPSLNAFATGSSPKNAAVAATTGLLQVMNREELEGVIGHEVSHIRNYDIRISTIAVALA
FT                   SAVTLISSIGGRALWYGGGSRKRSNNNDGGLGIILLLLSLLSLVLAPLVASLVQLAISR
FT                   QREYLADASSVELTRNPQGMIRALEKLKQSQPVKYPVDDASAALYINEPRKKGSFSSLF
FT                   STHPPIEERIERLQHM"
FT   CDS_pept        369263..369799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0394"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80896"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET1"
FT                   /inference="similar to AA sequence:RefSeq:YP_059627.1"
FT                   /protein_id="BAH80896.1"
FT                   /translation="MMLILSEIRKRPDGLHFDQVCDVKEKLLERDPQILDLKDVRVVGD
FT                   VHYDAGLYLLHYQLSYEVTLPSSRSMTPVSLKEVQDVQELFIEATDVAGKQDMVDDQLV
FT                   LVLEEDNIDLDESIVDNILLAIPLQVLTEEEKQYQELPTGQDWTVLTEDQYQSLKEEKQ
FT                   KENNPFASLQGLFDE"
FT   CDS_pept        370069..370755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covR"
FT                   /locus_tag="SDEG_0395"
FT                   /product="response regulator"
FT                   /note="similar to response regulator CsrR [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80897"
FT                   /db_xref="GOA:C5WET2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET2"
FT                   /inference="similar to AA sequence:RefSeq:YP_059628.1"
FT                   /protein_id="BAH80897.1"
FT                   /translation="MTKKILIIEDEKNLARFVSLELQHEGYEVTVEVNGREGLETALEK
FT                   DFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMTARDSIMDVVAGLDRGADDYIVKPF
FT                   AIEELLARIRAIFRRQDIESEKKTPSQGIYRDLVLNPQNRSVNRGDDEISLTKREYDLL
FT                   SILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMG
FT                   YVIREK"
FT   CDS_pept        370761..372260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="covS"
FT                   /locus_tag="SDEG_0396"
FT                   /product="transmembrane histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /note="similar to transmembrane histidine kinase CsrS
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80898"
FT                   /db_xref="GOA:C5WET3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041610"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059629.1"
FT                   /protein_id="BAH80898.1"
FT                   /translation="MVKQKQKKYKKSLPKRLSNIFFVLFFCIFSIFTLIAYSSTNYFLL
FT                   KKERQSVFQAVNIVRVRLSEVDSNFTLENLAEVLYKNDKTHLRIDDRNGSRVIRSERDI
FT                   TNTLDANQDIYVYNVDKQMIFTTDNEEASPGLRGPIGKVFHDHIEDQYRGFSMTQKVYS
FT                   NRTGKFVGYVQVFHDLGNYYVIRARLLFWLLVVELFGTSLAYLIILIATRRFLKPLHNL
FT                   HEVMRNISENPNNLNLRSDISSGDEIEELSVIFDNMLDKVETHTKLQSRFISDVSHELR
FT                   TPVAIIKGHIGLLQRWGKDDSDILEESLTATAHEADRMAIMINDMLDMIRVQGSFEGHQ
FT                   NDTTVLENSIETVIGNFRVLREDFEFTWHSENNETVARIYKNHFEQALVILIDNAVKYS
FT                   RQDKKISIDLKVNDKQEAIVRIQDKGEGISKEDIKHIFERFYRTDKSRNRTSTQAGLGI
FT                   GLSILKQIVDGYHLQMEVESELNQGSVFILHIPLAVSKDNQ"
FT   CDS_pept        372466..372960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="SDEG_0397"
FT                   /product="helicase loader"
FT                   /note="similar to ribonucleotide reductase transcriptional
FT                   regulator NrdR [Streptococcus equi subsp. zooepidemicus
FT                   MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80899"
FT                   /db_xref="GOA:C5WET4"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET4"
FT                   /inference="similar to AA sequence:RefSeq:YP_002124008.1"
FT                   /protein_id="BAH80899.1"
FT                   /translation="MRCPKCNYNKSSVVDSRQAEDGNTIRRRRECEKCHTRFTTFERVE
FT                   ELPLLVIKKDGTREQFSRDKILNGVVQSAQKRPVSSTDIENLISRIERTVRTTYENEVS
FT                   STIIGNLVMDELAELDEITYVRFASVYKSFKDVDEIEELLQQITTRVRGKKKSSLNDET
FT                   H"
FT   CDS_pept        372944..374122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="SDEG_0398"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="replication initiation/membrane attachment
FT                   protein[DNA replication recombination and repair]; COG3611"
FT                   /note="similar to replicative DNA helicase [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80900"
FT                   /db_xref="GOA:C5WET5"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET5"
FT                   /inference="similar to AA sequence:RefSeq:YP_279746.1"
FT                   /protein_id="BAH80900.1"
FT                   /translation="MMKPIDTFTYLKRNKVSCDATSLIQLYFPIIGSDATAVYQYFLHF
FT                   FDDGARAHKFSDVLNHLQFGMKRFEDAMVMLTAMDLVVLYQLPDAYLVKLQQPLGHEAF
FT                   LKEPVYSRLLEQKIGESAVSELQLAIPNQARNISKRFSDVFGTDGLSPKTSQSARKTFD
FT                   LDSFQQLMTRDGLQFEDSQKDVISLYSISEQYEMNWFDTYQLAKATAVNGKIQPKRLLV
FT                   KKQQAAKEPSNDTFSQAEQVILREAKQDSSLIFLEKIKKARRATVTKDEKTLLQTLAKM
FT                   SFLDDVINVMVLYTFNKTKSANLQKSYLMKIANDFSYQQVSTAEEAMLALRAFTDRQGS
FT                   RQAKPKTSQQTNVPKWSNPNYQETTSQEEQAKLDQFKQAALKRLENLRKGGD"
FT   CDS_pept        374123..375025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaI"
FT                   /locus_tag="SDEG_0399"
FT                   /product="primosomal protein"
FT                   /note="similar to primosomal protein DnaI [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80901"
FT                   /db_xref="GOA:C5WET6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR009928"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059632.1"
FT                   /protein_id="BAH80901.1"
FT                   /translation="MEKIGDTMAKLGQNSRVNSDQLIQTILADPEVADFISRHHLSQEQ
FT                   INLSLSKFNQFLVERQKYQLKDDSYIAKGYQPILAMNEGYADVSYLETKELVEAQKQAA
FT                   ISERIQLVSLPKSYRHIHLSDIDVNNASRMEAFSAILDFVEQYPSVEQKGLYLYGDMGI
FT                   GKSYLLAAMAHELSEKKGVSTTLLHFPSFAIDVKNAISNGSVKEEIDAVKNVPVLILDD
FT                   IGAEQATSWVRDEVLQVILQYRMLEDLPTFFTSNYSFADLERKWATIKGNDETWQAKRV
FT                   MERVRYLAREFHLEGVNRR"
FT   CDS_pept        375088..376398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="SDEG_0400"
FT                   /product="GTP-binding protein"
FT                   /note="similar to GTP-binding protein EngA [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80902"
FT                   /db_xref="GOA:C5WET7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059633.1"
FT                   /protein_id="BAH80902.1"
FT                   /translation="MVLPTVAIVGRPNVGKSTLFNRIAGERISIVEDVEGVTRDRIYAT
FT                   GEWLNRQFSLIDTGGIDDVDAPFMEQIKHQAQIAMEEADVIVFVVSGKEGVTDADEYVS
FT                   KILYRTNTPVILAVNKVDNPEMRNDIYDFYSLGLGDPYPVSSVHGIGTGDVLDAIVENL
FT                   PVEEVEENDDIIRFSLIGRPNVGKSSLINAILGEDRVIASPVAGTTRDAIDTHFTDADG
FT                   QEFTMIDTAGMRKSGKIYENTEKYSVMRAMRAIDRSDVVLMVINAEEGIREYDKRIAGF
FT                   AHEAGKGMIIVVNKWDTIDKDNHTVAQWEADIRDQFQFLAYAPIIFVSALTKQRLNKLP
FT                   ELIKRISDSQNKRIPSAVLNDVIMDAIAINPTPTDKGKRLKIFYATQVAVKPPTFVIFV
FT                   NEEELMHFSYLRFLENQIRAAFTFEGTPIHLIARKRK"
FT   CDS_pept        376615..379713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="snf"
FT                   /locus_tag="SDEG_0401"
FT                   /product="SWF/SNF family helicase"
FT                   /note="similar to SWF/SNF family helicase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80903"
FT                   /db_xref="GOA:C5WET8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR013663"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET8"
FT                   /inference="similar to AA sequence:RefSeq:YP_059634.1"
FT                   /protein_id="BAH80903.1"
FT                   /translation="MDMARLIPGRIRNEGIELYEQGLVRILDDHEGLLQAEVGPYHVQY
FT                   GADDEDVTCQCDVFEARQYCKHIAAVEYFLKNDEEGKRFSEQLSDQTEHKAETQKMTSF
FT                   GSLFLDSLAMNDDDTIKYRLSTLGSRSPFSSDYWWSLKINRLPDDRSYVIRDIKGFLQL
FT                   VKKEGFYQIGKNYFEQLSWLQFDQPSQELIDFLWRLSSDTDKGEQDNVFPNHGRHLRLP
FT                   SGFFEEGIHLLTGLYDFSFEGPSQTYHHLFVRPLDAEAGLYHFKVEVHRQSIELQITEK
FT                   NVQYFFDNAYLLYQDTFYHLSLKQAKMVQAIRSLPINADLAKHIHFHLDDQAKLAASLL
FT                   EFKQIGSVEAPKSFTIRDFDVTFQFDLVGQDEISCQLLFDYGHYQVTDKATLDQLPFAS
FT                   NYKKEEKINRSLRAFGFSPQFYSKKRLSSKAELYAFFTEMVPYVERIGTVVLSSSLEGL
FT                   RSKERPQIAIERKGGLLDISFDFSTIVEDDIDDALTALFQNNSYFVSQSGQLVVFDEET
FT                   QKVSHSLRELRAKHLKNGHMQLDGIAALQVSQLFEGMSSVHLSKELEELVHHLQHPETF
FT                   AIKPLSVQAQVRDYQRQGIQWLSMLDHYGFGGILADDMGLGKTLQTIAFLSSQLKPDSK
FT                   VLILSPSSLIYNWLDECQKFTPQLDAVVSYGLKQVRDHLIEEGHQITITSYSSFRQDFE
FT                   TYQAFEYDYLILDEAQVIKNAQTKIAQCLRAFNAKNCFALSGTPIENKLLEIWSIFQIV
FT                   LPGLLPAKKEFLKMTAKQVSRYIKPFIMRRKKEDVLPELPNLIEMTYPNEMTDSQKAIY
FT                   LAQLRQMQDQIRTASDADINRRKIEILSGITRLRQICDTPSLFMDYDGESGKLESLRTL
FT                   LLQIKENGHRALIFSQFRGMLDLAKQEMDALGLTAYQMTGSTPANERQEMTRAFNNGSK
FT                   DAFLISLKAGGVGLNLTGADTVVLIDLWWNPAVEMQAISRAHRIGQEDNVEVYRLITRG
FT                   TIEEKILELQESKRNLVTTVLDGNESRANMSIEEIKEILGLEI"
FT   CDS_pept        379954..380559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0402"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spyM18 0396
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80904"
FT                   /db_xref="UniProtKB/TrEMBL:C5WET9"
FT                   /inference="similar to AA sequence:RefSeq:NP_606644.1"
FT                   /protein_id="BAH80904.1"
FT                   /translation="MTNTQFPLVADGVPIIDTAKQMALYENEDLITNIHGYYQDKDYDD
FT                   VTKNYQFADQVMSHQSSSSHQRLQTINEGRSYAKEARKKAKQDLKEKRQAYLAKEMTYV
FT                   PKQVPKTKRPAESVLPKQRPETEMSRFTEKLHQEDYILAELPREYKEPDNPSHQGSAKK
FT                   NNYDFLKRSQIYNNKETREQREKTIAQELNLSRFEDLE"
FT   CDS_pept        380603..381934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SDEG_0403"
FT                   /product="UDP-N-acetylmuramate-L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="similar to UDP-N-acetylmuramate-L-alanine ligase
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80905"
FT                   /db_xref="GOA:C5WEU0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU0"
FT                   /inference="similar to AA sequence:RefSeq:YP_059636.1"
FT                   /protein_id="BAH80905.1"
FT                   /translation="MSKTYHFIGIKGSGMSALALMLHQMGHKVQGSDVEKYYFTQRGLE
FT                   QAGITILPFSEDNITEDMELIVGNAFREDNNNEVAYAIQHELPFKRYHEFLGDFMKQFI
FT                   SFGVAGAHGKTSTTGLLSHVLKNITDTSYLIGDGTGRGSANAQYFVFESDEYERHFMPY
FT                   HPEYSIITNIDFDHPDYFTGIDDVRSAFNDYAKQVKKALFVYGEDQELKKITANAPIYY
FT                   YGFEEGNDFVASDIARTTHGSDFTVKHDGQIIGRFHVPAYGRHNILNATAVIANLFVAG
FT                   IDMELVAEHLKTFSGVKRRFTEKLINETIIIDDFAHHPTEIVATIDAARQKYPNKEIVA
FT                   IFQPHTFTRTIALLDDFALALNEADSVYLAQIYGSAREVDKGEVKVEDLAAKLTKPAKI
FT                   VTVDNVSPLLDHDNAVYVFMGAGDIQLYERSFEELLANLTKNNQ"
FT   CDS_pept        381978..382463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0404"
FT                   /product="putative arylalkylamine n-acetyltransferase"
FT                   /EC_number="2.3.1.87"
FT                   /note="similar to putative arylalkylamine
FT                   n-acetyltransferase [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80906"
FT                   /db_xref="GOA:C5WEU1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU1"
FT                   /inference="similar to AA sequence:RefSeq:NP_606646.1"
FT                   /protein_id="BAH80906.1"
FT                   /translation="MMLIRQVQEADWETIAAIERDNFSPQEAATKEAIGERIRLIPDTF
FT                   LVALIDQKIVGYIEGPVMAKPILEDHLFHHVKSNPVSGGYIAITSLSIDKAFQQQGIGI
FT                   ALLAAMKDLAVAQRRDGIILTCHDYLIPYYEMNGFHNQGLSESEHGGAIWYQMFWHT"
FT   CDS_pept        382575..384182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0405"
FT                   /product="aminodeoxychorismate lyase family"
FT                   /EC_number="4.1.3.38"
FT                   /note="similar to aminodeoxychorismate lyase family
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80907"
FT                   /db_xref="GOA:C5WEU2"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU2"
FT                   /inference="similar to AA sequence:RefSeq:YP_059638.1"
FT                   /protein_id="BAH80907.1"
FT                   /translation="MALTDFKDDEYKNQQRSFKEQILAELEKANQIRKEKEEELFQKEQ
FT                   EAKEAARRTAQLYAEYKRQDYLKKETATGNPQSDDQLAGDPSLSYPEHQSIPESTEANN
FT                   ETVDKNLETENPPASAADLETSREEVGRQEAFSDMTQEEVRAEKGEAVRRTVNKRQQTD
FT                   RMAKKISTILISSIIIALLAVGLAGTVYVYSALNPVDKNSKEFVQVEIPSGSGNKLIGQ
FT                   ILQKEGLIKNSTVFSFYTKFKNFTNFQSGYYNLQKNMSLEEIAKALQEGGTAEPTKPAL
FT                   GKILIPEGYTIKQIAKAVEHNSKGKDQKAKTPFHEKDFLNLVADETFIQKMVKKYPRLL
FT                   GSIPTKEAAVYRLEGYLFPATYNYYEETTLESLIDDMLAATDATLAPYYDQIAASGKSV
FT                   NDVLTLASLVEKEGSTDDDRRQIASVFYNRLNNGMALQSNIAILYAMGKLGQKTTLAED
FT                   AAIDTTINSPYNIYTNTGLMPGPVDSSGLSAIEATINPASTDYLYFVANVHTGEVYYAK
FT                   TFEEHSANVEKYVNSQIQ"
FT   CDS_pept        384255..384737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SDEG_0406"
FT                   /product="transcription elongation factor"
FT                   /note="similar to transcription elongation factor GreA
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80908"
FT                   /db_xref="GOA:C5WEU3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU3"
FT                   /inference="similar to AA sequence:RefSeq:YP_059639.1"
FT                   /protein_id="BAH80908.1"
FT                   /translation="MAEKTYPMTLTEKEQLEKELEELKLVRRPEVVERIKIARSYGDLS
FT                   ENSEYDAAKDEQAFVEGQISTLETKIRYAEIIDSDAVAKDEVAIGKTVVVQEVGTTDKD
FT                   TYHIVGAAGADIFSGKISNESPIAQALIGKKTGDKVRIESPAATYDVEIISVEKTN"
FT   CDS_pept        complement(384947..385870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0407"
FT                   /product="OxaA-like protein precursor"
FT                   /note="similar to OxaA-like protein precursor
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80909"
FT                   /db_xref="GOA:C5WEU4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU4"
FT                   /inference="similar to AA sequence:RefSeq:YP_059641.1"
FT                   /protein_id="BAH80909.1"
FT                   /translation="MKLKLNRILFSGLALSILFTLTGCVGRDAHGNPKGMIWEFLGKPM
FT                   SYFIDYFANNAGLGYGLAIIIVTIVVRTLILPLGLYQSWKASYQSEKMAFLKPVFEPIN
FT                   KRIKQASSQEEKMAAQTELMAAQRAHGINPLGGIGCLPLLIQMPFFSAMYFAAQYTKGV
FT                   STSTFMGIDLGSRSLVLTAIIAALYFFQSWLSMMAVSEEQREQMKAMMYTMPIMMIVMS
FT                   FSLPAGVGLYWLVGGFFSIIQQLITTYILKPRLHKQIEEEYAKNPPKAYQSTSSRKDVT
FT                   PSQNMEQAILPKKTKSNRNAGKQRKR"
FT   CDS_pept        complement(385953..386264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0408"
FT                   /product="acylphosphatase"
FT                   /EC_number="3.6.1.7"
FT                   /note="similar to acylphosphatase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80910"
FT                   /db_xref="GOA:C5WEU5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU5"
FT                   /inference="similar to AA sequence:RefSeq:YP_059642.1"
FT                   /protein_id="BAH80910.1"
FT                   /translation="MWYNKAKEGLLMKKVRLLVSGRVQGVGFRYATYALALDMGDIYGR
FT                   VWNNSDGTVEILVQSKDSDKIAKFIQEVRKGPSKWAKVTYVDVTMANFEDFQDFRISN"
FT   CDS_pept        386494..387231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0409"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="similar to 23S rRNA methyltransferase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80911"
FT                   /db_xref="GOA:C5WEU6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059643.1"
FT                   /protein_id="BAH80911.1"
FT                   /translation="MVITSKANQLIKQTKKLLQKKHRQHSYLIEGWHLFEEAQQSGQGF
FT                   RHIFVLEELAERVADQEKVVLVSADVLKELTDSPSPQGIIAEVDMPQLAFPTDYQGKYL
FT                   ILEDVQDPGNLGTIIRTADAAGFDGVFLSEKSADVYNSKTLRSMQGSHFHLPIWRTDIY
FT                   KICREMQEHNTPVLATTLSKVSVDYKTVPHQESFALVMGNEGQGISAEMTTLADQLVHI
FT                   TMPGQAESLNVAVAAGILIFSFI"
FT   CDS_pept        387270..387770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0410"
FT                   /product="HAD superfamily hydrolase"
FT                   /note="similar to hydrolase (HAD superfamily)
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80912"
FT                   /db_xref="GOA:C5WEU7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059644.1"
FT                   /protein_id="BAH80912.1"
FT                   /translation="MHYTEDKEYMEHVGHLIAHPRFQKLEGIVQHHHSTRLEHSINVSY
FT                   SSYKLAKRFGWDAKSTARGGLLHDFFYYDWRVTKFNKSHAWVHPRIAVRNAKKLTELNK
FT                   KEEDIILKHMWGATVAFPRYKESYIVTLVDKYWAVKEAATPLMQKWTNRRFLRRKTLQS
FT                   HNR"
FT   CDS_pept        387785..388474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0411"
FT                   /product="integral membrane protein"
FT                   /note="similar to integral membrane protein [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80913"
FT                   /db_xref="GOA:C5WEU8"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU8"
FT                   /inference="similar to AA sequence:RefSeq:YP_059645.1"
FT                   /protein_id="BAH80913.1"
FT                   /translation="MNDHVIYTQSDAGLNQFFAKIYSLVGMGIGLSAFVSYLMLYPFRD
FT                   NLVSIIANQPMVYYGAVIIELILVFVASGAARKNTPAALPLFLIYSALNGFTLSFIIAI
FT                   YTQTTVFQAFVSSAVVFFAMSVLGVKTKRDMTGLRKAMFAALIGIIVASLINLFIGSGM
FT                   MSYVISIISVLIFSGLIASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLL
FT                   RLFGRND"
FT   CDS_pept        389002..389244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0412"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy0328
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80914"
FT                   /db_xref="GOA:C5WEU9"
FT                   /db_xref="InterPro:IPR005359"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEU9"
FT                   /inference="similar to AA sequence:RefSeq:YP_059646.1"
FT                   /protein_id="BAH80914.1"
FT                   /translation="MSTTVWILLLIVALGVGVFGGIFIARKQIEKEIGEHPRLTPEAIR
FT                   EMMSQMGQKPSEAKIQQTYRNIVKQSKAAVAKGKK"
FT   CDS_pept        389421..390218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glr"
FT                   /locus_tag="SDEG_0413"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="similar to glutamate racemase [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80915"
FT                   /db_xref="GOA:C5WEV0"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV0"
FT                   /inference="similar to AA sequence:RefSeq:YP_279761.1"
FT                   /protein_id="BAH80915.1"
FT                   /translation="MMDTRPIGFLDSGVGGLTVVRELMRQLPHEKVVYIGDSARAPYGP
FT                   RPAEQIREYTWDLVRFLLTKNVKMIVFACNTATAVAWEEVKEALDIPVLGVILPGSSAA
FT                   IKSTTKGQVGVIGTPMTIASDIYRQKIQLLAPTVEVASLACPKFVPIVESNEIRSSVAK
FT                   KVVYESLTPLVGKIDTLVLGCTHYPLLRPIIQNVMGPSVKLIDSGAECVRDISVLLNYF
FT                   EINGSRCQEKVKHHFYTTASPEIFQEIASVWLNQKIDVEHVTL"
FT   CDS_pept        390176..391201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0414"
FT                   /product="xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="similar to xanthosine triphosphate pyrophosphatase
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80916"
FT                   /db_xref="GOA:C5WEV1"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV1"
FT                   /inference="similar to AA sequence:RefSeq:YP_599917.1"
FT                   /protein_id="BAH80916.1"
FT                   /translation="MVKPKNRCGACDLMSEKIYEYKDETNWFIGKMTGHNMITGWGIDR
FT                   EIIKRIDDLLDGIAAMLDWENPKGYDVSVVRYQSPLSLITFIIDMINQETRREIKVIPH
FT                   AGTILLMENGQLLAVYLPEGGVSTDAFFASSTDGFGDTLLIATRNEGKTKEFRRLFGDL
FT                   GYRVENLNDYPELPDVAETGVTFEENARLKAETISRLTGKMVLADDSGLKVDALGGLPG
FT                   VWSARFSGPDATDDSNNAKLLHELAMVFDQKDRSAQFHTTLVVAAPDKDSLVVEAEWPG
FT                   YIATQPKGDNGFGYDPLFIVGETGRHAAELEADEKNHLSHRGQAVRKLMEVFPIWQAKQ
FT                   S"
FT   CDS_pept        391180..391701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0415"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spyM18 0413
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80917"
FT                   /db_xref="GOA:C5WEV2"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV2"
FT                   /inference="similar to AA sequence:RefSeq:NP_606657.1"
FT                   /protein_id="BAH80917.1"
FT                   /translation="MASKTIIVMSDSHGDRDIVQAIKDKYLGQVDAIFHNGDSELKSSD
FT                   PIWDGIYVVGGNCDYDAGYPDDLVTQLDNLTIAQTHGHLYHINFTWDKLDYFAQEAEAD
FT                   LCIYGHLHRPAAWQVEKTIFVNPGSVSQPRGEVNEKLYARIDVTDTTIRVNYFTRQHEL
FT                   YPLLSKEFKR"
FT   CDS_pept        391698..392159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0416"
FT                   /product="CBS domain containing protein"
FT                   /note="similar to CBS domain containing protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80918"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV3"
FT                   /inference="similar to AA sequence:RefSeq:YP_281670.1"
FT                   /protein_id="BAH80918.1"
FT                   /translation="MIAKEFETFLMSHLDSYLIPAEDLAIFINTHNADHVMLLLVSNGF
FT                   SRVPVITREKKYVGTISISDIMTYQAQGQLTDWEMRQTDIGEMVNTKIETISITSSLTE
FT                   IMHKLVDYPFLPVVDQEERFVGIITRKSILKAVNSLLHDFTDDYTITKK"
FT   CDS_pept        392156..392902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0417"
FT                   /product="tyrosine recombinase"
FT                   /note="similar to tyrosine recombinase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80919"
FT                   /db_xref="GOA:C5WEV4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR020876"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV4"
FT                   /inference="similar to AA sequence:RefSeq:YP_059651.1"
FT                   /protein_id="BAH80919.1"
FT                   /translation="MITYIEAFIASKTLSLNSQKAYQYDLQQFSQVVGERISQDKLSLY
FT                   QNSLSAISPSAKKRKISTVNQFLYYLYQENHLSYYFRITDRTKIPTANKQDLALIDRDC
FT                   FYQDTPLAAGQLIALLMLELGLTPSDLACIEVANLDLTFQVLRLQTAKGVRVLPLSHQL
FT                   IPFLERQRNGKKRYLFEHQGQAFSRQWFFNQLKGFLESIGYKELTAQKLREQFILKEKS
FT                   RGKSIMELSQFLGLKSPATLEKYYKS"
FT   CDS_pept        392902..393609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="SDEG_0418"
FT                   /product="segregation and condensation protein"
FT                   /note="similar to segregation and condensation protein ScpA
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80920"
FT                   /db_xref="GOA:C5WEV5"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV5"
FT                   /inference="similar to AA sequence:RefSeq:YP_601796.1"
FT                   /protein_id="BAH80920.1"
FT                   /translation="MDIKVKDFEGPLDLLLHLVSKYKVDIYEVPIVEVIEQYLAYVETL
FT                   QAMKLEVAGEYMLMASQLMLIKSRRLLPKIVEEPQDDDNLEQDLLDKIEEYSRFKALSQ
FT                   ELAEQHNRRAKYYSKPKQELIFEDAVLQEDKTVMDLFLAFSKIMTAKREAFKNNHTVIE
FT                   RDDYRIEDMMVSIEKRLEKDKVVSLSAIFDDCQSLNEVITLFLASLELIKMHLVIVEQA
FT                   TNFGQIILRKEMP"
FT   CDS_pept        393606..394169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="SDEG_0419"
FT                   /product="segregation and condensation protein B"
FT                   /note="similar to segregation and condensation protein B
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80921"
FT                   /db_xref="GOA:C5WEV6"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV6"
FT                   /inference="similar to AA sequence:RefSeq:NP_606661.1"
FT                   /protein_id="BAH80921.1"
FT                   /translation="MKSYLSQIEALLFVAGEEGLSLRQLATMLSLPPTALQQQLEKLSQ
FT                   KYESDLDSSLCLMESSNTYKLVTKEIFADLLRDYAKAPINQSLSRASLEVLSIIAYKQP
FT                   ITRIEIDDIRGVNSSGALTKLLAFELIKEAGKKEVIGRPRLYATTDYFLDYMGINHLDQ
FT                   LVDVSAIELADEESALFKQETEND"
FT   CDS_pept        394278..395000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0420"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="similar to Ribosomal large subunit pseudouridine
FT                   synthase B [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80922"
FT                   /db_xref="GOA:C5WEV7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059654.1"
FT                   /protein_id="BAH80922.1"
FT                   /translation="MRINKYIAHAGVASRRKAEELIKQGLVTLNGQIITDLATTVKSGD
FT                   VVEIEGSPIYNEEKVYYLLNKPRGVISSVSDDKGRKTVLDLLPQVKERIYPVGRLDWDT
FT                   SGVLILTNDGDFTDTMIHPRNEIDKVYLARVKGIATKENLRPLTRGVVIDGKKTKPARY
FT                   NIIRVEADKNRSIVELTIHEGRNHQVKKMFESVGLLVDKLSRTRFGTLELTGLRPGESR
FT                   RLNKKEISQLHNLANTKK"
FT   CDS_pept        394997..395248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0421"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein Sez 1639
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80923"
FT                   /db_xref="GOA:C5WEV8"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV8"
FT                   /inference="similar to AA sequence:RefSeq:YP_002123983.1"
FT                   /protein_id="BAH80923.1"
FT                   /translation="MITTLLVAPVKAYQRYISPLFPPTCRYRPTCSAYMITAIEKHGAK
FT                   GVLMGLARILRCHPFVAGGDDSVPDHFSLKRNNKALKK"
FT   CDS_pept        395389..395985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0422"
FT                   /product="tRNA (cytosine34-2'-O-)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="similar to 23S rRNA methyltransferase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80924"
FT                   /db_xref="GOA:C5WEV9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEV9"
FT                   /inference="similar to AA sequence:RefSeq:YP_059656.1"
FT                   /protein_id="BAH80924.1"
FT                   /translation="MTPGSVVFLMKRISEIVMRKEILNPTYKEENSRNHVVLFQPQIPQ
FT                   NTGNIARTCAATNAPLHIIKPMGFPIDDRKMKRAGLDYWDKLDVRFYDSLEDFVAQCQG
FT                   KLHLISKFADKIYSEETYADDQPHYFLFGREDTGLPEAFMREHAEKALRIPMNDDHVRS
FT                   LNVSNTVCMVVYEALRQQEFKGLDLTHTYQHDKLK"
FT   CDS_pept        396540..397103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0423"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spyM18 0427
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80925"
FT                   /db_xref="GOA:C5WEW0"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW0"
FT                   /inference="similar to AA sequence:RefSeq:NP_606667.1"
FT                   /protein_id="BAH80925.1"
FT                   /translation="MSKTHKMVMVAILSAISFVLMLFSFAIIPGAEFLKIEFSVIPVLL
FT                   GLVLMDLKSAYLILLLRSLLKLFLNNRGVNDFIGLPMNIIAIALFVTAFALVWNRQKTL
FT                   SQYVFASLLGTGLLTFGMVVLNYIFAIPLYAKFANFDIGAYIGIAKYMVAMVIPFNLVE
FT                   GLIFAIAFYFVYIASKSILERYQH"
FT   CDS_pept        397108..397758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0424"
FT                   /product="phosphatidylglycerophosphatase B homolog"
FT                   /note="similar to phosphatidylglycerophosphatase B homolog
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80926"
FT                   /db_xref="GOA:C5WEW1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281678.1"
FT                   /protein_id="BAH80926.1"
FT                   /translation="MKNKQNHFLIASFALLIFVMIGYTVKFFPESLTSLDSSIQTAIRG
FT                   TLPQSVTRFFRIITVFGNVTTQLLVVTVSVIAFLFIKWKMEAFLVLSNGFVAALLISSF
FT                   KLLYQRPRPSIEHLVYAGGFSFPSGHAMGSMLIFGSLLIVCHQRIKSRPLQVAVDALFV
FT                   TLILLIGLSRVYLGVHYPSDVLAGFILGFGILHFLYPCYDQKRFEWRFLLKQD"
FT   CDS_pept        397935..398876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0425"
FT                   /product="Fe-S oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /note="similar to Fe-S oxidoreductase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80927"
FT                   /db_xref="GOA:C5WEW2"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW2"
FT                   /inference="similar to AA sequence:RefSeq:YP_059659.1"
FT                   /protein_id="BAH80927.1"
FT                   /translation="MKKRYQTLNDYYRTLFGAKIFKVPIDAGFDCPNRDGTVTHGGCTF
FT                   CTVSGSGDAIVAPDAPIREQFYKEIDFMHRKWPEVKQYLVYFQNFTNTHDKVEVIRERY
FT                   EQAINEPGVVGINIGTRPDCLPDETIAYLAEVAERMHVTVELGLQTTYEKTSEMINRAH
FT                   SYDLYKEMVKRLRQYPKIEIVSHLINGLPGETHEMMLENVRRCVTDNDIQGIKLHLLHL
FT                   MTNTRMQRDYHEGRLQLLSQEDYVSIICDQLEIIPKHIVIHRITGDAPRDMLIGPMWSL
FT                   NKWEVLNAIDKEMERRDSWQGCKADRQLYAQG"
FT   CDS_pept        398899..399453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0426"
FT                   /product="SAM-dependent methyltransferase"
FT                   /EC_number="2.1.-.-"
FT                   /note="similar to SAM-dependent methyltransferase
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80928"
FT                   /db_xref="GOA:C5WEW3"
FT                   /db_xref="InterPro:IPR010719"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW3"
FT                   /inference="similar to AA sequence:RefSeq:NP_268698.1"
FT                   /protein_id="BAH80928.1"
FT                   /translation="MIKRPIHLSHDFLAEVMDKSSVVVDATMGNGNDTAFLAQSAKKVY
FT                   AFDVQEQAIRKTSERLAQLGLSNAELILAGHEAVDQYVTEPVRAAIFNLGYLPSADKSV
FT                   ITLPATTLLALSKILKLLEVGGRVAIMVYYGHEGGDMEKDALLDFVRQLDQRLVSAMLY
FT                   QPLNQVNTPPFLVMLEKLADF"
FT   CDS_pept        399573..400907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyX"
FT                   /locus_tag="SDEG_0427"
FT                   /product="putative hemolysin"
FT                   /note="similar to putative hemolysin [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80929"
FT                   /db_xref="GOA:C5WEW4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW4"
FT                   /inference="similar to AA sequence:RefSeq:NP_606671.1"
FT                   /protein_id="BAH80929.1"
FT                   /translation="MEDPVSQPLVIQFLVLFILTLLNAFFSASEMALVSLNRSRVEQKA
FT                   ADGDKKYARLLRVLEEPNHFLSTIQVGITFISLLSGASLSASLGKVISGWLGGSATAQT
FT                   AGGIISLIFLTYVSIVLGELYPKRIAMNLKDKLAIVSAPIIIGLGKVVSPFVWLLSAST
FT                   NLLSRITPMTFDDADEQMTRDEIEYMLSNSEATLDAEEIEMLQGIFSLDEMMAREVMVP
FT                   RTDAFMIDINDDPLENIQEILKQSFSRIPVYDVDKDKIIGLIHTKRLLESGFRQGFENI
FT                   NMRKILQEPLFVPETIFVDDLLRQLRNTQNQMAILLDEYGGVAGLVTLEDLLEEIVGEI
FT                   DDETDKAEQFVHEIGENTYIVIGTMTLNEFNEYFDTELESDDVDTIAGFYLTGTGTIPS
FT                   QEQKEAYEIDSQDKHLVLINDKVKDGRITKLKLVLSNIEQIIEED"
FT   CDS_pept        400913..401776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0428"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="similar to pyruvate formate-lyase activating enzyme
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80930"
FT                   /db_xref="GOA:C5WEW5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR034465"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW5"
FT                   /inference="similar to AA sequence:RefSeq:YP_059662.1"
FT                   /protein_id="BAH80930.1"
FT                   /translation="MPSLFYEKCYNENVKTFTRNEGDAMTEIDYGQVTGMVHSTESFGS
FT                   VDGPGIRFIIFLQGCKMRCQYCHNPDTWEMETNNSKLRTVNDVLKEALQYKHFWGKKGG
FT                   ITVSGGEAMLQIDFITALFTEAKKLGIHTTLDTCGFAYRPTPEYHEVLDKLLAVTDLIL
FT                   LDLKEIDEEQHKIVTRQPNQNILEFARYLSDKQIPVWIRHVLVPGLTDIDDHLVRLGEF
FT                   VKTLKNVDKFEVLPYHTMGEFKWRELGIPYQLEGVKPPTKERVQNAKNLMQTESYTEYM
FT                   NRIHQS"
FT   CDS_pept        401906..402841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0429"
FT                   /product="putative manganese-dependent
FT                   inorganicpyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="similar to putative manganese-dependent inorganic
FT                   pyrophosphatase [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80931"
FT                   /db_xref="GOA:C5WEW6"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR022934"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059663.1"
FT                   /protein_id="BAH80931.1"
FT                   /translation="MSKILVFGHQNPDTDAIASSYGFDYLSQKAFGLDTEVVALGTPNE
FT                   ETAFALDYFGVEAPRVVESAKAEGAEQVILTDHNEFQQSIADIREVEVYGVVDHHRVAN
FT                   FETANPLYMRVEPVGSASSIVYRMFKENGIDVPKAIAGMLLSGLISDTLLLKSPTTHVS
FT                   DHRVAEELAELAEVNLETYGMSLLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVN
FT                   TVDISEVLERQEAIEAAIKDAMAAEGYSDFVLMVTDIVNSNSEILAIGANMDKVEAAFN
FT                   FTLENNHAFLAGAVSRKKQVVPQLTESFGA"
FT   CDS_pept        402841..403569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0430"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80932"
FT                   /db_xref="InterPro:IPR014924"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW7"
FT                   /inference="similar to AA sequence:RefSeq:YP_059664.1"
FT                   /protein_id="BAH80932.1"
FT                   /translation="MKRRFKRAWFFDQALFSLFYAIIEGMITVFHSDKLTRQSFFQDLI
FT                   NYLDQHDHVILRDIKKAFPNITGIDKAIESYVQAGYIRRENKRYGINLPIVTSDQQLVL
FT                   DTMLFVDTCSVKYEDFLAVTFETQLANQTNQVIIKEKTNITRNQLTLANYFYRLKRGEK
FT                   PSAEQMDLYKLLGDVNQEYALKYMTTFLLKFTRKELVMQKRPDIFVEALVRLGYLVQVE
FT                   PTKYQLLMTLDKESLTFTAP"
FT   CDS_pept        complement(403614..404615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="SDEG_0431"
FT                   /product="ferrichrome transport system permease protein"
FT                   /note="similar to ferrichrome transport system permease
FT                   protein [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80933"
FT                   /db_xref="GOA:C5WEW8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281685.1"
FT                   /protein_id="BAH80933.1"
FT                   /translation="MKSFKQVAPFYLGLFLLLLGLILMSLSIGESNMSLLSVIKVLLGE
FT                   SNSAMTLIITKIRLPRILAACVGGGSLALSGLLLQSLTRNPLADSGILGINTGAGVTLA
FT                   IFVSFSSLNQTILSQFLPLFAMLGASLTIFSVYQLSLTKQGKINPTRLMITGVGVTTML
FT                   SSLMVALVGNVNRYKVDLVINWLSGQITGDDWPTLTLIAPLLILLWLVGFYQAHHLNIM
FT                   TLSDDTAIGLGLALNAQRLVTLALATALAALSVLLVGNISFIGLMAGHTSKRLVGNDHR
FT                   LTIPTSLFIGMLILLIADTIGRVYLVGSNIQTGIIVSLIGAPYFLYLMAKTK"
FT   CDS_pept        complement(404612..405655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="SDEG_0432"
FT                   /product="ferrichrome transport system permease protein"
FT                   /note="similar to ferrichrome transport system permease
FT                   protein [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80934"
FT                   /db_xref="GOA:C5WEW9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEW9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281686.1"
FT                   /protein_id="BAH80934.1"
FT                   /translation="MHKSPDYIYLPTQKTKRVTKSQTFWLLFALISLSLVLAIYCNLRF
FT                   GAIHLSHQDISHIFLGKQGGHKANVLLDIRIPRLMAAALVGAALAVSGAIMQGITRNPI
FT                   AEPGLLGINSGAGLALVLAYAFVPHLHYSLIILLSLLGSCLAAALVFGLSYQTRKGYHQ
FT                   LRLVLAGAMVSILLSALGQGVTNYYHLANAIIGWQAGGLVGVNWQMVAYIAPLVVAGLV
FT                   LAQLLSYHLTILSLSDYQAKALGQRTTLMSVIFMLLVLLLSSAAVAIAGSISFVGLMVP
FT                   HLIKVFAAKNYRQIIPLSALLGASFMLWVDFACRKLNPPYETPLSALVSLVGFPCFLWL
FT                   LRKGGTH"
FT   CDS_pept        complement(405648..406586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="SDEG_0433"
FT                   /product="ferrichrome-binding protein"
FT                   /note="similar to ferrichrome-binding protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80935"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281687.1"
FT                   /protein_id="BAH80935.1"
FT                   /translation="MKKLALLLTLCLTTITLVACGNQTNSKPNPSSNNLSSMPKIAGMT
FT                   YYGDIPSQPKRVVSLASTYTGYLKKLDLNLVGVTSYDKKNPVLAKTIKKAKQVAATDLE
FT                   AITALEPDVIVVGSTEENIKQLAEIAPVISIEYRKRDYLQVFSDFGRVFNKEKETAKWL
FT                   KDWETKTAAYEKEVKAVTGDKATFTIMGLYEKEIYLFGKDWGRGGEIIHQAFHYDAPEK
FT                   VKQDVFKQGYLSLSQEVLPDYIGDYVVLAAEDDKTGSALYESDLWKSLPAVQKNHVIKV
FT                   NANVFYFTDPLSLEYQLKTLRKAILSSESNA"
FT   CDS_pept        complement(406611..407393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="SDEG_0434"
FT                   /product="ferrichrome transport ATP-binding protein"
FT                   /note="similar to ferrichrome transport ATP-binding protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80936"
FT                   /db_xref="GOA:C5WEX1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281688.1"
FT                   /protein_id="BAH80936.1"
FT                   /translation="MTQISAEAIAIAYDKMTIIDDLSLRIPQGEITTIIGANGSGKSTL
FT                   LKGLTRLLPLNKGAVYLDGQSIAKLATKEVAKKIALLPQVQETTDGTTVYELVSYGRFP
FT                   HQSYLGKLSQTDKDTIHWAMEATKITAYANQPVDTLSGGQRQRVWIAMALAQDTDTIFL
FT                   DEPTTYLDMNHQLEILDLLKSLNQTSGKTMVMVLHDLNLSARYSNHLIAMKEGQIKYVG
FT                   SVREVMTPAVIQDLFHIKAQLIDDPIHNCPILLTYQLQ"
FT   CDS_pept        complement(407642..409087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SDEG_0435"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /note="similar to UDP-N-acetylmuramoylalanyl-D-glutamate-
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80937"
FT                   /db_xref="GOA:C5WEX2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281689.1"
FT                   /protein_id="BAH80937.1"
FT                   /translation="MISIEHVLNILKKDHNFREVLDADGYHYHYQGLSFERLSYDSRQV
FT                   DGKTLFFAKGATFKADYLKEAIAKGLPLYVSEVDYKLDIPVVLVTDIKKAMSLIAMAFY
FT                   DNPQDQLKLLGFTGTKGKTTAAYFAYHILKESYKPALLSTMNTTLDGQTFFKSQLTTPE
FT                   SLDLFAMMAECVKNGMTHLIMEVSSQAYLVGRVYGLTFDVGVFLNISPDHIGPIEHPTF
FT                   EDYFYHKRLLMENSRAVVINSGMDHFPFLANQVANQEHAFYGALSDNQITTSQAFSFEA
FT                   NGQLAGHYDIQLIGHFNQENAMAAGLACLRLGASLADIQKGIAKTRVPGRMEVLTMTNH
FT                   AKVFVDYAHNGDSLEKLLSVVEEHQTGNLVLILGAPGNKGESRRADFGAVINQHPNLTV
FT                   ILTADDPNFEDPEYISQEIASHITRPIDIVSDREQAIQKAMSLCQGPEDAVIIAGKGAD
FT                   AYQIVKGEKAPYAGDLAVAQRYL"
FT   CDS_pept        409175..410809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0436"
FT                   /product="export protein for polysaccharides and
FT                   teichoicacids"
FT                   /note="similar to export protein for polysaccharides and
FT                   teichoic acids [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80938"
FT                   /db_xref="GOA:C5WEX3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX3"
FT                   /inference="similar to AA sequence:RefSeq:YP_281690.1"
FT                   /protein_id="BAH80938.1"
FT                   /translation="MSTEKKQLTQEELMVQGAAWSTAGNFISRLLGVLYIIPWYIWMGQ
FT                   YAIQANALFNMGYNVYAYFLLISTTGLNVAIAKQVAKYNSMGQTEHSYQLIRSTLKLML
FT                   GLGVVFSAIMYLGSPLFTSLSGGDAKLIPIMHSLSLAVLVFPVMSVIRGIFQGHNNIKP
FT                   YAISQIAEQLIRVIWMLLTTFLIMKLGSGDYASAVTQSTFAAFIGMVASMGVLGYYLWK
FT                   QGLLAAVFSKPDHTVSIDIKGLLLETLKESIPFIVTGSAIQAFQLIDQWSFVNTMSLFT
FT                   DYSRSQLLVLFGYFNANPAKITMVLIAVAASIGGVGIALLTENYVKKDMRAAARLIINN
FT                   IEMLMMFLLPALTGAIILARPLYSVFYGASEDRAIHLFVAVLFQTLLLALYTLFSPMLQ
FT                   ALFENRKAIYYFAYGILIKLVLQVPLIYLMHAYGPLLATTIALLVPIYLMYRRLHQVTR
FT                   FNRKLLQKRLLLTLIETIIMGLVVFIANWLLGYAFKPTGRLTSLLYLLIIGGLGMAVYT
FT                   ALTLLTHQLDKLIGSKASRLRQKLGWH"
FT   CDS_pept        complement(410795..411880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0437"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80939"
FT                   /db_xref="GOA:C5WEX4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX4"
FT                   /inference="similar to AA sequence:RefSeq:YP_060130.1"
FT                   /protein_id="BAH80939.1"
FT                   /translation="MQDYYTPKGKQLTIHERRQIQRWKLEGRSNREIARLLGKAPQTIH
FT                   NEIKRGLVRQQVRKGKFEAVYSAQHAQLVYQENRKRSVRPIRQRKQDREAIEHYMRQNY
FT                   SPEMIVKAKGVQVPVSTIYYWIHHGKLSLGKETMLYPRKAKQARKHASPYFKPAGKSIE
FT                   QRPDSINQRLEAGHYEIDTVILTRAKNKCLLTLTDRKTRHQLIRLIPDKSAQAVNKALT
FT                   GILKDYTVNSITADNGTEFSRLSDVFPASAIYYAHPYASWERGTNENHNRLTRRWLPKG
FT                   TKTTTPKEVAAIEHWINHYPKRLFNYKSPVEMLKLANFNLKFGLLFFILLISLPINGKK
FT                   ETTPQSVHHEIVSLDNSLVPT"
FT   CDS_pept        412094..412723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="SDEG_0438"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="similar to uracil phosphoribosyltransferase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80940"
FT                   /db_xref="GOA:C5WEX5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX5"
FT                   /inference="similar to AA sequence:RefSeq:YP_281691.1"
FT                   /protein_id="BAH80940.1"
FT                   /translation="MGKCQVISHPLIQHKLSILRRQTTSTKDFRELVNEIAMLMGYEVS
FT                   RDLPLEDVEIQTPVSKTVQKQLAGKKLAIVPILRAGIGMVDGFLSLVPAAKVGHIGMYR
FT                   DEETLEPVEYLVKLPEDIDQRQIFLVDPMLATGGSAILAVDSLKKRGATNIKFVCLVAA
FT                   PEGVKKLQEAHPDVDIFTAALDERLNEHGYIVPGLGDAGDRLFGTK"
FT   CDS_pept        412945..413535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="SDEG_0439"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /EC_number="3.4.21.92"
FT                   /note="similar to ATP-dependent Clp protease proteolytic
FT                   subunit [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80941"
FT                   /db_xref="GOA:C5WEX6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281692.1"
FT                   /protein_id="BAH80941.1"
FT                   /translation="MIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSVIAQ
FT                   LLFLDAQDNTKDIYLYVNTPGGSVSAGLAIVDTMNFIKADVQTIVMGMAASMGTVIASS
FT                   GTKGKRFMLPNAEYMIHQPMGGTGGGTQQTDMAIAAEHLLKTRHRLEKILAQNAGKTIK
FT                   QIHKDAERDYWMSAEETLAYGFIDEIMENNELK"
FT   CDS_pept        413921..414217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0440"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs2095
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80942"
FT                   /db_xref="InterPro:IPR025384"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX7"
FT                   /inference="similar to AA sequence:RefSeq:NP_736525.1"
FT                   /protein_id="BAH80942.1"
FT                   /translation="MTPHDVQKLQELEEKYEAFFPKLEELIISFAQVEAAYDDYRALRA
FT                   FYGSEDWFHFRTQETEGLKAGILSEDQLYELICEHNDLLGRLLRFSSTMYRHL"
FT   CDS_pept        414292..414762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0441"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical proteinSMU.1671c
FT                   [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80943"
FT                   /db_xref="InterPro:IPR010368"
FT                   /db_xref="InterPro:IPR023378"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX8"
FT                   /inference="similar to AA sequence:RefSeq:NP_722004.1"
FT                   /protein_id="BAH80943.1"
FT                   /translation="MLVISEEFIAIEEAIDQLVACLKKVPQYQAYAEAKAAVEADGNLQ
FT                   VEMSRFQDIKKRYDASKALQEFRPEVRQLRREMLLQKRTLDCHPLVVSMRLAQMDLQEI
FT                   LANISEEIAGAVSDSIFVDTGLPLAPKRPKHPSGPYQNIKEKGLSCFKNKNV"
FT   CDS_pept        414738..415028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0442"
FT                   /product="hypothetical protein"
FT                   /note="similar to conserved hypothetical protein
FT                   [Streptococcus pyogenes M1GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80944"
FT                   /db_xref="GOA:C5WEX9"
FT                   /db_xref="InterPro:IPR016979"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEX9"
FT                   /inference="similar to AA sequence:INSD:AAK33433.1"
FT                   /protein_id="BAH80944.1"
FT                   /translation="MFQKQERIGLVIYLYYNRDARKLLKFGDLYYHSKRSRYLVIYINK
FT                   NDLETKVDEISRLKFVKEVKPSAFDDIDRQFVGNLHREENTMTLTEGASQA"
FT   CDS_pept        415232..416404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="SDEG_0443"
FT                   /product="putative ABC transporter, branched chain
FT                   aminoacid-binding protein"
FT                   /note="similar to putative ABC transporter, branched chain
FT                   amino acid-binding protein [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80945"
FT                   /db_xref="GOA:C5WEY0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY0"
FT                   /inference="similar to AA sequence:RefSeq:NP_722002.1"
FT                   /protein_id="BAH80945.1"
FT                   /translation="MKKKLLFSGLVLLSTTSLAACSAAPGASSQAASGTEIGKTLKIGL
FT                   NLELTGNVSAYGSAEEKGAKLAVDEINKAGGVDGKTIEVITKDNKSDNSEAATVTTNLA
FT                   TESKVNVVVGPATSGATAAASPNASKAAVPLITPSGTTDNLTLTSDGKTNPYVFRTTFV
FT                   DSYQGDVLAKYASDHLKAKQVVLFYDNSSDYSKGIAKRFKKVYTDTIVAEATFQSGDTD
FT                   FQSALTKLKDKEYDAIVMPGYYQETGTIIKQAREMGIASPILGPDGFADDKLVELAGAS
FT                   NVNKVYYISGFSASTSDKAVQFVKAYQAKYGTSPSMFAALAYDSIYMAADAAKDSKTSV
FT                   DLAKRLAKLKDFEGVTGTMTIDKQHNPIKPVSVVELTNGKESSATTVTAD"
FT   CDS_pept        416593..417462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="SDEG_0444"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter, permease protein"
FT                   /note="similar to putative branched chain amino acid ABC
FT                   transporter, permease protein [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80946"
FT                   /db_xref="GOA:C5WEY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY1"
FT                   /inference="similar to AA sequence:RefSeq:NP_722001.1"
FT                   /protein_id="BAH80946.1"
FT                   /translation="MLQQLVNGLILGSVYALLALGYTMVYGIIKLINFAHGDLYMMGAF
FT                   IGYYLINALQLNFFLALILTMVFTACLGVLIEFLAYRPLRQSTRIAALITAIGVSFLLE
FT                   YGMVYFVGAEARAFPQALKVVKYHLGPISVTNVQLIILLVSLTLMLALQFIVKQTKMGK
FT                   AMRAVSVDSDAAQLMGINVNSTISFTFALGSALAGAAGVLIGLYYNSINPLMGMTPGLK
FT                   AFVAAVLGGIGIIPGAAFGGFIIGLLETFSTAIGLSSYRDAVVYVVLIMILLVRPAGLL
FT                   RKNVKEKV"
FT   CDS_pept        417466..418419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="SDEG_0445"
FT                   /product="putative branched chain amino acid ABC
FT                   transporter, permease protein"
FT                   /note="similar to putative branched chain amino acid ABC
FT                   transporter, permease protein [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80947"
FT                   /db_xref="GOA:C5WEY2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY2"
FT                   /inference="similar to AA sequence:RefSeq:NP_722000.1"
FT                   /protein_id="BAH80947.1"
FT                   /translation="MKKEHKALLAWIFILALVYLILTLLIGTDILGPYYVQILMGIGIA
FT                   IIMAMGTNLVLGFSGQFPLGQAGFMAVGAYATAILTKYMPTYLGFYLSMLVGVLVAGLI
FT                   AVIVGFPTLRLKGDYLAIATLGVAEIIRIAIINGGELTNGAAGLTGVLQYTSWPVVYAF
FT                   VVVIAIVMLNFIRSATGRQVIAVREDEIAAESMGVNTTKIKVITFALAAMTASMAGSLY
FT                   VGYIGTVVPKDFTIMRSIDYLIIAVLGGLGSMTGTIVAAIVLGLLNMYLQNFSDVRMII
FT                   YSLALILVMVFRPGGLLGTREFRLSTLLSKKEKGGN"
FT   CDS_pept        418420..419184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="SDEG_0446"
FT                   /product="branched-chain amino acid ABC transporter ATP
FT                   binding protein"
FT                   /note="similar to branched-chain amino acid ABC transporter
FT                   ATP binding protein [Streptococcus thermophilus CNRZ1066]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80948"
FT                   /db_xref="GOA:C5WEY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY3"
FT                   /inference="similar to AA sequence:RefSeq:YP_140780.1"
FT                   /protein_id="BAH80948.1"
FT                   /translation="MALLEVKQLSKHFGGLTAVGDVTMALEMGELVGLIGPNGAGKTTL
FT                   FNLLTGVYEPSEGTIVLNGQLLNGKSPDKIASLGLSRTFQNIRLFKNMTVLENVLIGLA
FT                   NQGKSHFWSSLLRLPKFYQTEAALKEEALSLLARFQLEGEAETLAKNLPYGQQRRLEIV
FT                   RALATKPKILFLDEPAAGMNPQETAELTALIRQLKTDFGITIILIEHDMSLVMEVTERI
FT                   YVLEYGRLIAHGSPQDIKNNPRVIEAYLGGDL"
FT   CDS_pept        419184..419894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="SDEG_0447"
FT                   /product="ABC-type branched-chain amino acid
FT                   transportsystem, ATPase component"
FT                   /note="similar to ABC-type branched-chain amino acid
FT                   transport system ATPase component [Streptococcus suis
FT                   98HAH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80949"
FT                   /db_xref="GOA:C5WEY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY4"
FT                   /inference="similar to AA sequence:RefSeq:YP_001201112.1"
FT                   /protein_id="BAH80949.1"
FT                   /translation="MAMLSVKQLSVNYGAIEAVKDVSFEVHEGEVVTLIGANGAGKTSI
FT                   LRTISGLVKPKSGSISFLGQDLLKQPARKIVAAGLSQVPEGRHVFAGLTVMENLEMGAF
FT                   LSRNREQNQKNLRLIFDRFPRLEERKHQDAATLSGGEQQMLAMGRALMSQPKLLLLDEP
FT                   SMGLAPLFIKEIFDIIQAIQRQGTTVLLIEQNANKALAIANRAYVLETGQLVLSGTGQE
FT                   LLTSEAVKKAYLGG"
FT   CDS_pept        419939..420601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0448"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein STRINF 01997
FT                   [Streptococcus infantarius subsp. infantarius ATCC
FT                   BAA-102]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80950"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY5"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02921113.1"
FT                   /protein_id="BAH80950.1"
FT                   /translation="MSVKDYMTKEVISISPEESVAHAADLMRDKGLRRLPVIEKGQLVG
FT                   LVTEGTMADASPSKATSLSIYEMNYLLNKTKIRDIMIRQVVTVEPDASLEDAIYEMMTY
FT                   KVGVLPVVQNNQVVGIITDRDVFKAFLEVSGYGVEGIRVVLLADNAVGVLAKIADCLSQ
FT                   ENLNIRRTVVANRSNGKTVIEMQLDGTTASQWLSERLAAAGITVESVLKTLAKPDLS"
FT   CDS_pept        420688..421323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SDEG_0449"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="similar to thymidylate kinase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80951"
FT                   /db_xref="GOA:C5WEY6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281694.1"
FT                   /protein_id="BAH80951.1"
FT                   /translation="MITGKLITVEGPDGAGKTTVLEQVVPLLKERLSQEIVTTREPGGV
FT                   AISEHIRELILDVNHTTMDPKTELLLYIAARRQHLVEKVLPALEAGQLVFIDRFIDSSV
FT                   AYQGAGRGLSKTDIQWLNRFATDGLEPDLTLYFDVPSEIGLARIAANKNREVNRLDLEA
FT                   VDMHQRVREGYLALAQEQPNRIVTIDASKPLEDVVDVALAHILALMEA"
FT   CDS_pept        421339..422211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0450"
FT                   /product="DNA polymerase III subunit delta"
FT                   /EC_number="2.7.7.7"
FT                   /note="similar to DNA polymerase III subunit delta
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80952"
FT                   /db_xref="GOA:C5WEY7"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY7"
FT                   /inference="similar to AA sequence:RefSeq:NP_606686.1"
FT                   /protein_id="BAH80952.1"
FT                   /translation="MDLAQKAPKVYQAFQDILKKDRLNHAYLFSGDFANAEMALFLAKV
FT                   IFCEQKKEQTPCGHCRSCQLIEQGDFADVTVLEPTGQVIKTDVVKEMMANFSQTGYEGK
FT                   RQVFIIKDCEKMHVNAANSLLKYIEEPQGQAYMFLLTNDDNKVLPTIKSRTQVFQFPKN
FT                   EAYLFQLAQERGLLRSQADLVAKLAKNVDQLEDLAQNSHFLEVMAQTERFVSIWLKDQL
FT                   QAYLALNHLVLLATEKEEQELILTLLTLLLAREQSQTPFKQLEAVYQARLMWQSNVNFQ
FT                   NTLEYMVMS"
FT   CDS_pept        422208..423008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="SDEG_0451"
FT                   /product="initiation-control protein, YabA-like"
FT                   /note="similar to DNA replicationintiation control protein
FT                   YabA [Streptococcus pyogenes M1GAS]; Involved in initiation
FT                   control of chromosomereplication."
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80953"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY8"
FT                   /inference="similar to AA sequence:RefSeq:NP_268716.1"
FT                   /protein_id="BAH80953.1"
FT                   /translation="MISAIGIRYGETELVKYAQTDQEFPKGTLLVVKDDKGSHLAKVCQ
FT                   VKKAFSESSLPKGLPTVVRLATAMDKKAFEDNAKFAAASKAEVVALIAKNGLDMKLIDI
FT                   VFPLDRHYVLITFSAEERVDFRQLLKDLAAYFKTRIELHQINSREEAKIYGGLGPCGRP
FT                   LCCSSFLGEFPAVSIKMLKNQGLSLNSGKSTGYCGRLLCCLQYEESFYQESKKKFPDYG
FT                   TIVETSDGPATVAAIDIFTDTVKVRLKDQLTLVTYALEEVKVSE"
FT   CDS_pept        423001..423324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0452"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0334
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80954"
FT                   /db_xref="GOA:C5WEY9"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEY9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281698.1"
FT                   /protein_id="BAH80954.1"
FT                   /translation="MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLEN
FT                   TKLRERLSQLEHETVAKNPSKQGKDHLEGIYEEGFHICNFFYGQRRENDEECMFCRELL
FT                   DRK"
FT   CDS_pept        423329..424192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0453"
FT                   /product="corrin/porphyrin methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="similar to corrin /porphyrin methyltransferase
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80955"
FT                   /db_xref="GOA:C5WEZ0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ0"
FT                   /inference="similar to AA sequence:RefSeq:YP_279792.1"
FT                   /protein_id="BAH80955.1"
FT                   /translation="MQVQKSFKDKKTSGTLYLVPTPIGNLQDMTFRAVATLKEVDFICA
FT                   EDTRNTGLLLKYFDIATKQISFHEHNAYEKIPDLIDLLISGRSLAQVSDAGMPSISDPG
FT                   HDLVKAAIDNDIAVVALPGASAGITALIASGLAPQPHIFYGFLPRKAGQQKSFFESKSL
FT                   YPETQIFYESPYRVKDTLANMLTCYGDRQVVLVRELTKLFEEYQRGSISEILSYLEETP
FT                   LKGECLLIVSGSQVDSEVELTAEVDLVSLVQKEIQAGAKPNQAIKTVAKAYQVNRQELY
FT                   QQFHDL"
FT   CDS_pept        424219..424611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0454"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80956"
FT                   /db_xref="GOA:C5WEZ1"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281700.1"
FT                   /protein_id="BAH80956.1"
FT                   /translation="MTEDQTAVLILGTYGIILAIFLLSALLCLIANWRLFKRAGYKGWY
FT                   SLIPFYAGFVKHKITFGEDNKWFYFIGWVIAIYYYYVHFCYVRAFGGSKGLAVFGLFFP
FT                   GIATLIIAFGKAYTAEEYHPVPHLLN"
FT   CDS_pept        complement(424658..425287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="SDEG_0455"
FT                   /product="copper homeostasis protein"
FT                   /note="similar to copper homeostasis protein [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80957"
FT                   /db_xref="GOA:C5WEZ2"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ2"
FT                   /inference="similar to AA sequence:RefSeq:YP_279794.1"
FT                   /protein_id="BAH80957.1"
FT                   /translation="MIKEFCAENLTLLPTLDAGQVTRVELCDNLAVGGTTPSYGVIKEA
FT                   CQLLHDKNISVATMIRPRGGDFVYNDLELKAMEEDILKAIEAGSDALVLGLLTSENQLD
FT                   TDAIEQLLPATQGLPLVFHMAFDRIPTDHQHQALDQLIDYGFVRVLTHGSPEATPITDN
FT                   VEQLKDLVTYANKRIEIMIGGGVTAENCQSLSQLTGTAIVHGTKII"
FT   CDS_pept        425404..426495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0456"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein STRINF 01988
FT                   [Streptococcus infantarius subsp. infantarius ATCC
FT                   BAA-102]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80958"
FT                   /db_xref="GOA:C5WEZ3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ3"
FT                   /inference="similar to AA sequence:RefSeq:ZP_02921104.1"
FT                   /protein_id="BAH80958.1"
FT                   /translation="MSQYYFSAGPAVLPRSVLKQAQASLLDIDGRGTNILELSHRSQRF
FT                   EDIIQTAEELLRELMAIPDNYRVLFLQGGASTQFSMLPLNVARGKTAYYQVAGHWGKKA
FT                   YLEALTLAREIEVKPILLASSEADAFEYIPTFDPKILDAEAAYVHITTNNTIEGTALYD
FT                   LPQTNGIPLVADMSSNILIYPYQVEDFAMIYASAQKNMGPAGVTVVIIDEDFLNQEPTL
FT                   SSMWDYRVQAEAHSLYNTPPTFSIYVLSLVLDWLKGMGGVAKMAKRNQEKAQLLYDYLD
FT                   QSRFYHNPVRYADQRSMVNVPFTCPNPALDALFIQEAEARGLYGLQGHSSVGGMRASLY
FT                   NAFSKEGVLALIEMMAAFEAKYQ"
FT   CDS_pept        426521..427072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0457"
FT                   /product="acetyltransferase GNAT family"
FT                   /EC_number="2.3.1.-"
FT                   /note="similar to putative acetyltransferase [Streptococcus
FT                   equi]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80959"
FT                   /db_xref="GOA:C5WEZ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ4"
FT                   /inference="similar to AA sequence:INSD:AAN18301.1"
FT                   /protein_id="BAH80959.1"
FT                   /translation="MEIRLAFPNEVAQVMTVIEDAKAVIAAYGSDQWQNGYPNEEVMID
FT                   DILKGHAYVALNDEGTIVAYAAAIYGNEEAYNAIYDGQWRTPNQDYVTFHRIAVLKDHQ
FT                   GQGVAQTFLQGLIERFDQKDFRCDTHEKNNVMQHLLTKLGYVYCGKVPLDGVRLAYQKI
FT                   KESHEQADYQEIDEDSRYGL"
FT   CDS_pept        427133..427630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="SDEG_0458"
FT                   /product="methylated-DNA-protein-cysteinemethyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="similar to putative methylated-DNA-protein-cysteine
FT                   S-methyltransferase[Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80960"
FT                   /db_xref="GOA:C5WEZ5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_721985.1"
FT                   /protein_id="BAH80960.1"
FT                   /translation="MTLTESYYDSPLGKISLVATDHALLGAWFLGQAYFQAGLDRLPQR
FT                   GTNAILQAAASWLDTYFEGNPTAISINLVPKGTPFQQNVWETLRQIPYGETITYGQLAT
FT                   QVACQSAQAVGAAIGRNPLSLFIPCHRVIAADGQLRGYAGGLDKKAWLLKHERSLITKE
FT                   KK"
FT   CDS_pept        427627..427983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0459"
FT                   /product="arsenate reductase family protein"
FT                   /EC_number="1.20.-.-"
FT                   /note="similar to arsenate reductase family protein
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80961"
FT                   /db_xref="GOA:C5WEZ6"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ6"
FT                   /inference="similar to AA sequence:RefSeq:YP_597946.1"
FT                   /protein_id="BAH80961.1"
FT                   /translation="MITIYQYPKCSTCQRAMAELKQLISDFEVIDIKANPPKAQDLKHW
FT                   METSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDKAAELLATDGMLIKRPILIKDGNVL
FT                   QVGYRKPYQELNLS"
FT   CDS_pept        complement(428034..428342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0460"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1540
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80962"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ7"
FT                   /inference="similar to AA sequence:RefSeq:NP_688534.1"
FT                   /protein_id="BAH80962.1"
FT                   /translation="MVTAINVYLVTDGNGQEAVAFYQEVFQAKVVNLFLWKAGVNMTAS
FT                   IMVDSIEEAQRIYDKLITNAKAINLPLQETFWSPAYANITDQFGMMWQLNTELKAEH"
FT   CDS_pept        complement(428344..428733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0461"
FT                   /product="glyoxalase family protein"
FT                   /note="similar to glyoxalase family protein [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80963"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ8"
FT                   /inference="similar to AA sequence:RefSeq:NP_688535.1"
FT                   /protein_id="BAH80963.1"
FT                   /translation="MITKSTTMLYVADTEAALQFWTEQVGFVLIDQAQQEGTSSYEIAP
FT                   NKESAISFGLHNKEIVAAANPGMDLGFPSLLFETDHLQAEYERLTAAGVTTNPIMEYQG
FT                   MIHFTFSDNEGHYIAVRQSTSPKGV"
FT   CDS_pept        complement(428831..429766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0462"
FT                   /product="sugar-binding transcriptional regulator, LacI
FT                   family"
FT                   /note="similar to sugar-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80964"
FT                   /db_xref="GOA:C5WEZ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WEZ9"
FT                   /inference="similar to AA sequence:RefSeq:NP_687799.1"
FT                   /protein_id="BAH80964.1"
FT                   /translation="MTSIRDIAKLAGVAPSTVSRYLNQSDYVSQETSQIIATVIQQLDY
FT                   SPNMTARQLSTGKTNRIGVIIPHTKHPYFIDIFRGLMEAALESQYQLLFLPSDYEQEIE
FT                   RDYLEQLKGKAFDSLIFTSRKIPLSLLESYADYGQIVLLESCTSKKISSVSIDRHQGLQ
FT                   ELFQWLAGYNVGKCALLFSRNKATSSTFKATLSAFKANLGNQHPYETFGQVSTYEEAYR
FT                   LAATLSQDPSFDAIVANGDDVAAGILIYYQEHQLQLPLIVSQEKQLSGQLLHLPSIDNN
FT                   SFQLGKHAFSLATGTHVVHLTLPSQFFKNR"
FT   CDS_pept        complement(429763..430575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0463"
FT                   /product="hydrolase, haloacid dehalogenase-like family"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80965"
FT                   /db_xref="GOA:C5WF00"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF00"
FT                   /inference="similar to AA sequence:RefSeq:NP_687798.1"
FT                   /protein_id="BAH80965.1"
FT                   /translation="MMQKHLFLDMDGTLLDRRGRVSLSNAAGIKKAQLPITLVSARAPI
FT                   EMKEAIDALDLAGPQIGFNGGLIYQYHQNQLETIAELPLPKQAGQLLINHIQQTYPELS
FT                   QSYYYKDKWLSFKKDDGIDYESQLTLLEPELVSLSSYLSPTEPLFKIMLITFDDLEMQN
FT                   LKENLLQLQLEGVSIQQSGSYYLEITHQEAVKSRGIDYIMTALKLPKEATVAFGDGHND
FT                   LPMFAKVGTSIAMANAHLDVLRQATFVTTTNDKDGVAHGIWKYVKGNQ"
FT   CDS_pept        complement(430704..431531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="SDEG_0464"
FT                   /product="putative 3'-exo-deoxyribonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /note="similar to putative 3'-exo-deoxyribonuclease
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80966"
FT                   /db_xref="GOA:C5WF01"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF01"
FT                   /inference="similar to AA sequence:RefSeq:NP_268721.1"
FT                   /protein_id="BAH80966.1"
FT                   /translation="MKLISWNIDSLNAALTGESPRALLSRAVLDTLVAQDADIIAIQET
FT                   KLSAKGPTKKHIETLLSYFPDYLHVWRSSVEPARKGYAGTMFLYKNTLNPVITFPEIGA
FT                   PTTMDAEGRMITLEFENFFVTQVYTPNAGDGLRRLEDRQIWDQKYADYLVELDAQKPVL
FT                   ATGDYNVAHKEIDLANPGSNRRSPGFTDEERQGFTNLLARGFTDTFRHLHGDIPNVYTW
FT                   WAQRSKTSKINNTGWRIDYWLTSNRLVDKINRSEMISSGERQDHTPILLDIDL"
FT   CDS_pept        431820..432452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0465"
FT                   /product="conserved hypothetical protein, possible
FT                   hemolysis inducing protein"
FT                   /note="similar to hemolysis inducing protein [Streptococcus
FT                   mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80967"
FT                   /db_xref="GOA:C5WF02"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF02"
FT                   /inference="similar to AA sequence:RefSeq:NP_721979.1"
FT                   /protein_id="BAH80967.1"
FT                   /translation="MLSKKLTVLSSLVTLSPIILGLTLWQYLPEKIPTHFDLTGQADGF
FT                   SSKLEGIMALPLIILGIHLITLFIGTKKPIITQKGAALYLIYWLLPSLCLVVQTGILLT
FT                   SAGFINRNLFNPIAGLACLLIVLGFLLPYLKQNPIMGIRLPWTLADEDNWAKTHRFAGR
FT                   IWLVGGSFLFALSYFKADVQSAVIVVLGAMLVVPIVYSYLLNRAEKK"
FT   CDS_pept        432751..434280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="SDEG_0466"
FT                   /product="L-lactate permease"
FT                   /note="similar to L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80968"
FT                   /db_xref="GOA:C5WF03"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF03"
FT                   /inference="similar to AA sequence:UniProtKB:O33654"
FT                   /protein_id="BAH80968.1"
FT                   /translation="MITMIQTLFAIIPIAWLILSLAVFRIRGDLACLIGLVITIVTSIF
FT                   AFDFKVTDSLTAALEGAMMGFWPIVYIIVAAVFTYNLTTASGGMSVIKQLLTSISNDRR
FT                   ILVLILAWGFGGFLEAIAGFGTAVAIPASILVALGMKPLRAALICLIANTTPTAFGAIG
FT                   LPVTTLAQVTGLEVKQLSVIVSIQLFLLIVAIPFVLVSLAGEGDRSFKGIFGLTLASGL
FT                   SFALPQIVISHYLGAELPSIIGSLLCILVTVLFVKLKEKGNVSSETAEPVSLKEGVMAS
FT                   LPFLLVFIFIMLTSSLFPAINQLLSKVSTTFSIYTGDHAKPYTINWLTSPGTMIILATV
FT                   LAGLGQGMSIGQIGQILAKSIKQLTKTMVTVASIVALSKVMSYSGMIGTIAVSLVAVTG
FT                   GFYPFIAPIIGSLGTFITGSDTSANVLFGELQVKAASNLNMNPYWLAAANMSGATAGKM
FT                   ISPQSIAVAAVAIGLEGQEGRLLKEVMKFCFLYILLTCLVVFIMGKALGYL"
FT   CDS_pept        434422..435603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0467"
FT                   /product="putative lactate oxidase"
FT                   /EC_number="1.13.12.4"
FT                   /note="similar to putative lactate oxidase [Streptococcus
FT                   pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80969"
FT                   /db_xref="GOA:C5WF04"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014080"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF04"
FT                   /inference="similar to AA sequence:RefSeq:NP_606695.1"
FT                   /protein_id="BAH80969.1"
FT                   /translation="MVQKTVVTEETTDFVMDFKTSSAEGNVDFINVFDLEKMAQQVIPK
FT                   GAFGYIASGAGDTFTLHENIRSFNHKLIVPHGLKGVDNPSTEITFDGDRLSSPIIMAPV
FT                   AAHKLANEQGEVASAKGVSEFGTIYTTSSYSTTDLPEITTALNGAPHWFQFYYSKDDGI
FT                   NRHIMDRLKEQGVKSIVLTVDATVGGNREVDKRNGFVFPVGMPIVQEYLPDGAGKTMDY
FT                   VYKSAKQALSPKDVEYIAQYSGLPVYVKGPQCAEDTLRALDAGASGIWVTNHGGRQLDG
FT                   GPAAFDSLQEVAETVDKRVPIVFDSGVRRGQHIFKAIASGADLVALGRPVIYGLAMGGS
FT                   IGTRQVFEKLNDELKMVMQLAGTQTVEDIRNFTLRHNPYDSSIPFDQNALRLD"
FT   CDS_pept        435855..437222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cepA"
FT                   /locus_tag="SDEG_0468"
FT                   /product="cell envelope proteinase A"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to cell envelope proteinase A [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80970"
FT                   /db_xref="GOA:C5WF05"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF05"
FT                   /inference="similar to AA sequence:INSD:ABD72254.1"
FT                   /protein_id="BAH80970.1"
FT                   /translation="MEKKQRFSLRKYKLGTVSVLIGSLLFLATSSVSAEEVATTSLTAN
FT                   GSVTQLSAQEHQAKESPVLPVPTTKDSDMAGEVGVEVGKGAQPPIELAAQEGTETDKGG
FT                   EATDPHQTSELPPVNRDVHDWVKTKGAWDRGFKGQGKVIAIIDTGIDANHQAMRLTDVS
FT                   TAKVTSKAAMEERKKAAGIQYGVWLTDKVIFAHNYVENNDKVKEVKFDLFGEEELEGLD
FT                   IKVDVQKVKSSKHYRPQAVEPPKETVIKIEDIQGSLEIDWPEIDDDTKYESHGMHVTGI
FT                   AAGNGIEAAATGERFLGIAPEAQVMFMRVFANDVMGTGDSLFIKAIEDAVALGADAINL
FT                   SLGSANGSQLSGNRALMEALEKAKQAGVSVVVAAGNERVFGSDHDDPFVTNPDYGLVGS
FT                   PSTGRPPTSVAAINNKWVIERLMTVEGLQDRANLNNGKAIYAESVDFKDIKKQPWL"
FT   CDS_pept        437173..438603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cepA"
FT                   /locus_tag="SDEG_0469"
FT                   /product="cell envelope proteinase A"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to cell envelope proteinase A [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80971"
FT                   /db_xref="GOA:C5WF06"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010435"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF06"
FT                   /inference="similar to AA sequence:INSD:ABD72242.1"
FT                   /protein_id="BAH80971.1"
FT                   /translation="MQNLLILKISKNSLGYDLSYPFVYIEQLTEAGYTAKDIKDKIVLI
FT                   ERDPEKTYDDMIAQAKAHGAVGVVMFNNVPGQANRLIRLNPHGMVLPLAFISHEFGKAM
FT                   STLNGNGTGSLMFDSSLSKAPSQKGNEMNHFSNWGLTSDGYLKPDVTAPGGDIYSSYND
FT                   NHYGSQTGTSMAAPQIAGASLLIKQYLEQIKPDLPKDQVADLVKNIMMSNARVHVNPVT
FT                   NVTTSPRQQGAGLLNLEAAVSSGLYVTGKDNYGRISLGNVTDNFSFEVTVHNLSQEAKS
FT                   LRYETELLTDKVNPEEGRFTLTSRLLKTYLGEIIEVPANGQKTITITLDASAFTEELSQ
FT                   QMPNGYYLEGFVRFVDSNNQQNNQVTIPFVGFKGEFENLAVVEESIYQLKAKGEKGFYF
FT                   DESGPKDDIYVGKHFTGLVTLGTDTNVSTATISDNGLHTLGTFRNQDGKFILGRNNQGQ
FT                   PVLAISPNRIFWQIFNRC"
FT   CDS_pept        438674..440605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cepA"
FT                   /locus_tag="SDEG_0470"
FT                   /product="cell envelope proteinase A"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to cell envelope proteinase A [Streptococcus
FT                   pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80972"
FT                   /db_xref="GOA:C5WF07"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF07"
FT                   /inference="similar to AA sequence:INSD:ABD72253.1"
FT                   /protein_id="BAH80972.1"
FT                   /translation="MTFELILDRQKPLLNQVTFDPRTNQFSPAAIEDLGPSGVLRDSVF
FT                   YLETKDNKPYTISINNGYKYVSVADNKQFVARQADSSFILPLDKAELGNFYYMVEDFAG
FT                   NIAIAKLGDHLPKTIGNDLVHLTLTDGNYQKKVGYEDNLDMVATDTGLVTNQAQLAVSH
FT                   RNRPHSQLVTLNQDFFISPNDDGNKDFVAFKGLPNKTYNNLQVTVFAAEDQQRLTPIWF
FT                   SQPGADLSDIESTAWRGITAGGEKVLSGSYQYVITYHDANNHAQEKVFKVSVNHNKPIL
FT                   TQGSFRKDDDVEFFTPGQPQAISSSGIARVEVFYLTKKNGRLFDVVESQHSVSVTDNKV
FT                   LIPQNEDGSYTIPTVEGVSPGDYYYLVEDKAGNVAFTTLPNLRAVGQERGVLSLALDVN
FT                   VLEGKHPISFTYLVRDATGKPIETLDYFNHSSNSLILPFGQYTVELLTYDTNLIELQSD
FT                   KVVSFTLTEHNPFQHIAFAMAKMDSSQVTVHFDRLLPEGSQVSLKTLQGHLIPLNQSLY
FT                   VPKAYGKTVRDGSYQLVVTLPKGYRIEGETRVQAKQNEVHELALRLVKDASEQLLVSDN
FT                   HQQGLTSVETNTESSAVPTVVSSSQNQKKSEAAVQLPTTGDKALVKWSILGFLLISLAA
FT                   LFSRKKMD"
FT   CDS_pept        440818..442482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0471"
FT                   /product="cell shape-determining protein"
FT                   /note="similar to conserved hypothetical protein
FT                   [Streptococcus suis 89/1591]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80973"
FT                   /db_xref="GOA:C5WF08"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF08"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00874690.1"
FT                   /protein_id="BAH80973.1"
FT                   /translation="MMKKRLSLILFGLDFLLLAACYWIYLPALNIWSLAFWSFVIFGLI
FT                   LLLITLVILSAFDMTTTVTRSFKQGLGRKDVTGSFSKHSLTGLVKWLTLVIVMLVGILS
FT                   LITVVNTKLFRAKSYAQVIEVKNADFNKDFPETDLSALALLDRDSAEKIGDTYLGTIDK
FT                   VSQFGISDEYRQITIGKRPYRVSPLEYKSFWKWVTNRQEGIDYYVKVNQTTGKAELVKL
FT                   NKAMKYSHSEYLLRDTMRHLRFQYPMTIFADPSFEVDDNGNPYYVATTYAPKFGLSSQD
FT                   PTGVILLDAVSGKSKYYNLKSVPGWVDRVYSSENVLERVNDHYTYQNGYWNTVFSQTGV
FT                   KQTTDSYNYITIGSDIYLYTGITSATADSSNLGFILVNMRTREITNYKLASATERSAMK
FT                   SAEGEVQEKNYSATAPTLVKLNDKAYYLISLKDAAGLVKSYALVDAEDYQQVTVNNDIQ
FT                   TLIAQFTDRDTSSLSSATVSHKKAKMVSGQVEQLASQIISGTTVYYLASDGNVYKVKAS
FT                   SETTDLLPFLKVGDHFEAELIDDHFLKGFTIVEPNDQ"
FT   CDS_pept        442767..443474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0472"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80974"
FT                   /db_xref="GOA:C5WF09"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF09"
FT                   /inference="similar to AA sequence:RefSeq:YP_599959.1"
FT                   /protein_id="BAH80974.1"
FT                   /translation="MSRKKRKKYQVYEGLRCAMMLCFISGYVNAFTYMTQGKRFAGVQT
FT                   GNLLSFAIRLSEKQLEEALQFLLPMLVFMLGQSFTYFMHRWAKQKGLHWYLLSSFILTG
FT                   IAFGTALFTPFLPSNFTVAALAFFASIQVDTFKTLRGASYANVMMTGNIKNAAYLLTKG
FT                   LYEKNQEITHIGRNTLIVILAFACGVVCSTILSLTYDEYALTPILIPLLYVNYLLAQEF
FT                   YHIQTKIKPIKRA"
FT   CDS_pept        443739..445739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="SDEG_0473"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="similar to methionyl-tRNA synthetase / protein
FT                   secretion chaperonin CsaA [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80975"
FT                   /db_xref="GOA:C5WF10"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF10"
FT                   /inference="similar to AA sequence:RefSeq:YP_601841.1"
FT                   /protein_id="BAH80975.1"
FT                   /translation="MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVF
FT                   YLTGLDEHGQKIQTKAAEAGISPQTYVDNMAKDVKDLWQLLDISYDKFIRTTDDYHEEV
FT                   VAAVFEKLLAQDDIYLGEYSGWYSVSDEEFFTESQLEEVFRDEDGKVIGGIAPSGHQVE
FT                   WVSEESYFLRLSKYADRLVAFFKEQPDFIQPDGRMNEMLKNFIEPGLEDLAVSRTTFTW
FT                   GVPVPSNPKHVVYVWIDALLNYATALGYGQMDHANFDKFWNGTVFHMVGKDILRFHSIY
FT                   WPILLMMLDLPMPERLIAHGWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSL
FT                   PVGSDGTFTPEDYVGRINYELANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDTELS
FT                   QLIDAQLADYHKYMEAVDYPRALEAIWTIIARTNKYIDETAPWVLAKEDGDKAQLASVM
FT                   AHLAASLRVVAHLIQPFMMETSAAIMTQLGLEPVSDLSVLALADFPDNTKVVAKGTPIF
FT                   PRLDMEAEIDYIKAQMGSSSAISQEKEWIPEDVELKSEKDDITFETFDAVEIRVAEVKE
FT                   VSKVEGSDKLLRFRLDAGDGEDRQILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKY
FT                   ISQGMILSAEHGDQLTVLTVDPSVANGSVIG"
FT   CDS_pept        446272..447285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF1"
FT                   /locus_tag="SDEG_0474"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="similar to ribonucleoside-diphosphate reductase beta
FT                   chain [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80976"
FT                   /db_xref="GOA:C5WF11"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF11"
FT                   /inference="similar to AA sequence:RefSeq:YP_599962.1"
FT                   /protein_id="BAH80976.1"
FT                   /translation="MTQHYYERSQSPIDYALSKTKKQLRSVNWNHLNDDKDLEVWNRVT
FT                   QNFWLPEKVPVSNDLTSWRSLGEDWQQLITRTYTGLTLLDTVQATVGDVAQIQHSQTDH
FT                   EQVIYTNFAFMVAIHARSYGTIFSTLCSSEQIEEAHEWVVSTQSLQERARVLIPYYTGN
FT                   DPLKSKVAAAMMPGFLLYGGFYLPFYLSARGKMSNTSDIIRLILRDKVIHNYYSGYKYQ
FT                   QKVAGLSPEKQAEMKTFVFDLLYELIDLEKAYLKELYDGFDLAEDAIRFSLYNAGKFLQ
FT                   NLGYESPFTEEETRVSPEVFAQLSARADENHDFFSGNGSSYVMGITEETTDDDWEF"
FT   CDS_pept        447289..447762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="SDEG_0475"
FT                   /product="ribonucleotide reduction protein"
FT                   /note="similar to NrdI protein [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80977"
FT                   /db_xref="GOA:C5WF12"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF12"
FT                   /inference="similar to AA sequence:RefSeq:YP_601844.1"
FT                   /protein_id="BAH80977.1"
FT                   /translation="MAELIIVYFSSKSNNTHRFVQKLGLPAQRISIDDSPVEVGVDYLL
FT                   IVPTYAAGGSDAKGAVPKQVIHFLNNPTNRKHCKGVISSGNTNFGDTFAIAGPIISQKL
FT                   QVPLLHQFELLGTTTDVKKVQAIFARYRHQKHPKLKNRPMNTIQKGQPHVTPQ"
FT   CDS_pept        447746..449932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE1"
FT                   /locus_tag="SDEG_0476"
FT                   /product="ribonucleoside-diphosphate reductase alphachain"
FT                   /EC_number="1.17.4.1"
FT                   /note="similar to ribonucleoside-diphosphate reductase
FT                   alpha chain [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80978"
FT                   /db_xref="GOA:C5WF13"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF13"
FT                   /inference="similar to AA sequence:RefSeq:YP_599964.1"
FT                   /protein_id="BAH80978.1"
FT                   /translation="MSHPNESYLSFNALTRFKKTDGSYHFDSDAIAVERYLDEQISPNL
FT                   VMFPSLEEKLAYLIKEGYYEQAIFDLYPDDVIKEAFQYAYQQDYRFLNLMGAMKFYQSY
FT                   ALKTLDGKYYLETVEDRVVMNALFLANGDQTLLFNLIKDMLHRRFQPATPTFLNAGKKR
FT                   RGEYISCYLLRIEDNMESISRAIGTSLQLSKRGGGVALCLTNLREIGAPIKEIENQATG
FT                   IVPVMKLLEDSFSYANQLGQRQGAGAVYLHAHHPEVLTFLDTKRENADEKIRIKSLALG
FT                   LVIPDITFQLAKENKEMALFSPYDIKRVYGKDMSDISITEEYNKLLANPAIKKTYISAR
FT                   KLFQLIAELHFESGYPYLLFDDTVNQRNPHAQKGRIVMSNLCSEIAQVSTESTYNDDLS
FT                   FKDIGEDICCNLGSINIAEAMTDAKHFSQLITTSIRALDQVSRASDLSCAPSIEKGNAA
FT                   NHAVGLGAMNLHGFLATNHLYYDSEEAVDFTDLFFHTMAYHAFKASCQLAKEKGAFADF
FT                   ERSTYADGSYFKQYVIEDAKPKTKRIAALLKSYGFQLPTVADWKALVRDIQTYGLANAH
FT                   LLAVAPTGSISYLSSCTPSLQPVVAPVEVRKEGNLGRIYVPAYQINQENYAYYERGAYE
FT                   MGPEPIIKIVAAAQKHVDQAISLTLFMTDQATTRDLNRSYIQAFKLKCASIYYVRVRQE
FT                   VLAGSEQYDEDSQLDSVDKNGLTDTINECQSCMI"
FT   CDS_pept        450230..451564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ-1"
FT                   /locus_tag="SDEG_0477"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /note="similar to branched-chain amino acid transport
FT                   system II carrier protein [Streptococcus agalactiae
FT                   2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80979"
FT                   /db_xref="GOA:C5WF14"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF14"
FT                   /inference="similar to AA sequence:RefSeq:NP_688549.1"
FT                   /protein_id="BAH80979.1"
FT                   /translation="MVKKGFLTGLLLFGIFFGAGNLIFPPALGVASGQDFWPAILGFCL
FT                   SGVGLAILTLLLGTVTNGGYKTEMAQKFSPWFSLTFLVILYLTIGPLFAIPRTATVSFE
FT                   VGLSPIVGHSPIALLLFSACFFVAAYLLAIRPNGILDSVGKLLTPAFALLILLLVLVGA
FT                   VVYGHNDSAKTSVEYAGKAFGTGILAGYNTLDALAAVAFCLVATETLKKFGFQSKKEYL
FT                   STIWVVGIVTSVAFSILYIGLGFLGNKFPVPADVLADPNINKGAYVLSQASYHLFGSFG
FT                   RFFLSVMVTLTCFTTTVGLIVSVSEFFAKSFRFGSYTFFASVFTFVGFLIANLGLNAVI
FT                   TFSIPVLTLLYPIVIVMILIILMNKWVPLSKKGMSLTIGLVTLVSFIEVLASQVHQDAL
FT                   THLVELLPFHAVSMGWLLPTLLGLVVALLLPDKQKGTSFDLSQFD"
FT   CDS_pept        complement(451902..452765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0478"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80980"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF15"
FT                   /inference="similar to AA sequence:RefSeq:YP_599751.1"
FT                   /protein_id="BAH80980.1"
FT                   /translation="MSHLQYTAKSHHLQWSIAQLTQICSQCYRDYCPKSIKHRKNVGLS
FT                   KVSDVSLLVLLLLQAELGITSQRRFYRICHLFFCGNLLERSRFNRRTRQLIGVVQLIRQ
FT                   ALNKPISSDTIVIMDSFPMPLCQPIRNHKAKVFKGLADIGYNASKHLWFYGFKVHMLVT
FT                   LSGVMLNYIVTPASVHDIKVVDELLEGCKQTVVLADLGYLSQELKDKLGHKGYHLWTPL
FT                   RQNMVGAKQHNNRQLLAWRRTIETRFSELCSLFDIEQTLARGLSGLQLRLEQFILAYNL
FT                   KYFEIN"
FT   CDS_pept        453629..453865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0479"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spr0700
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80981"
FT                   /db_xref="InterPro:IPR021361"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF16"
FT                   /inference="similar to AA sequence:RefSeq:NP_358294.1"
FT                   /protein_id="BAH80981.1"
FT                   /translation="MTFEEILPGLKAKRKYVRTGWGGAENYVQLFDSIEQNGQALEVTP
FT                   YFLINVSGEGEGFSMWAPTPCDVLATDWVEVHD"
FT   CDS_pept        453858..454556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0480"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="similar to 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase [Streptococcusagalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80982"
FT                   /db_xref="GOA:C5WF17"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF17"
FT                   /inference="similar to AA sequence:RefSeq:NP_688537.1"
FT                   /protein_id="BAH80982.1"
FT                   /translation="MTKRVLITGVSSGIGLAQARLFLENGYAVYGVDKSAKPDLPGNFQ
FT                   FLQLDLSGDLAALHDFAPHVDIICHTAGILDDYKPLLDISDADIDKIFQVNLFATIRIT
FT                   RHYLPQMVANGSGIIINMCSIASFLAGGGGVAYTASKHALAGFTRQLALDYAKSGIQVF
FT                   GIAPGAVKTAMTQADFEPGGLAQWVADETPIGRWLDPAEIAELTLYLASGKAGAMQGEI
FT                   LKVDGGWSLK"
FT   CDS_pept        454813..455262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0481"
FT                   /product="cytoplasmic protein"
FT                   /note="similar to conserved hypothetical protein
FT                   [Streptococcus agalactiae H36B]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80983"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF18"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00783841.1"
FT                   /protein_id="BAH80983.1"
FT                   /translation="MTAEELWQAYRKINPGIGDEIDAWAFGAQPDLLAQLVLKGIKTAT
FT                   ASAYDLYELDQEPLPQVGTYDVVLDGQGQAVCIVHITKVEVLPFDQVSAEHAYKEGEGD
FT                   RSLAWWRQAHQDFFQPYFEEAGLVFSEQSPIVLEEFQVVYPQLGD"
FT   CDS_pept        455264..456223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0482"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SPs1547
FT                   [Streptococcus pyogenes SSI-1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80984"
FT                   /db_xref="GOA:C5WF19"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF19"
FT                   /inference="similar to AA sequence:RefSeq:NP_802809.1"
FT                   /protein_id="BAH80984.1"
FT                   /translation="MKLAILGTGMIVKDLLPVLQEIKGIDLNAIVSTPRSVDVARELAK
FT                   SFAIPTATSDFDSVLASEDVDTVYIATPNHLHYEGAKKALLAGKHVICEKPFTLTAGEL
FT                   DELVVIAKERKLILLEAITNQYLSNMTFIKEHLDQLGDIKIVECNYSQYSSRYDAFKQG
FT                   DIAPAFDPQKGGGALRDLNIYNIHFVVGLFGSPKKVQYLANMDKGIDTSGMLVMDYEQF
FT                   KVVCIGAKDCTAEIKSTIQGNKGSLAVLGATNTLPQVQLSLHGHEAEVANLNKHEHRMY
FT                   EEFLAFRDMIDQRDFEKVNQALEHSRAVMAVLERAVHS"
FT   CDS_pept        456557..457894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0483"
FT                   /product="phosphoglycerate transporter protein"
FT                   /note="similar to phosphoglycerate transporter protein
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80985"
FT                   /db_xref="GOA:C5WF20"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF20"
FT                   /inference="similar to AA sequence:RefSeq:YP_279819.1"
FT                   /protein_id="BAH80985.1"
FT                   /translation="MEEDYNKREPEKFTQFLRRQKVVFFVAFFGYVCAYLVRNNFKLMS
FT                   NTIMVQNGWDKAQIATLLSCLTVSYGLAKFYMGALGDRVSLRKLFSISLGASALICILI
FT                   GFFNSSMVVLGILLVLCGVVQGALAPASQAMIANYFPNKTRGGAIAGWNISQNMGSALL
FT                   PLTIALLTSMGLVVPANGNILLAFLIPGILVLLFALCCWKLGGDNPESEGLDSLRTMYG
FT                   DAGESAVASEEEKHNLSYWQLIWKYVFCNPSLLLVAAVNVALYFVRFGIEDWMPIYLSQ
FT                   VANMSEAHIHFAISMLEWVAIPGSLVFAWLAVRYPNKMAKIGAIGLFVLAAIVFVYERL
FT                   TATGSPNYFLLLVIAGILGSLIYGPQLIVNILTINFVPLNVAGTAIGFVGVTAYLIGNM
FT                   GANWLMPILADGFGWFWSYIVVAALSAFSAVGYLILAKREEEIIKD"
FT   CDS_pept        458066..459448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="SDEG_0484"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.-"
FT                   /note="similar to UDP-N-acetylglucosamine pyrophosphorylase
FT                   [Streptococcus pyogenes MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80986"
FT                   /db_xref="GOA:C5WF21"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF21"
FT                   /inference="similar to AA sequence:RefSeq:YP_596097.1"
FT                   /protein_id="BAH80986.1"
FT                   /translation="MTNYAIILAAGKGTRMKSDLPKVLHHVSGLTMLEHVFRSVAAIEP
FT                   EQNVTVIGHKADMVRAVLADQSEFVLQTEQLGTGHAVMMAEEKLAGLEGHTLVIAGDTP
FT                   LITGQSLKSLIDFHVNHKNVATILTATAQDPFGYGRIIRNKDGEVIKIVEQKDASDFEQ
FT                   QIKEINTGTYVFDNKRLFEALKNITTNNAQGEYYLTDVISIFRDHKEKVGAYTLRDFNE
FT                   SLGVNDRVALATAEAVMRQRITKKHMVNGVTFQNPETVYIESDVEIAPDVLIEGNVTLK
FT                   GKTRIAAECVLTNGTYIVDSEIGQGSIITNSMIESSTLASGVTVGPYAHIRPGTSLAKD
FT                   VHIGNFVEVKGSHIGEKTKAGHLTYIGNAQVGSKVNVGAGTITVNYDGQNKYQTVIGDY
FT                   AFIGSNSTLIAPLEVGDNALTAAGSTISKTVPADSIAIGRSRQVTKEDYAKRLPHHPSR
FT                   SK"
FT   CDS_pept        459479..460033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0485"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="similar to ADP-ribose pyrophosphatase [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80987"
FT                   /db_xref="GOA:C5WF22"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF22"
FT                   /inference="similar to AA sequence:RefSeq:YP_601859.1"
FT                   /protein_id="BAH80987.1"
FT                   /translation="MEFEEKTLKRQVIFDGHIFKVVVDDVELPNNLGQSKRELIFHRGA
FT                   VAVLAVTPDKKIVIVKQYRKAIEAVSYEIPAGKLEVGESGSELEAAARELEEETAYTGH
FT                   LSLLYEFYTAIGFCNEKIKLYLATDLEKVPNPKPQDEDEVIEVLELTYEDCMELVSQGK
FT                   LADAKTLIALQYYALQFGGDR"
FT   CDS_pept        460303..460998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="SDEG_0486"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="similar to 5'-methylthioadenosine/S-
FT                   adenosylhomocysteine nucleosidase[Streptococcus pyogenes
FT                   MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80988"
FT                   /db_xref="GOA:C5WF23"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF23"
FT                   /inference="similar to AA sequence:RefSeq:YP_596100.1"
FT                   /protein_id="BAH80988.1"
FT                   /translation="MKIGIIAAMEEELRLLLENVLDCQVHQVLSNTYYTGRLGQHDLVL
FT                   VQSGIGKVMSAMTVAILVDHFDVDAIINTGSAGAVAPGLAIGDVVVADQLVYHDVDVTA
FT                   FGYAYGQMAAQPLYFNCDPQFVNTFKEVLAQSSTGSRVGLIATGDSFIAGQDKIDNIKT
FT                   VFPTVLAVEMEGAAIAQAAHATGKPFIVVRAMSDTAAHDANITFDQFIIEAGKKSAQTL
FT                   MAFLEKLAV"
FT   CDS_pept        complement(461071..461718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scaR"
FT                   /locus_tag="SDEG_0487"
FT                   /product="iron-dependent repressor"
FT                   /note="similar to iron-dependent repressor [Streptococcus
FT                   pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80989"
FT                   /db_xref="GOA:C5WF24"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF24"
FT                   /inference="similar to AA sequence:RefSeq:YP_279825.1"
FT                   /protein_id="BAH80989.1"
FT                   /translation="MTPNKEDYLKCIYEIGEQESKISNKMVAEKMQVSAPAVSEMIKKM
FT                   ISQGWIVKEKAKGYLLTDKGQVLVANLYRKHRLIEVFLIHQLGYNAQEVHQEAEVLEHT
FT                   VSDTFIDRLDETLGFPTFCPHGGTIPRNGQPLVEINHTTLNTITDLGRFRLSRIHDQFD
FT                   LIQYLEAHGLKINTELELTQIDTFAKTYTIQYLDKELIIPENIAKQLYVTAL"
FT   CDS_pept        461864..462796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsA"
FT                   /locus_tag="SDEG_0488"
FT                   /product="manganese-binding protein"
FT                   /note="similar to manganese-binding protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80990"
FT                   /db_xref="GOA:C5WF25"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF25"
FT                   /inference="similar to AA sequence:RefSeq:YP_281731.1"
FT                   /protein_id="BAH80990.1"
FT                   /translation="MKKKISLILSAFLAAFLLVACSSSGSQADKSDKLKVVVTNSILAD
FT                   MTKTIAGDKIDLHSIVPIGQDPHEYEPLPEDVEKTNNADVIFYNGINLEDGGQAWFTKL
FT                   VKNAQKKKNKDYFAASDGVDVIYLEGESEKGKEDPHAWLNLENGIIYSKNIAKQLMAKD
FT                   PKNKETYEKNLKAYVAKLEKLDKEAKSKFDAIPANKKLIVTSEGCFKYFSKAYGVPSAY
FT                   IWEINTEEEGTPDQMSSLIEKLKVVKPAALFVESSVDRRPMETVSKDSGIPIYAEIFTD
FT                   SVAKKGEDGDSYYAMMKWNLDKISEGLAK"
FT   CDS_pept        462861..463586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsB"
FT                   /locus_tag="SDEG_0489"
FT                   /product="manganese transport system ATP-binding protein"
FT                   /note="similar to manganese transport system ATP-binding
FT                   protein [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80991"
FT                   /db_xref="GOA:C5WF26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF26"
FT                   /inference="similar to AA sequence:RefSeq:YP_281732.1"
FT                   /protein_id="BAH80991.1"
FT                   /translation="MITTTNLSVSYDGDSNALDNISLTIEGPAIVGIIGPNGAGKSTFM
FT                   KSVLNLIDYRGQVRVDDKDGRKLGHTVAYVEQRSMIDYHFPITVKECVALGTYRKLGLF
FT                   RRVGKKEFDQVERFLEQVGLAGFGNRPIKSLSGGQFQRMLVARCLIQESDYIFLDEPFV
FT                   GIDSVSEKIIVDLLKELKAAGKTILIVHHDLSKVEHYFDKLLILNKTLVAYGKVDDVFT
FT                   VDTLSKAYGNHLILGKEMV"
FT   CDS_pept        463587..464435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtsC"
FT                   /locus_tag="SDEG_0490"
FT                   /product="metal cation ABC transporter membrane protein"
FT                   /note="similar to metal cation ABC transporter membrane
FT                   protein [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80992"
FT                   /db_xref="GOA:C5WF27"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF27"
FT                   /inference="similar to AA sequence:RefSeq:YP_001129019.1"
FT                   /protein_id="BAH80992.1"
FT                   /translation="MSLKFFEGLMSYHFLQNALVTAIVIGVVSGAVGCFIILRSMSLMG
FT                   DAISHAVLPGVALSFILGINFFIGAIVFGLLASVIITYIKENSVIKGDTAIGITFSSFL
FT                   ALGIILIGVANSSTDLFHILFGNILAVQDSDKWITIGVSVFVLGVIILFFKELLITSFD
FT                   PILAKSMGMNVNAYHYMLMILLTLVSVTAMQSVGTILIVALLITPAATAYLYANSLKVM
FT                   LVMSSAIGALSSVLGLYLGYTFNVAAGSSIVLTSAAIFLISFFISPKQGYIKKVMMTKS
FT                   K"
FT   CDS_pept        complement(464566..465372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0491"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="similar to peptidyl-prolyl cis-trans isomerase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80993"
FT                   /db_xref="GOA:C5WF28"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF28"
FT                   /inference="similar to AA sequence:RefSeq:YP_281734.1"
FT                   /protein_id="BAH80993.1"
FT                   /translation="MKKLLSLSLLAVSLLSLSACESVDRAIKGDKYVDGKIAKEESEAA
FT                   SKAYEENIQKALKADASQFPQLNKEVVKDEAKVVMKTSQGDITLKLFPKYAPLAVENFL
FT                   THAKNGYYDKVTFHRVINDFMIQAGDPKGNGTGGESIWKGKDAKKDAGNGFANEISPFL
FT                   YNIRGALAMANAGADTNGSQFFINQNKKNQSKSLSSANYPKPIISAYEQGGNPSLDGGY
FT                   TVFGQVIEGMDIVDNIAAVAVGQNDKPVDDITIHSIEVIKDYRFNK"
FT   CDS_pept        465491..467998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="SDEG_0492"
FT                   /product="cell division protein"
FT                   /note="similar to cell division protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80994"
FT                   /db_xref="GOA:C5WF29"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF29"
FT                   /inference="similar to AA sequence:RefSeq:YP_281735.1"
FT                   /protein_id="BAH80994.1"
FT                   /translation="MTVIIAQDKEYTLKIASFFRFYFLMSKKWYNDIMAKRTQRKKSAP
FT                   KKRLTKAEIERQRAIKRMVSSILIALLLVFAMIRLGVFGITAYNVIRFMVGSLAYPFML
FT                   AILVYLFFFKWLRQRDGVIAGFIIVFIGLLIEWHAYLFAMPKMINQDVFRGTASLITRD
FT                   LMAFRVTEFVGGGMFGALLYKPVAFLFSNIGSYFIGFLFILLGLFLMTPWDIYDVSHFV
FT                   KEAVNKLAMAYQENKEKRFIKREERRLLAEQEALEKQAQEEEKRLAELTVDSETGEIVE
FT                   DSQSQASYDLADDMTTEPEILSYDSHFKDDETSLFDQEDLAYAEEEIGAEDNQLSALGF
FT                   SEDEMDMDEPVEVDFTPKTNLLYKLPTIDLFAADKPKNQSKEKNLVRKNIKVLEDTFQS
FT                   FGIDVKVERAEIGPSVTKYEIKPAVGVRVNRISNLADDLALALAAKDVRIEAPIPGKSL
FT                   VGIEVPNSEIATVSFRELWEQSNTSDDKLLEVPLGKAVNGSARSFDLTRMPHLLVAGST
FT                   GSGKSVAVNGIISSILMKARPDQVKFLMVDPKMVELSVYNDIPHLLIPVVTNPRKASKA
FT                   LQKVVDEMENRYELFSKVGVRNIAGYNAKVEDYNRQSEQKQMPLPLIVVIVDELADLMM
FT                   VASKEVEDAIIRLGQKARAAGIHMILATQRPSVDVISGLIKANVPSRIAFAVSSGTDSR
FT                   TILDENGAEKLLGRGDMLFKPIDENHPVRLQGSFISDDDVERIVNFIKDQAEADYDDSF
FT                   DPGEVSDNDPGFSGNGGAAEGDPLFEEAKALVLETQKASASMIQRRLSVGFNRATRLMD
FT                   ELEEAGVIGPAEGTKPRKVLQTN"
FT   CDS_pept        complement(468067..468420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0493"
FT                   /product="integral membrane protein"
FT                   /note="similar to integral membrane protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80995"
FT                   /db_xref="GOA:C5WF30"
FT                   /db_xref="InterPro:IPR024515"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF30"
FT                   /inference="similar to AA sequence:RefSeq:YP_281736.1"
FT                   /protein_id="BAH80995.1"
FT                   /translation="MMIYKLTALAFLILTPLFAMIVTSLLRLNKKGLKFPDVALFLFAI
FT                   EIVLVSGKFFTHNLLPYYLIIMSLLAIVISLLLVVRTQSFSYHRFMKLFWRVGFLVTFI
FT                   FYLILVIFIFTLA"
FT   CDS_pept        complement(468576..469604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0494"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80996"
FT                   /db_xref="GOA:C5WF31"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF31"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH80996.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIARLLGRH
FT                   RSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLKLNGCSARFIA
FT                   QLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI
FT                   RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLILGKKTKGEAVMLTLVERQT
FT                   RYALGVKLEDKQSQTINRAVTHLISQYPIASITADNGSEFSLLSTLEAVDVYFAHPYSS
FT                   HERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLLQYQSSTFLFELAR
FT                   TA"
FT   CDS_pept        469762..470265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="SDEG_0495"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="similar to LSU ribosomal protein L11P [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80997"
FT                   /db_xref="GOA:C5WF32"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF32"
FT                   /inference="similar to AA sequence:RefSeq:YP_601870.2"
FT                   /protein_id="BAH80997.1"
FT                   /translation="MRYAICISVGGKNLNYRQNHNRRIFKMAKKVEKLVKLQIPAGKAT
FT                   PAPPVGPALGQAGINIMGFTKEFNARTADQAGMIIPVVISVYEDKSFDFITKTPPAAVL
FT                   LKKAAGVEKGSGTPNKTKVATVTRAQVQEIAETKMPDLNAANIEAAMRMIEGTARSMGF
FT                   TVTD"
FT   CDS_pept        470371..471060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="SDEG_0496"
FT                   /product="50S ribosomal protein L1"
FT                   /note="similar to 50S ribosomal protein L1 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80998"
FT                   /db_xref="GOA:C5WF33"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF33"
FT                   /inference="similar to AA sequence:RefSeq:YP_281738.1"
FT                   /protein_id="BAH80998.1"
FT                   /translation="MAKKSKQMRAALEKVDSTKAYSVEEAVALVKETNFAKFDASVEVA
FT                   YNLNIDVRKADQQIRGAMVLPNGTGKTQRVLVFARGAKAEEAKAAGADFVGEDDLVAKI
FT                   NGGWLDFDVVIATPDMMAIVGRLGRVLGPRNLMPNPKTGTVTMDVAKAVEESKGGKITY
FT                   RADKAGNVQALIGKVSFDADKLVENFKAFHDVMAKAKPATAKGTYMTNVSITSTQGVGI
FT                   KVDPNSL"
FT   CDS_pept        471967..472695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SDEG_0497"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="similar to uridylate kinase [Streptococcus pyogenes
FT                   str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAH80999"
FT                   /db_xref="GOA:C5WF34"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF34"
FT                   /inference="similar to AA sequence:RefSeq:YP_001129014.1"
FT                   /protein_id="BAH80999.1"
FT                   /translation="MEPKYQRILIKLSGEALAGDKGVGIDIPTVQSIAKEIAEVHASGV
FT                   EIALVIGGGNLWRGEPAAEAGMDRVQADYTGMLGTVMNALVMADSLQHYGVDTRVQTAI
FT                   PMQNVAEPYIRGRALRHLEKGRIVVFGAGIGSPYFSTDTTAALRAAEIEADAILMAKNG
FT                   VDGVYNADPRKDANAVKFDELTHGEVIKRGLKIMDATASTLSMDNDIDLVVFNMNEAGN
FT                   IKRVVFGEHIGTTVSNKACE"
FT   CDS_pept        472724..473281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SDEG_0498"
FT                   /product="ribosome releasing factor"
FT                   /note="similar to ribosome releasing factor [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81000"
FT                   /db_xref="GOA:C5WF35"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF35"
FT                   /inference="similar to AA sequence:RefSeq:YP_281743.1"
FT                   /protein_id="BAH81000.1"
FT                   /translation="MANAIIETAKERFAQSHHSLSREYASIRAGRANASLLDRIQVDYY
FT                   GAPTPLNQLASITVPEARVLLISPFDKSSIKDIERALNASDLGITPANDGSVIRLVIPA
FT                   LTEETRKELAKEVKKVGENAKIAIRNIRRDAMDDAKKQEKAKEITEDELKTLEKDIQKA
FT                   TDDAIKEIDRMTAEKEKELLSV"
FT   CDS_pept        473390..474247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0499"
FT                   /product="s1 RNA binding domain"
FT                   /note="similar to s1 RNA binding domain [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81001"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF36"
FT                   /inference="similar to AA sequence:RefSeq:YP_281744.1"
FT                   /protein_id="BAH81001.1"
FT                   /translation="MNDLLATVITGLIKEENANDYFIQKEGFTFTLSKAEGERQIGDMV
FT                   TGFAYTDIKQKARLTTKEIRSTRTSYGWGEVTEVRRDLGVFVDTGIPNKEIVVSLDVLP
FT                   EMKELWPKKGDKLYIRLEVDKKDRIWGIPAEPEVFQKMASPAYNNMQNQHWPAIVYRLK
FT                   LTGTFVYLPENNMLGFIHPSERYAEPRLGQVLDARVIGFREVDRTLNLSLKPRSFEMLE
FT                   NDAQMIVTYLEANGGFMTLNDKSSPEDIKTTFGISKGQFKKALGGLMKAKRIKQDATGT
FT                   ELIG"
FT   CDS_pept        474320..474829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="SDEG_0500"
FT                   /product="methionine sulfoxide reductase A"
FT                   /EC_number="1.8.4.11"
FT                   /note="similar to methionine sulfoxide reductase A
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81002"
FT                   /db_xref="GOA:C5WF37"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF37"
FT                   /inference="similar to AA sequence:RefSeq:NP_606727.1"
FT                   /protein_id="BAH81002.1"
FT                   /translation="MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVC
FT                   AKTTGHTEAVEIIFDPEEISYEELVELYWAQTDPTDAFGQFEDRGDNYRPVIYYTTKRQ
FT                   KEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEEYHQGFYKKNPQRYAQSSAIRHQF
FT                   LEENWS"
FT   CDS_pept        474826..475041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0501"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="similar to D-alanyl-D-alanine carboxypeptidase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81003"
FT                   /db_xref="GOA:C5WF38"
FT                   /db_xref="InterPro:IPR010673"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF38"
FT                   /inference="similar to AA sequence:RefSeq:YP_281746.1"
FT                   /protein_id="BAH81003.1"
FT                   /translation="MRKSFYSWLMTQRNPKSNEPLAILADLVFDDTTFPKHTNDFETIS
FT                   RYLEDQAGFSFNLGQFDEIWEDYLAH"
FT   CDS_pept        475200..476396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0502"
FT                   /product="surface antigen"
FT                   /note="similar to surface antigen [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81004"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF39"
FT                   /inference="similar to AA sequence:RefSeq:YP_281747.1"
FT                   /protein_id="BAH81004.1"
FT                   /translation="MIINKKSLFVTTVALSLVPFATTEAQEWTPRSVAEIKSELILTDN
FT                   VLTYTVKYGDTLSTIAEAMNIDVNVLGRINNIANIDLIFPDTILTATYNYQNQATTLTV
FT                   QAPSSQAYLGDANANLATDQVTVQEQTTGATASVTAPSAMTGAAAATPVVPTLPSTPAP
FT                   AAPTVVAPAAEAPVTVPTEVITDAPVAPAVPEVQPAEVVAEPVTEEPAVVTNPEVTVEE
FT                   EVPATPETVVPETVVEPVTPVVPVEETPAAEVAAPAEPVVDPTTIATSNGLSYAPNHAY
FT                   NPMNAGLQPKTAAFKEEVASAYGITSFSGYRPGDPGDHGKGLAIDFMVPESSTLGDQVA
FT                   QYAIDHMAERGISYVIWKQRFYAPFASIYGPAYTWNPMPDRGSVTENHYDHVHVSFSG"
FT   CDS_pept        476620..478479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0503"
FT                   /product="67 kDa Myosin-crossreactive antigen"
FT                   /note="similar to 67 kDa Myosin-crossreactive antigen
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81005"
FT                   /db_xref="GOA:C5WF40"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF40"
FT                   /inference="similar to AA sequence:RefSeq:YP_281748.1"
FT                   /protein_id="BAH81005.1"
FT                   /translation="MSKLVTRRQVFSNCSRIHICLFEIKGGLEMYYTSGNYEAFATPRK
FT                   PKDVDQKSAYIVGTGLAGLAAAVFLIRDGHMAGERIHLFEELPLAGGSLDGIEKPHLGF
FT                   VTRGGREMENHFECMWDMYRSIPSLEIPGASYLDEFYWLDKDDPNSSNCRLIHKRGNRV
FT                   DDDGQYTLGKQSKELINLIMKTEESLGDQTIEEFFSEDFFKSNFWVYWATMFAFEKWHS
FT                   AVEMRRYAMRFIHHIDGLPDFTSLKFNKYNQYDSMVKPIIAYLESHDVDIQFDTKVTDI
FT                   QVEQTAGKKVAKTIHMTVSGEAKAIELTPDDLVFVTNGSITESSTYGSHHEVAKPTKAL
FT                   GGSWNLWENLAAQSDDFGHPKVFYQDLPAESWFVSATATIKHPAIEPYIERLTHRDLHD
FT                   GRVNTGGIITITDSNWMMSFAIHRQPHFKEQKDNETTVWIYGLYSNIEGNYVHKKIEEC
FT                   TGQEITEEWLYHLGVPVDKIKDLASQDYINTVPVYMPYITSYFMPRVKGDRPKVIPDGS
FT                   VNLAFIGNFAESPSRDTVFTTEYSIRTAMEAVYSLLNVERGVPEVFNSVYDIRELLKAF
FT                   YYLNDKKAIKDMDLPIPGLIEKIGRKKLKGTFIEELLQEAHLM"
FT   CDS_pept        478640..479701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="SDEG_0504"
FT                   /product="phosphate starvation-induced protein"
FT                   /note="similar to PhoH protein [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81006"
FT                   /db_xref="GOA:C5WF41"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF41"
FT                   /inference="similar to AA sequence:RefSeq:YP_281749.1"
FT                   /protein_id="BAH81006.1"
FT                   /translation="MQEYSVDITLTHPDDVLALFGSNERHLKLIEDHLGVIIHARTERI
FT                   QIISDDEEAVALAQLTIQALLILVARGMVVNTSDVVTALSMAESDKIDQFVALYEEEII
FT                   KDNYGKAIRVKTLGQKTYVDSVKRHDVVFGVGPAGTGKTFLAVTLAVTALKRGQVKRII
FT                   LTRPAVEAGESLGFLPGDLKEKVDPYLRPVYDALYHILGKEQTTRLMERDVIEIAPLAY
FT                   MRGRTLDDAFVILDEAQNTTIMQMKMFLTRLGFNSKMIVNGDTSQIDLPRNVKSGLIDA
FT                   TQKLQGIKQIDFVYFSAKDVVRHPVVADIIKAYETSSEETKDLAEPKANNIDDDHQSGL
FT                   TQYPVIGQNPNDN"
FT   CDS_pept        479748..480323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0505"
FT                   /product="uracil DNA glycosylase superfamily protein"
FT                   /note="similar to uracil DNA glycosylase superfamily
FT                   protein [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81007"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF42"
FT                   /inference="similar to AA sequence:RefSeq:YP_281750.1"
FT                   /protein_id="BAH81007.1"
FT                   /translation="MDDLTTAIMADEDNRYYTERSIEPLYAAPKTARIIIVGQAPGIVA
FT                   QETKLYWNDRSGIRLRDWLGVDNDTFYRSGLFGIIPMDFYYPGKGKSGDLPPRNGFAAK
FT                   WHPPLRELMPEVELTILVGRYAQDFYLGNKAYKTLTETVRHFADYLPDYFPLVHPSPRN
FT                   QLWLAKNSWFEQDLLPILQKRVEAILAK"
FT   CDS_pept        480431..480979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0506"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0388
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81008"
FT                   /db_xref="GOA:C5WF43"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF43"
FT                   /inference="similar to AA sequence:RefSeq:YP_281751.1"
FT                   /protein_id="BAH81008.1"
FT                   /translation="MPIISSEVGSLPLTINLMYIEMIDETGQVSQEIMEQTIDLLNFAA
FT                   QKTGKEEKEMSVTFVTNARSHELNLEYRDTDRPTDVISLEYKPETPILFSQDDLAADPS
FT                   LAEMMAEFDAYIGELFISIDKAREQAEDYGHSFEREMGFLAVHGFLHINGYDHYTPEEE
FT                   KEMFTLQEEILTAYGLTRQ"
FT   CDS_pept        480960..481367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgk"
FT                   /locus_tag="SDEG_0507"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="similar to diacylglycerol kinase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81009"
FT                   /db_xref="GOA:C5WF44"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF44"
FT                   /inference="similar to AA sequence:RefSeq:YP_281752.1"
FT                   /protein_id="BAH81009.1"
FT                   /translation="MALHDNNTTKRKWKNRTITSSLEFALTGVFTAFKEERNLRSHLFS
FT                   AFLACVAGLVFSISAIEWLFLLLAIFLVITLEIVNSAIENVVDLASDYHFSMLAKNAKD
FT                   MAAGAVLMISGYAVLTGLIIFIPKLWNILVH"
FT   CDS_pept        481488..482384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="SDEG_0508"
FT                   /product="GTP-binding protein"
FT                   /note="similar to GTP-binding protein Era [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81010"
FT                   /db_xref="GOA:C5WF45"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF45"
FT                   /inference="similar to AA sequence:RefSeq:YP_281753.1"
FT                   /protein_id="BAH81010.1"
FT                   /translation="MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMG
FT                   IYTTETEQIVFIDTPGIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMI
FT                   IERLKAAKIPVILVINKIDKVHPDQLLAQIDDFRSQMEFKEVVPISALEGNNVPTLIKL
FT                   LTDNLEEGFQYFPEDQITDHPERFLVSEMIREKVLHLTQQEVPHSVAVVVESMKRDEET
FT                   DKVHIRATIMVERDSQKGIIIGKQGAMLKKIGKMARRDIELMLGDKVYLEMWVKVKKNW
FT                   RDKKLDLADFGYNEKEY"
FT   CDS_pept        482571..482924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0509"
FT                   /product="phosphohydrolase"
FT                   /EC_number="3.1.-.-"
FT                   /note="similar to phosphohydrolase [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81011"
FT                   /db_xref="GOA:C5WF46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF46"
FT                   /inference="similar to AA sequence:RefSeq:YP_601884.1"
FT                   /protein_id="BAH81011.1"
FT                   /translation="MTQDYVSYIRSKVGHATIIMTFTGGILADEEGRVLLQLRGDKKTW
FT                   AIPGGAQELYESTYETCRREFLEETGVAVTPVRLLNTYTNFQETYPNGDQVQTVAFVLQ
FT                   KVQHHQKVPYDSP"
FT   CDS_pept        complement(482707..484113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0510"
FT                   /product="bacteriocin processing peptidase"
FT                   /note="similar to bacteriocin processing peptidase /
FT                   bacteriocin export ABC transporter [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81012"
FT                   /db_xref="GOA:C5WF47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF47"
FT                   /inference="similar to AA sequence:RefSeq:YP_601902.1"
FT                   /protein_id="BAH81012.1"
FT                   /translation="MTSCKRTFVPQIDARDCGIAALASIAKFYGSDYSLAHLRELAKTN
FT                   KEGTTALGIVKAAKEMGFETRAIQADMTLFDMSDVPYPFIVHVNLVQNTKLFLLSLISI
FT                   PIYIIIIFTFMKPFEKMNNDVMQSNSMVSSAIIEDINGIETIKSLTSEEIRYQKIDSEF
FT                   VDYLDKSFKLSKYSILQSSLKQGAQLILNVIVLWFGAKLVMGGKISVGQLITFNTLLSY
FT                   FTNPLENIINLQTKLESAKVANNRLNEVYLVKSEFQKEQALTDTYCLYGDIQFADLSYK
FT                   YGFGRDTLSDISLTIKEGEKVSIVGINGSGKTTLAKMIVNFFEPYKGQISINHQNLKMI
FT                   DKKVLRQHINYLPQQAYIFSGSILENLTLGANHSTSQEDIMKACEIAQIRKDIEQMPMG
FT                   YHTELSDGAGLSGGQKQRSALGRRWGKFLENSCRYLTVVQVSQQLLFLPRIPDGRSHRL
FT                   IRKVLGRLLE"
FT   CDS_pept        484417..484644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0511"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0398
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81013"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF48"
FT                   /inference="similar to AA sequence:RefSeq:YP_601892.1"
FT                   /protein_id="BAH81013.1"
FT                   /translation="MNTKTLKQFEVMNSEMLAGVEGGWGVWGEAITGLLGGFAPSPTLD
FT                   QLNGKWPIRKPSKPCSPYGTGGTPNACNGL"
FT   CDS_pept        484681..485010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0512"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0399
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81014"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF49"
FT                   /inference="similar to AA sequence:RefSeq:YP_601893.1"
FT                   /protein_id="BAH81014.1"
FT                   /translation="MEVDMLTLYKRQIAEVWEIGRETPQPEWVRDAFRKNYICWLDEHV
FT                   RILMTGLNPSLTTNLKIGATGTVGGGFAGYGMYVLGYPGDFLDVTNHRVISAKKFHKEY
FT                   QIIDG"
FT   CDS_pept        485418..485657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blpM"
FT                   /locus_tag="SDEG_0513"
FT                   /product="bacteriocin BlpM-like"
FT                   /note="similar to bacteriocin BlpM [Streptococcus
FT                   pneumoniae SP6-BS73]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81015"
FT                   /db_xref="GOA:C5WF50"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF50"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01821307.1"
FT                   /protein_id="BAH81015.1"
FT                   /translation="MEQFEVMNSEMLAGVEGGKNNWQTNVWECGLSAVAGWGFGVSICA
FT                   ASGVGVPLMGACGYLGAKSAVTLWAAMTEAKGGV"
FT   CDS_pept        485795..485995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blp"
FT                   /locus_tag="SDEG_0514"
FT                   /product="bacteriocin"
FT                   /note="similar to bacteriocin Blp [Streptococcus pneumoniae
FT                   G54]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81016"
FT                   /db_xref="GOA:C5WF51"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF51"
FT                   /inference="similar to AA sequence:RefSeq:YP_002037203.1"
FT                   /protein_id="BAH81016.1"
FT                   /translation="MLIVISIFQIYLIYLSLKGSDKHNRIIEITGINTFFILFLIYHHI
FT                   NFFCMGYIIFVIFILGLYRKS"
FT   CDS_pept        486540..487289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fasA"
FT                   /locus_tag="SDEG_0515"
FT                   /product="response regulator"
FT                   /note="similar to response regulator FasA [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81017"
FT                   /db_xref="GOA:C5WF52"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF52"
FT                   /inference="similar to AA sequence:RefSeq:YP_601897.1"
FT                   /protein_id="BAH81017.1"
FT                   /translation="MNIFVLEDDFLHQTRIEKIIYKILTDNKLEVNHLEVYGKPNQLLE
FT                   DISERGRHQLFFLDIDIKGEDKKGMEIAVEIRNRDPHAVIVFVTTHSEFMPVSFQYQVS
FT                   ALDFIDKELPEELFSHRIEKAITYVQDNQGKTLAEDSFVFTNVKSQIQVPFSDLLYIET
FT                   SLIPHKLILYSTKQRVEFYGQLSEIVEQDDRLFQCHRSFVVNPYNISSIDRSERLVYLK
FT                   GGLSCIVSRLKIRSLIKVVEELHTKEK"
FT   CDS_pept        487290..488624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0516"
FT                   /product="sensory transduction protein kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="similar to sensory transduction protein kinase
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81018"
FT                   /db_xref="GOA:C5WF53"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF53"
FT                   /inference="similar to AA sequence:RefSeq:YP_601898.1"
FT                   /protein_id="BAH81018.1"
FT                   /translation="MIYLINTIVITLNVVVLLLIHARIFGYRMDTKKSLLGIFTFYICS
FT                   LLSTSLSNLLSVGFLGGLLLYPLFFLLYTRYIARRRVNGSLLLFYSLFPIAFWDVIHSF
FT                   IVYFIVFNISFLKNNYHSNIIIMIFSIVAGTMVLLLIQAFNYDFSHLRKKKLNQRTRMI
FT                   ISIANFSMILYFITIPMIDFIEEVENINFTHYQEMITAIYFLLFICFVNLLDRNLRQEL
FT                   QKQVVLQKELQLQNMARYSKQIEGLYQNIRSFRHDYANILTSLKIAIDCKDIEMISSIY
FT                   HKVLKDSGKVLKGEKFNLARLRNINDLPLKSLLFVKLSEAQRSSIPVSIEIGEPISIKN
FT                   IELIDFLTLVSILIDNAIEGAAESGIVLCFFEQFGKQTLIVQNDTFEKQINLSTIFERG
FT                   VSSKGNNRGVGLSNVREILESYPTVTLKTVSDQFVFKQILEIEIL"
FT   CDS_pept        complement(488685..488810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0517"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0405
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81019"
FT                   /db_xref="GOA:C5WF54"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF54"
FT                   /inference="similar to AA sequence:RefSeq:YP_601899.1"
FT                   /protein_id="BAH81019.1"
FT                   /translation="MNNKKTKNNFSTLSESELLKVIGGDIFKLVIDHISMKARKK"
FT   CDS_pept        complement(488901..490265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="silD"
FT                   /locus_tag="SDEG_0518"
FT                   /product="hypothetical protein"
FT                   /note="similar to SilD [Streptococcus pyogenes]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81020"
FT                   /db_xref="GOA:C5WF55"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF55"
FT                   /inference="similar to AA sequence:INSD:AAM90902.1"
FT                   /protein_id="BAH81020.1"
FT                   /translation="MNPNLFKSAEFYHRRHHNFATFLILPSVLLVSFLVIFALFAKKEI
FT                   TITSQGELTPTKVIASVQSTSDHTIVVNNLKNNKFIKKGDVIIQYSKTMENSQKKALEK
FT                   RLATLNKQKNGLQILRTSLEQETNLFKGEDEFGYSDTFNHFFKQSQDIITGIAKKNAEV
FT                   NNQASLANHAISVITSQLDELHQKITDYEELKQAINNQEYKLSPDNPHQTALKKYQTQF
FT                   QTQEDNSALKEEYLSQISQNISELESSMANLNIQRASTGNLSLPDTSHRIKIDSLKTQF
FT                   LQNTSQQLTTVENQITELKDQIEQANIQLKNNIIIAPETGTIHLNSEFEGKSLIPNGSE
FT                   VAQIYPDIQKIKEVFITYYVTSEHVSLLKEKQGVRLSLEKVGNQTLTINGTIQTIDKSA
FT                   TKTDQGNLFKVTALSKLSNKDSDVVQYGLQGRVTSVITRKSYFNYYKDKILNSFN"
FT   CDS_pept        complement(490276..492429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0519"
FT                   /product="bacteriocin processing peptidase"
FT                   /note="similar to bacteriocin processing peptidase /
FT                   bacteriocin export ABC transporter [Streptococcus pyogenes
FT                   MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81021"
FT                   /db_xref="GOA:C5WF56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF56"
FT                   /inference="similar to AA sequence:RefSeq:YP_601902.1"
FT                   /protein_id="BAH81021.1"
FT                   /translation="MISYRKTFVAQIDARDCGVAALASIAKYYGSDYSLAHLRELAKTN
FT                   KEGTTALGIVKAAKLMGFETRAIQADMTLFDIEDVPYPFIVHVNKEGKFQHYYVVYQNK
FT                   KNYLIIGDPDPTVKVTKMTKERFTSEWTGVAIFLAPEPSYKPHKDKKNGLISFLPLIFK
FT                   QRSLIFYIILASLLVTLINIVGSYYLQGILDDYIPNQLKSTLGIISIGLIITYILQQMM
FT                   SFSRDYLLTVLSQRLSIDVILSYIRHIFELPMSFFATRRTGEIISRFTDANAIIDALAS
FT                   TILSLFLDVSILTIVGTVLLVQNTNLFLLSLVSVPLYIVIIFIFMHPFEKMNNDVMQSN
FT                   SMVSSAIIEDINGIETIKSLTSEENRYQKIDSEFVDYLDKSFKLSKYSILQSSLKQGAQ
FT                   LILNVIVLWFGAKLVMGGKISVGQLITFNTLLSYFTNPLENIINLQTKLQSAKVANNRL
FT                   NEVYLVDSEFQEAGTLVNQELLHGDIQFEELSYKYGFGRDTLSNINLTIKQGDKVSLVG
FT                   ISGSGKTTLAKMIVNFFEPYNGRITINHNDLKMIDKKSLRQHINYLPQQAYIFNGSILE
FT                   NLTLGANDCTSHEDILRACEVAEIRQDIEQMPMGYQTELSDGAGLSGGQKQRIALARAL
FT                   LTKAPVLILDEATSGLDVLTEKRVIDNLLAMTDKTIIFVAHRLSISARTNQVIVLDEGK
FT                   IIEIGSHQELMTKQGFYHHLFSS"
FT   CDS_pept        492824..493852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0520"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81022"
FT                   /db_xref="GOA:C5WF31"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF31"
FT                   /inference="similar to AA sequence:RefSeq:YP_599593.1"
FT                   /protein_id="BAH81022.1"
FT                   /translation="MNMSNINSTRKSSYSHLSATERGEIAAYLKMGKKPVEIARLLGRH
FT                   RSTICREIKRGSVEQVKDKNGKQTFFNAYFADSGQRVYETNRQKSSYLKLNGCSARFIA
FT                   QLESALTANIRLHSVDSFVQTYKVNHPEEVVPSTKTIYRYIKEGLLAIKPIDLPKMVSI
FT                   RKRSKKVMKTNKKTLGKSIEERPEYINDRSEFGHWEIDLILGKKTKGEAVMLTLVERQT
FT                   RYALGVKLEDKQSQTINRAVTHLISQYPIASITADNGSEFSLLSTLEAVDVYFAHPYSS
FT                   HERGTNENFNGLLREYVPKGISLNPLTSEELDNYLTAINERPRRLLQYQSSTFLFELAR
FT                   TA"
FT   CDS_pept        494133..494333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0521"
FT                   /product="hypothetical membrane associated protein"
FT                   /note="similar to hypothetical membrane associated protein
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81023"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF58"
FT                   /inference="similar to AA sequence:RefSeq:YP_598008.1"
FT                   /protein_id="BAH81023.1"
FT                   /translation="MTTMKELTINDMASISGGNAPGDAVIGGLGGLASGLKFCKLPHPV
FT                   LTGGCVVGFTVGGAYLGYTAN"
FT   CDS_pept        494628..494822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0522"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy0424
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81024"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF59"
FT                   /inference="similar to AA sequence:RefSeq:YP_059742.1"
FT                   /protein_id="BAH81024.1"
FT                   /translation="MEVLKNGLASINGGGKDGANIFLTGMAGAAQGVTVCAQTGVFIPW
FT                   QGYILCGAAGAATNIIWPH"
FT   CDS_pept        494872..495132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0523"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SPs1514
FT                   [Streptococcus pyogenes SSI-1]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81025"
FT                   /db_xref="GOA:C5WF60"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF60"
FT                   /inference="similar to AA sequence:RefSeq:NP_802776.1"
FT                   /protein_id="BAH81025.1"
FT                   /translation="MKILDIIFNLSDRKMIFLENVEKLGGYIVPFTLIILSVAYNFRHP
FT                   YPIWAAILGGISLIVIFIYFILIVYLYLRYRYLVWKKNTRN"
FT   CDS_pept        495348..495758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0524"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0413
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81026"
FT                   /db_xref="GOA:C5WF61"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF61"
FT                   /inference="similar to AA sequence:RefSeq:YP_601907.1"
FT                   /protein_id="BAH81026.1"
FT                   /translation="MRNILRFLGIVIISAVILFSIGSFYDLPLMKNIQLICWSFILDLF
FT                   VFVYKQRQTTEVLTWYQVVKQFWLFIKCTILIPTLIAFIIIIGCLTSISEVSIYFYLHL
FT                   IVVCYTIGMILSLGRLISPNHSIFNKLKKRNE"
FT   CDS_pept        complement(495788..495931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0525"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M6 Spy0427
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81027"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF62"
FT                   /inference="similar to AA sequence:RefSeq:YP_059745.1"
FT                   /protein_id="BAH81027.1"
FT                   /translation="MPRQLLLLCCCNFGKDEYSRIENRLFLKLQRYLLVTNYSLIESVT
FT                   LN"
FT   CDS_pept        496274..496504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0526"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="similar to CAAX amino terminal protease family
FT                   protein [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81028"
FT                   /db_xref="GOA:C5WF63"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF63"
FT                   /inference="similar to AA sequence:RefSeq:NP_735994.1"
FT                   /protein_id="BAH81028.1"
FT                   /translation="MFVMRTFGNSLSGLLVVILSSILFSWSHLHGLSIIDFVVYFGIGL
FT                   IFASLYHYTKSIYYSIGVHIVWNSLPYIFIF"
FT   CDS_pept        496903..497667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0527"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS2096 Spy0420
FT                   [Streptococcus pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81029"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF64"
FT                   /inference="similar to AA sequence:RefSeq:YP_600016.1"
FT                   /protein_id="BAH81029.1"
FT                   /translation="MFSSDQPYQVVLYRGEVNTVRFTYTNQMYLMKDIRIALDGSGKSL
FT                   TAQTVPGMGHVYEGFQTSARGIFTMSGVPESTIPVANPNAQTKYTRYFKVIDDMHNTMY
FT                   KGTVFLVQPQAWKYTMKSIDQLVVDDLNHIGADDIERMTTLIKTAGALLTTGGSGSLPD
FT                   NIKISINPRGGQAMIIYGDGSTDIIPPAVLWKKRLEKDNAEEGLTTSPKIVHDVRDSEQ
FT                   EEGDHDDEEQTGEPIFLRRKELSRTLFKNLGK"
FT   CDS_pept        complement(497689..498717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0528"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1491
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81030"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF65"
FT                   /inference="similar to AA sequence:RefSeq:NP_688485.1"
FT                   /protein_id="BAH81030.1"
FT                   /translation="MKIKKIVSSLAAALLVSSLSALNYEVKADDTTDGYHYYVTQQDRY
FT                   GQIVNYINEQHRLLNQYVVENVNAFDQLNAKSAVDRLNSAIASFKQTDDQLLAQLKVGR
FT                   ISNSDYNAIVQQRNAISQTVQRLVDQENSKLQTSQNQYAQLIKQRNQAAVNGYKAEVAN
FT                   LQQEVDAISTDAIEAETAKLAAITVNGNSPVRVSTDNVEDTHTQPLATETDQEAAEREE
FT                   HSATPVPVAPQAESTNIADYDNLKEVLRSNISNHVPHISVQMEFKTQDQVNEYQQQLGG
FT                   IIRAIGDELGTATSFASQSRISTYTLGGEIQRIVVNTKDGVVKPVITMTVEQVEIPLDD
FT                   QP"
FT   CDS_pept        498944..499798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutR"
FT                   /locus_tag="SDEG_0529"
FT                   /product="transcriptional regulator"
FT                   /note="similar to transcriptional regulator [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81031"
FT                   /db_xref="GOA:C5WF66"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF66"
FT                   /inference="similar to AA sequence:RefSeq:YP_601914.1"
FT                   /protein_id="BAH81031.1"
FT                   /translation="MEKELGKTLRRLRQGKQVSISSLADEHLSKSQISRFERGESEISC
FT                   SRLLNLLDKLNITIDEFVSTHSKTHTHFFTLLSRVRKYYAEKNVAKLLKLLEDYAHKDY
FT                   ESTMIKAILSSIEPTVEPSEEEVTRLTDYLFSVEQWGYYEIILLGNCSRFINYNTLFLL
FT                   TKEMVTSFAYSEQNKTNKTLVTQLSINCLIISIDYSYFDHSDYLIEKIEFLLRDELNFY
FT                   EKTVFLYVHGYYKLKQGQVSGKDDMRQALQIFKYLGEDALYYSYKEHYRKEVLGDEEDK
FT                   KEG"
FT   CDS_pept        499980..500807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpg"
FT                   /locus_tag="SDEG_0530"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="similar to formamidopyrimidine-DNA glycosylase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81032"
FT                   /db_xref="GOA:C5WF67"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF67"
FT                   /inference="similar to AA sequence:RefSeq:YP_281771.1"
FT                   /protein_id="BAH81032.1"
FT                   /translation="MPELPEVETVRRGLESLVLGQEIVAVKVEVPKMVKSDLRIFLQTL
FT                   PGQTIQTIGRRGKYLVFDFGQTVLVSHLRMEGKYLLFPDEVPEQKHFHVFFTLKNGSTL
FT                   VYQDVRKFGTFDLIPKSQLSDFFAQRKLGPEPKKETFKLKPFEVALQSSKKLIKPYLLD
FT                   QTLVAGLGNIYVDEVLWAAKVHPERLSFSLKKAEIKRLHDETIRILQLGIEKGGSTVRT
FT                   YRNALGADGTMQHYLQVYGQAGKPCPRCGQAISKLKVGGRGTHICPKCQKKRS"
FT   CDS_pept        500777..501397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0531"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="similar to dephospho-CoA kinase [Streptococcus
FT                   pyogenes MGAS2096]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81033"
FT                   /db_xref="GOA:C5WF68"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF68"
FT                   /inference="similar to AA sequence:RefSeq:YP_600024.1"
FT                   /protein_id="BAH81033.1"
FT                   /translation="MSEMSEKKVLMIGITGGIASGKSTVVAMIKEAGYQVIDADQVVHQ
FT                   LQEKGGRLYEALKQAFGNEILKEDGELNRKKLSEMVFSNPSHMATSSAIQNQIIKEELA
FT                   AERDQLAQSQTVIFMDIPLLIELGYQDWFDAIWLVYVDAQTQLRRLMARNHLREVDAKK
FT                   RLSSQLSIEEKRPYASLVIDNIGDMETLRKQVHKALEQLSKPY"
FT   CDS_pept        501858..502559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0532"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /note="similar to ABC transporter ATP binding protein
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81034"
FT                   /db_xref="GOA:C5WF69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF69"
FT                   /inference="similar to AA sequence:RefSeq:NP_688481.1"
FT                   /protein_id="BAH81034.1"
FT                   /translation="MELVIRNIRKNFQEKEVLKGASYTFREGEITGLLGRNGAGKTTLF
FT                   NILYGEHQADQGEIFLVENGVERPLELEEIGMVFSENYLPEFLTGYEFIKFYLDLHPGK
FT                   DQLAIDDYLDFMEINEVDRHTIIKGYSDGMKSKLSLISILISKPKVILLDEPLTAVDLV
FT                   SSIAIKRLLLTLRDKHILILSTHILALAEDLCDHVAILHNGTLETMPLSTTDETFEAKL
FT                   LEILQGESHDN"
FT   CDS_pept        502549..504186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0533"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1486
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81035"
FT                   /db_xref="GOA:C5WF70"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF70"
FT                   /inference="similar to AA sequence:RefSeq:NP_688480.1"
FT                   /protein_id="BAH81035.1"
FT                   /translation="MTTKDLLRILWQIDGVTRYNTLIYWLQKLPLIGRRIPQACYRLKE
FT                   RKVFLTVIHGLIFPFSILAQMALYVGICFTLAHIVRAWFSEYTWYASPKPFTLSLLWLV
FT                   IFSLLLMTTLDIKLVTRDDMDLAKAIRQFHLLPRDYLKAKQLMRLGRELLFHVLALGIY
FT                   FTLNHFTFWHAISFTLLVSGVRLFLKVIFVPLYDRKGDDKEKYLNRLLFSLFGIAFLVS
FT                   GGLLVLGNRFAPQIFFSIPAGCLGFVLWGYGFYRLISDAELDTLTRSVVTHETMKERVA
FT                   VMENVHTVEVAVKEKDIDLSPQKKHRLQGLTGIAYLNAIFLQRMGKRLRKGVTIRLLIV
FT                   GLAIVAELIGLYYFRHQLGQVKHQEFVRILYVSLVSGYLIYVGESYIKFCFYHLDRPLL
FT                   KFNDYRQREVILATLKTRFWSIIKHNIPIFVAANLFVLILYVALFPLVWTEMVLIVMVQ
FT                   FLSMSFFSLYFLYLYFLLQPFTEGLKSKNVLYNVLTFIVYYLGYQLFRFTTDMTMPIFL
FT                   IILFGMILILGVGYLAVYYLAPKTFRLK"
FT   CDS_pept        504296..505798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0534"
FT                   /product="ATPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="similar to ATPase [Streptococcus pyogenes MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81036"
FT                   /db_xref="GOA:C5WF71"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF71"
FT                   /inference="similar to AA sequence:RefSeq:YP_596141.1"
FT                   /protein_id="BAH81036.1"
FT                   /translation="MTTITIAKGDQLVALQLGMLNRHGLIAGATGTGKTVTLKVLAEQL
FT                   SLAGVPVFLADIKGDLSNLAKAGEVTEKLATRLAKMGITDYQPQAFPVRLWDVFGQTGQ
FT                   PLRTTISEMGPMMLSRLLGLNDTQTGVMTIVFKIADEKGWLLIDLKDLQAILKEVGDHA
FT                   SDYSSHYGNVTKQSVGAIQRSLLTLEQEGAEQFFGEPALEVADLIQRDVVSGQGVINIL
FT                   SATKLFQSPTLYTTFLLWLLSELYELLPEVGDLDKPKMVFFFDEAHLLFKDAPKVFLEK
FT                   VEQIVRLIRSKGVGIFFVTQNPLDLPETVLAQLGNRIQHALRAYTPKEQKAVRVAADTF
FT                   RQNPDLDVARVITELEVGEALISVLNDKGQPSIVERAYIMPPKSSFAVLSETESQQIVQ
FT                   SSPFATKYSQAIDRDSAYEKLAAKVLEDNRLAEEALAAAQREKEAKEAIKAQAAAEKAS
FT                   RRSVGRPRKTVVEKATDAFISTTVRTIGRELVRGLLGSLRKR"
FT   CDS_pept        506058..507179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0535"
FT                   /product="multidrug resistance protein B"
FT                   /note="similar to multidrug resistance protein B
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81037"
FT                   /db_xref="GOA:C5WF72"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF72"
FT                   /inference="similar to AA sequence:RefSeq:YP_059756.1"
FT                   /protein_id="BAH81037.1"
FT                   /translation="MPFMALYVEELGAPKALVEWYAGLAVAITALASAIFAPLWGKLAD
FT                   RYGRKPMMLRASFVMTFTMGGLAVIPNVFWLLVLRLLTGIFSGYIPNSTALIASQVPQE
FT                   KSGYALGTLATGVTAGALIGPLIGGVLAELLGIRQVFLLVGIILLLCSLMTVFYVKEDF
FT                   EPIEKSQMVPTKDILKQVKSRKIMLGLFVTSMIIQVSAQSVAPILSLYIRHLGQTQNLM
FT                   FVSGLVVSAMGFSSLLSSSYLGKLGDRFGNHRLLLVALLYSFIMYVMSALAQTSLQLGL
FT                   LRFAYGFGVGALMPSINSLLTKLTPKAGISRVFSYNQMFSNIGQVLGPFIGSNVAVGLG
FT                   YRSVFYVTSMIVFVNLVWSLIIFKKYIKVKDIV"
FT   CDS_pept        507176..507322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0536"
FT                   /product="50S ribosomal protein L33"
FT                   /note="similar to 50S ribosomal protein L33 [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81038"
FT                   /db_xref="GOA:C5WF73"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF73"
FT                   /inference="similar to AA sequence:RefSeq:YP_059757.1"
FT                   /protein_id="BAH81038.1"
FT                   /translation="MRIKINLECSQCGSKNYLTSKNKSSHPEKIKVPKYCPKERKVTLH
FT                   VES"
FT   CDS_pept        507368..507604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="SDEG_0537"
FT                   /product="translocase"
FT                   /note="similar to translocase [Streptococcus pyogenes
FT                   MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81039"
FT                   /db_xref="GOA:C5WF74"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF74"
FT                   /inference="similar to AA sequence:RefSeq:NP_664155.1"
FT                   /protein_id="BAH81039.1"
FT                   /translation="MYNLLLTILLVLSVLLVIAIFMQPQKNPSSNVFDSSGSEALFERT
FT                   KARGFEAFMQRFTAVLVFFWLAIALALAILSSK"
FT   CDS_pept        507716..510031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0538"
FT                   /product="exoribonuclease II"
FT                   /EC_number="3.1.13.1"
FT                   /note="similar to exoribonuclease II [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81040"
FT                   /db_xref="GOA:C5WF75"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF75"
FT                   /inference="similar to AA sequence:RefSeq:YP_601921.1"
FT                   /protein_id="BAH81040.1"
FT                   /translation="MTYLKEHGKSNVNDLAAALEMAGAKHFPSLIKTISKMESQGLLRF
FT                   SNDGSLALRKEREKKKEATVQGIFRANKAGFGFLSVDENEDDMFIGRNDVGYAIDGDIV
FT                   EATIKKPADRLKGTAAEAKVVAIVERSLKTAVGTFILDDDKPKYAGYIRSKNQKIQQKI
FT                   YIKKEPVVLKGTEIIKVDIDKYPTRGHDYFVASVRDIVGHQGDVGIDVLEVLESMDIVS
FT                   EFPAEVLAEANAISEAPTAKDLIGRVDLRQETTITIDGADAKDLDDAIHIKLLDNGNYE
FT                   LGVHIADVSYYVTEGSALDKEAVRRGTSVYVTDRVVPMLPERLSNGICSLNPNVDRLTQ
FT                   SALMEINSQGHVVNYQICQSVIKTTYRMTYSTVNDIIAGDEEALQEFASIADDVTLMVA
FT                   LHRILEAMRSKRGALDFDTQEAKIIVNDKGMPVDVVLRQRGIAERMIESFMLAANECVA
FT                   EHFATAKLPFIYRIHEEPKAEKLQKFMDYASIFGIQIQGTANKISQEALQAFMARVEGQ
FT                   PGAEVLNMMLLRSMQQARYSEHNHGHYGLAAEYYTHFTSPIRRYPDLLVHRMIREYNQP
FT                   SQEKRDHFAQIIPELATSSSQLERRAIDAERVVEAMKKAEYMAEYVGEEFDGIVASVVK
FT                   FGLFVELPNTIEGLVHITSLPEYYHFNERTLSLQGEKSGKVFKVGQPIRVKLVKADKET
FT                   GDIDFEYLPSDFDVVEKIKMSDKASRRDRRKSSKSSKGTKKKEPKEVAKAKTKGKTKKG
FT                   SKKPFYKEQAKKKSRKRS"
FT   CDS_pept        510034..510501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="SDEG_0539"
FT                   /product="SsrA-binding protein"
FT                   /note="similar to SsrA-binding protein [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81041"
FT                   /db_xref="GOA:C5WF76"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF76"
FT                   /inference="similar to AA sequence:RefSeq:YP_601922.1"
FT                   /protein_id="BAH81041.1"
FT                   /translation="MAKGEGQLLAQNKKARHDYHIVETVEAGIVLTGTEIKSVRAARIQ
FT                   LKDGFAQIKNGEAWLINVHIAPFEQGNIWNADPERIRKLLLKKREITHLANELKGTGMT
FT                   LVPLKVYLKDGFAKVLIGLAKGKHDYDKRETIKRREQDRDIKRVMKSVNHR"
FT   CDS_pept        complement(511097..512023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0540"
FT                   /product="putative sugar transferase"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to putative sugar transferase [Streptococcus
FT                   pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81042"
FT                   /db_xref="GOA:C5WF77"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF77"
FT                   /inference="similar to AA sequence:RefSeq:NP_664162.1"
FT                   /protein_id="BAH81042.1"
FT                   /translation="MTLLSVIIPCFNEEKAILPYFEEMRQLELSMTSQLAFEYIFIDDG
FT                   SKDQTLNILRDLATRFPNVHYLSFSRHFGKEAGLLAGLEEAKGNYITVMDVDLQDPPEL
FT                   LPLMFAKITEGYDVVVTRRHNRQGEPWLRSALSHLFYSLIQNLSDTEIVSGVRDYRLMT
FT                   RQVVDSILELGEVNRFSKGIFSWVGYRTTYISFDNRKRQHGKSHWSFWGLFRYSLDGFV
FT                   NFSEMPLTIATWTGTFSFLISILAILFIVIRKLLFGDPVSGWASTVSIILFMGGIQLFC
FT                   MGIIGKYISKIFLETKKRPVYIIKEKH"
FT   CDS_pept        complement(512160..513344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0541"
FT                   /product="putative streptodornase"
FT                   /EC_number="3.1.21.1"
FT                   /note="similar to phage-encoded extracellular
FT                   streptodornase D [Streptococcus
FT                   pyogenes];deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81043"
FT                   /db_xref="GOA:C5WF78"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF78"
FT                   /inference="similar to AA sequence:INSD:AAS09918.1"
FT                   /protein_id="BAH81043.1"
FT                   /translation="MSKLRRKWLSHSLVALAMTLSLGFVPNAQPHDNVTYAQETAVTQD
FT                   WTLAQYPDYYVIEGKSAIQKEDFPQLKTTTEKVYKKSGRSTKRVTVSDLQYADLDGYNR
FT                   SGVAYGIITKDMIDMSAGSREKWENDYNPSGWFSYQFKADGRAATENDYKHSPRQVKRI
FT                   PNNQEVSIVLSNGKVRHGYLFDRSHLIADSLGGRPYRNNLITGTRTQNVGNNDRKGGMQ
FT                   YIENKVLTYINQNPSVHVYYKAEPVYVGTELVPRYVVVSALSSDGVIDEKVRVFNTANG
FT                   FTIDYQNGGLLSDVTLEEETTTDSDDTLTEDTKEPTTDEEGTDQISPDAATEDTATDVD
FT                   SQRIVYVASNGSSPVYWYHKENLPAGVNLDRLVEMTEQDALSRGKKHSSTEPTH"
FT   CDS_pept        complement(513690..514067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloA"
FT                   /locus_tag="SDEG_0542"
FT                   /product="putative lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="similar to putative lactoylglutathione lyase
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81044"
FT                   /db_xref="GOA:C5WF79"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF79"
FT                   /inference="similar to AA sequence:RefSeq:NP_664163.1"
FT                   /protein_id="BAH81044.1"
FT                   /translation="MKALHTCIRVKDLDKSVDFYTKAFPFKETRRRDFPDSQFTLVYLA
FT                   LEGESYELELTYNYDHGDYDLGDGYGHIALGSDNFEEDHEKHRQAGFPVTDIKGLTDKS
FT                   ARYYFIQDPDGYKIEVIDLNR"
FT   CDS_pept        complement(514077..514742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0543"
FT                   /product="putative NAD(P)H-flavin oxidoreductase"
FT                   /EC_number="1.5.1.30"
FT                   /note="similar to putative NAD(P)H-flavin oxidoreductase
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81045"
FT                   /db_xref="GOA:C5WF80"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF80"
FT                   /inference="similar to AA sequence:RefSeq:NP_664164.1"
FT                   /protein_id="BAH81045.1"
FT                   /translation="MNQSIHHQLQQALHFRTAVRVYKDETISEEDLNLILDAAWLSPSS
FT                   VGLEGWRFVVLDNKQIKEEIKPFAWGAQYQLETASHFVLLIAERNARYDSPVIKNSLLR
FT                   RGIEEGEGLESRLKLYEAFQKEDMDMADDPRALFDWTAKQTYIALGNMMMTAALLGIDS
FT                   CPIEGFNYAKVDTILATHGIINKDKEGIASMLSLGYRLRDPRHPQVRKPREEVISVVK"
FT   CDS_pept        complement(514786..515871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0544"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="similar to Xaa-Pro dipeptidase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81046"
FT                   /db_xref="GOA:C5WF81"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF81"
FT                   /inference="similar to AA sequence:RefSeq:YP_059768.1"
FT                   /protein_id="BAH81046.1"
FT                   /translation="MTKLDQIRLHLEQKGAELAIFSDPVTINYLTGFFCDPHERQLFLF
FT                   VYHDLAPVLFVPALEVARASQEVDFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHL
FT                   NVSKFHGLQIVFSGQFANLTPFVQGMRLIKSADEIEKMMIAGQFADKAVQVGFDNISLD
FT                   VTETDIIAQIEFEMKKQGINKMSFDTMVLTGNNAANPHGIPGTNKIENNALLLFDLGVE
FT                   TLGYTSDMTRTVAVGKPNQFQIDMYNLCLEAHQAAIDFIKPGVTAAQVDAAARQVIEKA
FT                   GYGEYFNHRLGHGIGMDVHEFPSIMAGNELVIEEGMCFSVEPGIYIPGKVGVRIEDCGY
FT                   VTKDGFEVFTHTPKELLYFEG"
FT   CDS_pept        516045..517046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SDEG_0545"
FT                   /product="catabolite control protein A"
FT                   /note="similar to catabolite control protein A
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81047"
FT                   /db_xref="GOA:C5WF82"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF82"
FT                   /inference="similar to AA sequence:RefSeq:YP_281787.1"
FT                   /protein_id="BAH81047.1"
FT                   /translation="MNTDDTITIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVI
FT                   DRLDYRPNAVARGLASKKTTTVGVVIPNIANSYFSILAKGIDDIAAMYKYNIVLASSDE
FT                   DDDKEVNVVNTLFAKQVDGIIFMGHHLTEKIRAEFSRSRTPIVLAGTVDLDHQLPSVNI
FT                   DYKAAVSNVVDILAENHQSIAFVSGPLIDDINGKVRLAGYKEGLKHNKLDFKEGLVFEA
FT                   NYSYKEGFELAQRVINSGATAAYVAEDELAAGLLNGLFEAGKRVPEDFEIITSNDSPVV
FT                   QYTRPNLSSISQPVYDLGAVSMRMLTKIMNKEELEEKEILLNHGIKKRGTTK"
FT   CDS_pept        517200..518663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyS"
FT                   /locus_tag="SDEG_0546"
FT                   /product="cytoplasmic alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /note="similar to cytoplasmicalpha-amylase [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81048"
FT                   /db_xref="GOA:C5WF83"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013776"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015237"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF83"
FT                   /inference="similar to AA sequence:RefSeq:NP_687723.1"
FT                   /protein_id="BAH81048.1"
FT                   /translation="MTNQLIMQAFEWYLPADGNHWKTVKASIPQLQHLGVTELWLPPAF
FT                   KGTGINDVGYGVYDLFDLGEFDQNGTVITKYGSKQEYLDLITALKEAAIKPIADIVLNH
FT                   KANGDHKERFFVIKMNPENRQEALTEPYEIEGWTGFDFPGRNGCYNDFKWHWYHFTGLD
FT                   YDAKNNETGIYMITGDNKGWANNDLIDDEHGNFDYLMYNDLDFKHPEVIQNLQDWAKWF
FT                   IETTGIEGFRLDAVKHIDSYFIQTFVNDIRTQIKPDLEVFGEYWKSDQDSMEDYLEATN
FT                   EQFALVDVGLHMSFFNASHQGKDFDLTHIFEGSLVASRPDLAITFVENHDTQRGQALES
FT                   TVEDWFKPLAYGLILLRQEGKPCLFYGDYYGISGDFAQASFKEVLDKLTLLRKEAVYGE
FT                   QVDYFDHANCIAWTCLGDEEHPHPLAVILSNGDEGWKHVEIGQDFVGQTFVDYLGHCSE
FT                   KVVVAEDGWLDIKVETGSISAWVPEERSF"
FT   CDS_pept        518740..519738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0547"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="similar to glycosyltransferase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81049"
FT                   /db_xref="GOA:C5WF84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF84"
FT                   /inference="similar to AA sequence:RefSeq:YP_281788.1"
FT                   /protein_id="BAH81049.1"
FT                   /translation="MKVLLYLEAENYLKKSGIGRAIKHQAKALSLVGQDFTTDPNDDYD
FT                   LVHLNTYGLKSWLLMAKAQKAGKKVIMHGHSTEEDFRNSFIFSNLLSPLFKKYLCQFYN
FT                   KADAIITPTLYSKSLIEQYGVKTPIFAVSNGIDLEQYRADSEKEAAFRQYFDIKEGEKV
FT                   VMGAGLFFLRKGIDDFVKVAQAMPDVRFIWFGETNKWVIPAQVRRLVNGKHPKNLIFPG
FT                   YIKGGVYEGAMTGADAFFFPSREETEGIVVLEALASRQHLVLRDIPVYDGWVDQNSAEL
FT                   ATDIPGFIQALTKILAGDSNKMDAGYKVAQSRRLETVGQALVDVYKKVMEL"
FT   CDS_pept        519740..521074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0548"
FT                   /product="1,2-diacylglycerol 3-glucosyltransferase"
FT                   /EC_number="2.4.1.336"
FT                   /note="similar to 1,2-diacylglycerol 3-glucosyltransferase
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81050"
FT                   /db_xref="GOA:C5WF85"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF85"
FT                   /inference="similar to AA sequence:RefSeq:YP_598036.1"
FT                   /protein_id="BAH81050.1"
FT                   /translation="MRVGLFTDTYFPQVSGVATSIRTLKEELEKEGHEVYIFTTTDRDV
FT                   KRFEDPTIIRLPSVPFVSFTDRRVVYRGLISSYKIAKQYDLDLIHTQTEFSLGLLGKMV
FT                   GKALRIPVVHTYHTQYEDYVSYIANGKIIRPSMVKPLLRGYLKDLDGVICPSRIVLNLL
FT                   EGYEVTIPKRVIPTGIPLEKYIRDDIKAEDVASLKEELGIAADETMLLSLSRISYEKNI
FT                   QAIINQMPTVLAKHSKIKLIVVGDGPYLETLKDLAMQLKVEQHVTFTGMVPHDRVALYY
FT                   KACNFFVSASTSETQGLTYIESLASGKPIIAQSNPYLDDVITDKMFGTLYHAEEDLSDA
FT                   IIDAIVETPVMDQQLLEEKRYEISAEHFGKSIYTFYLDTLIARNNKEPQKLSLYLNHSG
FT                   KNSSLKLVQGAIHLPKRAVKATALTSVKVVKAPIKLVNAIKDFLD"
FT   CDS_pept        521498..523441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="SDEG_0549"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="similar to threonyl-tRNA synthetase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81051"
FT                   /db_xref="GOA:C5WF86"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF86"
FT                   /inference="similar to AA sequence:RefSeq:YP_281790.1"
FT                   /protein_id="BAH81051.1"
FT                   /translation="MIKITFPDGAVREFESGVTTFEIAESISKSLAKKALAGKFNGQLI
FT                   DTTRAIEEDGSIEIVTPDHEDAYDVLRHSAAHLFAQAAKRLFPNLHLGVGPAIAEGFYY
FT                   DTDNADGQISNEDLPRIEAEMQKIVKENYPCIREEVTKEEALELFKDDPYKVELINEHA
FT                   GAGLTVYRQGEFVDLCRGPHVPSTGRIQVFHLLNVAGAYWRGNSDNNMMQRVYGTAWFD
FT                   KKDLKAYLTRLEEAKERDHRKLGKELDLFMISQEVGQGLPFWLPDGATIRRTLERYITD
FT                   KELASGYQHVYTPPLASVELYKTSGHWEHYQEDMFPVMDMGDGEEFVLRPMNCPHHIQV
FT                   YKNHVHSYRELPIRIAELGMMHRYEKSGALSGLQRVREMTLNDGHIFVTPEQIRDEFKR
FT                   TLQLIIDVYEDFNLTDYRFRLSYRDPEDTHKYYDNDEMWENAQAMLKGAMDDMGVDYFE
FT                   AEGEAAFYGPKLDIQVKTALGNEETLSTIQLDFLLPERFDLKYIGADGEEHRPVMIHRG
FT                   VISTMERFTAILIETYKGAFPTWLAPHQVTVIPISNEAHIDYAWEVAKTLRDRGVRADV
FT                   DDRNEKMQYKIRASQTSKIPYQLIVGDKEMEEKSVNVRRYGSKATHTESVEDFVENILV
FT                   DIARKSRPDAQA"
FT   CDS_pept        523571..524563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0550"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="similar to ABC transporter ATP-binding protein
FT                   [Streptococcus pyogenesstr. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81052"
FT                   /db_xref="GOA:C5WF87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF87"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128969.1"
FT                   /protein_id="BAH81052.1"
FT                   /translation="MAMIEVSHLHKQFTKTIKEPGLKGVMKSFVNPQKEVFEAVKDLSF
FT                   EVPKGQILGFIGANGAGKSTTIKMLTGILKPTSGYCRINVKIPQDNRQDYVKDIGVVFG
FT                   QRTQLWWDLALQETYAVLKEIYDVPEKDFRKRMDFLNEVLELNEFIKDPVRTLSLGQRM
FT                   RADIAASLLHNPKVLFLDEPTIGLDVSVKDNIRRAITQINQEEETTILLTTHDLSDIEQ
FT                   LCDRIIMIDKGQEIFDGTVTQLKQTFGKMKSLSFELEAGQEEVVSQFLGLPDITVERHE
FT                   LTLEIQYDSSRYQTADVIQRTMADFVVRDLKMTDADIEDIIRRFYRKEL"
FT   CDS_pept        524565..525197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0551"
FT                   /product="daunorubicin resistance transmembrane protein"
FT                   /note="similar to daunorubicin resistance transmembrane
FT                   protein [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81053"
FT                   /db_xref="GOA:C5WF88"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF88"
FT                   /inference="similar to AA sequence:RefSeq:YP_281792.1"
FT                   /protein_id="BAH81053.1"
FT                   /translation="MQSFWKRYKPFISAGIQELMTYRVNFFLYRLGDVMGAFVAFYLWK
FT                   AVFDSSKQSLINGFTLSDMTFYIIMSFVTTLLTKSDSSFMIGEEVKDGSIIMRLLRPVH
FT                   FAASYLFMEIGFRWIVLISVGFPFLVVLSGIKVMAGLSILQVLASSCLYLVSLLLAFLI
FT                   NFYFNICFGFSAFVFKNLWGSNLLKNALVAFMSGSLIPLAFFLKWFL"
FT   CDS_pept        525185..525382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0552"
FT                   /product="daunorubicin resistance transmembrane protein"
FT                   /note="similar to daunorubicin resistance transmembrane
FT                   protein [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81054"
FT                   /db_xref="GOA:C5WF89"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF89"
FT                   /inference="similar to AA sequence:RefSeq:YP_601937.1"
FT                   /protein_id="BAH81054.1"
FT                   /translation="MVSIVLSFLPFSSLVYTPVMIVIGKYSLSQIMVALSLQIFWLLVM
FT                   VVLSQVIWKKVQYHLTIQGG"
FT   CDS_pept        525384..526169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0553"
FT                   /product="ABC transporter permease protein"
FT                   /note="similar to ABC transporter permease protein
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81055"
FT                   /db_xref="GOA:C5WF90"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF90"
FT                   /inference="similar to AA sequence:RefSeq:YP_601938.1"
FT                   /protein_id="BAH81055.1"
FT                   /translation="MAKLRRMHAIFIKQYLKQIMEYKVDFVVGVLGVFLTQGLNLLFLS
FT                   VLFQHIPSLEGWTFEQIAFIYGFSLIPKGIDHLFFDNLWALGQRLVRKGEFDKYLTRPI
FT                   SPLFHVLVETFQVDALGELLVGVILLVTTAGSIVWTLPKVLLFILVIPFATLIYTSLKI
FT                   ATASISFWTKQSGAVIYIFYMFNDFSKYPMSIYHSFLRWLISFVIPFAFTAYYPASYFL
FT                   TGQHLLFNIGGLVVVSLLVLALSLKLWKWGLGAYESAGS"
FT   CDS_pept        complement(526273..527262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0554"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /EC_number="2.7.1.29"
FT                   /note="similar to dihydroxyacetone kinase family protein
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81056"
FT                   /db_xref="GOA:C5WF91"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012735"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF91"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128966.1"
FT                   /protein_id="BAH81056.1"
FT                   /translation="MVTILNQTQTLISQYIASVLAAHPHLAQLQDLPIIYNRHLDDQLI
FT                   PILSGGGSGHEPAHSGFVGDGMLSAAIYGDIFTPPTATDILEALRFLDKGKGVFVIIKN
FT                   FEADIREFSQAIHLARQEGRNIKYIISHDDISVEPKKQFQMRHRGLAGTVLLHKILGAA
FT                   AQSGASLDDLEHLAFDLATEIATIGFATKSASLPNAALPLFDLPDHQISYGIGIHGEEG
FT                   YRTVPFMSSEHLAVEIVNKLQIKFHWQEDEHFILLVNNLGTATDLEQGIFLNDIHQLLD
FT                   LEGLHLPFIKNGKFMTSLDMTGISVTLCRLKDRQWLDYLQAPTNAYAW"
FT   CDS_pept        complement(527277..527813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0555"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51438
FT                   [Streptococcus pyogenes str.Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81057"
FT                   /db_xref="GOA:C5WF92"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012738"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF92"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128965.1"
FT                   /protein_id="BAH81057.1"
FT                   /translation="MATSLITKKKIAKAFKKQLAVKSFDKISVVDIMDQAQIRRQTFYN
FT                   HFLDKYELLDWIFETELQEQVTHNLNYISGFQLLEELLFYFERNKTFYAQLFDIKGQND
FT                   FYSYFMDYCQVLMAKIISEYQSQEMSQSDAADYLAFLTHYHARALADMIKGYVSQSEPK
FT                   PCLTYLKQLILTSIH"
FT   CDS_pept        527965..528954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0556"
FT                   /product="dihydroxyacetone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="similar to dihydroxyacetone kinase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81058"
FT                   /db_xref="GOA:C5WF93"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF93"
FT                   /inference="similar to AA sequence:RefSeq:YP_059779.1"
FT                   /protein_id="BAH81058.1"
FT                   /translation="MKKIMNDATQIVDDMLQGLAYMHDDLVERLDGYDVIVRKAEKTGK
FT                   VALISGGGSGHEPSHAGFVGEGMLSAAICGAVFTSPTPDQILEAIKAADEGAGVFMVIK
FT                   NYSGDIMNFEMAQELAEMEGIDVASVVVDDDIAVENSLYTQGRRGVAGTILVHKILGHA
FT                   AREGKSLADIKALADELVLNIKTIGLALSGATVPEVGKPGFVLEDDEFEYGVGIHGEPG
FT                   YKKEKLQSSSVLAQELVTKLADSFDMSAGQHYGVLVNGLGATPLMEQYVFANDVAKLLA
FT                   EKDVTVSFKKIGDYMTSIDMAGLSLTLIKLDKDEWTEALQSDVITPAW"
FT   CDS_pept        528965..529540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0557"
FT                   /product="dihydroxyacetone kinase family protein"
FT                   /EC_number="2.7.1.29"
FT                   /note="similar to dihydroxyacetone kinase family protein
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81059"
FT                   /db_xref="GOA:C5WF94"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF94"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128963.1"
FT                   /protein_id="BAH81059.1"
FT                   /translation="MQAQDAIKWMTLFNDKIQVNKDYLSQLDTPIGDGDHGGNMARGMS
FT                   AVMENLDGKEFASAADVFKVVAMQLLGKVGGASGPLYGSAFMGLSKASEDSSLADALQA
FT                   GLDMIQKRGKAEKGEKTMVDVWIPVIEALKNDGLTKDVVEEAVLATKDIQATKGRASYV
FT                   GERSVGHIDPGSFSSGLLFEAMLEAEVV"
FT   CDS_pept        529540..529914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0558"
FT                   /product="dihydroxyacetone kinase phosphotransfer protein"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to dihydroxyacetone kinase phosphotransfer
FT                   protein [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81060"
FT                   /db_xref="GOA:C5WF95"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF95"
FT                   /inference="similar to AA sequence:RefSeq:YP_059781.1"
FT                   /protein_id="BAH81060.1"
FT                   /translation="MSDLGIIIVSHSKNIAQGVVDLISEVETDVAITYVGGAEDGGIGT
FT                   SFDQVQAIVDANPKDDLLAFFDLGSARMNIEMVSDFSDKTITLNVVPIVEGAYTAAALI
FT                   QAGADKDAILSQLEELAINK"
FT   CDS_pept        529932..530642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0559"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="similar to glycerol uptake facilitator protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81061"
FT                   /db_xref="GOA:C5WF96"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF96"
FT                   /inference="similar to AA sequence:RefSeq:YP_059782.1"
FT                   /protein_id="BAH81061.1"
FT                   /translation="MNFTGELLGTFILVLLGDGVVSACILNKTKAQNSGWIAIVLGWGI
FT                   AVTVAVYISGFMSGAHLNPAVTLAMAAIGSLPWSQVVTYLVAQFLGAMLGALVLYLHYY
FT                   PHWKETKDAGTILACFSTGPAIRHTWSNLFGEALGTAVLVITVMAIGPNKVAAGFGPII
FT                   VGFVVMAVGFSLGATTGYAINPARDLGPRIMHALLPIPNKGDSDWSYAWIPVLGPILGG
FT                   VAGALIYQVILNMM"
FT   CDS_pept        530776..531345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0560"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51433
FT                   [Streptococcus pyogenes str.Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81062"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF97"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128960.1"
FT                   /protein_id="BAH81062.1"
FT                   /translation="MRRLLSTMIKCNQDLPKNSLVVDMTLEKAAQLYENQVLTDTQRFR
FT                   KIRLSESGLTLEVRFLKKQPVQWLSESTNSNQLEEKANKFLANDDQTINISQAAFAQFL
FT                   EDTGDQNPIHREAPYVLPGAFLLEQVSDRLAIDYRRLHLRFYAPAVLDRTIQLMVKGRA
FT                   IGLFQAGKLVAKGDYDHDGYLYCCRP"
FT   CDS_pept        531308..532429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0561"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="similar to acetyl-CoA acetyltransferase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81063"
FT                   /db_xref="GOA:C5WF98"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF98"
FT                   /inference="similar to AA sequence:RefSeq:YP_281795.1"
FT                   /protein_id="BAH81063.1"
FT                   /translation="MTMTDIYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPA
FT                   PIDQVICGNAVGTGGNIGRLMTLYSHLGESVPALTVDMQCASAGAALSVGYAKIKAGMA
FT                   SNLLVGGIESSSLQPESVYASADWRQGPYKVAQFSPDTNSPFAMIEGAERVAREHGFTK
FT                   EYLNHWTLKSHQKASYCQEQALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHV
FT                   ISAANACLTHDAAAFLQLSSQPSAFKLIDVVEVAGDPQRSPLMVVTASQVLLAKHGLGM
FT                   ADMTAIEWNEAFAVIDGLFETHYPDLLDRYNIFGGALAYGHPFGASAAIILLHLMKALE
FT                   IKEGRYGLAAIPAAGGQGIAFLVECNQEWCNAN"
FT   CDS_pept        532419..533663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0562"
FT                   /product="long-chain-fatty-acid-CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="similar to long-chain-fatty-acid-CoA ligase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81064"
FT                   /db_xref="GOA:C5WF99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5WF99"
FT                   /inference="similar to AA sequence:RefSeq:YP_281796.1"
FT                   /protein_id="BAH81064.1"
FT                   /translation="MLTRLNQWAKECPDKRAVVTDQQTLTYYELWQAIITDKKLPLEER
FT                   PQVIHEQHYLKQLIAFLQGLRQNNRPLIAHPNMPDGYQQRIRQDNQKPPTQADFAVLSS
FT                   GSTGQAKLFWRSLSSWTEMFDYQNQVFGLNADTSLFLHGSFSFTGNLNLALAQLWAGGC
FT                   IVWTQKPSFKTWLMLWQKEQVSHLYLLPTYLNRILPYLTKANMTATHLLTSSQLMSPDL
FT                   LQRYYQTFPQLEVIIFYGASELSFITWCNGKDALETAGLVGHPFPGVNISLVDKQIFVE
FT                   TPYAIEGIKQPYSVSDFGDMCSAGLILKGRRDDWVNQQGVKCHLPSLVELVAQASGVKE
FT                   ATALKVGSGLNQAVLLVLVLTENQKLAAIKDFLVSHLSPWQLPKYYLLVDQLPLNDSGK
FT                   IDRAALLALLPSKGT"
FT   CDS_pept        533740..534753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0563"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81065"
FT                   /db_xref="InterPro:IPR021462"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281797.1"
FT                   /protein_id="BAH81065.1"
FT                   /translation="MKGGKAMTQAILDRYQALKEYQRAGLSNQSFRALAEEAVIDSRLG
FT                   SPSFWMIWPIEKKAKTIKALLTFLLDLVEMPVELSGQLEDTKALLANFSPDLSPDHPFW
FT                   KEMASLVDQAFPARTLGEVGDLERRLHQFRYVISSQQAQYIRNYYKQEEMTDGQALAIF
FT                   LRAKKGPALWRRSPDYTLLDSARLHNKLKIEGEKVIFPDQELSYNIKVLLWFHTEFILD
FT                   NKGFFLNEIDGEVVTEKGIVNGASFNYGTDGPRHWDLDVDPIRHHDPNFRREVAKGFQS
FT                   PSRVFRKWFKQNRNDFAFSYFNAKGIYSSDHKSSFSMVKQEAKKFKRLIKYGISKK"
FT   CDS_pept        complement(534849..535295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0564"
FT                   /product="ABC transporter permease protein"
FT                   /note="similar to aminoacid (glutamine) ABC transporter
FT                   permease protein [Streptococcus thermophilus CNRZ1066]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81066"
FT                   /db_xref="GOA:C5WFA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA1"
FT                   /inference="similar to AA sequence:RefSeq:YP_141527.1"
FT                   /protein_id="BAH81066.1"
FT                   /translation="MDFYHFLVFKMESITAGITAFTVFTSAALAEIIRGGLNAVNHGQT
FT                   EAGLSQGFTHFQVFCLIIFPQAFRKMLPAIISQFVTVIKDTSLLYSVLAIQELFGNSQI
FT                   LMGRYFEPKDVFLLYGIVAGLYFLINMSISQFSRTLAKKWAQAN"
FT   CDS_pept        complement(535274..535495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="SDEG_0565"
FT                   /product="putative amino acid ABC transporter, integral
FT                   membrane protein"
FT                   /note="similar to putative amino acid ABC transporter
FT                   integral membrane protein [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81067"
FT                   /db_xref="GOA:C5WFA2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA2"
FT                   /inference="similar to AA sequence:RefSeq:NP_721866.1"
FT                   /protein_id="BAH81067.1"
FT                   /translation="MSPLLTYSNLLFLLEGLGLTLFISLAVIILSTLFGTLLAVMRNSH
FT                   SKPLGLIASIYIEFVRNVPNLLWIFIIF"
FT   CDS_pept        complement(535510..536211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0566"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs0689
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81068"
FT                   /db_xref="GOA:C5WFA3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA3"
FT                   /inference="similar to AA sequence:RefSeq:NP_735139.1"
FT                   /protein_id="BAH81068.1"
FT                   /translation="MTLLTTTSSVALPQWTAFFNNFPLFLKAFLYTLGVSLAALLLAMV
FT                   LGVIIGGLSTAKQKGNRVIARVYVEFYQNTPLLVQVVFMYYGLAIISKGFIMPSAFLTT
FT                   VCCVGLYHAAYIAEVIRSGIEAVPKGQTEAALSQGFTRLQTMSLIIIPQAVRTILPPLT
FT                   NQVVNLIKNTSIVAIISGADLMFTAKVWAYDTTYYVPAFAGAAFLYFILCFPIAIFGRR
FT                   QEERNKETYSL"
FT   CDS_pept        complement(536225..537031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0567"
FT                   /product="amino acid ABC transporter, amino acid-binding
FT                   protein"
FT                   /note="similar to amino acid ABC transporter, amino
FT                   acid-binding protein [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81069"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA4"
FT                   /inference="similar to AA sequence:RefSeq:NP_687732.1"
FT                   /protein_id="BAH81069.1"
FT                   /translation="MLMKKYSLLVICFLLTLICPSLSQASELTTPNVLKQITKKGQLRI
FT                   GVKQDVPNFGYYHPKHRQFEGMEIDIAKKIAKALNVKPQFTAVTAQTREALLDNQQLDM
FT                   IIATYTITPERQKQYAFSNPYYLDEIGFLVKKSDAITSIKELDQKTIGVAQGSTTKNAI
FT                   EEYGKAHDLSFSFVQLGSYPELAISLYANRIASFSVDKSILSGYTNQKTTILTEGFNQQ
FT                   AYGVATTKSNKALITHINKLLEQWQKDGSLAKIYRKHGLTPATRKP"
FT   CDS_pept        complement(537025..537897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0568"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="similar to aminoacid (glutamine) ABC transporter
FT                   ATP-binding protein [Streptococcus thermophilus CNRZ1066]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81070"
FT                   /db_xref="GOA:C5WFA5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA5"
FT                   /inference="similar to AA sequence:RefSeq:YP_141524.1"
FT                   /protein_id="BAH81070.1"
FT                   /translation="MMLTVKESCDKLFYFYVRKLNTKEIAMTLVTFTSVEKYYGEYHAL
FT                   KNINLTIERGQVVVLLGPSGSGKSTLIRTINALESIETGSLVVNNIEVANAGSKELVAL
FT                   RQKVGMVFQHFNLYPHKKVLENITLAPMKVLNVSREEAEKTAEKYLTFVNMWDRKDAYP
FT                   SMLSGGQKQRIAIARGLAMNPDLLLFDEPTSALDPETIGDVLAVMQNLASEGMNMIVVT
FT                   HEMGFAKEVADRIIFMADGEILEDTTDVEGFFNHPKEPRAQQFLSKMINHTSDSVVTTK
FT                   QKKHGKGAC"
FT   CDS_pept        538077..538787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicR"
FT                   /locus_tag="SDEG_0569"
FT                   /product="two-component response regulator"
FT                   /note="similar to two-component response regulator
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81071"
FT                   /db_xref="GOA:C5WFA6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281798.1"
FT                   /protein_id="BAH81071.1"
FT                   /translation="MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK
FT                   PDLIILDLMLPELDGLEVAKEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFS
FT                   NRELLARVKAHLRRTETIETAVAEENASSGSQELTIGNLQILPDAFVAKKHGKEVELTH
FT                   REFELLHHLANHMGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYI
FT                   LTRRGVGYYMKSYD"
FT   CDS_pept        538780..540132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicK"
FT                   /locus_tag="SDEG_0570"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to two-component sensor histidine kinase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81072"
FT                   /db_xref="GOA:C5WFA7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281799.1"
FT                   /protein_id="BAH81072.1"
FT                   /translation="MTRDIIGNLSAFELAILLLLVFVAFYFIHLAVRDYRNARIIRMMS
FT                   HKIRDLINGRYTDMINEKADIELMELADQLNDLSDVFRLTHENLAQEKNRLASILAYMS
FT                   DGVLATDRSGKIIMINETARKQLNLTKEKALEKNITDLLEGDTPYTYRELVSKTPVVTV
FT                   NSRNDMGEFVTLRLRFALNRRESGFISGLVVVLHDTTEQEKEERERRLFVSNVSHELRT
FT                   PLTSVKSYLEALDEGAIKEDIAPSFIKVSLDETNRMMRMISDLLNLSRIDNQVTQLSVE
FT                   MTNFTAFMTSILNRFDLVKNQQTGTGKVYEIVRDYPITSVWLEIDNDKMTQVIENILNN
FT                   AIKYSPDGGKITVRMKTTDTQLIISISDQGLGIPKKDLPLIFDRFYRVDKARSRAQGGT
FT                   GLGLAIAKEIIKQHHGFIWAKSDYGKGSTFTIVLPYEKDAAIYEEWEDDID"
FT   CDS_pept        540136..540945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vicX"
FT                   /locus_tag="SDEG_0571"
FT                   /product="Zn-dependent hydrolase"
FT                   /note="similar to Zn-dependent hydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81073"
FT                   /db_xref="GOA:C5WFA8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281800.1"
FT                   /protein_id="BAH81073.1"
FT                   /translation="MIESGFKYSILASGSTGNCFYLETPKKRLLIDAGLTGKKITSLLA
FT                   EIDRKPEDLDAILITHEHSDHIKGVGVMARKYHLDVYANEKTWQLMDERNMLGKLDASQ
FT                   KHIFQRDKMLTFGDVDIESFGVSHDAVDPQFYRIMKDNKSFVMLTDTGYVSDRMTGIIE
FT                   NADGYLIESNHDIEILRSGSYPWSLKQRILSDMGHLSNEDGAGAMIRSLGHKTKKIYLG
FT                   HLSKENNIKELAHMTMVNQLAMADLAVGTDFTVHDTSPDTACPLTDI"
FT   CDS_pept        541703..542395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mc"
FT                   /locus_tag="SDEG_0572"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="similar to ribonuclease III [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81074"
FT                   /db_xref="GOA:C5WFA9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFA9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281801.1"
FT                   /protein_id="BAH81074.1"
FT                   /translation="MKKLEELLAASFDICFEDHTLLETAFTHTSYANEHRLLNISHNER
FT                   LEFLGDAVLQLIISEYLFAKYPKKTEGDMSKLRSMIVREESLAGFSRFCSFDTYIKLGK
FT                   GEEKSGGRNRDTILGDLFEAFLGALLLDKGVDEVRRFLQQVMIPQVEKGNFEKVKDYKT
FT                   CLQELLQSKGDIAIDYQVISEKGPAHAKQFEVAVFVNEEVLSKGLGKSKKMAEQDAAKN
FT                   ALVQLSEV"
FT   CDS_pept        542396..545941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="SDEG_0573"
FT                   /product="chromosome partition protein"
FT                   /note="similar to chromosome partition protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81075"
FT                   /db_xref="GOA:C5WFB0"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281802.1"
FT                   /protein_id="BAH81075.1"
FT                   /translation="MFLKEIEMQGFKSFADKTKIEFDKGVTAVVGPNGSGKSNITESLR
FT                   WALGESSAKSLRGGKMPDVIFAGTENRSPLNYAQVAVVLDNSDHFIKEAKEVIRIERHI
FT                   YRNGDSDYLIDGRKVRLRDIHDLFMDTGLGRDSFSIISQGRVEEIFNSKPEERRAIFEE
FT                   AAGVLKYKTRKKETQSKLNQTQDNLDRLDDIIYELDNQLVPLEKQAKVAQKFLDLDASR
FT                   KQLQLDILVTDIALDQAKQSDDRAALESVKQDLSTYYANRQSMEADYQQLKQKRQSLSH
FT                   ESDQTQTNLLELTKLISDLEKQIELIKLESSQKAEKKAEAKQRLDQLQDQLQGFKAEES
FT                   QRAEHLKALDQQLEDVADHLVSLTQELDRFSSDPDQLIEQLREEFVGLMQQEAELSNQL
FT                   TALKAQLEKENQDRQNQAQEYQDLIAKTDSLTQACQEAEEGYKAQSEQVKTLLQSYQTS
FT                   EQDINHLEGRYRAEQSRLFDLLDQKKAKEARQASLEAIQRSHSQFYAGVRAVLQAAKQL
FT                   GGILGAVSEHLSFDTDYQTALEVALGASSQHIIVADEAAAKRAIAYLKKNRQGRATFLP
FT                   LTTIKARSLSENHQRQLATCDGYLGTAESLVRYDAKLSAIVQNLLASTAIFETIDQANH
FT                   AARLLGYKVRIVTLDGTELRPGGSFSGGANRQNNTTFIKPELEQVSRDLAQLNEQLRAA
FT                   EKDVAALQSDVAVKKEELAQLKLSGEQARLAEQKAQMAYQQLKEKQDDSQALLQALSER
FT                   QENTSDHALIAEQSRIEDALVRITKKKADLTHDISDIKENKDLIKQKTDQLSQALSQRR
FT                   LEERDLLNEKKFEQTNQSRLKAQLQQCQQDITNLESILSSHVSQDSIQQLPQWEEQLQD
FT                   ALQHKTASQERLIQLRFEIEDYEARLEELAEQMTKEGEKNEAFIRRQTQLEASLEQVAN
FT                   RLRTYAKSLSEDFQMSLEEAKLAANSIEQLPAAREELQSLQKAIRALGPINSEAITQYE
FT                   EVHERLTFLNGQKADLMKAKNLLLETIGSMDSEVKARFKVTFEAIRDSFKETFTQMFGG
FT                   GSADLVLTETDLLSAGVEISVQPPGKKIQSLNLMSGGEKALSALALLFAIIRVKTIPFV
FT                   ILDEVEAALDEANVKRFGDYLNRFDKDSQFIVVTHRKGTMAAADSIYGITMQESGVSKV
FT                   VSVKLKDSQNLTYLS"
FT   CDS_pept        546281..546928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="SDEG_0574"
FT                   /product="putative protease"
FT                   /note="similar to CspA [Streptococcus agalactiae]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81076"
FT                   /db_xref="GOA:C5WFB1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB1"
FT                   /inference="similar to AA sequence:INSD:AAN85092.1"
FT                   /protein_id="BAH81076.1"
FT                   /translation="MNTKQRFSLRKYKIGAVSVLLGTLLFMGGVTTTSADAVTNDSSVA
FT                   SLVQSASAQEAPSSPIAAIVKEEASVATVQAMPSSTDTDAQGGVTSTTSNMAETPSSSE
FT                   PLAEELNRLAVGEKEATPQNIDSNEIISIPHVWDSGYKDQGTVVAVIDSGLDSQHDVLQ
FT                   LSDVSQAKYHSQEELEAAKQKAGITYGQWYNNKVIFGYNYVDVNTDLKEAVD"
FT   CDS_pept        547168..548010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0575"
FT                   /product="truncated reticulocyte binding protein"
FT                   /note="similar to reticulocyte binding protein
FT                   [Streptococcus agalactiae 515]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81077"
FT                   /db_xref="GOA:C5WFB2"
FT                   /db_xref="InterPro:IPR009063"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB2"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00789182.1"
FT                   /protein_id="BAH81077.1"
FT                   /translation="MSTFIVYIQVIDQAVATLVKARQALNGKVTDLTALSNEILEEANV
FT                   IASQSFTNANPLNRETYQNQLAVAKALLQKAKVSQEEVEQALAALLTAKEHVLGHQTDY
FT                   TALRQMVTKASVLKQTAAKYQMASQSSKEAYDNLLTAAQNLLETQGATQAEVDALLAQI
FT                   KAAEKALDGQGNLSSQENTHSPQEQLLPEESQEAPPHSMLLGQKDLRESEVAQKRAQRV
FT                   FALLNEPQTPLARAVANSNKKLEHLPQTGDKSPQLLLISLGFASLLMVIPLAYIRSKN"
FT   CDS_pept        548250..548636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0576"
FT                   /product="hydrolase"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81078"
FT                   /db_xref="GOA:C5WFB3"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB3"
FT                   /inference="similar to AA sequence:RefSeq:YP_281833.1"
FT                   /protein_id="BAH81078.1"
FT                   /translation="MIKLIATDMDGTFLAEDGTYDQARLAALLPKLTEKGIVFTVSSGR
FT                   SLLAIDQLFEPFLDQIAVIAENGSVVQYQGEVLFADVMTQEQYAEVAEKILANPHYLET
FT                   GMVFSGQKAAYVLKGASQEYITKN"
FT   CDS_pept        548680..549048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0577"
FT                   /product="hydrolase"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81079"
FT                   /db_xref="GOA:C5WFB4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB4"
FT                   /inference="similar to AA sequence:RefSeq:YP_281833.1"
FT                   /protein_id="BAH81079.1"
FT                   /translation="MENDTIFKVSTNFTGDTVLEGSDWLNQALPYATAVTTGFDSIDII
FT                   LKEVNKGFGMDHLCLALGIEPSETIAFGDNFNDYQMLEFAGKAIATENARPEIKAISDQ
FT                   VIGHCNDGAVLTYLEGLV"
FT   CDS_pept        549052..549876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0578"
FT                   /product="hydrolase"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81080"
FT                   /db_xref="GOA:C5WFB5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB5"
FT                   /inference="similar to AA sequence:RefSeq:YP_281834.1"
FT                   /protein_id="BAH81080.1"
FT                   /translation="MDIKILALDLDGTLYNTEKIVTDANKEALAAAREKGVKVVITTGR
FT                   PLRAIGNLLEELNLLDEEDYSITFNGGLIQRNTGEILNKRSLNFDQIYQIQKALEAVGL
FT                   PTDIISDGDVYSIPSKDGRHSQYCLANPMLNFIEVSSVDDLPTDIFYNKIVTVTDPDFL
FT                   DQQIAKLSPRLFEDFEAFKSRDIIFEIMPNGIDKAFGLKLLCEHLGLDAKHVMAMGDEA
FT                   NDFSMLEWAGLGVAMANGVSGAKAAADAVTTLTNDESGVAEAVKRFILDEEN"
FT   CDS_pept        549876..551426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftzY"
FT                   /locus_tag="SDEG_0579"
FT                   /product="putative cell division protein"
FT                   /note="similar to cell division protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81081"
FT                   /db_xref="GOA:C5WFB6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281835.1"
FT                   /protein_id="BAH81081.1"
FT                   /translation="MGLFDRLFGKKETQQVTETKPEEELLETSAKEEAVSTTSEQDQPD
FT                   LTLSQDDAPAVFTLEEQASKDSLEASQQREEKLVESTAVSPADSASMVGDKDALTSSPF
FT                   GQATVSDTEEIKEQPIVDQFPVEQTQDAESANFTEEDETSVSEEPTSSQQFMEDYYRRK
FT                   AALEKSLQEAAAATVPLMPEEPVEVSVGSDMSEEVAQDDSLTEVTETDEEKYKRSLKKT
FT                   RIGFSARLNSFFANFRRVDEEFFEDLEEMLILSDVGVHVATTLTEELRYEAKLENAKKP
FT                   DALKRVIVEKLVDIYEKDGRYNEAINYQDGLTVMLFVGVNGVGKTTSIGKLAYRYKQEG
FT                   KKVMLVAADTFRAGAVAQLVEWGRRVDVPVITGPEKADPASVVFDGVEKAVAEGADILL
FT                   IDTAGRLQNKENLMAELEKMGRIIKRVIPDAPHETLLALDASTGQNALSQAKEFSKITP
FT                   LTGLILTKIDGTAKGGVVLAIRQELDIPVKFIGFGEKMDDIGEFHSEDFMKGLLEGIL"
FT   CDS_pept        complement(551479..552597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0580"
FT                   /product="multidrug resistance protein B"
FT                   /note="similar to multidrug resistance protein B
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81082"
FT                   /db_xref="GOA:C5WFB7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281836.1"
FT                   /protein_id="BAH81082.1"
FT                   /translation="MATGLFTFGTILAVLTQSFAVMLLARIFQGIGTGMIMPQMFNIIL
FT                   ERVPMHKIGFFMGFGGLIISLAPAFGPTYGGFMISHFSWQWIFICILPVPLIAGILAYY
FT                   YLEDSPVSEKVPFDWLAFIALSISLTSALLAITSLENGSVNLYYLGLFILSFVLFLYKN
FT                   LTAKQPFLDIHILKIPSLTFGLIPFFVFQLINLGINFLTPNFIVMEKIANSSQAGMVLL
FT                   PGTLLGALLAPAFGKLYDQKGARLSLYLGNALFSLSLLIMTLQTKYFMLGAFTLLYILF
FT                   TFGRNMGFNNSLATAIREFPAEKNADATAIFQMMQQFAGALGTAMASLIANSQPEFTSG
FT                   VQSVYLLFTFFALCNFAFFIAMFKHLAKKRLA"
FT   CDS_pept        complement(552473..552844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0581"
FT                   /product="major facilitator superfamily protein"
FT                   /note="similar to major facilitator superfamily protein
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81083"
FT                   /db_xref="GOA:C5WFB8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB8"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128927.1"
FT                   /protein_id="BAH81083.1"
FT                   /translation="MSHHQQTVSKQTIMAIIAIALIGFSGILSETSMNVTFPTLMSVYQ
FT                   LPLNSLQWMTTIYLLAVAIMMTTSATLKKMCGKDPSFYGHRSLYLWDHLGRADPVLCGH
FT                   VVSPHFSRHWDWYDYATNV"
FT   CDS_pept        553172..554014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0582"
FT                   /product="transcription antiterminator"
FT                   /note="similar to transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81084"
FT                   /db_xref="GOA:C5WFB9"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFB9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281837.1"
FT                   /protein_id="BAH81084.1"
FT                   /translation="MLIKRVLNHNAAISTNHQGLDILLMGKGIAFGKKVGDSIELNAIE
FT                   TSFVLKNSDNMNRFTELFITVPPEVVACSERIINLGKIKLGKTLDEILYINLTDHIHSA
FT                   IERHEQGMLIHNPLRWEIQRYYPDEYAIGVKALELIGRDLGISLALDEAAFIATHFVNA
FT                   GLDNPFNEPQKITEIVSSIEQKVKTTFKTELDEDSIDYYRFMTHAKLFAQRVLSGTTYD
FT                   DDDADLLLVVKAKYPKAYQCVKEIGKDMARDYHYQLNASEQLYLTVHVKRLVKNLKET"
FT   CDS_pept        554016..555878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0583"
FT                   /product="PTS system"
FT                   /note="similar to PTS system beta-glucoside-specific IIABC
FT                   component [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81085"
FT                   /db_xref="GOA:C5WFC0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281838.1"
FT                   /protein_id="BAH81085.1"
FT                   /translation="MTYKETAKAILAAVGGEKNIQQVTHCVTRLRLVLTNDELVDDQIV
FT                   KAIPNVMGVMRKNGQYQIILGNDVNNYYQAFLSLGHFDNQDEDHSSKAKGSILERLIET
FT                   IAGVITPLIPALLGGGMLKVVGILLPMLGLASADSQTVAFTNFFGDAAYYFMPVMIAYS
FT                   AAARFKVTPVLAATIAGILLHPAFVAMVAEGKPLTLFGAPVTPASYGSSVIPILIMVYL
FT                   MQYIEKWVNRLVPSVMKSFLQPTLIILISGFLALVVVGPLGVIIGQGLSSTMLTIYHVA
FT                   PWLALAILGAIMPLVVMTGMHWAFAPIFLAASVATPDVLILPAMLASNLAQGAASLAVA
FT                   FKTKQKQTRQVALAAGISALLAGITEPALYGVTLKFKKPLYAAMISGGLVGAFIGFVNI
FT                   ASYTFVVPSIIGLPQYINPSGGANFTNALIAGAATIVLAFSLTWFMGIDEESPEQVSVA
FT                   ADMSQVKSGLSTKQTLYAPMTGEMLFLSEVPDEPFSSKLLGEGFAILPSEGVVYAPFDG
FT                   EVITFFPTKHAVALKNTRGVEVLIHVGIDTVELKGQGFEQLVSVGDVVKRGQALLKMDI
FT                   DFITSKGYSLISPVVVTNSAEQLEIIIQDDKKMVTKEDALLVIL"
FT   CDS_pept        555897..557321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="SDEG_0584"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /EC_number="3.2.1.86"
FT                   /note="similar to 6-phospho-beta-glucosidase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81086"
FT                   /db_xref="GOA:C5WFC1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281839.1"
FT                   /protein_id="BAH81086.1"
FT                   /translation="MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWT
FT                   DSPTSDNLTLEAIDFYHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQF
FT                   YDDLFDELLNYGIEPLVTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKV
FT                   KYWLTFNEVNSILHMPFTSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDV
FT                   KVGCMILAMPAYPMTSDPRDVLAAREFENLNLLFSDIHVRGKYPSYINSYFKENGIEIV
FT                   FEDGDKELLAEHTVDFLSFSYYMSVTQARNPEAYTSGQGNILGGLANPHLESSEWGWQI
FT                   DPIGLRLVLNQYYDRYQIPLFIVENGLGAKDQLVQTAGGSMTVHDDYRIDYMSHHLVQV
FT                   AKAIEDGVEVMGYTAWGCIDCVSMSTAQLSKRYGLIYVDRNDDGTGQLTRYKKKSFDWY
FT                   RQVIQTNGRYLEDNFS"
FT   CDS_pept        complement(557420..558259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0585"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenesMGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81087"
FT                   /db_xref="GOA:C5WFC2"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281840.1"
FT                   /protein_id="BAH81087.1"
FT                   /translation="MFTCGGALMIRFLILAGYFELTMYLQLSGKLDQYINVRYSYLAYI
FT                   SMVLSFILALVQLYTWMKNIKVHSHLSGKIARLTSPFILVFPVLIGLLVPTVTLDSTTV
FT                   SAKGYTFPLAAGASKTGVSDDGTIIQYLKPDTSLYFTKSAYQKEMRQELHKYKGKKPVT
FT                   ITTENYMEVMELIYLYPDEFLDRDIQYTGFVYNEPGHDNYQFLFRFGIIHCIADSGVYG
FT                   LLTTGNQTSYPNNTWLTVKGRLHMEYDKNLEQHLPVLQLAEVHQTKEPNNPYVYRVF"
FT   CDS_pept        complement(558235..559137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0586"
FT                   /product="hypothetical membrane spanning protein"
FT                   /note="similar to hypothetical membrane spanning protein
FT                   [Streptococcus pyogenesMGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81088"
FT                   /db_xref="GOA:C5WFC3"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC3"
FT                   /inference="similar to AA sequence:RefSeq:YP_281841.1"
FT                   /protein_id="BAH81088.1"
FT                   /translation="MSLFSTLPPSVLQWFAIFLSIIIEALPFVLLGTILSGCIEVFVTP
FT                   DLVQKYLPKQKFLRILFGTFVGFVFPSCECGIIPIINRFLEKKVPSYTAVPFLATAPII
FT                   NPIVLFATYSAFGNSLRFLMLRLFGAILVAIALGMMLAFLVDEDILKENAQPVHFHDYF
FT                   HESLPKRIYLALVHAIDEFFDTGRYLVFGTLIASAMQIYVPTRVLTTIGHNPLTAILIM
FT                   MLMAFILSLCSEADAFIGASLLSTFGVAPVLAFLLIGPMVDIKNLMMMVKAFKGRFIVQ
FT                   FIGVSVLMIAVYCLLVGVL"
FT   CDS_pept        complement(559284..559439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0587"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS9429 Spy0471
FT                   [Streptococcus pyogenes MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81089"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC4"
FT                   /inference="similar to AA sequence:RefSeq:YP_596203.1"
FT                   /protein_id="BAH81089.1"
FT                   /translation="MAITHKKNDELEKMMAGFASLPHFDAPLDVSTDGKLVTNNKPNNP
FT                   TKPSQS"
FT   CDS_pept        559611..560096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0588"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein spr1892
FT                   [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81090"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC5"
FT                   /inference="similar to AA sequence:RefSeq:NP_359483.1"
FT                   /protein_id="BAH81090.1"
FT                   /translation="MMMMTKEDWVRRLGLEPHVEGGYFKQTEKASERLDFSGKERALYT
FT                   SIYFLLEETNPSHFHRLTADEIWYFHAGEALTVHMITPDGHYEAVTLGLDLSKGQRLHY
FT                   CVPKGTIFGSTVEKDYALVSCLVVPGFEFDDFELFKRADLLAAYPEHQAIIERLTRD"
FT   CDS_pept        560183..560890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoP"
FT                   /locus_tag="SDEG_0589"
FT                   /product="two-component response regulator"
FT                   /note="similar to response regulator [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81091"
FT                   /db_xref="GOA:C5WFC6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC6"
FT                   /inference="similar to AA sequence:RefSeq:NP_359484.1"
FT                   /protein_id="BAH81091.1"
FT                   /translation="MTKQILLVDDEEHILRLLDYHLGKEGFSTQLVTDGRKALTLAETE
FT                   PFDFILLDIMLPQLDGIEVCKRLRAKGIKTPIMMVSAKSDEFDKVLALELGADDYLTKP
FT                   FSPRELLARVKAILRRTSKEQQEDDTDDFRDDYRVFGALTVYPDRHEVYKADHLLSLTP
FT                   KEFELLLYLMKHPNMTLTRERLLERIWGYDFGQETRLVDVHIGKLRDKIEDNPKDPQFI
FT                   QTIRGYGYKFKEL"
FT   CDS_pept        560891..562219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnpS"
FT                   /locus_tag="SDEG_0590"
FT                   /product="two-component sensor histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="similar to histidine kinase [Streptococcus
FT                   pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81092"
FT                   /db_xref="GOA:C5WFC7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC7"
FT                   /inference="similar to AA sequence:RefSeq:NP_359485.1"
FT                   /protein_id="BAH81092.1"
FT                   /translation="MKRYLQFLLVSFGLSFFILLGMAVAWLSKGVGLFLLALLLGSSAY
FT                   WLCRLWRWEQAFETLHQPLLTSNDHFLEKGQEDLTFLAKYMTDLKTDLVQQERHYKDLS
FT                   EKMETLLSHLTMGMFLVSSKGQLLLSSKSLPHYFPDMTEEMTSIEDLKRMDIRNLIHQA
FT                   FDQQLNVKKEVAGFHEDDLVLEVTAVPIINDAKSVSAVLVLLYDLTTIRTYEKMNLDFV
FT                   SNASHELRTPVTSIKGFAETIKAMPPEEEALKGDFLEIIYKESLRLEHIVEHLLTLSKL
FT                   QQMTLQLTEIELAVFVEELKQSLQPQLGKKDLQLNLQVPDDLMLVSDRQLLSQILLNLL
FT                   SNAIRYTEEGGHISVEAKKVTDGLAVSVTDTGIGMSQLELSRIFERFYRVNKGRSRQNG
FT                   GTGLGLAIVKELSQLLGGQVTVTSQLGKGSRFTLLLPEQISLD"
FT   CDS_pept        562377..563261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0591"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein"
FT                   /note="similar to phosphate ABC transporter,
FT                   phosphate-binding protein [Streptococcus pneumoniae
FT                   SP9-BS68]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC8"
FT                   /inference="similar to AA sequence:RefSeq:ZP_01821847.1"
FT                   /protein_id="BAH81093.1"
FT                   /translation="MIVMKVKKMLALAAISLTGFGLVACGNTNSGNGQSASGKIEVISR
FT                   ENGSGTRGAFTEITGILKKDGDKETDNTTKTAVIQNSTEGVLSAVQGNANAIGYISLGS
FT                   LTKSVKALAIDGVKASRETVLDGEYPLQRPFNIVWSSDLSQVGQDFIKFIHSKQGQQVV
FT                   TENKFIEAKTETAEYTSRNLSGKLSVVGSTSVSPLMEKLAEAYKKENPEVTIDITSNGS
FT                   SAGITAAKEKTADIGMVSRELSPEEGKSLTHDAIALDGIAVVVNNDNKASQISMAQLAD
FT                   VFSGQLTTWDKLK"
FT   CDS_pept        563379..564242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0592"
FT                   /product="phosphate ABC transporter"
FT                   /note="similar to phosphate ABC transporter permease
FT                   protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81094"
FT                   /db_xref="GOA:C5WFC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFC9"
FT                   /inference="similar to AA sequence:RefSeq:NP_346505.1"
FT                   /protein_id="BAH81094.1"
FT                   /translation="MTKQSFKEAIFKAIFFMSAAVAVVAILLICYFIFRNGLPFMADYG
FT                   FSRFLLGSDWSPTNNPASYGILPMIIGSLLVTFGAILIGVPTGVLTAVFMVYYCPKPIY
FT                   GFLKSAINLMAAIPSIVYGFFGLQLLVPWVRTFSGNGMNVFTASVLLGIMILPTIISLS
FT                   ESAIRTVPKTYYSGSLALGASHERSIFSVILPAARSGILSAIILGIGRAIGETMAVILV
FT                   AGNQPVIPSGIFEGTRTLTTNIVLEMAYASGQHRDALIATSAVLFFFILLINAGFAYLK
FT                   GKSSYE"
FT   CDS_pept        564235..565050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0593"
FT                   /product="phosphate ABC transporter"
FT                   /note="similar to phosphate ABC transporter permease
FT                   protein [Streptococcus pneumoniae TIGR4]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81095"
FT                   /db_xref="GOA:C5WFD0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD0"
FT                   /inference="similar to AA sequence:RefSeq:NP_346506.1"
FT                   /protein_id="BAH81095.1"
FT                   /translation="MSKYVLKTLVYFFAALTFVSLFVIIGFILIKGLPHLNMSLFSWTY
FT                   TSENISLMPAIISTVILVFGSLLLALPIGIFAGFYLVEYAKKDSLWVKMMRLASDTLSG
FT                   IPSIVFGLFGMLFFVVFLGFQYSLLSGILTSVIMVLPVIIRSTEEALLSVSDSMRQASF
FT                   GLGAGKIRTIFRIVLPVAMPGILAGVILAIGRIIGETAALMYTLGTSTNTPTSLMSSGR
FT                   SLALHMYMLSSEGLHVNEAYATGVILIITVLIINTLSSLLSRKLVKGAS"
FT   CDS_pept        565052..565804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0594"
FT                   /product="ABC transporter"
FT                   /note="similar to ABC transporter ATP-binding protein -
FT                   phosphate transport [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81096"
FT                   /db_xref="GOA:C5WFD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD1"
FT                   /inference="similar to AA sequence:RefSeq:NP_359489.1"
FT                   /protein_id="BAH81096.1"
FT                   /translation="MGTFSIRQLDLFYGEFQALKDISIDLPEKQITALIGPSGCGKSTF
FT                   LKTLNRMNDLVPSCRIEGEVLLDNQDIYSSKFNLNQLRKRVGMVFQQPNPFAMSIYDNV
FT                   AYGPRTHGIRDKKELDALVEKSLKGAAIWDEVKDNLKKSAMSLSGGQQQRLCIARALAV
FT                   EPDILLMDEPTSALDPISTLKIEDLIQDLKKDYTIIIVTHNMQQASRISDKTAFFLTGE
FT                   ICEYGNTVDIFTNPKDQRTEDYISGRFG"
FT   CDS_pept        565822..566472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0595"
FT                   /product="negative regulator of pho regulon for phosphate
FT                   transport"
FT                   /note="similar to negative regulator of pho regulon for
FT                   phosphate transport [Streptococcus pneumoniae R6]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81097"
FT                   /db_xref="GOA:C5WFD2"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD2"
FT                   /inference="similar to AA sequence:RefSeq:NP_359490.1"
FT                   /protein_id="BAH81097.1"
FT                   /translation="MRDQFELELQELEHSFLELGQLVLETGSKTLLALVSKDKDMAEQI
FT                   IARDQKINQRQSAIELACARMLALQQPQVSDLRFVISIMSSCSDLERMGDHMTGIAKAI
FT                   LQLKEDQLAPSEDQLHLMGQSALRMLADLLETFPLHQASKAVSIAQTDEQIDQHYYALS
FT                   KEIISLMKDQETSIPNGTQYLYIIGHLERFADYIANICERVVYLETGELIDLN"
FT   CDS_pept        567272..569404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0596"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SPy 0580
FT                   [Streptococcus pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81098"
FT                   /db_xref="GOA:C5WFD3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD3"
FT                   /inference="similar to AA sequence:RefSeq:NP_268842.1"
FT                   /protein_id="BAH81098.1"
FT                   /translation="MENKTNQTIAEALSVDLNQIEQVLALTAEGNTIPFIARYRKEVTG
FT                   NLDEVVIKSIIDMDKSLTTLNERKATILAKIEEQGKLTDQLRTSIEATEKLADLEELYL
FT                   PYKEKRRTKATIAREAGLFPLARLILQNAQNLETAAEPFVTEGFASPEAALAGAVDILV
FT                   EAMSEDAKLRSWTYNEIWQYSRLVSTLKDEQLDEKKVFQIYYDFSDQVSNMQGYRTLAL
FT                   NRGEKLGILKVSFEHNFEKMQRFFSVRFKETNPYIEDVINQTIKKKIVPAMERRVRSEL
FT                   SDAAEDGAIHLFSENLRHLLLVSPLKGKMVLGFDPAFRTGAKLAIVDQTGKLLATQVIY
FT                   PVAPASQTKIQAAKETLAQLIETYQIDIIAIGNGTASRESEAFVADVLKDFPNTSYVIV
FT                   NESGASVYSASELARHEFPDLTVEKRSAISIARRLQDPLAELVKIDPKSIGVGQYQHDV
FT                   SQKKLSENLNFVVDTVVNQVGVNVNTASPSLLAHVSGLNKTISENIVKYREENGALTSR
FT                   ADIKKVPRLGAKAFEQAAGFLRIPGAKNILDNTGVHPESYPAVKELFKVLEIHDLNEDA
FT                   KAKLAAVTIPQMAETLGIGLETLNDIITDLLKPGRDLRDDFEAPILRQDILDLKDLAIG
FT                   QKLEGTVRNVVDFGAFVDIGVHEDGLVHISEMSKTFVNHPSQVVSVGDLVTVWVSKIDL
FT                   DRHKVNLSLLPPRDTH"
FT   CDS_pept        569346..569828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0597"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0482
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81099"
FT                   /db_xref="GOA:C5WFD4"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD4"
FT                   /inference="similar to AA sequence:RefSeq:YP_281845.1"
FT                   /protein_id="BAH81099.1"
FT                   /translation="MTWTATRSISAYCHRVTLTNYVQEVSLADFGKPFRHQAYWNKRLK
FT                   TTGGRFFPKDGHLDFNPRVLEEHGGFVFRQIVRHELCHYHLYFEGRGYHHKDRDFKDLL
FT                   AQVDGLRYVPTSFNPKANHHYSCQTCGQVYQRKRRINLAKYVCGNCRGKLIEKNQS"
FT   CDS_pept        569892..570164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0598"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51378
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81100"
FT                   /db_xref="GOA:C5WFD5"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD5"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128919.1"
FT                   /protein_id="BAH81100.1"
FT                   /translation="METKFYKQRKNRLVAGVVAGLADKYGWDLTLARVLAALLIYGTGF
FT                   GLLLYILLALFLPYKEDLLEERYGRGPRRRKDADVLNEDEDGWFW"
FT   CDS_pept        570384..571376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsK"
FT                   /locus_tag="SDEG_0599"
FT                   /product="HPr(Ser) kinase"
FT                   /EC_number="2.7.-.-"
FT                   /note="similar to HPr kinase/phosphorylase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81101"
FT                   /db_xref="GOA:C5WFD6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281847.2"
FT                   /protein_id="BAH81101.1"
FT                   /translation="MSICKGLDSDLCYNIEKGENMTVTVKMLVKKVKLDVVYATDELLE
FT                   KEITTSDISRPGLEMTGYFDYYAPERLQLFGMKEWSYLTQMTSHNRYSVLKEMFKKDTP
FT                   AVIVSRALAIPDEMIQAAKEEGISLLSSRVSTSRLAGEMSYFLDASLAERTSVHGVLMD
FT                   IYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDVYAKDEETLWGEPAEILRHLLE
FT                   IRGVGIIDVMSLYGASAVKDSSQVQLAIYLENFEAGKVFDRLGNGNEEITFSGVSVPRI
FT                   RIPVKTGRNVSVVIEAAAMNHRAKEMGFDATQTFEDRLTQLITKNEASR"
FT   CDS_pept        571373..572152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="SDEG_0600"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="similar to prolipoprotein diacylglyceryl transferase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81102"
FT                   /db_xref="GOA:C5WFD7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281848.1"
FT                   /protein_id="BAH81102.1"
FT                   /translation="MINPIALQLGPLAIHWYALCILSGLILAVYLASKEAPRKGMTSDD
FT                   ILDFILIAFPLALIGARLYYVMFEWSYYAHHLDEIIAIWNGGIAIYGGLITGALVLLVY
FT                   CYYKVLDPIHFLDIAAPGVMIAQAIGRWGNFVNQEAYGKAVSHLNYLPSFIQKQMFIEG
FT                   SYRIPTFLYESLWNLLGFIIIMIWRRKPKSLLDGEIFAFYLIWYGCGRLVIEGMRTDSL
FT                   MFLGFRVSQYVSVLLIIIGLVFVFKRRRQKGIPYYQK"
FT   CDS_pept        572174..572578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0601"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0486
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81103"
FT                   /db_xref="GOA:C5WFD8"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281849.1"
FT                   /protein_id="BAH81103.1"
FT                   /translation="MDLVGIALIIIALAFVALVVFLILVLKKVSETVDEAKKTISILTS
FT                   DVNVTLYQTNEILAKANVLVEDVNGKVATIDPLFVAIADLSESVSDLNFQARHFGQKAS
FT                   SATNNVTKAGKVALVGKMASKVFGKKGEKA"
FT   CDS_pept        572575..573012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0602"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10750 Spy0508
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81104"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFD9"
FT                   /inference="similar to AA sequence:RefSeq:YP_602002.1"
FT                   /protein_id="BAH81104.1"
FT                   /translation="MSKFFKTLVVGAASGAAAAYFLSTEKGKALKNRAEKAYQAYKENP
FT                   DDYHQLAKEKGSEYSHLARETFYDVKDKLATGEMTKEEILELLKDKTTAFVQKTKETLV
FT                   EVEAKENQDDVIIDLNEDDIIIDYTEQDEHLSDADTSQDKY"
FT   CDS_pept        complement(573176..573460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0603"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51373
FT                   [Streptococcus pyogenes str.Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81105"
FT                   /db_xref="GOA:C5WFE0"
FT                   /db_xref="InterPro:IPR021688"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE0"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128914.1"
FT                   /protein_id="BAH81105.1"
FT                   /translation="MPTPLKKHDAFEHDDSYQESQGKFQDFQEFNGQSAKLKELVFFAR
FT                   IACFSLITVLFAFVLLVMNLAPVLAFLFASIISLGITSLLAKGIKSLLM"
FT   CDS_pept        573608..574585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0604"
FT                   /product="putative peptidase"
FT                   /note="similar to putative peptidase [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81106"
FT                   /db_xref="GOA:C5WFE1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128913.1"
FT                   /protein_id="BAH81106.1"
FT                   /translation="MQEICLMLRIFWYNKGYMKKIIITATAESIEQVKALLAAGVDRIY
FT                   VGEANYGLRLPHNFSYDELRQIAKLVHEAGKELTVACNALMHQDMMDHIKPFLDLMAEI
FT                   AVDYLVVGDAGVFYVTKRDGYNFKLIYDTSVFVTSSRQVNFWGQHGAVESVLAREIPSA
FT                   ELFTLAENLEFPAEVLVYGASVIHHSKRPLLENYYHFTKIDDEVSRERGLFLAEPGDAS
FT                   SHYSIYEDNHGTHIFINNDIDMMSKLGELYEHGLTHWKLDGIYCPGDDFVAITKLFIQA
FT                   KTLLEAGQFTQEEAEKLDQAVHAHHPAGRGLDTGFYEFDPKTVK"
FT   CDS_pept        574687..575973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0605"
FT                   /product="peptidase family U32"
FT                   /note="similar to peptidase family U32 [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81107"
FT                   /db_xref="GOA:C5WFE2"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281854.1"
FT                   /protein_id="BAH81107.1"
FT                   /translation="MSHMKKRPEVLSPAGTLEKLKVAIDYGADAVFVGGQAYGLRSRAG
FT                   NFSMEELQEGIDYAHARGAKVYVAANMVTHEGNEIGAGDWFRQLRDMGLDAVIVSDPAL
FT                   IVICSTEAPGLEIHLSTQASSTNYETFEFWKAMGLTRVVLAREVNMAELAEIRKRTDVE
FT                   IEAFVHGAMCISYSGRCVLSNHMSHRDANRGGCSQSCRWKYDLYDMPFGAERRSLKGEV
FT                   PEDYSMSSVDMCMIEHIPDLIENGVDSLKIEGRMKSIHYVSTVTNCYKAAVDAYMESPE
FT                   AFYAIKDELIDELWKVAQRELATGFYYGTPSENEQLFGARRKIPQYKFVGEVVAFDSAS
FT                   MTATIRQRNVIMEGDRIECYGPGFRHFETVVKDLHDADGQKIDRAPNPMELLTISLPRE
FT                   VKPGDMIRACKEGLVNLYQKDGTSKTVRA"
FT   CDS_pept        576178..576390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0606"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81108"
FT                   /db_xref="GOA:C5WFE3"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE3"
FT                   /inference="similar to AA sequence:RefSeq:YP_602006.1"
FT                   /protein_id="BAH81108.1"
FT                   /translation="MAEFTFKIEEHLLTLSENDKGWTKELNRVSFNGAEAKWDIRTWSP
FT                   DHTKMGKGITLTNEEFKTILDAFRK"
FT   CDS_pept        complement(576492..576635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0607"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M28 Spy0473
FT                   [Streptococcus pyogenes MGAS6180]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81109"
FT                   /db_xref="GOA:C5WFE4"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE4"
FT                   /inference="similar to AA sequence:RefSeq:YP_279942.1"
FT                   /protein_id="BAH81109.1"
FT                   /translation="MMTKEYISYISAAIFVLYGLLAAKWIFIGLGLILVFVGLGDRLQS
FT                   KK"
FT   CDS_pept        complement(576684..577811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0608"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1433
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81110"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE5"
FT                   /inference="similar to AA sequence:RefSeq:NP_688430.1"
FT                   /protein_id="BAH81110.1"
FT                   /translation="MKHYQIIIIGAGAAGIGFGAALKRYDINDFLILEQGTVGDSFLKW
FT                   PRTTQFITPSFTTNGFGFPDINAVVPNTSPAFSFNKEHLSGPEYAHYLSLVAKNDNLPI
FT                   QTNTQVLTIQRHPKGYQVKTSQGDFSCRYLIMATGEFQLPNNQGIKGAELGMHYGQVDS
FT                   FNVKSEDPFIIIGGNESACDALTHLAYLGNEVHLFTDSFGKRKTAADPSISLSPITQER
FT                   LKHIQDNPNYHIHITEGKHAQEIHQTEKGYQVIFQDGSTAYSHHKPILATGFLNTCHLI
FT                   GGEAIFDYNQDGIPLVTENDESTLNPNCFLIGPSLRQKNTIFCYIYKFRQRFSPLITEI
FT                   ASREGWQLDPDILEFYRANQMHLDRLDCCEVTCDC"
FT   CDS_pept        577915..578952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0609"
FT                   /product="ammonium transporter (Amt) family protein"
FT                   /note="similar to ammonium transporter (Amt) family protein
FT                   [Streptococcus agalactiae A909]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81111"
FT                   /db_xref="GOA:C5WFE6"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE6"
FT                   /inference="similar to AA sequence:RefSeq:YP_330075.1"
FT                   /protein_id="BAH81111.1"
FT                   /translation="MFLLICILVMWVMIFGVACFYFGSLDKQLTPQVIYRFTLAILMAT
FT                   LIWILGAYFFAFEGKMQTLMTVKSVSLERALDLLFQLCFCLYAVVMLIGAIIDRVKTSH
FT                   LLLLVGVWISLVYTPLAYLMWNTEGLLANLGARDFSGGMVVHLSAGLSTYILAHFAGKT
FT                   PHQHEKIRQEWLYLGMILVTFGWFGFNVGPVGQLNALAGQVLLNTLLAIVCGGFSWSLV
FT                   TFLRHKEESTVALLNGMIVGLVTSTAGVGYLNTGEISLLTFVASGLTCLLTDYLSHQLP
FT                   VDDVVDSFAMNGIGGFLGSLGLALLRPQLLLPQILAIFVTIFLSTLVSFVLGKTLLQHK
FT                   TKKVE"
FT   CDS_pept        complement(579029..580534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="SDEG_0610"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="similar to lysyl-tRNA synthetase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81112"
FT                   /db_xref="GOA:C5WFE7"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281858.1"
FT                   /protein_id="BAH81112.1"
FT                   /translation="MEENMSNQHIEELNDQQIVRREKMMALAEQGIDPFGKRFDRTANS
FT                   AELKEKYADKTKEELHELNETAIVAGRLMTKRGKGKVGFAHLQDREGQIQLYVRKDSVG
FT                   EDNYEIFKKADLGDFIGVEGEVMRTDMGELSIKATKLTHLSKSLRPLPEKFHGLTDIET
FT                   IYRKRHLDLISNRESFDRFVTRSKMISEIRRYLDGLDFLEVETPVLHNEAGGAAARPFV
FT                   THHNAQNIDMVLRIATELHLKRLIVGGMERVYEIGRIFRNEGMDATHNPEFTSIEVYQA
FT                   YADYLDIMNLTEGIIQHAAKAVKGDGPIDYQGTEIRINEPFKRVHMVDAIKEVTGVDFW
FT                   PEMTVEEAIALAKEKQVPLEKHFTSVGHIINAFFEEFVEETLVQPTFVFGHPVEVSPLA
FT                   KKNPEDTRFTDRFELFIMTKEYANAFTELNDPIDQLSRFEAQAQAKELGDDEATGIDYD
FT                   FVEALEYGMPPTGGLGIGIDRLCMLLTNTTTIRDVLLFPTMKP"
FT   CDS_pept        580696..581598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0611"
FT                   /product="hydrolase"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81113"
FT                   /db_xref="GOA:C5WFE8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281859.1"
FT                   /protein_id="BAH81113.1"
FT                   /translation="MITAIVFDVDDTIYDQQAPYRIAMEKCFPDFDMSVMNQAYIRFRH
FT                   YSDVGFPRVMAGEWTTEYFRFWRCKETLLEFGYREIDEATGVHFQEVYEHELENITMLD
FT                   EMRMTLDFLKSKNVPMGIITNGPTEHQLKKVRKLGLYDYIDPKRVIVSQATGFQKPEKE
FT                   IFNLAAEQFDMNPQTTLYVGDSYDNDIMGAFNGGWHSMWFNHRGRQLKPRTKPVYDVAI
FT                   DNFEQLFGAVKVLFDLPDNKFIFDVNDKKNPILQMGINNGLMMAAERLLESNMSIDKVV
FT                   ILLRLTKQQEKVLRLKYAR"
FT   CDS_pept        complement(581782..582402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0612"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="similar to phosphoglycerate mutase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81114"
FT                   /db_xref="GOA:C5WFE9"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFE9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281860.1"
FT                   /protein_id="BAH81114.1"
FT                   /translation="MKLYFVRHGKTLWNLEGRFQGAGGDSPLLEESKDEIRLLGKSLSK
FT                   ISFDAVYTSDLPRAMATAAIILDSFDQEPSLYHTDQLREWRLGKLEGAKIATMAAIYPQ
FT                   QMSAFRHNLAQFKPHHFEAESIYQTTQRVRQLIESFGDKNYHNVLIVGHGANLTASIRS
FT                   LLGFEPALLLAKGGLDNASLTILETKNGQDFQCLKWNDKSFTE"
FT   CDS_pept        complement(582415..582780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0613"
FT                   /product="putative membrane protein"
FT                   /note="similar to conserved hypothetical protein; putative
FT                   integral membrane protein [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81115"
FT                   /db_xref="GOA:C5WFF0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF0"
FT                   /inference="similar to AA sequence:RefSeq:NP_721127.1"
FT                   /protein_id="BAH81115.1"
FT                   /translation="MRTIANMIWFIFSGFWAWLAWSFIGILLCLTIIGIPFGLQCFKIG
FT                   NFGLFPFGKTIDTGTGTDSLILNLLWMLICGWSLAVMHLTSALLLCISIIGIPFAGQCL
FT                   KLALISLFPFGARITYL"
FT   CDS_pept        complement(582777..583262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0614"
FT                   /product="putative transcription regulator"
FT                   /note="similar to putative transcription regulator
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81116"
FT                   /db_xref="GOA:C5WFF1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF1"
FT                   /inference="similar to AA sequence:RefSeq:NP_606845.1"
FT                   /protein_id="BAH81116.1"
FT                   /translation="MIMAKKTKRKKTLVEQILDKAHIAHQRLSLNALEADLPSGIQASD
FT                   IYKTLALIGDKTGPLIGIIPLTEHLSEKQLAKVSGNKKVSMIPKKDLQKTTGYVHGANN
FT                   PVGIRQKHSFPIFIDETALEKGQMIVSAGEIGRSIQIDSHTLADFVGASFADLKEKK"
FT   CDS_pept        complement(583348..583944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0615"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SpyM51364
FT                   [Streptococcus pyogenes str.Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81117"
FT                   /db_xref="GOA:C5WFF2"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF2"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128905.1"
FT                   /protein_id="BAH81117.1"
FT                   /translation="MLFFVSEKEFFMSKNTNVKYLIEAAIFAALAMALSFIPDFAGWFS
FT                   PSYGAIPLVIFSLRRGLKYGLLAGLIWGLLHFALGKVYYLSMSQVFIEYILAFISMGLA
FT                   GIFSDSLVKTLRQQKKPFALLIALMATIVAVGVRYLWHFIAGVIFWGSYAPKGMSAIWY
FT                   SFTVNGTAGLLTLLVTLLALLLILPTQPQFFDPRD"
FT   CDS_pept        complement(584193..585035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0616"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="similar to N-acetylmuramoyl-L-alanine amidase
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81118"
FT                   /db_xref="GOA:C5WFF3"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF3"
FT                   /inference="similar to AA sequence:RefSeq:YP_602013.1"
FT                   /protein_id="BAH81118.1"
FT                   /translation="MRRRIKPIVVLVFFALLAMVLIIGKLHANQVKQKELEQAKANIPI
FT                   ATSSSTKTSTSETEDFVLNPIIDVSGWQLPEEIDYDTLSHNISGAIVRVYGGSQITAHN
FT                   NAAFTTGIDKSFKKHIKEFQKRDVPVAVYSYALGRSAKEMREEARAFYKNAAPFNPTYY
FT                   WIDVEEVTMKDMNKGVKAFREELKKLGAENIGLYIGTYFMAEQEISTKGFDAIWIPTYG
FT                   SDSGYYEAAPNTTLDYDLHQYTSQGYINGFNHPLDLNQIAVTKDTKKTFEKLFGKIKN"
FT   CDS_pept        585359..585862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0617"
FT                   /product="integral membrane protein"
FT                   /note="similar to integral membrane protein [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81119"
FT                   /db_xref="GOA:C5WFF4"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF4"
FT                   /inference="similar to AA sequence:RefSeq:YP_602014.1"
FT                   /protein_id="BAH81119.1"
FT                   /translation="MSTKVVSRIAVMSALCVVLRIAFSSLPNVQPVTAIFLGYLLYFGL
FT                   AEASLVMMLCLLSSSFLLGFGPWVFWQITCFAFILLLWRYIFYPLTLRVKRHQIIYQAV
FT                   FAGFGGFLYGVLIDTCFAYLYSMPWWSYVLAGMPFNIAHALSTLVFFPVIMMLFRRLIG
FT                   EQRI"
FT   CDS_pept        585846..586229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0618"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein MGAS10270 Spy0496
FT                   [Streptococcus pyogenes MGAS10270]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81120"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF5"
FT                   /inference="similar to AA sequence:RefSeq:YP_598105.1"
FT                   /protein_id="BAH81120.1"
FT                   /translation="MNKGFKTGFLALVAMLLVACSQGTKQTQTPSVPKSDHHVRLVVKE
FT                   DTNTVDEKVSFEEGDTVLEVLKDNYEVKEKDGFITSIDGIEQDMKANKYWLFKVNGKMA
FT                   DKGADQITVKDGDSIEFYQEVFN"
FT   CDS_pept        complement(586275..586799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0619"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="similar to glutathione peroxidase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81121"
FT                   /db_xref="GOA:C5WFF6"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281866.1"
FT                   /protein_id="BAH81121.1"
FT                   /translation="MIPLTKLSVTPRICHMPNLYDFTVKAQDGSDISLVNYKEKVVLVV
FT                   NTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCNQFLNQAPGDAEEINHFCSLTYHTT
FT                   FPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFAKFLIDQNGQVIKRYSSKTDPK
FT                   LIEEDLKALLG"
FT   CDS_pept        complement(586747..588546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepF"
FT                   /locus_tag="SDEG_0620"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="similar to oligoendopeptidase F [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81122"
FT                   /db_xref="GOA:C5WFF7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281867.1"
FT                   /protein_id="BAH81122.1"
FT                   /translation="MELKKRSEFPENELWDLTALYKDRQDFLLAIEKALQDIDLFKRNY
FT                   EGRLTSVDDFTQALIEIEHIYIQMSHIGTYAFMPQTTDFSDESFAQIAQAGDDFMTKAS
FT                   VALSFFDTALANADLDVLDTLEKNPYFSAAIRMAKIQKEHLLSPDVEKALANLREVINA
FT                   PYDIYTKMRAGDFDMDDFEVDGKTYKNSFVSYENFYQNHENAEIREKAFRSFSKGLRKH
FT                   QNTAAAAYLAKVKSEKLLADMKGYASVFDYLLAEQEVDRSLFDRQIDLIMTEFGPVAQK
FT                   FLKHVAQVNGLEKMTFADWKLDIDNDLNPEVSIEGAYNLVMKSLAPLGQEYTKEIERYQ
FT                   TERWVDFAANANKDSGGYAADPYKVHPYVLMSWTGRTSDVYTLIHEIGHSGQFIFSDNH
FT                   QSYFNTHMSTYYVEAPSTFNELMLSDYLEHQFDDPRQKRFALAHRLTDTYFHNFITHLL
FT                   EAAFQRKVYTLIEEGGTFGADQLNAMMKEVLTDFWGDAVDIDDDAALTWMRQAHYYMGL
FT                   YSYTYSAGLVISTAGYLNLKHNPNGAKEWLDFLKSGGSRTPLDTAMLIGADIATEKPLR
FT                   DTIQFLSDTVDQIISYTEDMSHA"
FT   CDS_pept        588677..591508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SDEG_0621"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="similar to phosphoenolpyruvate carboxylase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81123"
FT                   /db_xref="GOA:C5WFF8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281868.1"
FT                   /protein_id="BAH81123.1"
FT                   /translation="MLSFLVKSGMIKREANRGGVNSLSLKKLESSNNQAIIAEEVAILK
FT                   DMLEKITRRMIGDEAFATIETIVALSEKQDYVGLETIIASISNQDMDVISRYFSILPLL
FT                   INISEDVDLAYEINYQNNANKDYLGKLALTIDAVAEKENAKDILEQVNVVPVLTAHPTQ
FT                   VQRKTILELTTHIHDLLRKYRDVKAGVVNQEKWHNELYRYIEIIMQTDIIREKKLKVKN
FT                   EITNVMQYYNGSLIQAVTKLTTEYKNLAQKRGLDLVNPNPITMGMWIGGDRDGNPFVTA
FT                   ETLRLSATVQSEVILNYYIEKLAALYRTFSLSSTLIQPSAEVERLASLSQDQSIYRENE
FT                   PYRRAFHYVKSRLVQTRTQLTGDQDTTGQSLTAGRLTRQLAMQDQLEGPIAAYVSPEDF
FT                   KADLMAIEQSLLSNGDVALVDGDLREVMQAVDIFGFFLASIDMRQDSSVQEACVAELLK
FT                   GANIVEDYSSLSETEKCDLLVKQLTEDPRTLSSAAVAKSDLLEKELAIYAAARELKDKL
FT                   GDEVIKQHIISHTESVSDMFELAIMLKEVGLIDQHKARVQIVPLFETIEDLDNARDIMT
FT                   TYLSYDMVKSWIAANHNYQEIMLGYSDSNKDGGYLASGWTLYKAQNELTAIGEENGVKI
FT                   TFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGNKDVAYYHLEML
FT                   ISASINRMVTQMLTNPNEIDGFREVMDGIVADSNKIYRQLVFDNPHFYDYFFEASPIKE
FT                   VSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHYIDQAEGNL
FT                   ERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLADSQEVRDVFHVILDEWQLTK
FT                   NVILAIEGHEELLEDNPSLKQSLAFRLPYFNVLNYIQIELIKRLRNHQLREEDEKLIHT
FT                   TINGIATGLRNSG"
FT   CDS_pept        591696..593000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SDEG_0622"
FT                   /product="cell division protein"
FT                   /note="similar to cell division protein [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81124"
FT                   /db_xref="GOA:C5WFF9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFF9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281869.1"
FT                   /protein_id="BAH81124.1"
FT                   /translation="MIISRNIGETMKIDKRHLLNYSILLPYLILSVIGLIVVYSTTSVS
FT                   LIQAHANPFKSVINQGAFWTLSLIAIVFIYKLKLNFLTNTKVLTLVMLIEMTLLVIARF
FT                   FTTAIKGAHGWIVIGPISFQPAEYLKIIMVWYLALTFAKIQEKVSLYDYQALTRRKWWP
FT                   TEWGDLRDWRVYSLFMILLVAAQPDLGNASIIVLTAIIMFSISGIGYRWFSAILVLITS
FT                   LSTLFLGTIALIGVEKVAKVPVFGYVAKRFSAFFNPFHDLTDSGHQLANSYYAMSNGGW
FT                   FGRGLGNSIEKRGYLPEAQTDFVFSVVIEELGLIGAGLILALVFFLILRIMNVGIKAKN
FT                   PFNAMMALGVGGMMLMQVFVNIGGISGLIPSTGVTFPFLSQGGNSLLVLSVAVGFVLNI
FT                   DANEKREDILKEAELTYRKDARKENSNVININQFQ"
FT   CDS_pept        593071..593580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0623"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="similar to DNA-directed RNA polymerase specialized
FT                   sigma subunit [Streptococcus suis 98HAH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81125"
FT                   /db_xref="GOA:C5WFG0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG0"
FT                   /inference="similar to AA sequence:RefSeq:YP_001200080.1"
FT                   /protein_id="BAH81125.1"
FT                   /translation="MSPIKLEPYEQELVVYSKDIIAYLKASGVPDQLARDISQDVFLKM
FT                   LESNIILPPEKIRAWMYRVAVRKYIDHYRRDKTYLEILQRDFFHQETVVEFEQPNYTPL
FT                   YETISALPEKYRMVLSLYYFDGLSVKEIASILHKSLSSVKINLMRGRALLKEKLKKAGY
FT                   TYDDFN"
FT   CDS_pept        593564..594643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0624"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein Sez 1324
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81126"
FT                   /db_xref="GOA:C5WFG1"
FT                   /db_xref="InterPro:IPR025672"
FT                   /db_xref="InterPro:IPR029101"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG1"
FT                   /inference="similar to AA sequence:RefSeq:YP_002123673.1"
FT                   /protein_id="BAH81126.1"
FT                   /translation="MMISTDFEKLAKRHKRRNIFRTVTISVVLSLFLMVLGFIGLNRLT
FT                   SKNGQSIQQYYTVISEIAYPNISYSSWGYDATSQFTGNFVSHRFKDIDGISVPFEKYEH
FT                   YYSLILNQKSSANNNSLMSDDNGRSMYTRASHYKVPMFFNKGKKVQLGSIKPTQDIPLI
FT                   RQMSGQAVEVAITFDKGYTLKEMEQFIPKNLKLNWIWSGVQLEYLESQFGFTPYFNLGL
FT                   TAEQQKKMNAEIAKAYQTKKNPDLNPIYQKYSHKSAVSPVEGMENSYTAFQDRLEQYFK
FT                   MEESSLQTVTTEDGEVYSSKAMLKEYLRQNKNPKTAKFEGVILTGRAENFDQLQNADWI
FT                   YASNIGQSIQIQPYHHLEK"
FT   CDS_pept        594751..595965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0625"
FT                   /product="elongation factor Tu"
FT                   /note="similar to elongation factor Tu [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81127"
FT                   /db_xref="GOA:C5WFG2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281871.1"
FT                   /protein_id="BAH81127.1"
FT                   /translation="MEAFPKMAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARR
FT                   LPTSVNQPKDYASIDAAPEERERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITG
FT                   AAQMDGAILVVASTDGPMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEI
FT                   RDLLSEYDFPGDDLPVIQGSALKALEGDSKYEDIIMELMSTVDEYIPEPERDTDKPLLL
FT                   PVEDVFSITGRGTVASGRIDRGTVRVNDEIEIVGIKEETKKAVVTGVEMFRKQLDEGLA
FT                   GDNVGILLRGVQRDEIERGQVIAKPGSINPHTKFKGEVYILSKDEGGRHTPFFNNYRPQ
FT                   FYFRTTDVTGSIELPAGTEMVMPGDNVTINVELIHPIAVEQGTTFSIREGGRTVGSGIV
FT                   SEIEA"
FT   CDS_pept        596276..596707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0626"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG1552
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81128"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG3"
FT                   /inference="similar to AA sequence:RefSeq:NP_688545.1"
FT                   /protein_id="BAH81128.1"
FT                   /translation="MVTMVLRNTTIVEDIEKARAKKKYLPSFPTGILRKGINQDGITQL
FT                   DSQTDVVFGEKLIEVRIPWQLLNFSNLAAKRIHDDYMKHYGVKEVDADMIALGWGPAQS
FT                   HEMIPMEDYPLPSWERPKVRPFLKASYSIIKKEWTKKGE"
FT   CDS_pept        596871..597098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0627"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1605
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81129"
FT                   /db_xref="GOA:C5WFG4"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG4"
FT                   /inference="similar to AA sequence:RefSeq:NP_736040.1"
FT                   /protein_id="BAH81129.1"
FT                   /translation="MQLFFTFLQLSQLIFLLLLIAYASLLVISLVIEGVHLYEKREHRS
FT                   RLATHADDVGVSVIVPAYNEALTIVNTDDC"
FT   CDS_pept        597076..598299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0628"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.147"
FT                   /note="similar to glycosyl transferase group 2 family
FT                   protein [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81130"
FT                   /db_xref="GOA:C5WFG5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG5"
FT                   /inference="similar to AA sequence:RefSeq:NP_688541.1"
FT                   /protein_id="BAH81130.1"
FT                   /translation="MLILTIVNTIDSLLHLDYDHYEIIVVDDGSSDQTSMVLMNHFPLI
FT                   LHQEPINQHIVTKPYKAIYKADVEGVVLTLIVKENGGKGDALNMGINASCHDYFLCLDA
FT                   DSMLQKDSLKHIVTSVRLDKTVIAVGGLVQVAQGVKIEEGGVASYHLPWRMIPCAQAIE
FT                   YDSSFLGARIFLDYLKANLIISGAFGLFKKDIVKAVGGYDTETLGEDMELVMKLHFFCR
FT                   NNQVPYRICYETDAVCWSQAPTSLGDLRKQRRRWFLGLYQCLKKYRSVFANYRFGAVGF
FT                   VSYIYYIFFELISPFLELFGAGVVFLALIFHQLNIPFFFSLIFLYTLYCILITLTSFLH
FT                   RIYSQKLMIGVTDIIKGIYIAVFRYLVLHPVLTLVKTSSIIGYREKKNIWGQLKREIQM
FT                   QEYDNLLS"
FT   CDS_pept        598465..599223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="SDEG_0629"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="similar to triosephosphate isomerase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81131"
FT                   /db_xref="GOA:C5WFG6"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281872.1"
FT                   /protein_id="BAH81131.1"
FT                   /translation="MSRKPIIAGNWKMNKTPQEAKAFVEAVASKLPSNDLVDVAVAAPA
FT                   VDLVTTIEAAKDSVLKVAAQNCYFENAGAFTGETSPKVLAEMGADYVVIGHSERRDYFH
FT                   ETDEDINKKAKTIFANGLTPILCCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVASL
FT                   VLAYEPIWAIGTGKSATQDDAQKMCKAVRDVIAADFGQEVADKVRVQYGGSVKPENVKD
FT                   YMACPDVDGALVGGASLEADSFLALLDFLN"
FT   CDS_pept        complement(599291..600295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0630"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus thermophilus
FT                   LMD-9]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81132"
FT                   /db_xref="GOA:C5WFG7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG7"
FT                   /inference="similar to AA sequence:RefSeq:YP_820728.1"
FT                   /protein_id="BAH81132.1"
FT                   /translation="MGRTTNEKTEEMTELERLQYENEYLRAENAVLKKLRELRLQGRSQ
FT                   GSTEQQKSFTGLINVFDLRIVLNIGKLSRSTYYYQVKRLTQGDKNKELKEAIQDIYSEN
FT                   KGRYGYRRIHLELKNRGYKVNHKKVQRLMTELGLKARIRAKRRYNSYKGEVGKKADNLI
FT                   KRQFKAAQPLKKCYTDVTEFSIPASDQKLYLSPVLDGFNSEIIAYHLSTSPNLQQLKTM
FT                   LSEAFPEQTYQVTILHSDQGWQYQHTYYHHFLEEHGMRPSMSRKGNSLDNGMMESFFGT
FT                   LKTEMFYGFEKEFTSLETLKTAISEYINYYNTKRIKLTLKGLSPVQYRTQSLT"
FT   CDS_pept        complement(600321..600431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0631"
FT                   /product="ISSsa1 transposon OrfA"
FT                   /note="similar to ORFA transposon ISSsa1 [Streptococcus
FT                   sanguinis SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81133"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG8"
FT                   /inference="similar to AA sequence:RefSeq:YP_001034274.1"
FT                   /protein_id="BAH81133.1"
FT                   /translation="MKGRSQLEVSLDYGLPNKGMLPNWIAQYKKNGYSYS"
FT   CDS_pept        complement(600458..600658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0632"
FT                   /product="transposase"
FT                   /note="similar to transposase [Streptococcus pyogenes
FT                   MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81134"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFG9"
FT                   /inference="similar to AA sequence:RefSeq:YP_060051.1"
FT                   /protein_id="BAH81134.1"
FT                   /translation="MGCFSMKLSYEDKIEIYRLRQSGWTWPKISQTFNMSKYNLQYMVR
FT                   LIDIHGLESVIKGKIGIILLN"
FT   CDS_pept        complement(600873..601583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0633"
FT                   /product="ISSdy1, transposase OrfB"
FT                   /note="similar to ISSdy1 transposase OrfB [Streptococcus
FT                   agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81135"
FT                   /db_xref="GOA:C5WFH0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH0"
FT                   /inference="similar to AA sequence:RefSeq:NP_688236.1"
FT                   /protein_id="BAH81135.1"
FT                   /translation="MCRWLNMPRSSYYYQAVESVSEMEFEETIKRIFLESESRYGSRKI
FT                   KICLNNEGITRSRRRILRIMKRLNLVSVYQKATFKPHSRGKNEAPIPNHLDRQFKQERP
FT                   LQALVTDLTYVRVGNRWAYVCLIIDLYNREIIGLSLGWHKTAELVKQAIQSIPYALTKV
FT                   KMFHSDRGKEFDNQLIDEILKAFGITRSLSQAGCPYDNAVAESTYRAFKIEFVYQETFQ
FT                   SLEELALKTKDYVH"
FT   CDS_pept        complement(601619..601909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0634"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein gbs1310
FT                   [Streptococcus agalactiae NEM316]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81136"
FT                   /db_xref="GOA:C5WFH1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH1"
FT                   /inference="similar to AA sequence:RefSeq:NP_735750.1"
FT                   /protein_id="BAH81136.1"
FT                   /translation="MSRKVRRHFTDDFKQQIVDLYNAGRKRSSLIKEYELTPSTFDKWV
FT                   RQAKTTGSFKSVDNLTDEQRELIELRKHNKELEMQLDILKQAAVIMAQKGK"
FT   CDS_pept        complement(601962..602135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0635"
FT                   /product="L-lactate dehydrogenase (FMN-dependent) related
FT                   alpha-hydroxy acid dehydrogenase"
FT                   /EC_number="1.1.2.3"
FT                   /note="similar to L-lactate dehydrogenase (FMN-dependent)
FT                   related alpha-hydroxy acid dehydrogenase [Pediococcus
FT                   pentosaceus ATCC 25745]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81137"
FT                   /db_xref="GOA:C5WFH2"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH2"
FT                   /inference="similar to AA sequence:RefSeq:YP_804422.1"
FT                   /protein_id="BAH81137.1"
FT                   /translation="MRTRIMTMINGYQQSDREERLEILNLPSLQQRAQQIIPKGGFGYI
FT                   TEGSEDELNRLH"
FT   CDS_pept        complement(602259..603494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0636"
FT                   /product="factor essential for expression of methicillin
FT                   resistance"
FT                   /note="similar to factor essential for expression of
FT                   methicillin resistance [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81138"
FT                   /db_xref="GOA:C5WFH3"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH3"
FT                   /inference="similar to AA sequence:RefSeq:YP_281873.1"
FT                   /protein_id="BAH81138.1"
FT                   /translation="MALIEIAQERFAHYCQSLHRHSFIQTPEMAQLLTKRGAEPHFLGL
FT                   EKDGELKVAAIVFRQKVLGGWRLELNAGPNTNSPEYLKEFYSQLKAYAKKHHVIECIVK
FT                   PYDDYQQFDSNGNPLSETNEELIALLTSLGFQHDGFKIGYPEGEPVWHYVKNLEGITPS
FT                   QLSQSFSKKGKALLKKANTFGITLRSLNRDELHHFKEITAATSDRRDYSDKSLSYYQDF
FT                   YDSFGDYCEFVVATLNFNDYLTNLKQKQNQLGVRIEKLDNELMTHPHSEKKQNQLRELS
FT                   SQFETFDVRISEALDFLKEYGAKEIILAGSLFLYTPQEAVYLFSGSYPEFNRFYAPALL
FT                   QEHAMLTAIARGIKTYNFLGITGEFDGSDGVLRFKQNFNGYILQKPGTFRYYPRPMLFQ
FT                   SIQFLKKLLKRY"
FT   CDS_pept        complement(603494..604726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murM"
FT                   /locus_tag="SDEG_0637"
FT                   /product="UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-alanyltransferase/UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-seryltransferase"
FT                   /EC_number="2.3.2.-"
FT                   /EC_number="2.3.2.10"
FT                   /note="similar to UDP-N-acetylmuramoylpentapeptide-lysine
FT                   N(6)-alanyltransferase/UDP-N-acetylmuramoyl
FT                   pentapeptide-lysine N(6)-seryltransferase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81139"
FT                   /db_xref="GOA:C5WFH4"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH4"
FT                   /inference="similar to AA sequence:RefSeq:YP_281874.1"
FT                   /protein_id="BAH81139.1"
FT                   /translation="MGVKLMYTYKIGISPEEHDQFVLSQPQANLLQSSDWGHIKDNWKH
FT                   ERIGFYEDGIQVAAAACLIRPLPLGFSMIYIPRGPIMDYANFELLDFVIKTLKIFGKSK
FT                   RALFVKMDPSLQIKQSFLGIDSEENDFTLSIIAFLKQLGLEWSGRTKELDETIQPRVQA
FT                   NIYAKDFEFENLSKKAKQSIRTATNKGVEIIVGGAELLDDFSSLMAKTEERKGIILRGQ
FT                   SYYHKLLTTYADHSYITMAFLDLPKQKNLLSQQLDKASAEQAKFNEKSKPSKVTENQKT
FT                   IERLEKELTVLNTQLLQGQKRIPLAATLTLIYGDTSENLYAGMDDDYRNYQAPLLTWYH
FT                   TAKEAFQRGCRWHNLGGVENQLDGGLYHFKARLNPTIEEFAGEFNIPVNIISKLATAAY
FT                   NLRKKIRSTHH"
FT   CDS_pept        complement(604711..605520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0638"
FT                   /product="HAD superfamily hydrolase"
FT                   /note="similar to HAD superfamily hydrolase [Streptococcus
FT                   pyogenes MGAS9429]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81140"
FT                   /db_xref="GOA:C5WFH5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH5"
FT                   /inference="similar to AA sequence:RefSeq:YP_596234.1"
FT                   /protein_id="BAH81140.1"
FT                   /translation="MSIKLVAVDIDGTLITDDRRITDDVFQAIQEAKAQGVHVVIATGR
FT                   PIAGVVSLLEQLELNHKGNYVITFNGGLVQDAETGEEVVKELMTYEDYLEIEYLSRKLG
FT                   IHMHAITKEGIFTANRNIGKYTVHESTLVNMPIFYRTPEEMTGKEIIKIMMVDAPELLD
FT                   EAIKLIPQNFFDHYTIVKSTPFYLEFMPKTVSKGNAIKHLAKKLGLDMSQTMAIGDAEN
FT                   DRAMLEVVANPVVMENGVPELKKIAKYITKSNNDSGVAHAIREWVLN"
FT   CDS_pept        complement(606001..607302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0639"
FT                   /product="dGTP triphosphohydrolase"
FT                   /EC_number="3.1.5.1"
FT                   /note="similar to dGTP triphosphohydrolase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81141"
FT                   /db_xref="GOA:C5WFH6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281877.1"
FT                   /protein_id="BAH81141.1"
FT                   /translation="MNEKVFRDPVHNYIHINHQLIYDLVNTKEFQRLRRIKQVPTTAFT
FT                   FHGAEHSRFSHCLGVYEIARRVTEIFEEKYPDNWDKDESLVTMTAALLHDIGHGAYSHT
FT                   FETLFHTDHEAFTQEIITNPETEINAILVRHSPDFPDKVASVINHTYPNKQVVQLISSQ
FT                   IDCDRMDYLLRDSYFSAANYGQFDLMRILRVIRPVDGGIVFDRSGMHAVEDYIVSRFQM
FT                   YMQVYFHPASRAVELILQNLLKRAKTLYPEQKAYFQKTAPGLIPFFEKNAKLTDYLSLD
FT                   DGVMNTYFHVWMASEDHILSDLAGRFINRKILKSVTFDQESQEDLERLRQLVEAVGFDP
FT                   DYYTGIHVNFDLPYDIYRPELANPRTQIEMVQQDGSRAELSQLSPIVKALTGTTYGDRR
FT                   FYFPKEMLELDDLFASSKEAFISYISNGHFHFSN"
FT   CDS_pept        607384..607791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0640"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81142"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281878.1"
FT                   /protein_id="BAH81142.1"
FT                   /translation="MKLQIRNHIRFGDDTEIIHEVHDAEWRQKGDYQYLIYQNDEKEKV
FT                   VIKYNENELTMSRFSTPQSIMKFFAGKKVLIALPTPMGIQQFLTDTRHYQLDHASQQLA
FT                   LHYDLLQAHTEASFASYQLELSWTFPEADDE"
FT   CDS_pept        608119..610800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pacL"
FT                   /locus_tag="SDEG_0641"
FT                   /product="putative calcium-transporting ATPase"
FT                   /EC_number="3.6.3.8"
FT                   /note="similar to putative calcium-transporting ATPase
FT                   [Streptococcus pyogenes M1GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81143"
FT                   /db_xref="GOA:C5WFH8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH8"
FT                   /inference="similar to AA sequence:RefSeq:NP_268873.1"
FT                   /protein_id="BAH81143.1"
FT                   /translation="MSKEQRHEAFYTQSEETVLAQLETSREGLTSAQAKERLAEYGRNE
FT                   LDEGEKRSLFMKFLDQFKDLMIIILIVAALLSVLTEGMEGLTDAIIILAVVILNAAFGV
FT                   YQEGQAEAAIEALKSMSSPLARIRRDGHVIEVDSKELVPGDIVLLEAGDVVPADMRLLE
FT                   VNSLKIEEAALTGESVPVEKDLSTAVSEDAGIGDRVNMGYQNSNVTYGRGMGVVTNTGM
FT                   YTEVGHIAGMLANADETDTPLKQNLDNLSKILTYAILVIAAVTFAVGVFLRGQHPLEGL
FT                   MTSVALAVAAIPEGLPAIVTVVLSLGTQVLAKRNAIIRKLPAVETLGSTEIIASDKTGT
FT                   LTMNQMTVEKVYTNGALQSSSADIAFDNNTLRVMNFANDTKVDPSGKLIGDPTETALVQ
FT                   FGLDHNFDVRDAMVAEPRVAELPFDSDRKLMSTIHKQADGKYFIAVKGAPDQLLNRVTQ
FT                   IEENGQIRPITDADKQAILDTNKSLAKQALRVLMMAYKYSDALPTLETEVVEANLVFSG
FT                   LVGMIDPERPEAAQAVKVAKEAGIRPIMITGDHQDTAEAIAKRLGIIEEDGVDHVFTGA
FT                   ELNELSDEEFQKVFKQYSVYARVSPEHKVRIVKAWQNEGKVVAMTGDGVNDAPSLKTAD
FT                   IGIGMGITGTEVSKGASDMVLADDNFATIIVAVEEGRKVFSNIQKTIQYLLSANMAEVF
FT                   TIFLATLFGWDVLQPVHLLWINLVTDTLPAIALGVEPAEPGVMKHKPRGRKSSFFDGGV
FT                   KEAILYQGAFQTMLVLGVYGFALMFPEHTSYHDVHADALTMAYVTLGLIQLVHAYNVKS
FT                   VYQSIFTVGLFKNKLFNYSIPVAFVALMATVVVPGFNQFFHVTHLTITQWLVVIIGSLL
FT                   MVVLVELVKAVQRSLGQDEKAI"
FT   CDS_pept        complement(611410..612414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="SDEG_0642"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="similar to LacI family transcription regulator
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81144"
FT                   /db_xref="GOA:C5WFH9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFH9"
FT                   /inference="similar to AA sequence:RefSeq:YP_059856.1"
FT                   /protein_id="BAH81144.1"
FT                   /translation="MYAMQRKVTIKDIAELAKTSKTTVSFYLNGKFDKMSEETKNRIKS
FT                   TIEATNYKPSIAARSLNAKSTKLIGVVIGDITNSFSNQIVKGIESKAQEFGYQIIIGNS
FT                   NYDPSREDELIEKMLNLGVDGFIIQPTSNFRKYSRIIDIKKKKVVFFDSQLYEHRTNWV
FT                   KTNNYDAVYDTIQQCINKGYQHFIMITGNPNLLSTRIERASGFIDVLEANHLTYQQMII
FT                   DENQTSSEAIAQFLQTSLKNQSLIFVPNCWALPKVFTAMKALNINLPETGLVGFDNTEW
FT                   TKFSSPSLTTIIQPAYEEGEQATKILIDDIEGHSKEAKQQIFDCQVNWQESTF"
FT   CDS_pept        complement(612469..614394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0643"
FT                   /product="oligohyaluronate lyase"
FT                   /EC_number="4.2.2.-"
FT                   /note="similar to oligohyaluronate lyase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81145"
FT                   /db_xref="GOA:C5WFI0"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281881.1"
FT                   /protein_id="BAH81145.1"
FT                   /translation="MERKRPMSLAFARFKETVNPDFCRNYLLDYQANSYADQKRIADLL
FT                   LTNTFLFEDNWDMEPCHIPYHLDPITWQEAVTDDPEWNFMLNRQTYLQKLILVYLVERD
FT                   ERYLLKAKSFILNWIESAIPLDPKGVATRTLDTGIRCFAWVKCLIYLNLFNALTKQEES
FT                   LILASLEKQLHFLHANYLDKYSLSNWGILQTTAILLADAYFGSNLDIAAATAFARKELR
FT                   QQIALQILEDGSQFEQSTMYHVEVLKSLLELTALVPDYLPQLRPTLLAMSDYLLKMTGP
FT                   DHKQIPLGDSDFTDTRDILTLAATILEEPHLKAAAFPTLDIDSLLLLGEKGVHTFEQLP
FT                   IQTLPTFAHHFEHSGHITINQENYYLFFKNGPIGSSHTHSDQNSLCLYYKGQPLFCDAG
FT                   RYTYKEEPLRYALKSASHHSTAFLEEQLPEQIDSSWAYLSYPKSNYCHLRQNGHIYFID
FT                   GSYQTQFSDRNNYQHDRQILILPPGIFLIIDTIQAQGNHCLVSQFILDNHLEVKTDHLS
FT                   DLRLISDCPFTIEETILSKKYNQYLTSHKLIKRKPFKDKGCTSTLLVPDDTKVTPLTPL
FT                   QTGKRNPIETALAWHLKGKQFDYSICVLQEDLIKGEKLVLLNGHKIRGKVVVINHITNE
FT                   IIRLKH"
FT   CDS_pept        complement(614463..615344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaD"
FT                   /locus_tag="SDEG_0644"
FT                   /product="PTS system, N-acetylgalactosamine-specific IID
FT                   component"
FT                   /note="similar to putative N-acetylgalactosamine-specific
FT                   phosphotransferase system (PTS)"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81146"
FT                   /db_xref="GOA:C5WFI1"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI1"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128885.1"
FT                   /protein_id="BAH81146.1"
FT                   /translation="MNFTTNLNKSMQQLSKEANKMTGSNKLTKKDYLKTALRAFFLQNG
FT                   FNYSNYQGIGYANVIYPALKKHFGSDKKGLYQALEDNCEFYNTNPHFLPFITSLHLVML
FT                   ENNRPEEETRNIKMALMGPLAGIGDSLSQFCLAPLFSTIAASLASDGLVLGPILFFLAM
FT                   NIILTAIKIGSGLYGYKVGTSFIDKLSEQMAVVSRMANIVGVTVIAGLAATSVKITVPI
FT                   TFAAGKVDAANAAQKFVTIQGMLDKIAPALLPALFTLLMYYLIKNKKWTTYKLVLLTVL
FT                   IGIIGSWLGILA"
FT   CDS_pept        complement(615271..616053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0645"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIC
FT                   component"
FT                   /note="similar to PTS system N-acetylgalactosamine-specific
FT                   IIC component [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81147"
FT                   /db_xref="GOA:C5WFI2"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI2"
FT                   /inference="similar to AA sequence:RefSeq:YP_281883.1"
FT                   /protein_id="BAH81147.1"
FT                   /translation="MDINLLQALLIGLWTAFCFSGMLLGIYTNRCIILSFGVGIILGDL
FT                   PTALSMGAISELAYMGFGVGAGGTVPPNPIGPGIFGTLMAITSAGKVTPEAALALSTPI
FT                   AVAIQFLQTFAYTAFAGAPETAKKQLQKGNIRGFKFAANGTIWAFAFMGLGLGLLGALS
FT                   MDTLLHLVDYIPPVLLNGLTVAGKMLPAIGFAMILSVMAKKELIPFVLIGYVCAAYLQI
FT                   PTIGIAIIGIIFALNEFYNKPKQVDATTVQGGQQDDWI"
FT   CDS_pept        complement(616072..616560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agaV"
FT                   /locus_tag="SDEG_0646"
FT                   /product="PTS system"
FT                   /note="similar to PTS system N-acetylgalactosamine-specific
FT                   IIB component [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81148"
FT                   /db_xref="GOA:C5WFI3"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI3"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128883.1"
FT                   /protein_id="BAH81148.1"
FT                   /translation="MTQPNIIMTRVDERLIHGQGQLWVKFLNCNTVIVANDAVSEDKIQ
FT                   QSLMKTVIPSSIAIRFFSIQKVIDIIHKASPAQSIFIVVKDLQDAKRLVEGGVPITEIN
FT                   IGNIHKTDDKVAITQFISLGETDKSAIRCLAHDHQVVFNTKTTPAGNSASDVDILDYI"
FT   CDS_pept        complement(616596..617795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0647"
FT                   /product="unsaturated glucuronyl hydrolase"
FT                   /note="similar to unsaturated glucuronyl hydrolase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81149"
FT                   /db_xref="GOA:C5WFI4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI4"
FT                   /inference="similar to AA sequence:RefSeq:YP_281885.1"
FT                   /protein_id="BAH81149.1"
FT                   /translation="MTRSLKTIALEPIKQPERFTKEDFLSQEDITQALDLALKQVRLNM
FT                   DYFKEDFPTPATKDNQYAIMDNTEWTNAFWTGCLWLAYEYSGDDAIKALAQANDLSFLD
FT                   RVTRDIELDHHDLGFLYTPSCMAEWKLLKTSEAREAALKAADKLVQRYQDKGGFIQAWG
FT                   ELGKKEDYRLIIDCLLNIQLLFFASQETGDNRYRDMAINHFYASANHVIRDDASAYHTF
FT                   YFDPETGDPIKGVTRQGYSDDSAWARGQAWGIYGIPLTYRFLKEPELIQLFKGMTHYFL
FT                   NRLPKDQVSYWDLIFGDGSGQSRDSSATAIAVCGIHEMLKTLPDSDPDKKTYEAAMHSM
FT                   LRALIKDYANKDLKPGAPLMLHGVYSWHSGKGVDEGNIWGDYYYLEALLRFYKDWNPYW
FT                   "
FT   CDS_pept        complement(617795..618232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0648"
FT                   /product="PTS system, N-acetylgalactosamine-specific IIA"
FT                   /note="similar to putative N-acetylgalactosamine-specific
FT                   phosphotransferase system (PTS)"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81150"
FT                   /db_xref="GOA:C5WFI5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI5"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128881.1"
FT                   /protein_id="BAH81150.1"
FT                   /translation="MIAIIVMGHGHFASGIVSSLELIAGQQEKVTAIDFTAEMTAADVQ
FT                   DQLSRALIPEEETLVLCDLLGGTPFKVAATLMESLSNTTCNVLSGLNLAMLIEASFARQ
FT                   TAASFDDLVSGLITCSKEGIVDWKTLSQQEDGTTDDELGGI"
FT   CDS_pept        617862..618266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0649"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0523
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81151"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI6"
FT                   /inference="similar to AA sequence:RefSeq:YP_281886.1"
FT                   /protein_id="BAH81151.1"
FT                   /translation="MPSLEHVISPDTKSSKEAAVCLAKLASISMAKLRPERTLHVVLER
FT                   DSIKVAATLKGVPPRRSQRTKVSSSGIKARDNWSCTSAAVISAVKSIAVTFSCCPAINS
FT                   RDETIPLAKCPCPITIIAIINRSPLVYRFT"
FT   CDS_pept        618567..619361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idnO"
FT                   /locus_tag="SDEG_0650"
FT                   /product="gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="similar to gluconate 5-dehydrogenase [Streptococcus
FT                   pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81152"
FT                   /db_xref="GOA:C5WFI7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI7"
FT                   /inference="similar to AA sequence:RefSeq:YP_281887.1"
FT                   /protein_id="BAH81152.1"
FT                   /translation="MENMFSLQGKIALITGASYGIGFEIAKAYAQAGATIVFNDIKQEL
FT                   VDKGLAAYRELGIEAHGYVCDVTDEAGIQQMVSQIEDEVGVIDILVNNAGIIRRTPMLE
FT                   MAAEDFRQVIDIDLNAPFIVSKAVLPSMIAKGHGKIINICSMMSELGRETVSAYAAAKG
FT                   GLKMLTKNIASEFGEANIQCNGIGPGYIATPQTAPLRERQADGSRHPFDQFIIAKTPAA
FT                   RWGATEDLAGPAVFLASDASNFVNGHILYVDGGILAYIGKQP"
FT   CDS_pept        619386..620027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0651"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein M5005 Spy 0525
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81153"
FT                   /db_xref="GOA:C5WFI8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281888.1"
FT                   /protein_id="BAH81153.1"
FT                   /translation="MKIALINENSQAAKNGIIYDALTSVTDKHGYQVFNYGMYGTEGES
FT                   QLTYVQNGLLASILLTTKAADFVVTGCGTGVGAMLALNSFPGVTCGFASEPTEAYLFSQ
FT                   INGGNALSIPFAKGFGWGAELNLTLIFERLFAEPMGGGYPKERAIPEQRNARILSDLKK
FT                   ITYRDLLAIVKDIDQDFLKETISGAHFQEYFFANAEPSELVTYLKSVLEQ"
FT   CDS_pept        620017..621057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0652"
FT                   /product="2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /note="similar to 2-dehydro-3-deoxygluconokinase
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81154"
FT                   /db_xref="GOA:C5WFI9"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFI9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281889.1"
FT                   /protein_id="BAH81154.1"
FT                   /translation="MNSNSILTRKGGHMSKLLLVGEPLIRVSPNQFQPLTNACEAQLFF
FT                   GGSEVNIARTLGGFGLEARLFTALPDNPVGHAFHQFLKQSGVDMSLTAWQGHRVGLYYL
FT                   ENGFGCRASQVYYDRCGSSFSALDKDSLDLAAIFEGISHFHFSGISLALGKKTQDLIEI
FT                   LAREAKKRDICISFDLNFRSSMIAVADAKRLFSHFAQYADIIFGMEPLLLDSDDFDMFD
FT                   RKKADTTTIRERLAGLYQRYQLQAIYHTERSNDAQGSNHFKAYAYDRQFYESCEVTTPV
FT                   LQRVGSGDAFVAGLLYQLLEGNEKQRNLDFAVATASLKCTVAEDQLYHSVQQVEAVLAN
FT                   QRDIQR"
FT   CDS_pept        621062..621700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgdA"
FT                   /locus_tag="SDEG_0653"
FT                   /product="keto-hydroxyglutarate-aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="similar to keto-hydroxyglutarate-aldolase/keto-
FT                   deoxy- phosphogluconate aldolase [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81155"
FT                   /db_xref="GOA:C5WFJ0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281890.1"
FT                   /protein_id="BAH81155.1"
FT                   /translation="MGKIEILTKLKANRLVLVVRGESSEEALACSLASIEGGIKTIEVT
FT                   YTNPFASEVIGQLAERFKEDPEVLIGAGTVLDDVTARQAILAGAQFIVGPNFNRAVALI
FT                   CHRYSIPYLPGCMTVNEVVTALESGVDMVKLFPGSTVGMSFIQAIKSPLPQVEVMVTGG
FT                   VNEGNLTDWLAAGAQVLGIGGDFNRLASQGRFETITQRAAAYVKLTKDY"
FT   CDS_pept        621725..624928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0654"
FT                   /product="hyaluronate lyase precursor"
FT                   /EC_number="4.2.2.1"
FT                   /note="similar to hyaluronatelyase precursor HylB
FT                   [Streptococcus equi subsp. zooepidemicus MGCS10565]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81156"
FT                   /db_xref="GOA:C5WFJ1"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ1"
FT                   /inference="similar to AA sequence:RefSeq:YP_002123648.1"
FT                   /protein_id="BAH81156.1"
FT                   /translation="MKHKKYYPYICSSILLACLLWSPTVLADEDSSGTTALPMPQEIEP
FT                   PQQITDLSHQVTSQNDVAVTTTEKEGDSDLESQVTLTGENLLKNPQFDQTSPASTTSTD
FT                   KDKGWSKEAAEGWQVYKDSKQTVGSPQIDASEQQLTMTNEAGKKLRGCVHQTVVINPEK
FT                   QYLVSFDIETKDKIGQAFVRVIEEIKENNTLKEQRLWLSPMATGTMKKHQEKLYVPKLK
FT                   VNQIKLELFYETGQGQVIFDNISLREAGDKPSGAIKEVTHSLEERIALSLSKKHLLAIP
FT                   DYIYQVAAGANQIVRIDNGTVEPLQEGHTLLEVFTKEGQKIADLPLEVTGKDDSEMTAL
FT                   ISQWRQMILGADSYSVSNPAMQALNQKLDDSVTKNLNSLVNNQKESYLWEDLKDFGKSS
FT                   HMTATYRRLEEMAKQVNSPASKYYQDTALIRLIKDKLAWLHLNYYNPQKDIEGNANWWD
FT                   YEIGTPRAIVNTLTLLYPYFTQDEIKAQTKSISHFVPDPKQFRSTLVNPFKAIGGNLVD
FT                   MGRVKIIEALLTQDDVKLKESIEALDTLFEFQRDGSKGEGFYKDGSYIDHTNVAYTGAY
FT                   GNVLIDGLSQLIPLIQASPMALNAQKLEVIEHWIEKSFFPLLIHGELIDMSRGRSISRE
FT                   NASSRMAALEALRGILRLSQVLPEANKNRIQGQLKSILAFHDKERMLSSLSSYYDINLF
FT                   EQVLANEVIKLMPMSTNLSVFQNMDKLAYYHTDKDFGFALSMHSNRTLNFEAMNNENTR
FT                   GWYTGDGMFYLYNHDLTHYSDKYWPTVNPLKMPGTTEAEGKREDVTDDYLKKLTIDYKE
FT                   KAKEEAGMSTLPSSFVGAIKGDDKTALAAMDFQNWDRTVSAKKAWGIFDDRIVFLGAGI
FT                   QSTKDQAVSTTIDQRKDNPENPYRLLVNGQEVSLTNDTLEKDHVTSVLLLSQDGKNNIG
FT                   YLFDKPTTLVFSRQEQSGRWSDINKGSTNKELVTQTFITISQRHQQANDTYAYTLLPNV
FT                   SQEDFDKARTESSIEVVRNDSDLQILHDHKQDLWTVVNYHDGPQRINDQLTLEKAGLYL
FT                   YQKVGNVFKLLSKDLLPSD"
FT   CDS_pept        complement(625316..625810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0655"
FT                   /product="hypothetical protein"
FT                   /function="DNA replication, recombination, and repair"
FT                   /note="similar to hypothetical protein SSA 0868
FT                   [Streptococcus sanguinis SK36]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81157"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ2"
FT                   /inference="similar to AA sequence:RefSeq:YP_001034844.1"
FT                   /protein_id="BAH81157.1"
FT                   /translation="MTDPELTNQICQALEKALAALSDQTVIVAMHFVPHSIFTLKHPKV
FT                   KAFNAFLGSPAFHDIFRRYGVKEVVFGHQHKRFSPQTIDGVTYHSRPLGYAKEWQLTRA
FT                   FIRQTTLLTIRGRSTPSKAYCAIKELKAFKDYFAQQLAAELRDAMTIFDSNEMKGWTYE
FT                   Y"
FT   CDS_pept        complement(625901..626209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0656"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SAG0515
FT                   [Streptococcus agalactiae 2603V/R]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81158"
FT                   /db_xref="GOA:C5WFJ3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ3"
FT                   /inference="similar to AA sequence:RefSeq:NP_687545.1"
FT                   /protein_id="BAH81158.1"
FT                   /translation="MTRLAIMSDLHLDLNHFGPFERETLIEVLKHEKIDHLHLAGDMTN
FT                   HFYKDTEPFLIALAQDVTVTFNLGNHDMLDLTEADIETHDFKTYPIAPKLSLLAFHG"
FT   CDS_pept        complement(626379..626972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0657"
FT                   /product="putative truncated transposase"
FT                   /note="similar to putative transposase [Streptococcus
FT                   pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81159"
FT                   /db_xref="GOA:C5WFJ4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ4"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128932.1"
FT                   /protein_id="BAH81159.1"
FT                   /translation="MKNMALPKMATVKPKTALKKTQKTYPQNLLNQKFYPDKPNRVWST
FT                   DFTYISIGYKKYVDMCAILDLYSRKCIAWKLSHRMDAKLACDTLELALDKRKIEETLLF
FT                   HSDQGSQFKARELRKIIDDNNIMHSFSKPGYPYDNAVTEAFFKYLKHRQINRKHYQNIK
FT                   QVQLDCFEYIENFYNNYNPHTANLGLTPNQKEEN"
FT   CDS_pept        complement(627230..627505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0658"
FT                   /product="putative transposase TnpA"
FT                   /note="similar to probable transposase TnpA (fragment)
FT                   [Streptococcus pyogenes MGAS315]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81160"
FT                   /db_xref="GOA:C5WFJ5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ5"
FT                   /inference="similar to AA sequence:RefSeq:NP_664202.1"
FT                   /protein_id="BAH81160.1"
FT                   /translation="MSTVKRYDEEFKQSLVNLYQTGKTQSELCKDYGVSASALAKWIKQ
FT                   YSQVKLEDNSVLTAKQIQELQKRNAQLEEENLILKKASAIFMQNLK"
FT   CDS_pept        627784..628428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0659"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /note="similar to beta-phosphoglucomutase [Streptococcus
FT                   pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81161"
FT                   /db_xref="GOA:C5WFJ6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ6"
FT                   /inference="similar to AA sequence:RefSeq:YP_059867.1"
FT                   /protein_id="BAH81161.1"
FT                   /translation="MIQGIIFDMDGVLFDTEPFYFQRREAFLQAKGITIDHLSAKDFIG
FT                   GNLQELWKDLLDEHFTPEEAKAVAEAYESYKLQHKPPYAEVLFTEVRPCLQALRDKNIK
FT                   LALASNSNRDDILLALETSHIKDYFEVILAREDVSRGKPYPDIYEKAAQSLGLPKETLV
FT                   VVEDSQKGIAAAKAANLTVVAVTDYRYGIDQQEADANIDHLMQLCATIEQF"
FT   CDS_pept        628659..630572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0660"
FT                   /product="putative fructose-1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="similar to fructose-16-bisphosphatase [Streptococcus
FT                   agalactiae 515]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81162"
FT                   /db_xref="GOA:C5WFJ7"
FT                   /db_xref="InterPro:IPR009164"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ7"
FT                   /inference="similar to AA sequence:RefSeq:ZP_00789889.1"
FT                   /protein_id="BAH81162.1"
FT                   /translation="MSKYYRLLKEKFPTKSSLATEMINLEAICHLPKGTEHFLSDLHGE
FT                   YEAFDYLLRNGSGSIKKKLQECFPDKDPGTIDLLCQYIYYPAEKINANTLLSEQALQEE
FT                   LTSFLPDLLQLVKYIGGKYTRSKVRKLLPKDYAYIMEELLTEGQPDKNKENYYSAIIGK
FT                   VIELKQLENLFIAFATLIQQLAIDHLHVVGDIFDRGKYPDLILDRLMTFQHIDIQWGNH
FT                   DITWMGAVSGSMICMVNVIRIAARYNSIELIEDRYGINLRRLIDYSQTYFTPKVVFQPI
FT                   LDGDVISEQDERVLNCLQQATALLQFKLEHQLIHRRPEFEMMASSALDRIRPESEEMLV
FT                   GEKTYPLTDFPFDMVDWQTPGSLTTEEEDLLDDLLERFQQSDRLRHHIEFLFSKGAIYH
FT                   ISNNHLLYHGCIPMHSNGDFKSICLQGHFLSGKTLMDFYEEKVRQAYQHPDIQDDFATD
FT                   LFWYLWCGEGSSLFGKQRMTTFERYYIEDKETHKEKKNPYYHLREKEDICQRLLAEFTL
FT                   DETGHIVNGHTPVQEKSGEIPIKAGGKMIIIDGGLAKGYQKKTGIAGYTLISNSYGLEL
FT                   VAHNPFSSVEAVLNGECDIIFIKRLVEEVAERTLVKQTDNGKELLKEIEDLHYLYHHFD
FT                   EY"
FT   CDS_pept        630780..631952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0661"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="similar to iron-sulfur cluster-binding protein
FT                   [Streptococcus pyogenes MGAS10394]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81163"
FT                   /db_xref="GOA:C5WFJ8"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ8"
FT                   /inference="similar to AA sequence:RefSeq:YP_059868.1"
FT                   /protein_id="BAH81163.1"
FT                   /translation="MSSFRLEVLTYFDYDSSMNIKADIQALAKEIGISKIGFTTADDFS
FT                   YLEKSLRLGVEEGRTTGFEHKVIEERIKPKLSLASAKTIISIAVAYPHKLPVQPPKTSY
FT                   KRGKITPNSWGLDYHHVLQDKLQRLAEGIEALTADFEYKGMVDTGALVDTAVARRAGIG
FT                   FIGKNGLVISKEFGSYMYLGELITNLDIEPDQPVDYDCGDCRRCLDACPTSCLIGDGTM
FT                   NARRCLSFQTQDKGMMALEFRKKIKTVIYGCDICQICCPYNKGIDNPLASPIDPELAMP
FT                   ELVPFLELSNQSFKKTFGMIAGSWRGKNILQRNAIIALANAHDRSAIPKLLEIIDQNNN
FT                   PIHTATAIWALGELIKKPNPDMLAFMKDLALEHEESKEELERLLTKWQKA"
FT   CDS_pept        632159..633154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="SDEG_0662"
FT                   /product="peptide chain release factor 2"
FT                   /note="similar to peptide chain release factor 2
FT                   [Streptococcus thermophilus LMG 18311]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81164"
FT                   /db_xref="GOA:C5WFJ9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFJ9"
FT                   /inference="similar to AA sequence:RefSeq:YP_139599.1"
FT                   /protein_id="BAH81164.1"
FT                   /translation="MEHQMTEPDFWNDNIAAQKISQKLNELKSTYETFHNMQELSDETE
FT                   LYLEMLEEDDSVKDDLEASLETLGQILASYEMTLLLSEPYDHNNAILEIHPGSGGTEAQ
FT                   DWADMLFRMYTRFGNAKGFKVETLDYQAGDEAGIKSVTLSFEGPNAYGLLKSEMGVHRL
FT                   VRISPFDSAKRRHTSFVSVEVMPELDDTIEVDIRDDDIKMDTFRSGGAGGQNVNKVSTG
FT                   VRLTHIPTGIVVASTVDRTQYGNRDRAIKMLQAKLYQLEQEKKAAEVNALKGDKKEITW
FT                   GSQIRSYVFTPYTMVKDHRTNYEVAQVDKVMDGDIEGFIDAYLKWRMSDD"
FT   CDS_pept        633198..633890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SDEG_0663"
FT                   /product="cell division ATP-binding protein"
FT                   /note="similar to cell division ATP-binding protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81165"
FT                   /db_xref="GOA:C5WFK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281894.1"
FT                   /protein_id="BAH81165.1"
FT                   /translation="MALIEMKGVSKKYRRSTTALRDINVSVNQGEFVYLVGPSGAGKST
FT                   FIKLLYREEKLSSGKLYVGEFDLTKLKSRDVPILRRHIGVVFQDYKLLPKKTVFENVAY
FT                   AMEVIGEKRRHIKKRVPEVLDLVGLKHKMRSFPNQLSGGEQQRVAIARAIVNNPKLLIA
FT                   DEPTGNLDPEISWEIMQLLERINLQGTTILMATHNSHIVNTLRHRVIAIEDGRVVRDEM
FT                   EGDYGYDD"
FT   CDS_pept        633883..634812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="SDEG_0664"
FT                   /product="putative cell-division protein"
FT                   /note="similar to putative cell-division protein
FT                   [Streptococcus pyogenes MGAS8232]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81166"
FT                   /db_xref="GOA:C5WFK1"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK1"
FT                   /inference="similar to AA sequence:RefSeq:NP_606879.1"
FT                   /protein_id="BAH81166.1"
FT                   /translation="MIRYFFRHIWESIKNLKRNFWMTFASVSMVTVTLTLVGVFAATLL
FT                   NIQRVASGVENNIQINTYLQVDSTDAAKVVQNTAGEQVDNENYHKVYDQIAQLKGVQKI
FT                   TFSSKDEQLKKLQDTLGDVWDMYDEDTNPLQDIYIVETKTAKQVKGVTKRIKAIEGVED
FT                   ADYGGINSDKLFKFSKMIQTWGLIGTALLLFVAIFLISNTVRMTIMSRQRDIEIMRLVG
FT                   AKNSYIRGPFFFEGAWVGLLGAILPALLIYYGYDFAYKHFMPELQVNNLSLYPINPYVY
FT                   GLIGALFVIGVIIGSLGSVLSMRRYLKF"
FT   CDS_pept        complement(634935..635582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0665"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="similar to Zn-dependenthydrolase including
FT                   glyoxylases [Streptococcus suis05ZYH33]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81167"
FT                   /db_xref="GOA:C5WFK2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK2"
FT                   /inference="similar to AA sequence:RefSeq:YP_001197921.1"
FT                   /protein_id="BAH81167.1"
FT                   /translation="MTQHMTPITITNPVAEENTYLLVTDQGILVVDPGSNGKAIIDRIK
FT                   ELNKPLAAILLTHTHYDHIMSLEAVREAFGQPPVYVANEESTWLYTPEMNLSGLIRHAD
FT                   LPDIICQPAEEIFQYHTAYDIAGCQFIVVPTPGHSAGGVSFIFPEEAFVISGDALFRES
FT                   IGRTDLPTGNFEQLIDSINTQLFSLPNHYQVYPGHGPSTTISHEKNANPFFH"
FT   CDS_pept        635811..638273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinG"
FT                   /locus_tag="SDEG_0666"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="similar to ATP-dependent DNA helicase [Streptococcus
FT                   pyogenes M1 GAS]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81168"
FT                   /db_xref="GOA:C5WFK3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK3"
FT                   /inference="similar to AA sequence:RefSeq:NP_268891.1"
FT                   /protein_id="BAH81168.1"
FT                   /translation="MSNEMTRKYAVVDLEATNAGATAAIIQVGIVIIEGKEVVETYQTD
FT                   INPHEPLSDHIKALTGITDAQLAQAPEFSQVAKTIYELISDCVFVAHNVKFDANLLAEA
FT                   LFFEGYELLTPRVDTVELAQIFYPSLEKYTLGHLSAELGLELEEAHTAIADARATAALF
FT                   IKLLQKIESLPKECLESLLPYADSLLFETAMVIEQGFNQAKPYNPRTYVHLGKMLLPKH
FT                   LKRQSSPYQLSKQFAINMALLGLEERSKQASFAQLIEADYHQRQASFIEAQTGIGKTYG
FT                   YLLPLLAQEDQSQIIVSVPTKILQDQLMANEIAAIQERFHITCHSLKGPANYLKLEAFA
FT                   ESLEQEDQNRLVNRYKMQLLIWLLETKTGDLDEIKQKQRFAAYFDQLKHDGTLSQSSDF
FT                   YDYDFWQNSYVKAQTARVVITNHAYFLHRVQDDKDFAKNKVLVFDEAQKLMLQLDQLSR
FT                   HQLNLSHLLQSLQAKLGTPLPLLEKRLLESLVFELGQLSSDFYQNQGEQKTPDWSRIAG
FT                   YAKELPRADYQDLQAFFAVATDDYWLSSDKQEDKRVTYLNSASKEFIHFRQFLPETVKT
FT                   YFVSATLTISPEVTLADLLGFEEYLYHVIATDKKEDQLVLVDQDMPIVTEVSDQTYVEA
FT                   IAKRIEILKQEGYPILVLFNAKKHLLMVSDCLDQWQVPHLAQEKNGTAYNIKKRFDRGE
FT                   QSILLGLGSFWEGVDFVMADWMITVITRLPFDHPEDLFVKKMGHYLLGKGKNPFKDYFL
FT                   PMAILRLKQAIGRTMRRQDQKSVVLILDRRLLTKSYGHAIWDSLGQEFVISQQNFPDSL
FT                   VEMARFLL"
FT   CDS_pept        638555..639751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="SDEG_0667"
FT                   /product="aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="similar to aspartate aminotransferase [Streptococcus
FT                   pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81169"
FT                   /db_xref="GOA:C5WFK4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK4"
FT                   /inference="similar to AA sequence:RefSeq:YP_602049.1"
FT                   /protein_id="BAH81169.1"
FT                   /translation="MTKLSRRVLDMEESVTLAAGARAKALKAQGRDILSLTLGEPDFIT
FT                   PKNIQDKAIESIRNGKASFYTVASGLPELKAAIATYMENQYGYPLAANEIVAGTGAKFI
FT                   LYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFIQGLEENQFKVTVDQLEAART
FT                   NRTKVVLINSPSNPTGMIYGADELRAIGEWAVAHDIIILADDIYGSLVYNGNQFVPIST
FT                   LSEAIRRQTITVNGVAKSYAMTGWRVGFAVGDPEIIAAMSKIIGQTTSNLATVSQYAAI
FT                   EAFAGDQSSLEGMRLAFEERLNTIYPLLNQVPGFEVMKPQGAFYFFPNVKKAMTMTGFT
FT                   NVTAFTDAILEEVGLAVVSGEGFGAPENIRLSYATDLETLKEAVRRLTVFMERRTVTN"
FT   CDS_pept        639789..641135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="SDEG_0668"
FT                   /product="asparaginyl-tRNA synthetase AsnS"
FT                   /EC_number="6.1.1.22"
FT                   /note="similar to asparaginyl-tRNAsynthetase [Streptococcus
FT                   mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81170"
FT                   /db_xref="GOA:C5WFK5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK5"
FT                   /inference="similar to AA sequence:RefSeq:NP_721682.1"
FT                   /protein_id="BAH81170.1"
FT                   /translation="MTKKYASISDVKDYVGQEVTIGAWVANKSGKGKIAFLQLRDGSAF
FT                   FQAVAFKPNFIERFGEEEGADKFDTIKRLSQETSVFVKGIVKEDERSKFGYELDVTDIE
FT                   VIGESQDYPITPKEHGTDFLMDNRHLWLRSRRQAAIMQIRNAIIYASYEFFDQNGFIKF
FT                   DSPILSGNAAENTTELFETDYFGNPAFLSQSGQLYLEAGMMALGRVFDFGPVFRAEKSK
FT                   TRRHLTEFWMMDAEYPFLSHEESLDLQEAYVKAMIQGVLDRAPQALETLERDTDLLKKY
FT                   IAEPFKRVAYDDAISLLQEHASDEDADYEAIQHGDDFGSPHETWISNYFGVPTFVVNYP
FT                   ASFKAFYMKPVPGNEERVLCADLLAPEGYGEIIGGSERETDYNKLLAKIEEEGLNPDDY
FT                   AFYLDLRKYGSVPHCGFGLGLERMVTFVAGTKHIREAIPFPRMLHRIKP"
FT   CDS_pept        641426..642169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0669"
FT                   /product="hypothetical protein"
FT                   /note="similar to hypothetical protein SMU.1307c
FT                   [Streptococcus mutans UA159]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81171"
FT                   /db_xref="GOA:C5WFK6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK6"
FT                   /inference="similar to AA sequence:RefSeq:NP_721678.1"
FT                   /protein_id="BAH81171.1"
FT                   /translation="MTNKKWVKDAIDAKNYLISEGVFLFELDQPLQELIIADYPKLGPS
FT                   DFISQEHLADYRLRYLNDMMTSDKLKNDSIRDMVYDVSKKQKDHILNVQEALDSQITFG
FT                   QRLADQVAHFGGTWTFIISFVIFMAVWMLFNEISPFGWAFDHYPFILLNLALSTLAAIQ
FT                   APLIMMSQNRASEYDRLQAKNDYDVNKASEEGIRLLHTKLDHLVLQDQSDLMQIQKLQT
FT                   DILISITKQLARQSREDVTSSEENP"
FT   CDS_pept        642302..643192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0670"
FT                   /product="P-loop ATPase protein family protein"
FT                   /note="similar to P-loop ATPase protein family protein
FT                   [Streptococcus pyogenes str. Manfredo]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81172"
FT                   /db_xref="GOA:C5WFK7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK7"
FT                   /inference="similar to AA sequence:RefSeq:YP_001128866.1"
FT                   /protein_id="BAH81172.1"
FT                   /translation="MPDTHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPKF
FT                   LELIEQTNEDRRVALVVDMRSRLFFKEITSVLDSIETNEHIDCRILFLDATDGELVSRY
FT                   KETRRSHPLASDGRVLDGIRLERELLSPLKSMSQNVVNTTELTPRQLRKVISDQFAGDS
FT                   NQAAFRIEVMSFGFKYGLPLDADLVFDVRFLPNPYYQVSLREKTGLDQEVYDYVMAHPE
FT                   SEEFYKHLLNLIVPILPAYQKEGKSVLTVAIGCTGGQHRSVAFAHRLAESLAKDWSVNE
FT                   SHRDQNRRKETVNRS"
FT   CDS_pept        643189..644166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0671"
FT                   /product="transporter"
FT                   /note="similar to transporter [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81173"
FT                   /db_xref="GOA:C5WFK8"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK8"
FT                   /inference="similar to AA sequence:RefSeq:YP_281903.1"
FT                   /protein_id="BAH81173.1"
FT                   /translation="MKNPKITVIGGGTGIPVILKSLRKEAVDITAVVTVADDGGSSGEL
FT                   RNAMQLTPPGDLRNVLLAMSDMPKFYERVFQYRFNERDGALAGHPLGNLIIAGISEMQG
FT                   STYNAVQILTKFFHITGKIYPSSEQALTLHAVFKDGHEVAGESSIAKYQGMIDHVYVTN
FT                   TYNDQKPQASRKVVDTILESDMIVLGPGSLFTSILPNLVIPEIKEALRQTKAEIVYICN
FT                   IMTQYGETEQFSDADHVAVLNQHLGTDLIDTVLVNVAKVPQAYMNSNKFDEYLVQVDHD
FT                   FAGLCQSAKRVISSHFLRLENGGAFHDGNLVVEELMNLVRIAKP"
FT   CDS_pept        644163..645074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0672"
FT                   /product="hypothetical cytosolic protein"
FT                   /note="similar to hypothetical cytosolic protein
FT                   [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81174"
FT                   /db_xref="GOA:C5WFK9"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFK9"
FT                   /inference="similar to AA sequence:RefSeq:YP_281904.1"
FT                   /protein_id="BAH81174.1"
FT                   /translation="MSFTTKVKEELIHLSTADKNELAAIIKLSGSLGLVNQGLHLSITT
FT                   ENAKIARYIYSLIEDDYAIVPEIRYHQKTNLRKNRVYTVYVEQGVDTILADLKLADSFF
FT                   GLKTGIEPQILLNDDAGRSYLKGAFLASGSIRDPESGKYQLEMYSVYLDHAQDLAQLMQ
FT                   KFMLDAKTIEHKSGAVTYLQKAEDIMDFLIIVGAMTCKEEFEGIKVLREARNDINRANN
FT                   VETANIAKTISASMKTINNIIKIMDTIGLESLPIELQQVAQLRVKHPDYSIQQVADALE
FT                   FPITKSGVNHRLRKINKIADDL"
FT   CDS_pept        645207..646604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="SDEG_0673"
FT                   /product="dipeptidase"
FT                   /EC_number="3.4.-.-"
FT                   /note="similar to dipeptidase [Streptococcus pyogenes
FT                   MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81175"
FT                   /db_xref="GOA:C5WFL0"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFL0"
FT                   /inference="similar to AA sequence:RefSeq:YP_281905.1"
FT                   /protein_id="BAH81175.1"
FT                   /translation="MACTTILVGKKASYDGSTMVARTEDSQNGDFTPKKMIVVKPEDQP
FT                   RHYRSVQSSFEMDLPDNPMTYTSVPDALGKDGIWAEAGVNEANVAMSATETITTNSRVL
FT                   GADPLVASGIGEEDMVTLVLPYIRSAREGVLRLGAILEDYGTYESNGVAFSDEHDIWWL
FT                   ETIGGHHWIARRVPDDAYVTNPNQFGIDHFEFNNPEDYLGSADLKDFIDTYHLDLTYSH
FT                   EHFNPRYAFGSQRDKDRHYNTPRAWIMQKFLNPEIVQDPRSFALAWCQKPYRKITVEDV
FT                   KYVLSSHYQDTVYDPYGSEGTPVSKKIFRPIGINRTSQTAILHIRPNKPQEIAAIQWMA
FT                   YGSMPFNTMVPFFTQVKTIPDYFANTQENVSTDNFYWTNRLIAALADPHYNHHETDLDN
FT                   YLEETMAKGHAMLHAVEAQLLAGETVDLEEENQKMSDYVQGETQTLLNKILFDASNLMT
FT                   NRFSLSD"
FT   CDS_pept        646755..648302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="SDEG_0674"
FT                   /product="high-affinity zinc uptake system protein znuA
FT                   precursor"
FT                   /note="similar to high-affinity zinc uptake system protein
FT                   znuA precursor [Streptococcus pyogenes MGAS5005]"
FT                   /db_xref="EnsemblGenomes-Gn:SDEG_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAH81176"
FT                   /db_xref="GOA:C5WFL1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:C5WFL1"
FT                   /inference="similar to AA sequence:RefSeq:YP_281906.1"
FT                   /protein_id="BAH81176.1"
FT                   /translation="MKKKILLMISLIGVFFAWQLSQAKQVLAEGKVKVVTTFYPVYEFT
FT                   KGVIGNDGDVSLLMKAGTEPHDFEPSTKDIKKIQDADAFVYMDDNMETWISDVKKSLKS
FT                   KKVTIVKGTGNMLLVAGAGHDHHHEDADKKHEHNKHSEEGHNHAFDPHVWLSPYRSITV
FT                   VENIRDSLSKAYPEKAENFKANAATYIEKLKELDKDYTAALSDAKQKSFVTQHAAFGYM
FT                   ALDYGLNQISINGVTPDAEPSAKRIATLSKYVKKYGIKYIYFEENASNKVAKTLAKEAG
FT                   VKTAVLSPLEGLTEKEMKAGEDYFTVMRKNLETLRLTTDVAGKEILPEEDTTKTVYNGY
FT                   FKDKDVKDRKLSDWSGNWQSVYPYLQDGTLDQVWDYKAKKSKGKMTAAEYKDYYTTGYK
FT                   TDVEQININGKKNTMTFVRNGEKKTFTYKYAGKEILTYPKGNRGVRFMFEAKEADAGEF
FT                   KYVQFSDHAIAPEKAEHFHLYWGGDSQEKLHKELEHWPTYYGSDLSGREIAQEINAH"
FT   CDS_pept        648451..649182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SDEG_0675"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="similar to transcriptional regulatorGntR family
FT                   [Streptococcus pyogenes MGAS10750]"
FT                   /db_xref="EnsemblGen