(data stored in ACNUC7421 zone)

EMBL: AP010953

ID   AP010953; SV 1; circular; genomic DNA; STD; PRO; 5697240 BP.
XX
AC   AP010953;
XX
PR   Project:PRJDA32509;
XX
DT   11-SEP-2009 (Rel. 102, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Escherichia coli O26:H11 str. 11368 DNA, complete genome.
XX
KW   .
XX
OS   Escherichia coli O26:H11 str. 11368
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-5697240
RA   Hattori M., Toh H., Oshima K., Yamashita A., Hayashi T., Ogura Y., Ooka T.;
RT   ;
RL   Submitted (21-DEC-2008) to the INSDC.
RL   Contact:Masahira Hattori University of Tokyo, Graduate School of Frontier
RL   Sciences; 5-1-5 Kashiwanoha, Kashiwa, Chiba 277-8562, Japan URL
RL   :http://www.cb.k.u-tokyo.ac.jp/hattorilab/
XX
RN   [2]
RX   DOI; 10.1073/pnas.0903585106.
RX   PUBMED; 19815525.
RA   Ogura Y., Ooka T., Iguchi A., Toh H., Asadulghani M., Oshima K., Kodama T.,
RA   Abe H., Nakayama K., Kurokawa K., Tobe T., Hattori M., Hayashi T.;
RT   "Comparative genomics reveal the mechanism of the parallel evolution of
RT   O157 and non-O157 enterohemorrhagic Escherichia coli";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(42):17939-17944(2009).
XX
DR   MD5; 734b55c4d64fbb19ecaa7d0f5dd4a375.
DR   BioSample; SAMD00060955.
DR   COMPARE-RefGenome; 11368.
DR   EnsemblGenomes-Gn; EBG00000622959.
DR   EnsemblGenomes-Gn; EBG00001272646.
DR   EnsemblGenomes-Gn; EBG00001272647.
DR   EnsemblGenomes-Gn; EBG00001272648.
DR   EnsemblGenomes-Gn; EBG00001272649.
DR   EnsemblGenomes-Gn; EBG00001272650.
DR   EnsemblGenomes-Gn; EBG00001272651.
DR   EnsemblGenomes-Gn; EBG00001272652.
DR   EnsemblGenomes-Gn; EBG00001272653.
DR   EnsemblGenomes-Gn; EBG00001272654.
DR   EnsemblGenomes-Gn; EBG00001272655.
DR   EnsemblGenomes-Gn; EBG00001272656.
DR   EnsemblGenomes-Gn; EBG00001272657.
DR   EnsemblGenomes-Gn; EBG00001272658.
DR   EnsemblGenomes-Gn; EBG00001272659.
DR   EnsemblGenomes-Gn; EBG00001272660.
DR   EnsemblGenomes-Gn; EBG00001272661.
DR   EnsemblGenomes-Gn; EBG00001272662.
DR   EnsemblGenomes-Gn; EBG00001272663.
DR   EnsemblGenomes-Gn; EBG00001272664.
DR   EnsemblGenomes-Gn; EBG00001272665.
DR   EnsemblGenomes-Gn; EBG00001272666.
DR   EnsemblGenomes-Gn; EBG00001272667.
DR   EnsemblGenomes-Gn; EBG00001272668.
DR   EnsemblGenomes-Gn; EBG00001272669.
DR   EnsemblGenomes-Gn; EBG00001272670.
DR   EnsemblGenomes-Gn; EBG00001272671.
DR   EnsemblGenomes-Gn; EBG00001272672.
DR   EnsemblGenomes-Gn; EBG00001272673.
DR   EnsemblGenomes-Gn; EBG00001272674.
DR   EnsemblGenomes-Gn; EBG00001272675.
DR   EnsemblGenomes-Gn; EBG00001272676.
DR   EnsemblGenomes-Gn; EBG00001272677.
DR   EnsemblGenomes-Gn; EBG00001272678.
DR   EnsemblGenomes-Gn; EBG00001272679.
DR   EnsemblGenomes-Gn; EBG00001272680.
DR   EnsemblGenomes-Gn; EBG00001272681.
DR   EnsemblGenomes-Gn; EBG00001272682.
DR   EnsemblGenomes-Gn; EBG00001272683.
DR   EnsemblGenomes-Gn; EBG00001272684.
DR   EnsemblGenomes-Gn; EBG00001272685.
DR   EnsemblGenomes-Gn; EBG00001272686.
DR   EnsemblGenomes-Gn; EBG00001272687.
DR   EnsemblGenomes-Gn; EBG00001272688.
DR   EnsemblGenomes-Gn; EBG00001272689.
DR   EnsemblGenomes-Gn; EBG00001272690.
DR   EnsemblGenomes-Gn; EBG00001272691.
DR   EnsemblGenomes-Gn; EBG00001272692.
DR   EnsemblGenomes-Gn; EBG00001272693.
DR   EnsemblGenomes-Gn; EBG00001272694.
DR   EnsemblGenomes-Gn; EBG00001272695.
DR   EnsemblGenomes-Gn; EBG00001272696.
DR   EnsemblGenomes-Gn; EBG00001272697.
DR   EnsemblGenomes-Gn; EBG00001272698.
DR   EnsemblGenomes-Gn; EBG00001272699.
DR   EnsemblGenomes-Gn; EBG00001272700.
DR   EnsemblGenomes-Gn; EBG00001272701.
DR   EnsemblGenomes-Gn; EBG00001272702.
DR   EnsemblGenomes-Gn; EBG00001272703.
DR   EnsemblGenomes-Gn; EBG00001272704.
DR   EnsemblGenomes-Gn; EBG00001272705.
DR   EnsemblGenomes-Gn; EBG00001272706.
DR   EnsemblGenomes-Gn; EBG00001272707.
DR   EnsemblGenomes-Gn; EBG00001272708.
DR   EnsemblGenomes-Gn; EBG00001272709.
DR   EnsemblGenomes-Gn; EBG00001272710.
DR   EnsemblGenomes-Gn; EBG00001272711.
DR   EnsemblGenomes-Gn; EBG00001272712.
DR   EnsemblGenomes-Gn; EBG00001272713.
DR   EnsemblGenomes-Gn; EBG00001272714.
DR   EnsemblGenomes-Gn; EBG00001272715.
DR   EnsemblGenomes-Gn; EBG00001272716.
DR   EnsemblGenomes-Gn; EBG00001272717.
DR   EnsemblGenomes-Gn; EBG00001272718.
DR   EnsemblGenomes-Gn; EBG00001272719.
DR   EnsemblGenomes-Gn; EBG00001272720.
DR   EnsemblGenomes-Gn; EBG00001272721.
DR   EnsemblGenomes-Gn; EBG00001272722.
DR   EnsemblGenomes-Gn; EBG00001272723.
DR   EnsemblGenomes-Gn; EBG00001272724.
DR   EnsemblGenomes-Gn; EBG00001272725.
DR   EnsemblGenomes-Gn; EBG00001272726.
DR   EnsemblGenomes-Gn; EBG00001272727.
DR   EnsemblGenomes-Gn; EBG00001272728.
DR   EnsemblGenomes-Gn; EBG00001272729.
DR   EnsemblGenomes-Gn; EBG00001272730.
DR   EnsemblGenomes-Gn; EBG00001272731.
DR   EnsemblGenomes-Gn; EBG00001272732.
DR   EnsemblGenomes-Gn; EBG00001272733.
DR   EnsemblGenomes-Gn; EBG00001272734.
DR   EnsemblGenomes-Gn; EBG00001272735.
DR   EnsemblGenomes-Gn; EBG00001272736.
DR   EnsemblGenomes-Gn; EBG00001272737.
DR   EnsemblGenomes-Gn; EBG00001272738.
DR   EnsemblGenomes-Gn; EBG00001272739.
DR   EnsemblGenomes-Gn; EBG00001272740.
DR   EnsemblGenomes-Gn; EBG00001272741.
DR   EnsemblGenomes-Gn; EBG00001272742.
DR   EnsemblGenomes-Gn; EBG00001272743.
DR   EnsemblGenomes-Gn; EBG00001272744.
DR   EnsemblGenomes-Gn; EBG00001272745.
DR   EnsemblGenomes-Gn; EBG00001272748.
DR   EnsemblGenomes-Gn; EBG00001272750.
DR   EnsemblGenomes-Gn; EBG00001272751.
DR   EnsemblGenomes-Gn; EBG00001272754.
DR   EnsemblGenomes-Gn; EBG00001272755.
DR   EnsemblGenomes-Gn; EBG00001272757.
DR   EnsemblGenomes-Gn; EBG00001272759.
DR   EnsemblGenomes-Gn; EBG00001272760.
DR   EnsemblGenomes-Gn; EBG00001272762.
DR   EnsemblGenomes-Gn; EBG00001272764.
DR   EnsemblGenomes-Gn; EBG00001272766.
DR   EnsemblGenomes-Gn; EBG00001272768.
DR   EnsemblGenomes-Gn; EBG00001272770.
DR   EnsemblGenomes-Gn; EBG00001272772.
DR   EnsemblGenomes-Gn; EBG00001272774.
DR   EnsemblGenomes-Gn; EBG00001272778.
DR   EnsemblGenomes-Gn; EBG00001272781.
DR   EnsemblGenomes-Gn; EBG00001272782.
DR   EnsemblGenomes-Gn; EBG00001272784.
DR   EnsemblGenomes-Gn; EBG00001272785.
DR   EnsemblGenomes-Gn; EBG00001272786.
DR   EnsemblGenomes-Gn; EBG00001272787.
DR   EnsemblGenomes-Gn; EBG00001272788.
DR   EnsemblGenomes-Gn; EBG00001272789.
DR   EnsemblGenomes-Gn; EBG00001272791.
DR   EnsemblGenomes-Gn; EBG00001272793.
DR   EnsemblGenomes-Gn; EBG00001272794.
DR   EnsemblGenomes-Gn; EBG00001272796.
DR   EnsemblGenomes-Gn; EBG00001272797.
DR   EnsemblGenomes-Gn; EBG00001272798.
DR   EnsemblGenomes-Gn; EBG00001272799.
DR   EnsemblGenomes-Gn; EBG00001272800.
DR   EnsemblGenomes-Gn; EBG00001272801.
DR   EnsemblGenomes-Gn; EBG00001272802.
DR   EnsemblGenomes-Gn; EBG00001272803.
DR   EnsemblGenomes-Gn; EBG00001272805.
DR   EnsemblGenomes-Gn; EBG00001272807.
DR   EnsemblGenomes-Gn; EBG00001272809.
DR   EnsemblGenomes-Gn; EBG00001272811.
DR   EnsemblGenomes-Gn; EBG00001272812.
DR   EnsemblGenomes-Gn; EBG00001272813.
DR   EnsemblGenomes-Gn; EBG00001272814.
DR   EnsemblGenomes-Gn; EBG00001272815.
DR   EnsemblGenomes-Gn; EBG00001272816.
DR   EnsemblGenomes-Gn; EBG00001272817.
DR   EnsemblGenomes-Gn; EBG00001272818.
DR   EnsemblGenomes-Gn; EBG00001272819.
DR   EnsemblGenomes-Gn; EBG00001272820.
DR   EnsemblGenomes-Gn; EBG00001272821.
DR   EnsemblGenomes-Gn; EBG00001272823.
DR   EnsemblGenomes-Gn; EBG00001272825.
DR   EnsemblGenomes-Gn; EBG00001272827.
DR   EnsemblGenomes-Gn; EBG00001272829.
DR   EnsemblGenomes-Gn; EBG00001272831.
DR   EnsemblGenomes-Gn; EBG00001272833.
DR   EnsemblGenomes-Gn; EBG00001272835.
DR   EnsemblGenomes-Gn; EBG00001272837.
DR   EnsemblGenomes-Gn; EBG00001272839.
DR   EnsemblGenomes-Gn; EBG00001272841.
DR   EnsemblGenomes-Gn; EBG00001272843.
DR   EnsemblGenomes-Gn; EBG00001272845.
DR   EnsemblGenomes-Gn; EBG00001272847.
DR   EnsemblGenomes-Gn; EBG00001272849.
DR   EnsemblGenomes-Gn; EBG00001272851.
DR   EnsemblGenomes-Gn; EBG00001272853.
DR   EnsemblGenomes-Gn; EBG00001272855.
DR   EnsemblGenomes-Gn; EBG00001272857.
DR   EnsemblGenomes-Gn; EBG00001272859.
DR   EnsemblGenomes-Gn; EBG00001272861.
DR   EnsemblGenomes-Gn; EBG00001272862.
DR   EnsemblGenomes-Gn; EBG00001272864.
DR   EnsemblGenomes-Gn; EBG00001272866.
DR   EnsemblGenomes-Gn; EBG00001272868.
DR   EnsemblGenomes-Gn; EBG00001272870.
DR   EnsemblGenomes-Gn; EBG00001272872.
DR   EnsemblGenomes-Gn; EBG00001272874.
DR   EnsemblGenomes-Gn; EBG00001272876.
DR   EnsemblGenomes-Gn; EBG00001272878.
DR   EnsemblGenomes-Gn; EBG00001272880.
DR   EnsemblGenomes-Gn; EBG00001272882.
DR   EnsemblGenomes-Gn; EBG00001272883.
DR   EnsemblGenomes-Gn; EBG00001272885.
DR   EnsemblGenomes-Gn; EBG00001272887.
DR   EnsemblGenomes-Gn; EBG00001272889.
DR   EnsemblGenomes-Gn; EBG00001272891.
DR   EnsemblGenomes-Gn; EBG00001272893.
DR   EnsemblGenomes-Gn; EBG00001272895.
DR   EnsemblGenomes-Gn; EBG00001272897.
DR   EnsemblGenomes-Gn; EBG00001272899.
DR   EnsemblGenomes-Gn; EBG00001272901.
DR   EnsemblGenomes-Gn; EBG00001272902.
DR   EnsemblGenomes-Gn; EBG00001272903.
DR   EnsemblGenomes-Gn; EBG00001272904.
DR   EnsemblGenomes-Gn; EBG00001272905.
DR   EnsemblGenomes-Gn; EBG00001272907.
DR   EnsemblGenomes-Gn; EBG00001272909.
DR   EnsemblGenomes-Gn; EBG00001272911.
DR   EnsemblGenomes-Gn; EBG00001272913.
DR   EnsemblGenomes-Gn; EBG00001272914.
DR   EnsemblGenomes-Gn; EBG00001272916.
DR   EnsemblGenomes-Gn; EBG00001272918.
DR   EnsemblGenomes-Gn; EBG00001272920.
DR   EnsemblGenomes-Gn; EBG00001272922.
DR   EnsemblGenomes-Gn; EBG00001272923.
DR   EnsemblGenomes-Gn; EBG00001272924.
DR   EnsemblGenomes-Gn; EBG00001272925.
DR   EnsemblGenomes-Gn; EBG00001272927.
DR   EnsemblGenomes-Gn; EBG00001272929.
DR   EnsemblGenomes-Gn; EBG00001272931.
DR   EnsemblGenomes-Gn; EBG00001272933.
DR   EnsemblGenomes-Gn; EBG00001272935.
DR   EnsemblGenomes-Gn; EBG00001272936.
DR   EnsemblGenomes-Gn; EBG00001272937.
DR   EnsemblGenomes-Gn; EBG00001272938.
DR   EnsemblGenomes-Gn; EBG00001272941.
DR   EnsemblGenomes-Gn; EBG00001272943.
DR   EnsemblGenomes-Gn; EBG00001272945.
DR   EnsemblGenomes-Gn; EBG00001272947.
DR   EnsemblGenomes-Gn; EBG00001272949.
DR   EnsemblGenomes-Gn; EBG00001272951.
DR   EnsemblGenomes-Gn; EBG00001272953.
DR   EnsemblGenomes-Gn; EBG00001272954.
DR   EnsemblGenomes-Gn; EBG00001272956.
DR   EnsemblGenomes-Gn; EBG00001272958.
DR   EnsemblGenomes-Gn; EBG00001272960.
DR   EnsemblGenomes-Gn; EBG00001272962.
DR   EnsemblGenomes-Gn; EBG00001272964.
DR   EnsemblGenomes-Gn; EBG00001272966.
DR   EnsemblGenomes-Gn; EBG00001272968.
DR   EnsemblGenomes-Gn; EBG00001272970.
DR   EnsemblGenomes-Gn; EBG00001272972.
DR   EnsemblGenomes-Gn; EBG00001272973.
DR   EnsemblGenomes-Gn; EBG00001272974.
DR   EnsemblGenomes-Gn; EBG00001272975.
DR   EnsemblGenomes-Gn; EBG00001272976.
DR   EnsemblGenomes-Gn; EBG00001272978.
DR   EnsemblGenomes-Gn; EBG00001272979.
DR   EnsemblGenomes-Gn; EBG00001272980.
DR   EnsemblGenomes-Gn; EBG00001272981.
DR   EnsemblGenomes-Gn; EBG00001272982.
DR   EnsemblGenomes-Gn; EBG00001272984.
DR   EnsemblGenomes-Gn; EBG00001272985.
DR   EnsemblGenomes-Gn; EBG00001272987.
DR   EnsemblGenomes-Gn; EBG00001272989.
DR   EnsemblGenomes-Gn; EBG00001272991.
DR   EnsemblGenomes-Gn; EBG00001272992.
DR   EnsemblGenomes-Gn; EBG00001272994.
DR   EnsemblGenomes-Gn; EBG00001272996.
DR   EnsemblGenomes-Gn; EBG00001272998.
DR   EnsemblGenomes-Gn; EBG00001272999.
DR   EnsemblGenomes-Gn; EBG00001273001.
DR   EnsemblGenomes-Gn; EBG00001273003.
DR   EnsemblGenomes-Gn; EBG00001273005.
DR   EnsemblGenomes-Gn; EBG00001273007.
DR   EnsemblGenomes-Gn; EBG00001273009.
DR   EnsemblGenomes-Gn; EBG00001273011.
DR   EnsemblGenomes-Gn; EBG00001273013.
DR   EnsemblGenomes-Gn; EBG00001273015.
DR   EnsemblGenomes-Gn; EBG00001273016.
DR   EnsemblGenomes-Gn; EBG00001273018.
DR   EnsemblGenomes-Gn; EBG00001273020.
DR   EnsemblGenomes-Gn; EBG00001273022.
DR   EnsemblGenomes-Gn; EBG00001273023.
DR   EnsemblGenomes-Gn; EBG00001273024.
DR   EnsemblGenomes-Gn; EBG00001273025.
DR   EnsemblGenomes-Gn; EBG00001273026.
DR   EnsemblGenomes-Gn; EBG00001273027.
DR   EnsemblGenomes-Gn; EBG00001273028.
DR   EnsemblGenomes-Gn; EBG00001273029.
DR   EnsemblGenomes-Gn; EBG00001273030.
DR   EnsemblGenomes-Gn; EBG00001273031.
DR   EnsemblGenomes-Gn; EBG00001273032.
DR   EnsemblGenomes-Gn; EBG00001273033.
DR   EnsemblGenomes-Gn; EBG00001273034.
DR   EnsemblGenomes-Gn; EBG00001273035.
DR   EnsemblGenomes-Gn; EBG00001273036.
DR   EnsemblGenomes-Gn; EBG00001273037.
DR   EnsemblGenomes-Gn; EBG00001273038.
DR   EnsemblGenomes-Gn; EBG00001273039.
DR   EnsemblGenomes-Gn; EBG00001273040.
DR   EnsemblGenomes-Gn; ECO26_0019.
DR   EnsemblGenomes-Gn; ECO26_0020.
DR   EnsemblGenomes-Gn; ECO26_0021.
DR   EnsemblGenomes-Gn; ECO26_0137.
DR   EnsemblGenomes-Gn; ECO26_0138.
DR   EnsemblGenomes-Gn; ECO26_0197.
DR   EnsemblGenomes-Gn; ECO26_0198.
DR   EnsemblGenomes-Gn; ECO26_0221.
DR   EnsemblGenomes-Gn; ECO26_0222.
DR   EnsemblGenomes-Gn; ECO26_0226.
DR   EnsemblGenomes-Gn; ECO26_0227.
DR   EnsemblGenomes-Gn; ECO26_0229.
DR   EnsemblGenomes-Gn; ECO26_0233.
DR   EnsemblGenomes-Gn; ECO26_0234.
DR   EnsemblGenomes-Gn; ECO26_0241.
DR   EnsemblGenomes-Gn; ECO26_0261.
DR   EnsemblGenomes-Gn; ECO26_0262.
DR   EnsemblGenomes-Gn; ECO26_0317.
DR   EnsemblGenomes-Gn; ECO26_0351.
DR   EnsemblGenomes-Gn; ECO26_0352.
DR   EnsemblGenomes-Gn; ECO26_0404.
DR   EnsemblGenomes-Gn; ECO26_0405.
DR   EnsemblGenomes-Gn; ECO26_0406.
DR   EnsemblGenomes-Gn; ECO26_0407.
DR   EnsemblGenomes-Gn; ECO26_0425.
DR   EnsemblGenomes-Gn; ECO26_0532.
DR   EnsemblGenomes-Gn; ECO26_0533.
DR   EnsemblGenomes-Gn; ECO26_0534.
DR   EnsemblGenomes-Gn; ECO26_0545.
DR   EnsemblGenomes-Gn; ECO26_0546.
DR   EnsemblGenomes-Gn; ECO26_0605.
DR   EnsemblGenomes-Gn; ECO26_0609.
DR   EnsemblGenomes-Gn; ECO26_0629.
DR   EnsemblGenomes-Gn; ECO26_0637.
DR   EnsemblGenomes-Gn; ECO26_0639.
DR   EnsemblGenomes-Gn; ECO26_0720.
DR   EnsemblGenomes-Gn; ECO26_0721.
DR   EnsemblGenomes-Gn; ECO26_0765.
DR   EnsemblGenomes-Gn; ECO26_0767.
DR   EnsemblGenomes-Gn; ECO26_0840.
DR   EnsemblGenomes-Gn; ECO26_0844.
DR   EnsemblGenomes-Gn; ECO26_0845.
DR   EnsemblGenomes-Gn; ECO26_0846.
DR   EnsemblGenomes-Gn; ECO26_0872.
DR   EnsemblGenomes-Gn; ECO26_0876.
DR   EnsemblGenomes-Gn; ECO26_0888.
DR   EnsemblGenomes-Gn; ECO26_0890.
DR   EnsemblGenomes-Gn; ECO26_0891.
DR   EnsemblGenomes-Gn; ECO26_1163.
DR   EnsemblGenomes-Gn; ECO26_1164.
DR   EnsemblGenomes-Gn; ECO26_1165.
DR   EnsemblGenomes-Gn; ECO26_1168.
DR   EnsemblGenomes-Gn; ECO26_1257.
DR   EnsemblGenomes-Gn; ECO26_1269.
DR   EnsemblGenomes-Gn; ECO26_1271.
DR   EnsemblGenomes-Gn; ECO26_1286.
DR   EnsemblGenomes-Gn; ECO26_1287.
DR   EnsemblGenomes-Gn; ECO26_1288.
DR   EnsemblGenomes-Gn; ECO26_1294.
DR   EnsemblGenomes-Gn; ECO26_1325.
DR   EnsemblGenomes-Gn; ECO26_1336.
DR   EnsemblGenomes-Gn; ECO26_1337.
DR   EnsemblGenomes-Gn; ECO26_1369.
DR   EnsemblGenomes-Gn; ECO26_1533.
DR   EnsemblGenomes-Gn; ECO26_1559.
DR   EnsemblGenomes-Gn; ECO26_1751.
DR   EnsemblGenomes-Gn; ECO26_1785.
DR   EnsemblGenomes-Gn; ECO26_1786.
DR   EnsemblGenomes-Gn; ECO26_1795.
DR   EnsemblGenomes-Gn; ECO26_1796.
DR   EnsemblGenomes-Gn; ECO26_1802.
DR   EnsemblGenomes-Gn; ECO26_1804.
DR   EnsemblGenomes-Gn; ECO26_1807.
DR   EnsemblGenomes-Gn; ECO26_1808.
DR   EnsemblGenomes-Gn; ECO26_1809.
DR   EnsemblGenomes-Gn; ECO26_1812.
DR   EnsemblGenomes-Gn; ECO26_1813.
DR   EnsemblGenomes-Gn; ECO26_1818.
DR   EnsemblGenomes-Gn; ECO26_1819.
DR   EnsemblGenomes-Gn; ECO26_1821.
DR   EnsemblGenomes-Gn; ECO26_1841.
DR   EnsemblGenomes-Gn; ECO26_1876.
DR   EnsemblGenomes-Gn; ECO26_1877.
DR   EnsemblGenomes-Gn; ECO26_1917.
DR   EnsemblGenomes-Gn; ECO26_1935.
DR   EnsemblGenomes-Gn; ECO26_1944.
DR   EnsemblGenomes-Gn; ECO26_2030.
DR   EnsemblGenomes-Gn; ECO26_2037.
DR   EnsemblGenomes-Gn; ECO26_2038.
DR   EnsemblGenomes-Gn; ECO26_2059.
DR   EnsemblGenomes-Gn; ECO26_2060.
DR   EnsemblGenomes-Gn; ECO26_2081.
DR   EnsemblGenomes-Gn; ECO26_2106.
DR   EnsemblGenomes-Gn; ECO26_2109.
DR   EnsemblGenomes-Gn; ECO26_2110.
DR   EnsemblGenomes-Gn; ECO26_2112.
DR   EnsemblGenomes-Gn; ECO26_2113.
DR   EnsemblGenomes-Gn; ECO26_2119.
DR   EnsemblGenomes-Gn; ECO26_2120.
DR   EnsemblGenomes-Gn; ECO26_2128.
DR   EnsemblGenomes-Gn; ECO26_2129.
DR   EnsemblGenomes-Gn; ECO26_2143.
DR   EnsemblGenomes-Gn; ECO26_2146.
DR   EnsemblGenomes-Gn; ECO26_2153.
DR   EnsemblGenomes-Gn; ECO26_2154.
DR   EnsemblGenomes-Gn; ECO26_2155.
DR   EnsemblGenomes-Gn; ECO26_2209.
DR   EnsemblGenomes-Gn; ECO26_2213.
DR   EnsemblGenomes-Gn; ECO26_2214.
DR   EnsemblGenomes-Gn; ECO26_2215.
DR   EnsemblGenomes-Gn; ECO26_2219.
DR   EnsemblGenomes-Gn; ECO26_2233.
DR   EnsemblGenomes-Gn; ECO26_2234.
DR   EnsemblGenomes-Gn; ECO26_2289.
DR   EnsemblGenomes-Gn; ECO26_2290.
DR   EnsemblGenomes-Gn; ECO26_2305.
DR   EnsemblGenomes-Gn; ECO26_2329.
DR   EnsemblGenomes-Gn; ECO26_2422.
DR   EnsemblGenomes-Gn; ECO26_2423.
DR   EnsemblGenomes-Gn; ECO26_2492.
DR   EnsemblGenomes-Gn; ECO26_2493.
DR   EnsemblGenomes-Gn; ECO26_2503.
DR   EnsemblGenomes-Gn; ECO26_2504.
DR   EnsemblGenomes-Gn; ECO26_2645.
DR   EnsemblGenomes-Gn; ECO26_2660.
DR   EnsemblGenomes-Gn; ECO26_2846.
DR   EnsemblGenomes-Gn; ECO26_2848.
DR   EnsemblGenomes-Gn; ECO26_2851.
DR   EnsemblGenomes-Gn; ECO26_2859.
DR   EnsemblGenomes-Gn; ECO26_2870.
DR   EnsemblGenomes-Gn; ECO26_2871.
DR   EnsemblGenomes-Gn; ECO26_2872.
DR   EnsemblGenomes-Gn; ECO26_2878.
DR   EnsemblGenomes-Gn; ECO26_2884.
DR   EnsemblGenomes-Gn; ECO26_2886.
DR   EnsemblGenomes-Gn; ECO26_2887.
DR   EnsemblGenomes-Gn; ECO26_2892.
DR   EnsemblGenomes-Gn; ECO26_2895.
DR   EnsemblGenomes-Gn; ECO26_2899.
DR   EnsemblGenomes-Gn; ECO26_2906.
DR   EnsemblGenomes-Gn; ECO26_2915.
DR   EnsemblGenomes-Gn; ECO26_2978.
DR   EnsemblGenomes-Gn; ECO26_2979.
DR   EnsemblGenomes-Gn; ECO26_2982.
DR   EnsemblGenomes-Gn; ECO26_2983.
DR   EnsemblGenomes-Gn; ECO26_2999.
DR   EnsemblGenomes-Gn; ECO26_3000.
DR   EnsemblGenomes-Gn; ECO26_3024.
DR   EnsemblGenomes-Gn; ECO26_3032.
DR   EnsemblGenomes-Gn; ECO26_3035.
DR   EnsemblGenomes-Gn; ECO26_3036.
DR   EnsemblGenomes-Gn; ECO26_3040.
DR   EnsemblGenomes-Gn; ECO26_3154.
DR   EnsemblGenomes-Gn; ECO26_3176.
DR   EnsemblGenomes-Gn; ECO26_3177.
DR   EnsemblGenomes-Gn; ECO26_3222.
DR   EnsemblGenomes-Gn; ECO26_3238.
DR   EnsemblGenomes-Gn; ECO26_3380.
DR   EnsemblGenomes-Gn; ECO26_3394.
DR   EnsemblGenomes-Gn; ECO26_3395.
DR   EnsemblGenomes-Gn; ECO26_3396.
DR   EnsemblGenomes-Gn; ECO26_3397.
DR   EnsemblGenomes-Gn; ECO26_3407.
DR   EnsemblGenomes-Gn; ECO26_3425.
DR   EnsemblGenomes-Gn; ECO26_3535.
DR   EnsemblGenomes-Gn; ECO26_3536.
DR   EnsemblGenomes-Gn; ECO26_3662.
DR   EnsemblGenomes-Gn; ECO26_3723.
DR   EnsemblGenomes-Gn; ECO26_3724.
DR   EnsemblGenomes-Gn; ECO26_3725.
DR   EnsemblGenomes-Gn; ECO26_3727.
DR   EnsemblGenomes-Gn; ECO26_3830.
DR   EnsemblGenomes-Gn; ECO26_3831.
DR   EnsemblGenomes-Gn; ECO26_3928.
DR   EnsemblGenomes-Gn; ECO26_3929.
DR   EnsemblGenomes-Gn; ECO26_3937.
DR   EnsemblGenomes-Gn; ECO26_3938.
DR   EnsemblGenomes-Gn; ECO26_3942.
DR   EnsemblGenomes-Gn; ECO26_3943.
DR   EnsemblGenomes-Gn; ECO26_4070.
DR   EnsemblGenomes-Gn; ECO26_4072.
DR   EnsemblGenomes-Gn; ECO26_4148.
DR   EnsemblGenomes-Gn; ECO26_4149.
DR   EnsemblGenomes-Gn; ECO26_4152.
DR   EnsemblGenomes-Gn; ECO26_4153.
DR   EnsemblGenomes-Gn; ECO26_4181.
DR   EnsemblGenomes-Gn; ECO26_4182.
DR   EnsemblGenomes-Gn; ECO26_4185.
DR   EnsemblGenomes-Gn; ECO26_4188.
DR   EnsemblGenomes-Gn; ECO26_4189.
DR   EnsemblGenomes-Gn; ECO26_4318.
DR   EnsemblGenomes-Gn; ECO26_4319.
DR   EnsemblGenomes-Gn; ECO26_4375.
DR   EnsemblGenomes-Gn; ECO26_4378.
DR   EnsemblGenomes-Gn; ECO26_4571.
DR   EnsemblGenomes-Gn; ECO26_4572.
DR   EnsemblGenomes-Gn; ECO26_4594.
DR   EnsemblGenomes-Gn; ECO26_4595.
DR   EnsemblGenomes-Gn; ECO26_4596.
DR   EnsemblGenomes-Gn; ECO26_4679.
DR   EnsemblGenomes-Gn; ECO26_4680.
DR   EnsemblGenomes-Gn; ECO26_4727.
DR   EnsemblGenomes-Gn; ECO26_4729.
DR   EnsemblGenomes-Gn; ECO26_4730.
DR   EnsemblGenomes-Gn; ECO26_4768.
DR   EnsemblGenomes-Gn; ECO26_4788.
DR   EnsemblGenomes-Gn; ECO26_4890.
DR   EnsemblGenomes-Gn; ECO26_4901.
DR   EnsemblGenomes-Gn; ECO26_5003.
DR   EnsemblGenomes-Gn; ECO26_5006.
DR   EnsemblGenomes-Gn; ECO26_5064.
DR   EnsemblGenomes-Gn; ECO26_5065.
DR   EnsemblGenomes-Gn; ECO26_5121.
DR   EnsemblGenomes-Gn; ECO26_5127.
DR   EnsemblGenomes-Gn; ECO26_5128.
DR   EnsemblGenomes-Gn; ECO26_5147.
DR   EnsemblGenomes-Gn; ECO26_5148.
DR   EnsemblGenomes-Gn; ECO26_5153.
DR   EnsemblGenomes-Gn; ECO26_5154.
DR   EnsemblGenomes-Gn; ECO26_5183.
DR   EnsemblGenomes-Gn; ECO26_5184.
DR   EnsemblGenomes-Gn; ECO26_5246.
DR   EnsemblGenomes-Gn; ECO26_5290.
DR   EnsemblGenomes-Gn; ECO26_5292.
DR   EnsemblGenomes-Gn; ECO26_5297.
DR   EnsemblGenomes-Gn; ECO26_5299.
DR   EnsemblGenomes-Gn; ECO26_5361.
DR   EnsemblGenomes-Gn; ECO26_5362.
DR   EnsemblGenomes-Gn; ECO26_5410.
DR   EnsemblGenomes-Gn; ECO26_5426.
DR   EnsemblGenomes-Gn; ECO26_5427.
DR   EnsemblGenomes-Gn; ECO26_5450.
DR   EnsemblGenomes-Gn; ECO26_5453.
DR   EnsemblGenomes-Gn; ECO26_5463.
DR   EnsemblGenomes-Gn; ECO26_5464.
DR   EnsemblGenomes-Gn; ECO26_5467.
DR   EnsemblGenomes-Gn; ECO26_5479.
DR   EnsemblGenomes-Gn; ECO26_5483.
DR   EnsemblGenomes-Gn; ECO26_5488.
DR   EnsemblGenomes-Gn; ECO26_5489.
DR   EnsemblGenomes-Gn; ECO26_5501.
DR   EnsemblGenomes-Gn; ECO26_5504.
DR   EnsemblGenomes-Gn; ECO26_5529.
DR   EnsemblGenomes-Gn; ECO26_5538.
DR   EnsemblGenomes-Gn; ECO26_5588.
DR   EnsemblGenomes-Gn; ECO26_ncRNA01.
DR   EnsemblGenomes-Gn; ECO26_ncRNA02.
DR   EnsemblGenomes-Gn; ECO26_ncRNA03.
DR   EnsemblGenomes-Gn; ECO26_ncRNA04.
DR   EnsemblGenomes-Gn; ECO26_ncRNA05.
DR   EnsemblGenomes-Gn; ECO26_ncRNA06.
DR   EnsemblGenomes-Gn; ECO26_ncRNA07.
DR   EnsemblGenomes-Gn; ECO26_ncRNA08.
DR   EnsemblGenomes-Gn; ECO26_ncRNA09.
DR   EnsemblGenomes-Gn; ECO26_ncRNA10.
DR   EnsemblGenomes-Gn; ECO26_ncRNA11.
DR   EnsemblGenomes-Gn; ECO26_ncRNA12.
DR   EnsemblGenomes-Gn; ECO26_ncRNA13.
DR   EnsemblGenomes-Gn; ECO26_ncRNA14.
DR   EnsemblGenomes-Gn; ECO26_ncRNA15.
DR   EnsemblGenomes-Gn; ECO26_ncRNA16.
DR   EnsemblGenomes-Gn; ECO26_ncRNA17.
DR   EnsemblGenomes-Gn; ECO26_ncRNA18.
DR   EnsemblGenomes-Gn; ECO26_ncRNA19.
DR   EnsemblGenomes-Gn; ECO26_ncRNA20.
DR   EnsemblGenomes-Gn; ECO26_ncRNA21.
DR   EnsemblGenomes-Gn; ECO26_ncRNA22.
DR   EnsemblGenomes-Gn; ECO26_ncRNA23.
DR   EnsemblGenomes-Gn; ECO26_ncRNA24.
DR   EnsemblGenomes-Gn; ECO26_ncRNA25.
DR   EnsemblGenomes-Gn; ECO26_ncRNA26.
DR   EnsemblGenomes-Gn; ECO26_ncRNA27.
DR   EnsemblGenomes-Gn; ECO26_ncRNA28.
DR   EnsemblGenomes-Gn; ECO26_ncRNA29.
DR   EnsemblGenomes-Gn; ECO26_ncRNA30.
DR   EnsemblGenomes-Gn; ECO26_ncRNA31.
DR   EnsemblGenomes-Gn; ECO26_ncRNA32.
DR   EnsemblGenomes-Gn; ECO26_ncRNA33.
DR   EnsemblGenomes-Gn; ECO26_ncRNA34.
DR   EnsemblGenomes-Gn; ECO26_ncRNA35.
DR   EnsemblGenomes-Gn; ECO26_ncRNA36.
DR   EnsemblGenomes-Gn; ECO26_ncRNA37.
DR   EnsemblGenomes-Gn; ECO26_ncRNA38.
DR   EnsemblGenomes-Gn; ECO26_ncRNA39.
DR   EnsemblGenomes-Gn; ECO26_ncRNA40.
DR   EnsemblGenomes-Gn; ECO26_ncRNA41.
DR   EnsemblGenomes-Gn; ECO26_ncRNA42.
DR   EnsemblGenomes-Gn; ECO26_ncRNA43.
DR   EnsemblGenomes-Gn; ECO26_ncRNA44.
DR   EnsemblGenomes-Gn; ECO26_ncRNA45.
DR   EnsemblGenomes-Gn; ECO26_ncRNA46.
DR   EnsemblGenomes-Gn; ECO26_ncRNA47.
DR   EnsemblGenomes-Gn; ECO26_ncRNA48.
DR   EnsemblGenomes-Gn; ECO26_ncRNA49.
DR   EnsemblGenomes-Gn; ECO26_ncRNA50.
DR   EnsemblGenomes-Gn; ECO26_ncRNA51.
DR   EnsemblGenomes-Gn; ECO26_ncRNA52.
DR   EnsemblGenomes-Gn; ECO26_ncRNA53.
DR   EnsemblGenomes-Gn; ECO26_ncRNA54.
DR   EnsemblGenomes-Gn; ECO26_ncRNA55.
DR   EnsemblGenomes-Gn; ECO26_ncRNA56.
DR   EnsemblGenomes-Gn; ECO26_ncRNA57.
DR   EnsemblGenomes-Gn; ECO26_ncRNA58.
DR   EnsemblGenomes-Gn; ECO26_ncRNA59.
DR   EnsemblGenomes-Gn; ECO26_ncRNA60.
DR   EnsemblGenomes-Gn; ECO26_ncRNA61.
DR   EnsemblGenomes-Gn; ECO26_ncRNA62.
DR   EnsemblGenomes-Gn; ECO26_ncRNA63.
DR   EnsemblGenomes-Gn; ECO26_ncRNA64.
DR   EnsemblGenomes-Gn; ECO26_ncRNA65.
DR   EnsemblGenomes-Gn; ECO26_ncRNA66.
DR   EnsemblGenomes-Gn; ECO26_ncRNA67.
DR   EnsemblGenomes-Gn; ECO26_ncRNA68.
DR   EnsemblGenomes-Gn; ECO26_ncRNA69.
DR   EnsemblGenomes-Gn; ECO26_ncRNA70.
DR   EnsemblGenomes-Gn; ECO26_rRNA01.
DR   EnsemblGenomes-Gn; ECO26_rRNA02.
DR   EnsemblGenomes-Gn; ECO26_rRNA03.
DR   EnsemblGenomes-Gn; ECO26_rRNA04.
DR   EnsemblGenomes-Gn; ECO26_rRNA05.
DR   EnsemblGenomes-Gn; ECO26_rRNA06.
DR   EnsemblGenomes-Gn; ECO26_rRNA07.
DR   EnsemblGenomes-Gn; ECO26_rRNA08.
DR   EnsemblGenomes-Gn; ECO26_rRNA09.
DR   EnsemblGenomes-Gn; ECO26_rRNA10.
DR   EnsemblGenomes-Gn; ECO26_rRNA11.
DR   EnsemblGenomes-Gn; ECO26_rRNA12.
DR   EnsemblGenomes-Gn; ECO26_rRNA13.
DR   EnsemblGenomes-Gn; ECO26_rRNA14.
DR   EnsemblGenomes-Gn; ECO26_rRNA15.
DR   EnsemblGenomes-Gn; ECO26_rRNA16.
DR   EnsemblGenomes-Gn; ECO26_rRNA17.
DR   EnsemblGenomes-Gn; ECO26_rRNA18.
DR   EnsemblGenomes-Gn; ECO26_rRNA19.
DR   EnsemblGenomes-Gn; ECO26_rRNA20.
DR   EnsemblGenomes-Gn; ECO26_rRNA21.
DR   EnsemblGenomes-Gn; ECO26_rRNA22.
DR   EnsemblGenomes-Gn; ECO26_tRNA001.
DR   EnsemblGenomes-Gn; ECO26_tRNA002.
DR   EnsemblGenomes-Gn; ECO26_tRNA003.
DR   EnsemblGenomes-Gn; ECO26_tRNA004.
DR   EnsemblGenomes-Gn; ECO26_tRNA005.
DR   EnsemblGenomes-Gn; ECO26_tRNA006.
DR   EnsemblGenomes-Gn; ECO26_tRNA007.
DR   EnsemblGenomes-Gn; ECO26_tRNA008.
DR   EnsemblGenomes-Gn; ECO26_tRNA009.
DR   EnsemblGenomes-Gn; ECO26_tRNA010.
DR   EnsemblGenomes-Gn; ECO26_tRNA011.
DR   EnsemblGenomes-Gn; ECO26_tRNA012.
DR   EnsemblGenomes-Gn; ECO26_tRNA013.
DR   EnsemblGenomes-Gn; ECO26_tRNA014.
DR   EnsemblGenomes-Gn; ECO26_tRNA015.
DR   EnsemblGenomes-Gn; ECO26_tRNA016.
DR   EnsemblGenomes-Gn; ECO26_tRNA017.
DR   EnsemblGenomes-Gn; ECO26_tRNA018.
DR   EnsemblGenomes-Gn; ECO26_tRNA019.
DR   EnsemblGenomes-Gn; ECO26_tRNA020.
DR   EnsemblGenomes-Gn; ECO26_tRNA021.
DR   EnsemblGenomes-Gn; ECO26_tRNA022.
DR   EnsemblGenomes-Gn; ECO26_tRNA023.
DR   EnsemblGenomes-Gn; ECO26_tRNA024.
DR   EnsemblGenomes-Gn; ECO26_tRNA025.
DR   EnsemblGenomes-Gn; ECO26_tRNA026.
DR   EnsemblGenomes-Gn; ECO26_tRNA027.
DR   EnsemblGenomes-Gn; ECO26_tRNA028.
DR   EnsemblGenomes-Gn; ECO26_tRNA029.
DR   EnsemblGenomes-Gn; ECO26_tRNA030.
DR   EnsemblGenomes-Gn; ECO26_tRNA031.
DR   EnsemblGenomes-Gn; ECO26_tRNA032.
DR   EnsemblGenomes-Gn; ECO26_tRNA033.
DR   EnsemblGenomes-Gn; ECO26_tRNA034.
DR   EnsemblGenomes-Gn; ECO26_tRNA035.
DR   EnsemblGenomes-Gn; ECO26_tRNA036.
DR   EnsemblGenomes-Gn; ECO26_tRNA037.
DR   EnsemblGenomes-Gn; ECO26_tRNA038.
DR   EnsemblGenomes-Gn; ECO26_tRNA039.
DR   EnsemblGenomes-Gn; ECO26_tRNA040.
DR   EnsemblGenomes-Gn; ECO26_tRNA041.
DR   EnsemblGenomes-Gn; ECO26_tRNA042.
DR   EnsemblGenomes-Gn; ECO26_tRNA043.
DR   EnsemblGenomes-Gn; ECO26_tRNA044.
DR   EnsemblGenomes-Gn; ECO26_tRNA045.
DR   EnsemblGenomes-Gn; ECO26_tRNA046.
DR   EnsemblGenomes-Gn; ECO26_tRNA047.
DR   EnsemblGenomes-Gn; ECO26_tRNA048.
DR   EnsemblGenomes-Gn; ECO26_tRNA049.
DR   EnsemblGenomes-Gn; ECO26_tRNA050.
DR   EnsemblGenomes-Gn; ECO26_tRNA051.
DR   EnsemblGenomes-Gn; ECO26_tRNA052.
DR   EnsemblGenomes-Gn; ECO26_tRNA053.
DR   EnsemblGenomes-Gn; ECO26_tRNA054.
DR   EnsemblGenomes-Gn; ECO26_tRNA055.
DR   EnsemblGenomes-Gn; ECO26_tRNA056.
DR   EnsemblGenomes-Gn; ECO26_tRNA057.
DR   EnsemblGenomes-Gn; ECO26_tRNA058.
DR   EnsemblGenomes-Gn; ECO26_tRNA059.
DR   EnsemblGenomes-Gn; ECO26_tRNA060.
DR   EnsemblGenomes-Gn; ECO26_tRNA061.
DR   EnsemblGenomes-Gn; ECO26_tRNA062.
DR   EnsemblGenomes-Gn; ECO26_tRNA063.
DR   EnsemblGenomes-Gn; ECO26_tRNA064.
DR   EnsemblGenomes-Gn; ECO26_tRNA065.
DR   EnsemblGenomes-Gn; ECO26_tRNA066.
DR   EnsemblGenomes-Gn; ECO26_tRNA067.
DR   EnsemblGenomes-Gn; ECO26_tRNA068.
DR   EnsemblGenomes-Gn; ECO26_tRNA069.
DR   EnsemblGenomes-Gn; ECO26_tRNA070.
DR   EnsemblGenomes-Gn; ECO26_tRNA071.
DR   EnsemblGenomes-Gn; ECO26_tRNA072.
DR   EnsemblGenomes-Gn; ECO26_tRNA073.
DR   EnsemblGenomes-Gn; ECO26_tRNA074.
DR   EnsemblGenomes-Gn; ECO26_tRNA075.
DR   EnsemblGenomes-Gn; ECO26_tRNA076.
DR   EnsemblGenomes-Gn; ECO26_tRNA077.
DR   EnsemblGenomes-Gn; ECO26_tRNA078.
DR   EnsemblGenomes-Gn; ECO26_tRNA079.
DR   EnsemblGenomes-Gn; ECO26_tRNA080.
DR   EnsemblGenomes-Gn; ECO26_tRNA081.
DR   EnsemblGenomes-Gn; ECO26_tRNA082.
DR   EnsemblGenomes-Gn; ECO26_tRNA083.
DR   EnsemblGenomes-Gn; ECO26_tRNA084.
DR   EnsemblGenomes-Gn; ECO26_tRNA085.
DR   EnsemblGenomes-Gn; ECO26_tRNA086.
DR   EnsemblGenomes-Gn; ECO26_tRNA087.
DR   EnsemblGenomes-Gn; ECO26_tRNA088.
DR   EnsemblGenomes-Gn; ECO26_tRNA089.
DR   EnsemblGenomes-Gn; ECO26_tRNA090.
DR   EnsemblGenomes-Gn; ECO26_tRNA091.
DR   EnsemblGenomes-Gn; ECO26_tRNA092.
DR   EnsemblGenomes-Gn; ECO26_tRNA093.
DR   EnsemblGenomes-Gn; ECO26_tRNA094.
DR   EnsemblGenomes-Gn; ECO26_tRNA095.
DR   EnsemblGenomes-Gn; ECO26_tRNA096.
DR   EnsemblGenomes-Gn; ECO26_tRNA097.
DR   EnsemblGenomes-Gn; ECO26_tRNA098.
DR   EnsemblGenomes-Gn; ECO26_tRNA099.
DR   EnsemblGenomes-Gn; ECO26_tRNA100.
DR   EnsemblGenomes-Gn; ECO26_tRNA101.
DR   EnsemblGenomes-Tr; EBG00000622959-1.
DR   EnsemblGenomes-Tr; EBT00001804870.
DR   EnsemblGenomes-Tr; EBT00001804871.
DR   EnsemblGenomes-Tr; EBT00001804872.
DR   EnsemblGenomes-Tr; EBT00001804873.
DR   EnsemblGenomes-Tr; EBT00001804874.
DR   EnsemblGenomes-Tr; EBT00001804875.
DR   EnsemblGenomes-Tr; EBT00001804876.
DR   EnsemblGenomes-Tr; EBT00001804877.
DR   EnsemblGenomes-Tr; EBT00001804878.
DR   EnsemblGenomes-Tr; EBT00001804879.
DR   EnsemblGenomes-Tr; EBT00001804880.
DR   EnsemblGenomes-Tr; EBT00001804881.
DR   EnsemblGenomes-Tr; EBT00001804882.
DR   EnsemblGenomes-Tr; EBT00001804883.
DR   EnsemblGenomes-Tr; EBT00001804884.
DR   EnsemblGenomes-Tr; EBT00001804885.
DR   EnsemblGenomes-Tr; EBT00001804886.
DR   EnsemblGenomes-Tr; EBT00001804887.
DR   EnsemblGenomes-Tr; EBT00001804888.
DR   EnsemblGenomes-Tr; EBT00001804889.
DR   EnsemblGenomes-Tr; EBT00001804890.
DR   EnsemblGenomes-Tr; EBT00001804891.
DR   EnsemblGenomes-Tr; EBT00001804892.
DR   EnsemblGenomes-Tr; EBT00001804893.
DR   EnsemblGenomes-Tr; EBT00001804894.
DR   EnsemblGenomes-Tr; EBT00001804895.
DR   EnsemblGenomes-Tr; EBT00001804896.
DR   EnsemblGenomes-Tr; EBT00001804897.
DR   EnsemblGenomes-Tr; EBT00001804898.
DR   EnsemblGenomes-Tr; EBT00001804899.
DR   EnsemblGenomes-Tr; EBT00001804900.
DR   EnsemblGenomes-Tr; EBT00001804901.
DR   EnsemblGenomes-Tr; EBT00001804902.
DR   EnsemblGenomes-Tr; EBT00001804903.
DR   EnsemblGenomes-Tr; EBT00001804904.
DR   EnsemblGenomes-Tr; EBT00001804905.
DR   EnsemblGenomes-Tr; EBT00001804906.
DR   EnsemblGenomes-Tr; EBT00001804907.
DR   EnsemblGenomes-Tr; EBT00001804908.
DR   EnsemblGenomes-Tr; EBT00001804909.
DR   EnsemblGenomes-Tr; EBT00001804910.
DR   EnsemblGenomes-Tr; EBT00001804911.
DR   EnsemblGenomes-Tr; EBT00001804912.
DR   EnsemblGenomes-Tr; EBT00001804913.
DR   EnsemblGenomes-Tr; EBT00001804914.
DR   EnsemblGenomes-Tr; EBT00001804915.
DR   EnsemblGenomes-Tr; EBT00001804916.
DR   EnsemblGenomes-Tr; EBT00001804917.
DR   EnsemblGenomes-Tr; EBT00001804918.
DR   EnsemblGenomes-Tr; EBT00001804919.
DR   EnsemblGenomes-Tr; EBT00001804920.
DR   EnsemblGenomes-Tr; EBT00001804921.
DR   EnsemblGenomes-Tr; EBT00001804922.
DR   EnsemblGenomes-Tr; EBT00001804923.
DR   EnsemblGenomes-Tr; EBT00001804924.
DR   EnsemblGenomes-Tr; EBT00001804925.
DR   EnsemblGenomes-Tr; EBT00001804926.
DR   EnsemblGenomes-Tr; EBT00001804927.
DR   EnsemblGenomes-Tr; EBT00001804928.
DR   EnsemblGenomes-Tr; EBT00001804929.
DR   EnsemblGenomes-Tr; EBT00001804930.
DR   EnsemblGenomes-Tr; EBT00001804931.
DR   EnsemblGenomes-Tr; EBT00001804932.
DR   EnsemblGenomes-Tr; EBT00001804933.
DR   EnsemblGenomes-Tr; EBT00001804934.
DR   EnsemblGenomes-Tr; EBT00001804935.
DR   EnsemblGenomes-Tr; EBT00001804936.
DR   EnsemblGenomes-Tr; EBT00001804937.
DR   EnsemblGenomes-Tr; EBT00001804938.
DR   EnsemblGenomes-Tr; EBT00001804940.
DR   EnsemblGenomes-Tr; EBT00001804943.
DR   EnsemblGenomes-Tr; EBT00001804946.
DR   EnsemblGenomes-Tr; EBT00001804948.
DR   EnsemblGenomes-Tr; EBT00001804950.
DR   EnsemblGenomes-Tr; EBT00001804953.
DR   EnsemblGenomes-Tr; EBT00001804955.
DR   EnsemblGenomes-Tr; EBT00001804957.
DR   EnsemblGenomes-Tr; EBT00001804959.
DR   EnsemblGenomes-Tr; EBT00001804961.
DR   EnsemblGenomes-Tr; EBT00001804963.
DR   EnsemblGenomes-Tr; EBT00001804964.
DR   EnsemblGenomes-Tr; EBT00001804967.
DR   EnsemblGenomes-Tr; EBT00001804969.
DR   EnsemblGenomes-Tr; EBT00001804971.
DR   EnsemblGenomes-Tr; EBT00001804973.
DR   EnsemblGenomes-Tr; EBT00001804975.
DR   EnsemblGenomes-Tr; EBT00001804976.
DR   EnsemblGenomes-Tr; EBT00001804977.
DR   EnsemblGenomes-Tr; EBT00001804979.
DR   EnsemblGenomes-Tr; EBT00001804982.
DR   EnsemblGenomes-Tr; EBT00001804983.
DR   EnsemblGenomes-Tr; EBT00001804984.
DR   EnsemblGenomes-Tr; EBT00001804985.
DR   EnsemblGenomes-Tr; EBT00001804988.
DR   EnsemblGenomes-Tr; EBT00001804990.
DR   EnsemblGenomes-Tr; EBT00001804992.
DR   EnsemblGenomes-Tr; EBT00001804993.
DR   EnsemblGenomes-Tr; EBT00001804994.
DR   EnsemblGenomes-Tr; EBT00001804995.
DR   EnsemblGenomes-Tr; EBT00001804996.
DR   EnsemblGenomes-Tr; EBT00001804998.
DR   EnsemblGenomes-Tr; EBT00001804999.
DR   EnsemblGenomes-Tr; EBT00001805001.
DR   EnsemblGenomes-Tr; EBT00001805003.
DR   EnsemblGenomes-Tr; EBT00001805005.
DR   EnsemblGenomes-Tr; EBT00001805007.
DR   EnsemblGenomes-Tr; EBT00001805008.
DR   EnsemblGenomes-Tr; EBT00001805009.
DR   EnsemblGenomes-Tr; EBT00001805011.
DR   EnsemblGenomes-Tr; EBT00001805013.
DR   EnsemblGenomes-Tr; EBT00001805014.
DR   EnsemblGenomes-Tr; EBT00001805016.
DR   EnsemblGenomes-Tr; EBT00001805019.
DR   EnsemblGenomes-Tr; EBT00001805021.
DR   EnsemblGenomes-Tr; EBT00001805023.
DR   EnsemblGenomes-Tr; EBT00001805025.
DR   EnsemblGenomes-Tr; EBT00001805027.
DR   EnsemblGenomes-Tr; EBT00001805028.
DR   EnsemblGenomes-Tr; EBT00001805029.
DR   EnsemblGenomes-Tr; EBT00001805032.
DR   EnsemblGenomes-Tr; EBT00001805034.
DR   EnsemblGenomes-Tr; EBT00001805036.
DR   EnsemblGenomes-Tr; EBT00001805039.
DR   EnsemblGenomes-Tr; EBT00001805041.
DR   EnsemblGenomes-Tr; EBT00001805043.
DR   EnsemblGenomes-Tr; EBT00001805045.
DR   EnsemblGenomes-Tr; EBT00001805047.
DR   EnsemblGenomes-Tr; EBT00001805049.
DR   EnsemblGenomes-Tr; EBT00001805050.
DR   EnsemblGenomes-Tr; EBT00001805053.
DR   EnsemblGenomes-Tr; EBT00001805055.
DR   EnsemblGenomes-Tr; EBT00001805057.
DR   EnsemblGenomes-Tr; EBT00001805059.
DR   EnsemblGenomes-Tr; EBT00001805061.
DR   EnsemblGenomes-Tr; EBT00001805062.
DR   EnsemblGenomes-Tr; EBT00001805064.
DR   EnsemblGenomes-Tr; EBT00001805067.
DR   EnsemblGenomes-Tr; EBT00001805069.
DR   EnsemblGenomes-Tr; EBT00001805070.
DR   EnsemblGenomes-Tr; EBT00001805072.
DR   EnsemblGenomes-Tr; EBT00001805076.
DR   EnsemblGenomes-Tr; EBT00001805077.
DR   EnsemblGenomes-Tr; EBT00001805078.
DR   EnsemblGenomes-Tr; EBT00001805081.
DR   EnsemblGenomes-Tr; EBT00001805084.
DR   EnsemblGenomes-Tr; EBT00001805086.
DR   EnsemblGenomes-Tr; EBT00001805088.
DR   EnsemblGenomes-Tr; EBT00001805091.
DR   EnsemblGenomes-Tr; EBT00001805093.
DR   EnsemblGenomes-Tr; EBT00001805095.
DR   EnsemblGenomes-Tr; EBT00001805097.
DR   EnsemblGenomes-Tr; EBT00001805099.
DR   EnsemblGenomes-Tr; EBT00001805101.
DR   EnsemblGenomes-Tr; EBT00001805102.
DR   EnsemblGenomes-Tr; EBT00001805103.
DR   EnsemblGenomes-Tr; EBT00001805104.
DR   EnsemblGenomes-Tr; EBT00001805105.
DR   EnsemblGenomes-Tr; EBT00001805106.
DR   EnsemblGenomes-Tr; EBT00001805108.
DR   EnsemblGenomes-Tr; EBT00001805110.
DR   EnsemblGenomes-Tr; EBT00001805111.
DR   EnsemblGenomes-Tr; EBT00001805113.
DR   EnsemblGenomes-Tr; EBT00001805115.
DR   EnsemblGenomes-Tr; EBT00001805116.
DR   EnsemblGenomes-Tr; EBT00001805117.
DR   EnsemblGenomes-Tr; EBT00001805119.
DR   EnsemblGenomes-Tr; EBT00001805120.
DR   EnsemblGenomes-Tr; EBT00001805121.
DR   EnsemblGenomes-Tr; EBT00001805123.
DR   EnsemblGenomes-Tr; EBT00001805124.
DR   EnsemblGenomes-Tr; EBT00001805125.
DR   EnsemblGenomes-Tr; EBT00001805127.
DR   EnsemblGenomes-Tr; EBT00001805130.
DR   EnsemblGenomes-Tr; EBT00001805132.
DR   EnsemblGenomes-Tr; EBT00001805134.
DR   EnsemblGenomes-Tr; EBT00001805135.
DR   EnsemblGenomes-Tr; EBT00001805136.
DR   EnsemblGenomes-Tr; EBT00001805139.
DR   EnsemblGenomes-Tr; EBT00001805141.
DR   EnsemblGenomes-Tr; EBT00001805144.
DR   EnsemblGenomes-Tr; EBT00001805146.
DR   EnsemblGenomes-Tr; EBT00001805147.
DR   EnsemblGenomes-Tr; EBT00001805148.
DR   EnsemblGenomes-Tr; EBT00001805149.
DR   EnsemblGenomes-Tr; EBT00001805151.
DR   EnsemblGenomes-Tr; EBT00001805154.
DR   EnsemblGenomes-Tr; EBT00001805156.
DR   EnsemblGenomes-Tr; EBT00001805158.
DR   EnsemblGenomes-Tr; EBT00001805160.
DR   EnsemblGenomes-Tr; EBT00001805163.
DR   EnsemblGenomes-Tr; EBT00001805167.
DR   EnsemblGenomes-Tr; EBT00001805171.
DR   EnsemblGenomes-Tr; EBT00001805172.
DR   EnsemblGenomes-Tr; EBT00001805174.
DR   EnsemblGenomes-Tr; EBT00001805176.
DR   EnsemblGenomes-Tr; EBT00001805178.
DR   EnsemblGenomes-Tr; EBT00001805180.
DR   EnsemblGenomes-Tr; EBT00001805182.
DR   EnsemblGenomes-Tr; EBT00001805183.
DR   EnsemblGenomes-Tr; EBT00001805184.
DR   EnsemblGenomes-Tr; EBT00001805185.
DR   EnsemblGenomes-Tr; EBT00001805186.
DR   EnsemblGenomes-Tr; EBT00001805187.
DR   EnsemblGenomes-Tr; EBT00001805188.
DR   EnsemblGenomes-Tr; EBT00001805189.
DR   EnsemblGenomes-Tr; EBT00001805190.
DR   EnsemblGenomes-Tr; EBT00001805191.
DR   EnsemblGenomes-Tr; EBT00001805192.
DR   EnsemblGenomes-Tr; EBT00001805193.
DR   EnsemblGenomes-Tr; EBT00001805194.
DR   EnsemblGenomes-Tr; EBT00001805195.
DR   EnsemblGenomes-Tr; EBT00001805196.
DR   EnsemblGenomes-Tr; EBT00001805197.
DR   EnsemblGenomes-Tr; EBT00001805198.
DR   EnsemblGenomes-Tr; EBT00001805199.
DR   EnsemblGenomes-Tr; EBT00001805200.
DR   EnsemblGenomes-Tr; EBT00001805201.
DR   EnsemblGenomes-Tr; EBT00001805202.
DR   EnsemblGenomes-Tr; EBT00001805203.
DR   EnsemblGenomes-Tr; EBT00001805204.
DR   EnsemblGenomes-Tr; EBT00001805205.
DR   EnsemblGenomes-Tr; EBT00001805206.
DR   EnsemblGenomes-Tr; EBT00001805207.
DR   EnsemblGenomes-Tr; EBT00001805208.
DR   EnsemblGenomes-Tr; EBT00001805209.
DR   EnsemblGenomes-Tr; EBT00001805210.
DR   EnsemblGenomes-Tr; EBT00001805211.
DR   EnsemblGenomes-Tr; EBT00001805212.
DR   EnsemblGenomes-Tr; EBT00001805213.
DR   EnsemblGenomes-Tr; EBT00001805214.
DR   EnsemblGenomes-Tr; EBT00001805215.
DR   EnsemblGenomes-Tr; EBT00001805216.
DR   EnsemblGenomes-Tr; EBT00001805217.
DR   EnsemblGenomes-Tr; EBT00001805218.
DR   EnsemblGenomes-Tr; EBT00001805219.
DR   EnsemblGenomes-Tr; EBT00001805220.
DR   EnsemblGenomes-Tr; EBT00001805221.
DR   EnsemblGenomes-Tr; EBT00001805222.
DR   EnsemblGenomes-Tr; EBT00001805223.
DR   EnsemblGenomes-Tr; EBT00001805224.
DR   EnsemblGenomes-Tr; EBT00001805225.
DR   EnsemblGenomes-Tr; EBT00001805226.
DR   EnsemblGenomes-Tr; EBT00001805227.
DR   EnsemblGenomes-Tr; EBT00001805228.
DR   EnsemblGenomes-Tr; EBT00001805229.
DR   EnsemblGenomes-Tr; EBT00001805230.
DR   EnsemblGenomes-Tr; EBT00001805231.
DR   EnsemblGenomes-Tr; EBT00001805232.
DR   EnsemblGenomes-Tr; EBT00001805233.
DR   EnsemblGenomes-Tr; EBT00001805234.
DR   EnsemblGenomes-Tr; EBT00001805235.
DR   EnsemblGenomes-Tr; EBT00001805236.
DR   EnsemblGenomes-Tr; EBT00001805237.
DR   EnsemblGenomes-Tr; EBT00001805238.
DR   EnsemblGenomes-Tr; EBT00001805239.
DR   EnsemblGenomes-Tr; EBT00001805240.
DR   EnsemblGenomes-Tr; EBT00001805241.
DR   EnsemblGenomes-Tr; EBT00001805242.
DR   EnsemblGenomes-Tr; EBT00001805243.
DR   EnsemblGenomes-Tr; EBT00001805244.
DR   EnsemblGenomes-Tr; EBT00001805245.
DR   EnsemblGenomes-Tr; EBT00001805246.
DR   EnsemblGenomes-Tr; EBT00001805247.
DR   EnsemblGenomes-Tr; EBT00001805248.
DR   EnsemblGenomes-Tr; EBT00001805249.
DR   EnsemblGenomes-Tr; EBT00001805250.
DR   EnsemblGenomes-Tr; EBT00001805251.
DR   EnsemblGenomes-Tr; EBT00001805252.
DR   EnsemblGenomes-Tr; EBT00001805253.
DR   EnsemblGenomes-Tr; EBT00001805254.
DR   EnsemblGenomes-Tr; EBT00001805255.
DR   EnsemblGenomes-Tr; EBT00001805256.
DR   EnsemblGenomes-Tr; EBT00001805257.
DR   EnsemblGenomes-Tr; EBT00001805258.
DR   EnsemblGenomes-Tr; EBT00001805259.
DR   EnsemblGenomes-Tr; EBT00001805260.
DR   EnsemblGenomes-Tr; EBT00001805261.
DR   EnsemblGenomes-Tr; EBT00001805262.
DR   EnsemblGenomes-Tr; EBT00001805263.
DR   EnsemblGenomes-Tr; EBT00001805264.
DR   EnsemblGenomes-Tr; ECO26_0019.
DR   EnsemblGenomes-Tr; ECO26_0020.
DR   EnsemblGenomes-Tr; ECO26_0021.
DR   EnsemblGenomes-Tr; ECO26_0137.
DR   EnsemblGenomes-Tr; ECO26_0138.
DR   EnsemblGenomes-Tr; ECO26_0197.
DR   EnsemblGenomes-Tr; ECO26_0198.
DR   EnsemblGenomes-Tr; ECO26_0221.
DR   EnsemblGenomes-Tr; ECO26_0222.
DR   EnsemblGenomes-Tr; ECO26_0226.
DR   EnsemblGenomes-Tr; ECO26_0227.
DR   EnsemblGenomes-Tr; ECO26_0229.
DR   EnsemblGenomes-Tr; ECO26_0233.
DR   EnsemblGenomes-Tr; ECO26_0234.
DR   EnsemblGenomes-Tr; ECO26_0241.
DR   EnsemblGenomes-Tr; ECO26_0261.
DR   EnsemblGenomes-Tr; ECO26_0262.
DR   EnsemblGenomes-Tr; ECO26_0317.
DR   EnsemblGenomes-Tr; ECO26_0351.
DR   EnsemblGenomes-Tr; ECO26_0352.
DR   EnsemblGenomes-Tr; ECO26_0404.
DR   EnsemblGenomes-Tr; ECO26_0405.
DR   EnsemblGenomes-Tr; ECO26_0406.
DR   EnsemblGenomes-Tr; ECO26_0407.
DR   EnsemblGenomes-Tr; ECO26_0425.
DR   EnsemblGenomes-Tr; ECO26_0532.
DR   EnsemblGenomes-Tr; ECO26_0533.
DR   EnsemblGenomes-Tr; ECO26_0534.
DR   EnsemblGenomes-Tr; ECO26_0545.
DR   EnsemblGenomes-Tr; ECO26_0546.
DR   EnsemblGenomes-Tr; ECO26_0605.
DR   EnsemblGenomes-Tr; ECO26_0609.
DR   EnsemblGenomes-Tr; ECO26_0629.
DR   EnsemblGenomes-Tr; ECO26_0637.
DR   EnsemblGenomes-Tr; ECO26_0639.
DR   EnsemblGenomes-Tr; ECO26_0720.
DR   EnsemblGenomes-Tr; ECO26_0721.
DR   EnsemblGenomes-Tr; ECO26_0765.
DR   EnsemblGenomes-Tr; ECO26_0767.
DR   EnsemblGenomes-Tr; ECO26_0840.
DR   EnsemblGenomes-Tr; ECO26_0844.
DR   EnsemblGenomes-Tr; ECO26_0845.
DR   EnsemblGenomes-Tr; ECO26_0846.
DR   EnsemblGenomes-Tr; ECO26_0872.
DR   EnsemblGenomes-Tr; ECO26_0876.
DR   EnsemblGenomes-Tr; ECO26_0888.
DR   EnsemblGenomes-Tr; ECO26_0890.
DR   EnsemblGenomes-Tr; ECO26_0891.
DR   EnsemblGenomes-Tr; ECO26_1163.
DR   EnsemblGenomes-Tr; ECO26_1164.
DR   EnsemblGenomes-Tr; ECO26_1165.
DR   EnsemblGenomes-Tr; ECO26_1168.
DR   EnsemblGenomes-Tr; ECO26_1257.
DR   EnsemblGenomes-Tr; ECO26_1269.
DR   EnsemblGenomes-Tr; ECO26_1271.
DR   EnsemblGenomes-Tr; ECO26_1286.
DR   EnsemblGenomes-Tr; ECO26_1287.
DR   EnsemblGenomes-Tr; ECO26_1288.
DR   EnsemblGenomes-Tr; ECO26_1294.
DR   EnsemblGenomes-Tr; ECO26_1325.
DR   EnsemblGenomes-Tr; ECO26_1336.
DR   EnsemblGenomes-Tr; ECO26_1337.
DR   EnsemblGenomes-Tr; ECO26_1369.
DR   EnsemblGenomes-Tr; ECO26_1533.
DR   EnsemblGenomes-Tr; ECO26_1559.
DR   EnsemblGenomes-Tr; ECO26_1751.
DR   EnsemblGenomes-Tr; ECO26_1785.
DR   EnsemblGenomes-Tr; ECO26_1786.
DR   EnsemblGenomes-Tr; ECO26_1795.
DR   EnsemblGenomes-Tr; ECO26_1796.
DR   EnsemblGenomes-Tr; ECO26_1802.
DR   EnsemblGenomes-Tr; ECO26_1804.
DR   EnsemblGenomes-Tr; ECO26_1807.
DR   EnsemblGenomes-Tr; ECO26_1808.
DR   EnsemblGenomes-Tr; ECO26_1809.
DR   EnsemblGenomes-Tr; ECO26_1812.
DR   EnsemblGenomes-Tr; ECO26_1813.
DR   EnsemblGenomes-Tr; ECO26_1818.
DR   EnsemblGenomes-Tr; ECO26_1819.
DR   EnsemblGenomes-Tr; ECO26_1821.
DR   EnsemblGenomes-Tr; ECO26_1841.
DR   EnsemblGenomes-Tr; ECO26_1876.
DR   EnsemblGenomes-Tr; ECO26_1877.
DR   EnsemblGenomes-Tr; ECO26_1917.
DR   EnsemblGenomes-Tr; ECO26_1935.
DR   EnsemblGenomes-Tr; ECO26_1944.
DR   EnsemblGenomes-Tr; ECO26_2030.
DR   EnsemblGenomes-Tr; ECO26_2037.
DR   EnsemblGenomes-Tr; ECO26_2038.
DR   EnsemblGenomes-Tr; ECO26_2059.
DR   EnsemblGenomes-Tr; ECO26_2060.
DR   EnsemblGenomes-Tr; ECO26_2081.
DR   EnsemblGenomes-Tr; ECO26_2106.
DR   EnsemblGenomes-Tr; ECO26_2109.
DR   EnsemblGenomes-Tr; ECO26_2110.
DR   EnsemblGenomes-Tr; ECO26_2112.
DR   EnsemblGenomes-Tr; ECO26_2113.
DR   EnsemblGenomes-Tr; ECO26_2119.
DR   EnsemblGenomes-Tr; ECO26_2120.
DR   EnsemblGenomes-Tr; ECO26_2128.
DR   EnsemblGenomes-Tr; ECO26_2129.
DR   EnsemblGenomes-Tr; ECO26_2143.
DR   EnsemblGenomes-Tr; ECO26_2146.
DR   EnsemblGenomes-Tr; ECO26_2153.
DR   EnsemblGenomes-Tr; ECO26_2154.
DR   EnsemblGenomes-Tr; ECO26_2155.
DR   EnsemblGenomes-Tr; ECO26_2209.
DR   EnsemblGenomes-Tr; ECO26_2213.
DR   EnsemblGenomes-Tr; ECO26_2214.
DR   EnsemblGenomes-Tr; ECO26_2215.
DR   EnsemblGenomes-Tr; ECO26_2219.
DR   EnsemblGenomes-Tr; ECO26_2233.
DR   EnsemblGenomes-Tr; ECO26_2234.
DR   EnsemblGenomes-Tr; ECO26_2289.
DR   EnsemblGenomes-Tr; ECO26_2290.
DR   EnsemblGenomes-Tr; ECO26_2305.
DR   EnsemblGenomes-Tr; ECO26_2329.
DR   EnsemblGenomes-Tr; ECO26_2422.
DR   EnsemblGenomes-Tr; ECO26_2423.
DR   EnsemblGenomes-Tr; ECO26_2492.
DR   EnsemblGenomes-Tr; ECO26_2493.
DR   EnsemblGenomes-Tr; ECO26_2503.
DR   EnsemblGenomes-Tr; ECO26_2504.
DR   EnsemblGenomes-Tr; ECO26_2645.
DR   EnsemblGenomes-Tr; ECO26_2660.
DR   EnsemblGenomes-Tr; ECO26_2846.
DR   EnsemblGenomes-Tr; ECO26_2848.
DR   EnsemblGenomes-Tr; ECO26_2851.
DR   EnsemblGenomes-Tr; ECO26_2859.
DR   EnsemblGenomes-Tr; ECO26_2870.
DR   EnsemblGenomes-Tr; ECO26_2871.
DR   EnsemblGenomes-Tr; ECO26_2872.
DR   EnsemblGenomes-Tr; ECO26_2878.
DR   EnsemblGenomes-Tr; ECO26_2884.
DR   EnsemblGenomes-Tr; ECO26_2886.
DR   EnsemblGenomes-Tr; ECO26_2887.
DR   EnsemblGenomes-Tr; ECO26_2892.
DR   EnsemblGenomes-Tr; ECO26_2895.
DR   EnsemblGenomes-Tr; ECO26_2899.
DR   EnsemblGenomes-Tr; ECO26_2906.
DR   EnsemblGenomes-Tr; ECO26_2915.
DR   EnsemblGenomes-Tr; ECO26_2978.
DR   EnsemblGenomes-Tr; ECO26_2979.
DR   EnsemblGenomes-Tr; ECO26_2982.
DR   EnsemblGenomes-Tr; ECO26_2983.
DR   EnsemblGenomes-Tr; ECO26_2999.
DR   EnsemblGenomes-Tr; ECO26_3000.
DR   EnsemblGenomes-Tr; ECO26_3024.
DR   EnsemblGenomes-Tr; ECO26_3032.
DR   EnsemblGenomes-Tr; ECO26_3035.
DR   EnsemblGenomes-Tr; ECO26_3036.
DR   EnsemblGenomes-Tr; ECO26_3040.
DR   EnsemblGenomes-Tr; ECO26_3154.
DR   EnsemblGenomes-Tr; ECO26_3176.
DR   EnsemblGenomes-Tr; ECO26_3177.
DR   EnsemblGenomes-Tr; ECO26_3222.
DR   EnsemblGenomes-Tr; ECO26_3238.
DR   EnsemblGenomes-Tr; ECO26_3380.
DR   EnsemblGenomes-Tr; ECO26_3394.
DR   EnsemblGenomes-Tr; ECO26_3395.
DR   EnsemblGenomes-Tr; ECO26_3396.
DR   EnsemblGenomes-Tr; ECO26_3397.
DR   EnsemblGenomes-Tr; ECO26_3407.
DR   EnsemblGenomes-Tr; ECO26_3425.
DR   EnsemblGenomes-Tr; ECO26_3535.
DR   EnsemblGenomes-Tr; ECO26_3536.
DR   EnsemblGenomes-Tr; ECO26_3662.
DR   EnsemblGenomes-Tr; ECO26_3723.
DR   EnsemblGenomes-Tr; ECO26_3724.
DR   EnsemblGenomes-Tr; ECO26_3725.
DR   EnsemblGenomes-Tr; ECO26_3727.
DR   EnsemblGenomes-Tr; ECO26_3830.
DR   EnsemblGenomes-Tr; ECO26_3831.
DR   EnsemblGenomes-Tr; ECO26_3928.
DR   EnsemblGenomes-Tr; ECO26_3929.
DR   EnsemblGenomes-Tr; ECO26_3937.
DR   EnsemblGenomes-Tr; ECO26_3938.
DR   EnsemblGenomes-Tr; ECO26_3942.
DR   EnsemblGenomes-Tr; ECO26_3943.
DR   EnsemblGenomes-Tr; ECO26_4070.
DR   EnsemblGenomes-Tr; ECO26_4072.
DR   EnsemblGenomes-Tr; ECO26_4148.
DR   EnsemblGenomes-Tr; ECO26_4149.
DR   EnsemblGenomes-Tr; ECO26_4152.
DR   EnsemblGenomes-Tr; ECO26_4153.
DR   EnsemblGenomes-Tr; ECO26_4181.
DR   EnsemblGenomes-Tr; ECO26_4182.
DR   EnsemblGenomes-Tr; ECO26_4185.
DR   EnsemblGenomes-Tr; ECO26_4188.
DR   EnsemblGenomes-Tr; ECO26_4189.
DR   EnsemblGenomes-Tr; ECO26_4318.
DR   EnsemblGenomes-Tr; ECO26_4319.
DR   EnsemblGenomes-Tr; ECO26_4375.
DR   EnsemblGenomes-Tr; ECO26_4378.
DR   EnsemblGenomes-Tr; ECO26_4571.
DR   EnsemblGenomes-Tr; ECO26_4572.
DR   EnsemblGenomes-Tr; ECO26_4594.
DR   EnsemblGenomes-Tr; ECO26_4595.
DR   EnsemblGenomes-Tr; ECO26_4596.
DR   EnsemblGenomes-Tr; ECO26_4679.
DR   EnsemblGenomes-Tr; ECO26_4680.
DR   EnsemblGenomes-Tr; ECO26_4727.
DR   EnsemblGenomes-Tr; ECO26_4729.
DR   EnsemblGenomes-Tr; ECO26_4730.
DR   EnsemblGenomes-Tr; ECO26_4768.
DR   EnsemblGenomes-Tr; ECO26_4788.
DR   EnsemblGenomes-Tr; ECO26_4890.
DR   EnsemblGenomes-Tr; ECO26_4901.
DR   EnsemblGenomes-Tr; ECO26_5003.
DR   EnsemblGenomes-Tr; ECO26_5006.
DR   EnsemblGenomes-Tr; ECO26_5064.
DR   EnsemblGenomes-Tr; ECO26_5065.
DR   EnsemblGenomes-Tr; ECO26_5121.
DR   EnsemblGenomes-Tr; ECO26_5127.
DR   EnsemblGenomes-Tr; ECO26_5128.
DR   EnsemblGenomes-Tr; ECO26_5147.
DR   EnsemblGenomes-Tr; ECO26_5148.
DR   EnsemblGenomes-Tr; ECO26_5153.
DR   EnsemblGenomes-Tr; ECO26_5154.
DR   EnsemblGenomes-Tr; ECO26_5183.
DR   EnsemblGenomes-Tr; ECO26_5184.
DR   EnsemblGenomes-Tr; ECO26_5246.
DR   EnsemblGenomes-Tr; ECO26_5290.
DR   EnsemblGenomes-Tr; ECO26_5292.
DR   EnsemblGenomes-Tr; ECO26_5297.
DR   EnsemblGenomes-Tr; ECO26_5299.
DR   EnsemblGenomes-Tr; ECO26_5361.
DR   EnsemblGenomes-Tr; ECO26_5362.
DR   EnsemblGenomes-Tr; ECO26_5410.
DR   EnsemblGenomes-Tr; ECO26_5426.
DR   EnsemblGenomes-Tr; ECO26_5427.
DR   EnsemblGenomes-Tr; ECO26_5450.
DR   EnsemblGenomes-Tr; ECO26_5453.
DR   EnsemblGenomes-Tr; ECO26_5463.
DR   EnsemblGenomes-Tr; ECO26_5464.
DR   EnsemblGenomes-Tr; ECO26_5467.
DR   EnsemblGenomes-Tr; ECO26_5479.
DR   EnsemblGenomes-Tr; ECO26_5483.
DR   EnsemblGenomes-Tr; ECO26_5488.
DR   EnsemblGenomes-Tr; ECO26_5489.
DR   EnsemblGenomes-Tr; ECO26_5501.
DR   EnsemblGenomes-Tr; ECO26_5504.
DR   EnsemblGenomes-Tr; ECO26_5529.
DR   EnsemblGenomes-Tr; ECO26_5538.
DR   EnsemblGenomes-Tr; ECO26_5588.
DR   EnsemblGenomes-Tr; ECO26_ncRNA01-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA02-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA03-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA04-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA05-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA06-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA07-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA08-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA09-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA10-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA11-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA12-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA13-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA14-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA15-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA16-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA17-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA18-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA19-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA20-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA21-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA22-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA23-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA24-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA25-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA26-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA27-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA28-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA29-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA30-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA31-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA32-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA33-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA34-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA35-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA36-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA37-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA38-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA39-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA40-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA41-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA42-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA43-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA44-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA45-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA46-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA47-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA48-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA49-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA50-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA51-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA52-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA53-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA54-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA55-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA56-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA57-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA58-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA59-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA60-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA61-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA62-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA63-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA64-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA65-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA66-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA67-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA68-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA69-1.
DR   EnsemblGenomes-Tr; ECO26_ncRNA70-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA01-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA02-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA03-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA04-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA05-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA06-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA07-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA08-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA09-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA10-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA11-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA12-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA13-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA14-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA15-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA16-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA17-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA18-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA19-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA20-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA21-1.
DR   EnsemblGenomes-Tr; ECO26_rRNA22-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA001-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA002-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA003-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA004-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA005-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA006-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA007-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA008-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA009-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA010-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA011-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA012-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA013-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA014-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA015-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA016-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA017-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA018-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA019-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA020-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA021-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA022-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA023-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA024-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA025-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA026-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA027-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA028-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA029-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA030-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA031-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA032-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA033-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA034-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA035-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA036-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA037-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA038-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA039-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA040-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA041-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA042-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA043-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA044-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA045-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA046-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA047-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA048-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA049-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA050-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA051-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA052-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA053-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA054-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA055-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA056-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA057-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA058-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA059-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA060-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA061-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA062-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA063-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA064-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA065-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA066-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA067-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA068-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA069-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA070-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA071-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA072-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA073-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA074-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA075-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA076-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA077-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA078-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA079-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA080-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA081-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA082-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA083-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA084-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA085-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA086-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA087-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA088-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA089-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA090-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA091-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA092-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA093-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA094-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA095-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA096-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA097-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA098-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA099-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA100-1.
DR   EnsemblGenomes-Tr; ECO26_tRNA101-1.
DR   EuropePMC; PMC2764950; 19815525.
DR   EuropePMC; PMC3067419; 21317253.
DR   EuropePMC; PMC3158064; 21876740.
DR   EuropePMC; PMC3233075; 22003022.
DR   EuropePMC; PMC3273018; 22179243.
DR   EuropePMC; PMC3421808; 22718945.
DR   EuropePMC; PMC3503007; 23035199.
DR   EuropePMC; PMC3584874; 23275093.
DR   EuropePMC; PMC3641635; 23493634.
DR   EuropePMC; PMC3900561; 24466152.
DR   EuropePMC; PMC4001111; 24742173.
DR   EuropePMC; PMC4087235; 24675834.
DR   EuropePMC; PMC4172979; 25276419.
DR   EuropePMC; PMC4209514; 25349632.
DR   EuropePMC; PMC4384309; 25888127.
DR   EuropePMC; PMC4399054; 25667270.
DR   EuropePMC; PMC4609730; 26292302.
DR   EuropePMC; PMC4711113; 26567298.
DR   EuropePMC; PMC5322567; 28230102.
DR   EuropePMC; PMC5382810; 28663823.
DR   EuropePMC; PMC5753637; 29149094.
DR   EuropePMC; PMC6119250; 30170539.
DR   EuropePMC; PMC6267907; 30497396.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00039; DicF.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00113; QUAD.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00116; C0465.
DR   RFAM; RF00117; C0719.
DR   RFAM; RF00118; rydB.
DR   RFAM; RF00119; C0299.
DR   RFAM; RF00121; MicC.
DR   RFAM; RF00122; GadY.
DR   RFAM; RF00124; IS102.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00372; sroH.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00505; RydC.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01407; STnc560.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01804; Lambda_thermo.
DR   RFAM; RF01809; symR.
DR   RFAM; RF01813; rdlD.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02052; STnc630.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02060; STnc410.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02068; STnc480.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02082; STnc540.
DR   RFAM; RF02083; OrzO-P.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02111; IS009.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; AP010953.
DR   SILVA-SSU; AP010953.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5697240
FT                   /organism="Escherichia coli O26:H11 str. 11368"
FT                   /strain="11368"
FT                   /mol_type="genomic DNA"
FT                   /serovar="O26:H11"
FT                   /note="enteropathogenic Escherichia coli"
FT                   /db_xref="taxon:573235"
FT   CDS_pept        190..255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrL"
FT                   /locus_tag="ECO26_0001"
FT                   /product="thr operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23365"
FT                   /protein_id="BAI23365.1"
FT                   /translation="MKRISTTIITTITITTGNGAG"
FT   CDS_pept        337..2799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="ECO26_0002"
FT                   /product="fused aspartokinase I and homoserine
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23366"
FT                   /protein_id="BAI23366.1"
FT                   /translation="MRVLKFGGTSVANAERFLRVADILESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTISGQDALPNISDAERIFAELLTGLAAAQPGFPLAQLKTFVDQEFAQIKHV
FT                   LHGISLLGQCPDSINAALICRGEKMSIAIMAGVLEARGHNVTVIDPVEKLLAVGHYLES
FT                   TVDIAESTRRIAASRIPADHMVLMAGFTAGNEKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTITPIAQFQIPCL
FT                   IKNTGNPQAPGTLIGASRDEDELPVKGISNLNNMAMFSVSGPGMKGMVGMAARVFAAMS
FT                   RARISVVLITQSSSEYSISFCVPQSDCVRAERAMQEEFYLELKEGLLEPLAVTERLAII
FT                   SVVGDGMRTLRGISAKFFAALARANINIVAIAQGSSERSISVVVNNDDATTGVRVTHQM
FT                   LFNTDQVIEVFVIGVGGVGGALLEQLKRQQSWLKNKHIDLRVCGVANSKALLTNVHGLN
FT                   LENWQEELAQAKEPFNLGRLIRLVKEYHLLNPVIVDCTSSQAVADQYADFLREGFHVVT
FT                   PNKKANTSSMDYYHLLRHAAEKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELMKFSGI
FT                   LSGSLSYIFGKLDEGMSFSEATTLAREMGYTEPDPRDDLSGMDVARKLLILARETGREL
FT                   ELADIEIEPVLPAEFNAEGDVAAFMANLSQLDDRFAARVAKARDEGKVLRYVGNIDEDG
FT                   VCRVKIAEVDGNDPLFKVKNGENALAFYSHYYQPLPLVLRGYGAGNDVTAAGVFADLLR
FT                   TLSWKLGV"
FT   CDS_pept        2801..3733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="ECO26_0003"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23367"
FT                   /protein_id="BAI23367.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAEIFS
FT                   LNNLGRFADKLPSEPRENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALMAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELA
FT                   AKLMKDVIAEPYRERLLPGFRQARQAVAEIGAVASGISGSGPTLFALCDKPDTAQRVAD
FT                   WLGKNYLQNQEGFVHICRLDTAGARVLEN"
FT   CDS_pept        3734..5020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="ECO26_0004"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23368"
FT                   /protein_id="BAI23368.1"
FT                   /translation="MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDE
FT                   MLKLDFVTRSAKILSAFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTL
FT                   AFKDFGGRFMAQMLTHIAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKIS
FT                   PLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQ
FT                   ICYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPR
FT                   FLHDGQWSPKATQATLSNAMDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTM
FT                   RELKELGYTSEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKE
FT                   LAERADLPLLSHNLPADFAALRKLMMNHQ"
FT   CDS_pept        5234..5530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaX"
FT                   /locus_tag="ECO26_0005"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23369"
FT                   /protein_id="BAI23369.1"
FT                   /translation="MKKMQSIVLALSLVLVAPMAAQAAEITLVPSVKLQIGDRDNRGYY
FT                   WDGGHWRDHGWWKQHYEWRGNRWHPHGPPPPPRHHKKAHHDHHGGHGPGKHHR"
FT   CDS_pept        complement(5683..6459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="ECO26_0006"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23370"
FT                   /protein_id="BAI23370.1"
FT                   /translation="MLILISPAKTLDYQSPLTTTRYTLPELLDNSQQLIHEARKLTPPQ
FT                   ISTLMRISDKLAGINAARFHDWQPDFTPENARQAILAFKGDVYTGLQAETFSEDDFDFA
FT                   QQHLRMLSGLYGVLRPLDLMQPYRLEMGIRLENARGKDLYQFWGDIITNKLNEALAAQG
FT                   DNVVINLASDEYFKSVKPKKLNAEIIKPVFLDEKNGKFKIISFYAKKARGLMSRFIIEN
FT                   RLTKPEQLTGFNSEGYFFDEASSSNGELVFKRYEQR"
FT   CDS_pept        complement(6529..7959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="ECO26_0007"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23371"
FT                   /protein_id="BAI23371.1"
FT                   /translation="MPDFFSFINSVLWGSVMIYLLFGAGCWFTFRTGFVQFRYIRQFGK
FT                   SLKNSIHPQPGGLTSFQSLCTSLAARVGSGNLAGVALAITAGGPGAVFWMWVAAFIGMA
FT                   TSFAECSLAQLYKERDANGQFRGGPAWYMARGLGMRWMGVLFAVFLLIAYGIIFSGIQA
FT                   NAVARALSFSFDFPPLVTGIILAVFALLAITRGLHGVARLMQGFVPLMAIIWVLTSLVI
FT                   CVMNIGQLPHVIWSIFESAFGWQEAAGGAAGYTLSQAITNGFQRSMFSNEAGMGSTPNA
FT                   AAAAASWPPHPAAQGIVQMIGIFIDTLVICTASAMLILLAGNGTTYMPLEGIQLIQKAM
FT                   RVLMGSWGAEFVTLVVILFAFSSIVANYIYAENNLFFLRLNNPKAIWCLRICTFATVIG
FT                   GTLLSLPLMWQLADIIMACMAITNLTAILLLSPVVHTIASDYLRQRKLGVRPVFDPLRY
FT                   PDIGRQLSPDAWDDVSQE"
FT   CDS_pept        8238..9191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talB"
FT                   /locus_tag="ECO26_0008"
FT                   /product="transaldolase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23372"
FT                   /protein_id="BAI23372.1"
FT                   /translation="MTDKLTSLRQYTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRKLIDDAVAWAKQQSNDRAQQIVDATDKLAVNIGLEILKLVPGRISTEVDARLSYD
FT                   TEASIAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANTDKKEYAPAEDPGVVSVSEIYQYYKEHGYETVV
FT                   MGASFRNIGEILELAGCDRLTIAPTLLKELAESEGAIERKLSYTGEVKARPARITESEF
FT                   LWQHNQDPMAVDKLAEGIRKFAIDQEKLEKMIGDLL"
FT   CDS_pept        9306..9893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mog"
FT                   /locus_tag="ECO26_0009"
FT                   /product="predicted molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23373"
FT                   /protein_id="BAI23373.1"
FT                   /translation="MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETR
FT                   LIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAAGNVVVHGIFASVP
FT                   YCIQLLEGPYVETAPEVVAAFRPKSARRDVSE"
FT   CDS_pept        complement(9928..10494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaH"
FT                   /locus_tag="ECO26_0010"
FT                   /product="conserved predicted inner membrane protein"
FT                   /note="associated with acetate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23374"
FT                   /protein_id="BAI23374.1"
FT                   /translation="MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFY
FT                   GGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLG
FT                   LWGVFTLFMFFGTLKGARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGAS
FT                   AIYLAMGEVLNEQFGRTVLPIGESH"
FT   CDS_pept        complement(10643..11356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECO26_0011"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23375"
FT                   /protein_id="BAI23375.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKNMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
FT   CDS_pept        complement(11382..11786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECO26_0012"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23376"
FT                   /protein_id="BAI23376.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
FT   CDS_pept        12163..14079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ECO26_0013"
FT                   /product="chaperone Hsp70"
FT                   /note="co-chaperone with DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23377"
FT                   /protein_id="BAI23377.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVE
FT                   VKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILV
FT                   GGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFN
FT                   LDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVR
FT                   DAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETAL
FT                   KGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVK
FT                   DKK"
FT   CDS_pept        14168..15298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ECO26_0014"
FT                   /product="chaperone Hsp40"
FT                   /note="co-chaperone with DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23378"
FT                   /protein_id="BAI23378.1"
FT                   /translation="MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEA
FT                   KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGG
FT                   GRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPT
FT                   CHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDT
FT                   GDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIE
FT                   VPTLDGRVKLKVPGETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNEKQKQL
FT                   LQELQESFGGPTGEHNSPRSKSFFDGVKKFFDDLTR"
FT   CDS_pept        complement(15402..15611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECO26_0015"
FT                   /product="regulatory protein MokC for HokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23379"
FT                   /protein_id="BAI23379.1"
FT                   /translation="MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTR
FT                   KDLCEVHIRTGQTEVAVFTAYESE"
FT   CDS_pept        complement(15402..15554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokC1"
FT                   /locus_tag="ECO26_0016"
FT                   /product="small toxic membrane peptide HokC"
FT                   /note="small toxic membrane polypeptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23380"
FT                   /protein_id="BAI23380.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFT
FT                   AYESE"
FT   CDS_pept        16140..17306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ECO26_0017"
FT                   /product="sodium-proton antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23381"
FT                   /protein_id="BAI23381.1"
FT                   /translation="MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETP
FT                   VQLRVGSLEINKNMLLWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGG
FT                   MIVPALLYLAFNYADPITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIID
FT                   DLGAIIIIALFYTNDLSMASLGVAAVAIAVLAVLNLCGVRRTGVYILVGVVLWTAVLKS
FT                   GVHATLAGVIVGFFIPLKEKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTL
FT                   DGLTSILPLGIIAGLLIGKPLGISLFCWLALRLKLAHLPEGTTYQQIMAVGILCGIGFT
FT                   MSIFIASLAFGSVDPELINWAKLGILVGSISSAVIGYSWLRVRLRPSV"
FT   CDS_pept        17366..18271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaR"
FT                   /locus_tag="ECO26_0018"
FT                   /product="DNA-binding transcriptional activator NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23382"
FT                   /protein_id="BAI23382.1"
FT                   /translation="MSMSHINYNHLYYFWHVYKEGSVVGAAEALYLTPQTITGQIRALE
FT                   ERLQGKLFKRKGRGLEPSELGELVYRYADKMFTLSQEMLDIVNYRKESNLLFDVGVADA
FT                   LSKRLVSSVLNAAVVEGEPIHLRCFESTHEMLLEQLSQHKLDMIISDCPIDSTQQEGLF
FT                   SVRIGECGVSFWCTNPPPEKPFPACLEERRLLIPGRRSMLGRKLLNWFNSQGLNVEILG
FT                   EFDDAALMKAFGAMHNAIFVAPTLYAYDFYADKTVVEIGRVENVMEEYHAIFAERMIQH
FT                   PAVQRICNTDYSALFSPAAR"
FT   CDS_pept        complement(18310..18837)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0019"
FT                   /note="conserved predicted protein, C-terminal part"
FT   CDS_pept        complement(18944..19269)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0020"
FT                   /note="conserved predicted protein (pseudogene by a frame
FT                   shift mutation)"
FT   CDS_pept        complement(19282..20427)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0021"
FT                   /note="putative outer membrane usher protein precursor,
FT                   C-terminal part"
FT   CDS_pept        complement(20868..22289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0022"
FT                   /product="T3SS effector-like protein EspX-homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23383"
FT                   /protein_id="BAI23383.1"
FT                   /translation="MTNGISTSPHCLYKSNIVDDVIINKTRQNELVKVFCEYKTEFLIL
FT                   FDDFFRSHNLPKPSPVLHHFFQYTHLRDAYFYRCKLIEHTVQFYFFKHKGITLLRLDVF
FT                   DDRTSECLSEEIKIYQECHEKFVNFLKANFNQEIYPQLYTPEIFYEACRNLQSFYDHQE
FT                   TSQNAKYSAIDKKKSHLNQEIKKLIKKNIFPELYNEQCNKIPSSSIDDNQGIMWQNFKT
FT                   SNIAYSQLCKKLSLFKSIPSRLIKKSAYCSTENTITNKFDVVFSYCGNNVKEFILLLPY
FT                   NKSLEMHELNEQNIQYLTALNINIHKMLLSNITIEKSDLSYGYYFGCVLSNILCFESDL
FT                   SNTIFSNGEINNLFIKKSNIFGASFTNTRIKNLLCEDIMPGRWTTQLVNKHLGYRYTGV
FT                   FKTLASIDDKPSRFEILIPLVQTLVRDNVKLNNDVYKELNKFMHDYDKTSSEMRKYLKS
FT                   INECMFLMKNIAHQN"
FT   CDS_pept        complement(22773..23036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="ECO26_0023"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23384"
FT                   /protein_id="BAI23384.1"
FT                   /translation="MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKA
FT                   AAQKAFNEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA"
FT   CDS_pept        23139..23357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="ECO26_0024"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23385"
FT                   /protein_id="BAI23385.1"
FT                   /translation="MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGHFLPVICAMAMKS
FT                   HFFLISVLNRRLTLTAVQGILGRFSLF"
FT   CDS_pept        23365..24306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="ECO26_0025"
FT                   /product="bifunctional riboflavin kinase and FAD
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23386"
FT                   /protein_id="BAI23386.1"
FT                   /translation="MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRK
FT                   RNLPVMVMLFEPQPLELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTA
FT                   QNFISDLLVKHLRVKFLAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVR
FT                   ISSTAVRQALADDNLALAESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVK
FT                   GVYAVEVLGLGEKPLPGVANIGTRPTVAGIRQQLEVHLLGVAMDLYGRHIQVVLRKKIR
FT                   NEQRFASLDELKAQIARDELTAREFFGLTKPA"
FT   CDS_pept        24349..27165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="ECO26_0026"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23387"
FT                   /protein_id="BAI23387.1"
FT                   /translation="MSDYKSTLNLPETGFPMRGDLAKREPGMLARWTDDDLYGIIRAAK
FT                   KGKKTFILHDGPPYANGSIHIGHSVNKILKDIIVKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQEYGKPGEKFTAAEFRAKCREYAATQVDGQRKDFIRLGVLGDWSHPYLTMDFKTEA
FT                   NIIRALGKIIGNGHLHKGAKPVHWCVDCRSALAEAEVEYYDKTSPSIDVAFQAVDQDAL
FT                   KAKFAVSNVNGPISLVIWTTTPWTLPANRAISIAPDFDYALVQIDGQAVILAKDLVESV
FT                   MQRIGVTDYTILGTVKGAELELLRFTHPFMGFDVPAILGDHVTLDAGTGAVHTAPGHGP
FT                   DDYVIGQKYGLETANPVGPDGTYLPGTYPTLDGVNVFKANDIVVALLQEKGALLHVEKM
FT                   QHSYPCCWRHKTPIIFRATPQWFVSMDQKGLRAQSLKEIKGVQWIPDWGQARIESMVAN
FT                   RPDWCISRQRTWGVPMSLFVHKDTEELHPRTLELMEEVAKRVEVDGIQAWWDLDAKEIL
FT                   GDEADQYVKVPDTLDVWFDSGSTHSSVVDVRPEFAGHAADMYLEGSDQHRGWFMSSLMI
FT                   STAMKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMNKLGADILRLWVASTDYT
FT                   GEMAVSDEILKRAADSYRRIRNTARFLLANLNGFDPAKDMVKPEEMVVLDRWAVGCAKA
FT                   AQEDILKAYEAYDFHEVVQRLMRFCSVEMGSFYLDIIKDRQYTAKADSVARRSCQTALY
FT                   HIAEALVRWMAPILSFTADEVWGYLPGEREKYVFTGEWYEGLFGLADSEAMNDAFWDEL
FT                   LKVRGEVNKVIEQARADKKVGGSLEAAVTLYAEPELAAKLTALGDELRFVLLTSGATVA
FT                   DYNDAPADAQQSEVLKGLKVALSKAEGEKCPRCWHYTQDVGKVAEHAEICGRCVSNVAG
FT                   DGEKRKFA"
FT   CDS_pept        27165..27659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="ECO26_0027"
FT                   /product="prolipoprotein signal peptidase"
FT                   /note="signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23388"
FT                   /protein_id="BAI23388.1"
FT                   /translation="MSQSICSTGLRWLWLVVVVLIIDLGSKYLILQNFALGDTVPLFPS
FT                   LNLHYARNYGAAFSFLADSGGWQRWFFAGIAIGISVILAVMMYRSKATQKLNNIAYALI
FT                   IGGALGNLFDRLWHGFVVDMIDFYVGDWHFATFNLADTAICVGAALIVLEGFLPSKAKK
FT                   Q"
FT   CDS_pept        27747..28196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fkpB"
FT                   /locus_tag="ECO26_0028"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="rotamase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23389"
FT                   /protein_id="BAI23389.1"
FT                   /translation="MSESVQSNSAVLVHFTLKLDDGTTAESTRNNGKPALFRLGDASLS
FT                   EGLEQHLLGLKVGDKTTFSLEPDAAFGVPSPDLIQYFSRREFMDAGEPEIGAIMLFTAM
FT                   DGSEMPGVIREINGDSITVDFNHPLAGQTVHFDIEVLEIDPALEA"
FT   CDS_pept        28198..29148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="ECO26_0029"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   reductase, 4Fe-4S protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23390"
FT                   /protein_id="BAI23390.1"
FT                   /translation="MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYV
FT                   VDSLRERGAIFIEQISEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHM
FT                   EVARASRRGEESILIGHAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSF
FT                   MTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGS
FT                   KNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVAR
FT                   LQQLGGGEAIPLEGREENIVFEVPKELRVDIREVD"
FT   CDS_pept        29214..30128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="ECO26_0030"
FT                   /product="ribonucleoside hydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23391"
FT                   /protein_id="BAI23391.1"
FT                   /translation="MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKT
FT                   TRNALQLLHFWNAEIPLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAF
FT                   LAIRDALMRAPEPVTLVAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAE
FT                   FNIAADPEAAACVFRSGIEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYR
FT                   SGSMQSGLRMHDLCAIAWLVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANV
FT                   QVALDLDVKGFQQWVAEVLALAS"
FT   CDS_pept        30295..31116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="ECO26_0031"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23392"
FT                   /protein_id="BAI23392.1"
FT                   /translation="MHDANIRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLL
FT                   GSDAGELAGAGKTGVTVQSSLDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTT
FT                   GFDEAGKQAIRDAAADIAIVFAANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAHALDKDLKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTA
FT                   MFADIGERLEITHKASSRMTFANGAVRSALWLSGKESGLFDMRDVLDLNSL"
FT   CDS_pept        31572..32720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECO26_0032"
FT                   /product="carbamoyl phosphate synthetase small subunit"
FT                   /note="glutamine amidotransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23393"
FT                   /protein_id="BAI23393.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
FT   CDS_pept        32738..35959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="ECO26_0033"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23394"
FT                   /protein_id="BAI23394.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVI
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLEEFGVTMIGATADAIDKAEDRRRFDVAMKKIGLETARSGIAHTMEEALAVAADVG
FT                   FPCIIRPSFTMGGSGGGIAYNREEFEEICARGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENFDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKNGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEKVAEVGITGLNAEFLRQLKRKGFADARLAKLAGVREAEIRKLR
FT                   DQYDLHPVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKP
FT                   KGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANAT
FT                   VTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGEMVLIGGIMEHIEQAGVHSGDSACSLPAYTLSQEIQDVMRQQ
FT                   VQKLAFELQVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMAG
FT                   KSLAEQGVTKEVIPPYYSVKEVVLPFNKFPGVDPLLGPEMRSTGEVMGVGRTFAEAFAK
FT                   AQLGSNSTMKKHGRALLSVREGDKERVVDLAAKLLKQGFELDATHGTAIVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNGGF
FT                   ATAMALNADATEKVISVQEMHAQIK"
FT   CDS_pept        complement(35967..36185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0034"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23395"
FT                   /protein_id="BAI23395.1"
FT                   /translation="MTRFEAIKQGHIKIVDISIVCNFTVDKCELNPAYVIKNIDSPKDL
FT                   LNGQKKRSSSENRITYSIKLADEKYPP"
FT   CDS_pept        36220..36615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiF"
FT                   /locus_tag="ECO26_0035"
FT                   /product="DNA-binding transcriptional activator CaiF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23396"
FT                   /protein_id="BAI23396.1"
FT                   /translation="MCEGYVEKPLYLLIAEWMMAENRWVIAREISIHFDIEHSKAVNTL
FT                   TYILSEVAEISCEVKMIPNKLEGRGCQCQRLVKVVDIDEQIYARLRNNSRDKLVGVRKT
FT                   PRIPAVPLTELNREQKWQMMLSKSMRR"
FT   CDS_pept        complement(36701..37291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiE"
FT                   /locus_tag="ECO26_0036"
FT                   /product="predicted acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23397"
FT                   /protein_id="BAI23397.1"
FT                   /translation="MSYYAFEGLIPVVHPTAFVHPSAVLIGDVIVGAGVYIGPLASLRG
FT                   DYGRLIVQAGANIQDGCIMHGYCDTDTIVGENGHIGHGAILHGCVIGRDALVGMNSVIM
FT                   DGAVIGEESIVAAMSFVKAGFHGEKRQLLMGTPARAVRSVSDDELHWKRLNTKEYQDLV
FT                   GRCHASLHETQPLRQMEENRPRLQGTTDVTPKR"
FT   CDS_pept        complement(37297..38190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiD"
FT                   /locus_tag="ECO26_0037"
FT                   /product="crotonobetainyl CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23398"
FT                   /protein_id="BAI23398.1"
FT                   /translation="MKQQGTTLPANNHAIKQYAFFAGMLSSLKKQKWRKGMSESLHLTR
FT                   NGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKA
FT                   AAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIVCADNASF
FT                   ALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVVSQAELM
FT                   DNARELAQQLVNSAPLAIAALKEIFRTTSEMPVEEAYRYIRSGVLKHYPSVLHSEDAIE
FT                   GPLAFAEKRDPVWKGR"
FT   CDS_pept        complement(38191..39744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="ECO26_0038"
FT                   /product="predicted crotonobetaine CoA ligase:carnitine CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23399"
FT                   /protein_id="BAI23399.1"
FT                   /translation="MDIIGGQHLRQMWDDLADVYGHKTALICESSGGVVNRYSYLELNQ
FT                   EINRTANLFYTLGIRKGDKVALHLDNCPEFIFCWFGLAKIGAIMVPINARLLREESAWI
FT                   LQNSQACLLVTSAQFYPMYQQIQQEDATQLRHICLTDVALPADDGVSSFTQLKNQQPAT
FT                   LCYAPPLLTDDTAEILFTSGTTSRPKGVVITHYNLRFAGYYSAWQCALRDDDVYLTVMP
FT                   AFHIDCQCTAAMAAFSAGATFVLVEKYSARAFWGQVQKYRATITECIPMMIRTLMVQPP
FT                   SANDRQHRLREVMFYLNLSEQEKDAFCERFGVRLLTSYGMTETIVGIIGDRPGDKRRWP
FT                   SIGRAGFCYEAEIRDDHNRPLPAGEIGEICIKGVPGKTIFKEYFLNPKATAKVLEADGW
FT                   LHTGDTGYCDEEGFFYFVDRRCNMIKRGGENVSCVELENIIATHPKIQDIVVVGIKDSI
FT                   RDEAIKAFVVLNEGETLSEEEFFRFCEQNMAKFKVPSYLEIRKDLPRNCSGKIIRKNLK
FT                   "
FT   CDS_pept        complement(39818..41035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="ECO26_0039"
FT                   /product="crotonobetainyl CoA:carnitine CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23400"
FT                   /protein_id="BAI23400.1"
FT                   /translation="MDHLPMPKFGPLAGLRVVFSGIEIAGPFAGQMFAEWGAEVIWIEN
FT                   VAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFARR
FT                   GITDEVLWQHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMPA
FT                   FPYTADYFSGLTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEMC
FT                   PRMSKGKDPYYAGCGLYKCADGYIVMELVGITQIEECFKDIGLAHLLGTPEIPEGTQLI
FT                   HRIECPYGPLVEEKLDAWLAAHTIAEVKERFAELNIACAKVLTVPELESNPQYVARESI
FT                   TQWQTMDGRTCKGPNIMPKFKNNPGQIWRGMPSHGMDTAAILKNIGYSENDIQELVSKG
FT                   LAKVED"
FT   CDS_pept        complement(41164..42306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="ECO26_0040"
FT                   /product="crotonobetaine reductase subunit II, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23401"
FT                   /protein_id="BAI23401.1"
FT                   /translation="MDFNLNDEQELFVAGIRELMASENWEAYFAECDRDSVYPERFVKA
FT                   LADMGIDSLLIPEEHGGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLREGTQE
FT                   QIDKIMAFRGTGKQMWNSAITEPGAGSDVGSLKTTYTRRNGKIYLNGSKCFITSSAYTP
FT                   YIVVMARDGASPDKPVYTEWFVDMSKPGIKVTKLEKLGLRMDSCCEITFDDVELDEKDM
FT                   FGREGNGFNRVKEEFDHERFLVALTNYGTAMCAFEDAARYANQRVQFGEAIGRFQLIQE
FT                   KFAHMAIKLNSMKNMLYEAAWKADNGTITSGDAAMCKYFCANAAFEVVDSAMQVLGGVG
FT                   IAGNHRISRFWRDLRVDRVSGGSDEMQILTLGRAVLKQYR"
FT   CDS_pept        complement(42337..43851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="caiT"
FT                   /locus_tag="ECO26_0041"
FT                   /product="predicted transporter CaiT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23402"
FT                   /protein_id="BAI23402.1"
FT                   /translation="MKNEKRKTGIEPKVFFPPLIIVGILCWLTVRDLDAANVVINAVFS
FT                   YVTNVWGWAFEWYMVVMLFGWFWLVFGPYAKKRLGNEPPEFSTASWIFMMFASCTSAAV
FT                   LFWGSIEIYYYISTPPFGLEPNSTGAKELGLAYSLFHWGPLPWATYSFLSVAFAYFFFV
FT                   RKMEVIRPSSTLVPLVGEKHAKGLFGTIVDNFYLVALIFAMGTSLGLATPLVTECMQWL
FT                   FGIPHTLQLDAIIITCWIILNAICVACGLQKGVRIASDVRSYLSFLMLGWVFIVSGASF
FT                   IMNYFTDSVGMLLMYLPRMLFYTDPIAKGGFPQGWTVFYWAWWVIYAIQMSIFLARISR
FT                   GRTVRELCFGMVLGLTASTWILWTVLGSNTLLLIDKNIINIPNLIEQYGVARAIIETWA
FT                   ALPLSTATMWGFFILCFIATVTLVNACSYTLAMSTCREVRDGEEPPLLVRIGWSILVGI
FT                   IGIVLLALGGLKPIQTAIIAGGCPLFFVNIMVTLSFIKDAKQNWKD"
FT   CDS_pept        44325..45095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECO26_0042"
FT                   /product="predicted electron transfer flavoprotein subunit
FT                   FixA"
FT                   /note="contains ETFP adenine nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23403"
FT                   /protein_id="BAI23403.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAVDAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
FT   CDS_pept        45110..46051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixB"
FT                   /locus_tag="ECO26_0043"
FT                   /product="predicted electron transfer flavoprotein subunit
FT                   FixB"
FT                   /note="contains NAD/FAD-binding domain and ETFP adenine
FT                   nucleotide-binding domain-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23404"
FT                   /protein_id="BAI23404.1"
FT                   /translation="MNTFSQVWVFSDTPSRLPELMNGAQALANQINTFVLNDADGVQAI
FT                   QLGANHVWKLNGKPDDRMIEDYAGVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLK
FT                   AAVSNDASTVSVQDGKATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTG
FT                   ETHTVEWQAPAVAITRTATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIG
FT                   AELACSRPVAENEKWMEHERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAIN
FT                   KDKNAPIFQYADYGIVGDAVKILPALTAALAR"
FT   CDS_pept        46102..47388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="ECO26_0044"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains FAD/NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23405"
FT                   /protein_id="BAI23405.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTDVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
FT   CDS_pept        47385..47672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ECO26_0045"
FT                   /product="predicted 4Fe-4S ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23406"
FT                   /protein_id="BAI23406.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
FT   CDS_pept        47731..49062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="ECO26_0046"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23407"
FT                   /protein_id="BAI23407.1"
FT                   /translation="MQPSRNFDDLKFSSIHRRILLWGSGGPFLDGYVLVMIGVALEQLT
FT                   PALKLDADWIGLLGAGTLAGLFVGTSLFGYISDKVGRRKMFLIDIIAIGVISVATMFVS
FT                   SPVELLVMRVLIGIVIGADYPIATSMITEFSSTRQRAFSISFIAAMWYVGATCADLVGY
FT                   WLYDVEGGWRWMLGSAAIPCLLILIGRFELPESPRWLLRKGRVKECEEMMIKLFGEPVA
FT                   FDEEQPQQTRFRDLFNRRHFPFVLFVAAIWTCQVIPMFAIYTFGPQIVGLLGLGVGKNA
FT                   ALGNVVISLFFMLGCIPPMLWLNTAGRRPLLIGSFAMMTLALAVLGLIPDMGIWLVVMA
FT                   FAVYAFFSGGPGNLQWLYPNELFPTDIRASAVGVIMSLSRIGTIVSTWALPIFINNYGI
FT                   SNTMLMGAGISLFGLLISVAFAPETRGMSLAQTSNMTIRGQRMG"
FT   CDS_pept        49170..49700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="ECO26_0047"
FT                   /product="flavoprotein subunit KefF"
FT                   /note="for the KefC potassium efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23408"
FT                   /protein_id="BAI23408.1"
FT                   /translation="MILIIYAHPYPHHSHANKRMLEQARTLEGVEIRSLYQLYPDFNID
FT                   IAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAV
FT                   TTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHY
FT                   KQRLLEWQEAHHG"
FT   CDS_pept        49693..51555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="ECO26_0048"
FT                   /product="potassium: proton antiporter KefC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23409"
FT                   /protein_id="BAI23409.1"
FT                   /translation="MDSHTLIQALIYLGSAALIVPIAVRLGLGSVLGYLIAGCIIGPWG
FT                   LRLVTDAESILHFAEIGVVLMLFIIGLELDPQRLWKLRAAVFGGGALQMVICGGLLGLF
FT                   CMLLGLRWQVAELIGMTLALSSTAIAMQAMNERNLMVTQMGRSAFAVLLFQDIAAIPLV
FT                   AMIPLLATSSASTTMGAFALSALKVAGALVLVVLLGRYVTRPALRFVARSGLREVFSAV
FT                   ALFLVFGFGLLLEEVGLSMAMGAFLAGVLLASSEYRHALESDIEPFKGLLLGLFFIGVG
FT                   MSIDFGTLLENPLRIVILLLGFLIIKIAMLWLIARPLQVPNKQRRWFAVLLGQGSEFAF
FT                   VVFGAAQMANVLEPEWAKSLTLAVALSMAATPILLVILNRLEQSSTEEAREADEIDEEQ
FT                   PRVIIAGFGRFGQITGRLLLSSGVKMVVLDHDPDHIETLRKFGMKVFYGDATRMDLLES
FT                   AGAAKAEVLINAIDDPQTNLQLTEMVKEHFPHLQIIARARDVDHYIRLRQAGVEKPERE
FT                   TFEGALKTGRLALESLGLGPYEARERADVFRRFNIQMVEEMAMVENDTKARAAVYKRTS
FT                   AMLSEIITEDREHLSLIQRHGWQGTEEGKHTGNMADEPETKPSS"
FT   CDS_pept        51747..52226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="ECO26_0049"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23410"
FT                   /protein_id="BAI23410.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRH
FT                   TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
FT   CDS_pept        52289..52426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0050"
FT                   /product="CcdA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23411"
FT                   /protein_id="BAI23411.1"
FT                   /translation="MSRAHCVGLNLQATLQWNEVNEDAISALNEFAEETGCFSDEYRKF
FT                   "
FT   CDS_pept        complement(52525..52992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23412"
FT                   /protein_id="BAI23412.1"
FT                   /translation="MRQINTGLNTREIILEMIDEADAPPFAEQRTWHRRRIAFLCDCIS
FT                   VAVDYGFFCSVSQQSIMNITKMAEDVWITESKTTQLIDIWQQLKQLYPPETIPYAQKLP
FT                   TKELLELLLSSPDDLRIIEIPDIIGDVFDDQTWIRLFKKHFADVIQLRCDV"
FT   CDS_pept        complement(53028..53627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23413"
FT                   /protein_id="BAI23413.1"
FT                   /translation="MADYFEIRADYNQHTITIYQAYNDAIADVAVRDGRFGAPFSFNRM
FT                   TWIKPSFMWMMERSNWGLKKDQQHILAIRIKRTFFDTLLEQAVLTTPEAHVYPHAGIWE
FT                   TLFAQANVYVQWDPERSINGKKLEHRSLQLGISRNLISQFNEDAIVAIDDLTPLVRKCH
FT                   NLLINGKTTQAKSFLPPEKIYPVSAAARKALGMKNS"
FT   CDS_pept        complement(53652..54500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaH"
FT                   /locus_tag="ECO26_0053"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23414"
FT                   /protein_id="BAI23414.1"
FT                   /translation="MATYLIGDVHGCYDELFALLHKVEFTPGKDTLWLTGDLVARGPGS
FT                   LDVLRYVKSLGDSVRLVLGNHDLHLLAVFAGISRNKPKDRLTPLLEAPDADELLNWLRR
FT                   QPLLQIDEEKKLVMAHAGITPQWDLQTAKECARDVEAVLSSDSYPFFLDAMYGDMPNNW
FT                   SPELRGLGRLRFITNAFTRMRFCFPNGQLDMYSKESPEEAPAPLKPWFAIPGPVAEEYS
FT                   IAFGHWASLEGKGTPEGIYALDTGCCWGGSLTCLRWEDKQYFVQPSNRHKDLGEGEAVA
FT                   S"
FT   CDS_pept        complement(54507..54884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECO26_0054"
FT                   /product="Co2+ and Mg2+ efflux associated protein ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23415"
FT                   /protein_id="BAI23415.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
FT   CDS_pept        complement(54887..55708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="ECO26_0055"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23416"
FT                   /protein_id="BAI23416.1"
FT                   /translation="MNNRVHQGHLARKRFGQNFLNDQFVIDSIVSAINPQKGQAMVEIG
FT                   PGLAALTEPVGERLDQLTVIELDRDLAARLQTHPFLGPKLTIYQQDAMTFNFGELAEKM
FT                   GQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYGRLSVM
FT                   AQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVPHATMPHPVKDVRVLSRITTEAFNQRR
FT                   KTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQYCQMANYLAENAPLQES"
FT   CDS_pept        complement(55705..56694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="ECO26_0056"
FT                   /product="4-hydroxy-L-threonine phosphate dehydrogenase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23417"
FT                   /protein_id="BAI23417.1"
FT                   /translation="MVKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTD
FT                   RAAMLGLPLTLRPYSPNSPAQPQTTGTLTLLPVALRESVTAGQLAIENGHYVVETLARA
FT                   CDGCLNGEFAALITGPVHKGVINDAGIPFTGHTEFFEERSQAKKVVMMLATEELRVALA
FT                   TTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEE
FT                   IDTIIPVLDELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRG
FT                   VNITLGLPFIRTSVDHGTALELAGRGEADVGSFITALNLAIKMIVNTQ"
FT   CDS_pept        complement(56694..57980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="ECO26_0057"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="PPIase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23418"
FT                   /protein_id="BAI23418.1"
FT                   /translation="MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGL
FT                   MQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA
FT                   KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQ
FT                   VGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSAD
FT                   QQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNIS
FT                   VTEVHARHILLKPSPIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGD
FT                   LGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYR
FT                   MLMNRKFSEEAASWMQEQRASAYVKILSN"
FT   CDS_pept        complement(58033..60387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="imp"
FT                   /locus_tag="ECO26_0058"
FT                   /product="exported protein Imp"
FT                   /note="required for envelope biosynthesis and integrity"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23419"
FT                   /protein_id="BAI23419.1"
FT                   /translation="MKKRIPTLLATMIATALYSQQGLAADLASQCMLGVPSYDRPLVQG
FT                   DTNDLPVTINADHAKGDYPDDAVFTGSVDIMQGNSRLQADEVQLHQKEAPGQPEPVRTV
FT                   DALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYT
FT                   ILDNGSFTSCLPGSDTWSVVGSEIIHDREEQVAEIWNARFKVGPVPIFYSPYLQLPVGD
FT                   KRRSGFLIPNAKYTTTNYFEFYLPYYWNIAPNMDATITPHYMHRRGNIMWENEFRYLSQ
FT                   AGAGLMELDYLPSDKVYEDEHPNDDSSRRWLFYWNHSGVMDQVWRFNVDYTKVSDPSYF
FT                   NDFDNKYGSSTDGYATQKFSVGYAVQNFNATVSTKQFQVFSEQNTSSYSAEPQLDVNYY
FT                   QNDVGPFDTRIYGQAVHFVNTRDDMPEATRVHLEPTINLPLSNNWGSINTEAKLLATHY
FT                   QQTNLDWYNSRNTTKLDESVNRVMPQFKVDGKMVFERDMEMLAPGYTQTLEPRAQYLYV
FT                   PYRDQSDIYNYDSSLLQSDYSGLFRDRTYGGLDRIASANQVTTGVTSRIYDDAAVERFN
FT                   ISVGQIYYFTESRTGDDNITWENDDKTGSLVWAGDTYWRISERWGLRGGIQYDTRLDNV
FT                   ATSNSSIEYRRDEDRLVQLNYRYASPEYIQATLPKYYSTAEQYKNGISQVGAVASWPIA
FT                   DRWSIVGAYYYDTNANKQADSMLGVQYSSCCYAIRVGYERKLNGWDNDKQHAVYDNAIG
FT                   FNIELRGLSSNYGLGTQEMLRSNILPYQNTL"
FT   CDS_pept        60642..61457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECO26_0059"
FT                   /product="DnaJ-like protein DjlA, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23420"
FT                   /protein_id="BAI23420.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQSGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
FT   CDS_pept        complement(61574..62233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="ECO26_0060"
FT                   /product="pseudouridine synthase"
FT                   /note="for 23S rRNA (position 746) and tRNA phe (position
FT                   32)"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23421"
FT                   /protein_id="BAI23421.1"
FT                   /translation="MGMENYNPPQEPWLVILYQDDHIMVVNKPSGLLSVPGRLEEHKDS
FT                   VMTRIQRDYPQAESVHRLDMATSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHP
FT                   SPAEGLVDLPLICDWPNRPKQKVCYETGKPAQTEYEVVEYVADNTARVVLKPITGRSHQ
FT                   LRVHMLALGHPILGDRFYASPEARAMAPRLLLHAEMLTITHPAYGNSMTFKAPADF"
FT   CDS_pept        complement(62245..65151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="ECO26_0061"
FT                   /product="RNA polymerase-associated helicase protein"
FT                   /note="ATPase and RNA polymerase recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23422"
FT                   /protein_id="BAI23422.1"
FT                   /translation="MPFTLGQRWISDTESELGLGTVVAVDARTVTLLFPSTGENRLYAR
FT                   SDSPVTRVMFNPGDTITSHDGWQMQVEEVKEENGLLTYIGTRLDTEESGVALREVFLDS
FT                   KLVFSKPQDRLFAGQIDRMDRFALRYRARKYSSEQFRMPYSGLRGQRTSLIPHQLNIAH
FT                   DVGRRHAPRVLLADEVGLGKTIEAGMILHQQLLSGAAERVLIIVPETLQHQWLVEMLRR
FT                   FNLRFALFDDERYAEAQHDAYNPFDTEQLVICSLDFARRSKQRLEHLCEAEWDLLVVDE
FT                   AHHLVWSEDAPSREYQAIEQLAEHVPGVLLLTATPEQLGMESHFARLRLLDPNRFHDFA
FT                   QFVEEQKNYRPVADAVAMLLAGNKLSNDELNMLGEMIGEQDIEPLLQAANSDSEDAQSA
FT                   RQELVSMLMDRHGTSRVLFRNTRNGVKGFPKRELHTIKLPLPTQYQTAIKVSGIMGARK
FT                   SAEDRARDMLYPERIYQEFEGDNATWWNFDPRVEWLMGYLTSHRSQKVLVICAKAATAL
FT                   QLEQVLREREGIRAAVFHEGMSIIERDRAAAWFAEEDTGAQVLLCSEIGSEGRNFQFAS
FT                   HMVMFDLPFNPDLLEQRIGRLDRIGQAHDIQIHVPYLEKTAQSVLVRWYHEGLDAFEHT
FT                   CPTGRTIYDSVYNDLINYLASPDQTEGFDDLIKNCREQHEALKAQLEQGRDRLLEIHSN
FT                   GGEKAQALAESIEEQDDDTNLIAFAMNLFDIIGINQDDRGDNMIVLTPSDHMLVPDFPG
FT                   LSEDGITITFDREVALAREDAQFITWEHPLIRNGLDLILSGDTGSSTISLLKNKALPVG
FT                   TLLVELIYVVEAQAPKQLQLNRFLPPTPVRMLLDKNGNNLAAQVEFETFNRQLNAVNRH
FT                   TGSKLVNAVQQDVHAILQLGEAQIEKSARALIDAARNEADEKLSAELSRLEALRAVNPN
FT                   IRDDELTAIESNRQQVMESLDQAGWRLDALRLIVVTHQ"
FT   CDS_pept        complement(65316..67667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polB"
FT                   /locus_tag="ECO26_0062"
FT                   /product="DNA polymerase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23423"
FT                   /protein_id="BAI23423.1"
FT                   /translation="MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFI
FT                   PADQVPRAQHILQGEQGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVY
FT                   EADVRPPERYLMERFITSPVWVEGDMHNGTIVNARLKPHPDYRPPLKWVSIDIETTRHG
FT                   ELYCIGLEGCGQRIVYMLGPENGDASSLDFELEYVASRPQLLEKLNAWFANYDPDVIIG
FT                   WNVVQFDLRMLQKHAERYRLPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEAL
FT                   KSAFWNFSSFSLETVAQELLGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVT
FT                   QIFHKTEIMPFLLERATVNGLPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHAS
FT                   PGGYVMDSRPGLYDSVLVLDYKSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAW
FT                   FSREKHCLPEIVTNIWHGRDEAKRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLAS
FT                   SITMRGHQIMRQTKALIEAQGYDVIYGDTDSTFVWLKGAHSEEEAAKIGRALVQHVNAW
FT                   WAETLQKQRLTSALELEYETHFCRFLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLE
FT                   TVRTDWTPLAQQFQQELYLRIFRNEPYQEYVRQTIDKLMAGELDARLVYRKRLRRPLSE
FT                   YQRNVPPHVRAARLADEENQKRGRPLQYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYL
FT                   TRQLQPVAEGILPFIEDNFATLMTGQLGLF"
FT   CDS_pept        complement(67742..68437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="ECO26_0063"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23424"
FT                   /protein_id="BAI23424.1"
FT                   /translation="MLEDLKRQVLEANLALPKHNLVTLTWGNVSAVDRERGVFVIKPSG
FT                   VDYSVMTADDMVVVSIETGEVVEGTKKPSSDTPTHRLLYQAFPSIGGIVHTHSRHATIW
FT                   AQAGQSIPATGTTHADYFYGTIPCTRKMTDAEINGEYEWETGNVIVETFEKQGIDAAQM
FT                   PGVLVHSHGPFAWGKNAEDAVHNAIVLEEVAYMGIFCRQLAPQLPDMQQTLLDKHYLRK
FT                   HGAKAYYGQ"
FT   CDS_pept        complement(68606..70108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="ECO26_0064"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23425"
FT                   /protein_id="BAI23425.1"
FT                   /translation="MTIFDNYEVWFVIGSQHLYGPETLRQVTQHAEHVVNALNTEAKLP
FT                   CKLVLKPLGTTPDEITAICRDANYDDRCAGLVVWLHTFSPAKMWINGLTMLNKPLLQFH
FT                   TQFNAALPWDSIDMDFMNLNQTAHGGREFGFIGARMRQQHAVVTGHWQDKQAHERIGSW
FT                   MRQAVSKQDTRHLKVCRFGDNMREVAVTDGDKVAAQIKFGFSVNTWAVGDLVQVVNSIS
FT                   DGDVNALVDEYESCYTMTPATQIHGEKRQNVLEAARIELGMKRFLEQGGFHAFTTTFED
FT                   LHGLKQLPGLAVQRLMQQGYGFAGEGDWKTAALLRIMKVMSTGLQGGTSFMEDYTYHFE
FT                   KGNDLVLGSHMLEVCPSIAVEEKPILDVQHLGIGGKDDPARLIFNTQTGPAIVASLIDL
FT                   GDRYRLLVNCIDTVKTPHSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTVFSHALN
FT                   LNDMRQFAEMHDIEITVIDNDTRLPAFKDALRWNEVYYGFRR"
FT   CDS_pept        complement(70119..71819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="ECO26_0065"
FT                   /product="L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23426"
FT                   /protein_id="BAI23426.1"
FT                   /translation="MAIAIGLDFGSDSVRALAVDCASGEEIATSVEWYPRWQKGQFCDA
FT                   PNNQFRHHPRDYIESMEAALKTVLAELSVEQRAAVVGIGVDSTGSTPAPIDADGNVLAL
FT                   RPEFAENPNAMFVLWKDHTAVEEAEEITRLCHAPGNVDYSRYIGGIYSSEWFWAKILHV
FT                   TRQDTAVAQSAASWIELCDWVPALLSGTTRPQDIRRGRCSAGHKSLWHESWGGLPPASF
FT                   FDELDPILNRHLPSPLFTDTWTADIPVGTLCPEWAQRLGLPESVVISGGAFDCHMGAVG
FT                   AGAQPNALVKVIGTSTCDILIADKQSVGERAVKGICGQVDGSVVPGFIGLEAGQSAFGD
FT                   IYAWFGRVLGWPLEQLAAQHPELKAQINASQKQLLPALTEAWAKNPSLDHLPVVLDWFN
FT                   GRRTPNANQRLKGVITDLNLATDAPLLFGGLIAATAFGARAIMECFTDQGIAVNNVMAL
FT                   GGIARKNQVIMQACCDVLNRPLQIVASDQCCALGAAIFAAVAAKVHADIPSAQQKMASA
FT                   VEKTLQPRSEQAQRFEQLYRRYQQWAMSAEQHYLPTSAPAQAAQAVATL"
FT   CDS_pept        72158..73036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araC"
FT                   /locus_tag="ECO26_0066"
FT                   /product="DNA-binding transcriptional dual regulator AraC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23427"
FT                   /protein_id="BAI23427.1"
FT                   /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
FT                   ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRYPEAREWYHQWVYFRPRAYW
FT                   HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
FT                   MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
FT                   VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
FT                   EKVNDVAVKLS"
FT   CDS_pept        73122..73886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabI"
FT                   /locus_tag="ECO26_0067"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23428"
FT                   /protein_id="BAI23428.1"
FT                   /translation="MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGL
FT                   GALIGSGELSFWHAWLAGIVGCLLGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHA
FT                   LHQHSMFTILVGRFVGPTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAG
FT                   AAIDIPAGMQSGEFKWLLLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTP
FT                   LISAIGVVALVVLIRHPLMPVYIDILRKVVGG"
FT   CDS_pept        complement(74000..74698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ECO26_0068"
FT                   /product="thiamin transporter subunit ThiQ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23429"
FT                   /protein_id="BAI23429.1"
FT                   /translation="MLKLTDITWLYHHLPMRFSLTVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPASGSLTIDSVDHTTTPPSRRPVSMLFQENNLFSHLTVAQNIGLGLNPGLKLNA
FT                   AQQEKMHAIARQMGIDNLMARLPGELSGGQRQRVALARCLVREQPILLLDEPFSALDPA
FT                   LRQEMLTLVSTSCQQQKMTLLMVSHSVEDAARIATRSVVVADGRIAWQGKTNELLSGKA
FT                   SASALLGITG"
FT   CDS_pept        complement(74682..76292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="ECO26_0069"
FT                   /product="fused thiamin transporter subunits of ABC
FT                   superfamily: membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23430"
FT                   /protein_id="BAI23430.1"
FT                   /translation="MATRRQPLIPGWLIPGVSAATLVVAVALAAFLALWWNAPQGNWVA
FT                   VWQDSYLWHVVRFSFWQAFLSALLSVVPAIFLARALYRRRFPGRLALLRLCAMTLILPV
FT                   LVAVFGILSVYGRQGWLASLCQSLGLEWTFSPYGLQGILLAHVFFNLPMASRLLLQALE
FT                   NIPGEQRQLAAQLGMRGWHFFRFVEWPWLRRQIPPVAALIFMLCFASFATVLSLGGGPQ
FT                   ATTIELAIYQALSYDYDPARAAMLALLQMVCCLGLVLLSQRLSKAIAPGTTLLQGWRDP
FT                   DDRLHSRICDTVLIVLALLLLLPPLLAVIVDGVNRQLPEVLAQPVLWQALWTSLRIALA
FT                   AGVLCVVLTMMLLWSSRELRARQKMLAGQALEMSGMLILAMPGIVLATGFFLLLNNTIG
FT                   LPQSADGIVIFTNALMAIPYALKVLENPMRDITARYSMLCQSLGIEGWSRLKVVELRAL
FT                   KRPLAQALAFACVLSIGDFGVVALFGNDDFRTLPFYLYQQIGSYRSQDGAVTALILLLL
FT                   CFLLFTVIEKLPGRNVKTD"
FT   CDS_pept        complement(76268..77251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ECO26_0070"
FT                   /product="thiamin transporter subunit TbpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23431"
FT                   /protein_id="BAI23431.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDLRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
FT   misc_binding    complement(77282..77381)
FT                   /gene="TPP"
FT                   /bound_moiety="thiamine"
FT                   /note="thiamine pyrophosphate riboswitch, identified by
FT                   Rfam"
FT   CDS_pept        complement(77415..79070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrR"
FT                   /locus_tag="ECO26_0071"
FT                   /product="DNA-binding transcriptional regulator SgrR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23432"
FT                   /protein_id="BAI23432.1"
FT                   /translation="MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLN
FT                   TMQDRGWLTWEAEVGRGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVR
FT                   QMLVSHLGRSFRQGRHILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGE
FT                   LEADIAHHWQQISPLHWRFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVS
FT                   PTPWTLDIHLTQPDRWLPLLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNTTNQL
FT                   KIQAFDDFFGYRALIDEVNVWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLF
FT                   DSRTHRGANQQVRDWVSYVLSPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTIKSEKPA
FT                   GLESLILTFYQDHSEHRVIAGIMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSAN
FT                   FTLPLDFSLFAHLCEVPLLQHCIPIDWQADAARWRNGEMNLANWCQQLVASKAMVPLIH
FT                   HWLIIQGQRSMRGLRMNTLGWFDFKSAWFAPPDP"
FT   ncRNA           79138..79364
FT                   /gene="sgrS"
FT                   /locus_tag="ECO26_ncRNA01"
FT                   /note="sRNA that destabilizes ptsG mRNA; regulated by SgrR"
FT                   /inference="nucleotide motif:Rfam:RF00534"
FT                   /ncRNA_class="other"
FT   CDS_pept        79159..79290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgrT"
FT                   /locus_tag="ECO26_0072"
FT                   /product="predicted inhibitor of glucose transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23433"
FT                   /protein_id="BAI23433.1"
FT                   /translation="MRQFYQHYFTATAKLCWLRWLSVPQRLTMLEELMQWDDRNSES"
FT   CDS_pept        79392..80570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="setA"
FT                   /locus_tag="ECO26_0073"
FT                   /product="broad specificity sugar efflux system SetA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23434"
FT                   /protein_id="BAI23434.1"
FT                   /translation="MIWIMTMARRMNGVYAAFMLVAFMMGVAGALQAPTLSLFLSREVG
FT                   AQPFWIGLFYTVNAIAGIGVSLWLAKRSDSQGDRRKLIIFCCLMAIGNALLFAFNRHYL
FT                   TLITCGVLLASLANTAMPQLFALAREYADNSAREVVMFSSVMRAQLSLAWVIGPPLAFM
FT                   LALNYGFTVMFSIAAGIFTLSLVLIAFMLPSVARVELPSENALSMQGGWQDSNVRMLFV
FT                   ASTLMWTCNTMYIIDMPLWISSELGLPDKLAGFLMGTAAGLEIPAMILAGYYVKRYGKR
FT                   RMMVIAVAAGVLFYTGLIFFHSRMALMTLQLFNAVFIGIVAGIGMLWFQDLMPGRAGAA
FT                   TTLFTNSISTGVILAGVIQGAIAQSWGHFAVYWVIAVISVVALFLTAKVKDV"
FT   CDS_pept        complement(80619..81224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="ECO26_0074"
FT                   /product="3-isopropylmalate isomerase subunit LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23435"
FT                   /protein_id="BAI23435.1"
FT                   /translation="MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFN
FT                   DWRFLDEKGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAP
FT                   SFADIFYGNSFNNQLLPVKLSDAEVDELFALVKANPGIHFDVDLEAQEVKAGEKTYRFT
FT                   IDAFRRHCMMNGLDSIGLTLQHDDAIAAYEAKQPAFMN"
FT   CDS_pept        complement(81235..82635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="ECO26_0075"
FT                   /product="3-isopropylmalate isomerase subunit LeuC"
FT                   /note="dehydratase component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23436"
FT                   /protein_id="BAI23436.1"
FT                   /translation="MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLR
FT                   AHGRPVRQPGKTFATMDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPY
FT                   QGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRA
FT                   KTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNM
FT                   AIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQA
FT                   EEISPQVTWGTNPGQVISVNDNIPDPASFADPVERASAEKALAYMGLKPGIPLTEVAID
FT                   KVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAG
FT                   FEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGH
FT                   FADIRNIK"
FT   CDS_pept        complement(82638..83729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="ECO26_0076"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23437"
FT                   /protein_id="BAI23437.1"
FT                   /translation="MSKNYHIAVLPGDGIGPEVMTQALKVLDAVRNRFAMRITTSHYDV
FT                   GGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHLPPDQQPERGALLPLRKHFKL
FT                   FSNLRPAKLYQGLEAFCPLRADIAANGFDILCVRELTGGIYFGQPKGREGSGQYEKAFD
FT                   TEVYHRFEIERIARIAFESARKRRHKVTSIDKANVLQSSILWREIVNEIATEYPDVELA
FT                   HMYIDNATMQLIKDPSQFDVLLCSNLFGDILSDECAMITGSMGMLPSASLNEQGFGLYE
FT                   PAGGSAPDIAGKNIANPIAQILSLALLLRYSLDADDAACAIERAINRALEEGIRTGDLA
FT                   RGAAAVSTDEMGDIIARYVAEGV"
FT   CDS_pept        complement(83729..85300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="ECO26_0077"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23438"
FT                   /protein_id="BAI23438.1"
FT                   /translation="MSQQVIIFDTTLRDGEQALQASLSVKEKLQIALALERMGVDVMEV
FT                   GFPVSSPGDFESVQTIARQVKNSRVCALARCVEKDIDVAAESLKVAEAFRIHTFIATSP
FT                   MHIATKLRSTLDEVIERAIYMVKRARNYTDDVEFSCEDAGRTPIADLARVVEAAINAGA
FT                   TTINIPDTVGYTMPFEFAGIISGLYERVPNIDKAIISVHTHDDLGLAVGNSLAAVHAGA
FT                   RQVEGAMNGIGERAGNCSLEEVIMAIKVRKDILNVHTAINHQEIWRTSQLVSQICNMPI
FT                   PANKAIVGSGAFAHSSGIHQDGVLKNRENYEIMTPESIGLNQIQLNLTSRSGRAAVKHR
FT                   MDEMGYKESEYNLDNLYDAFLKLADKKGQVFDYDLEALAFIGKQQEEPEHFRLDYFSVQ
FT                   SGSNDIATAAVKLACGEEVKAEAANGNGPVDAVYQAINRITDYNVELVKYSLTAKGHGK
FT                   DALGQVDIVANYNGRRFHGVGLATDIVESSAKAMVHVLNNIWRAAEVEKELQRKAQHNE
FT                   NNKETV"
FT   CDS_pept        complement(85393..85479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuL"
FT                   /locus_tag="ECO26_0078"
FT                   /product="leu operon leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23439"
FT                   /protein_id="BAI23439.1"
FT                   /translation="MTHIVRFIGLLLLNASSLRGRRVSGIQH"
FT   CDS_pept        86139..87083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuO"
FT                   /locus_tag="ECO26_0079"
FT                   /product="DNA-binding transcriptional activator LeuO"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23440"
FT                   /protein_id="BAI23440.1"
FT                   /translation="MPEVQTDHSETAELSKPQLRMVDLNLLTVFDAVMQEQNITRAAHV
FT                   LGMSQPAVSNAVARLKVMFNDELFVRYGRGIQPTARAFQLFGSVRQALQLVQNELPGSG
FT                   FEPASSERVFHLCVCSPLDSILTSQIYNHIEQIAPNIHVMFKSSLNQNTEHQLRYQETE
FT                   FVISYEDFHRPEFTSVPLFKDEMVLVASKNHPTIKGPLLKHDVYNEQHAAVSLDRFASF
FT                   SQPWYDTVDKQASIAYQGMAMMSVLSVVSQTHLVAIAPRWLAEEFAESLELQVLPLPLK
FT                   QNSRTCYLSWHEAAGRDKGHQWMEEQLVSICKR"
FT   CDS_pept        87401..89125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="ECO26_0080"
FT                   /product="acetolactate synthase III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23441"
FT                   /protein_id="BAI23441.1"
FT                   /translation="MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDH
FT                   VLVRHEQAAVHMADGLARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVA
FT                   TSLIGYDAFQECDMVGISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPK
FT                   DILNPANKLPYVWPESVSMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAIMAGC
FT                   HQQLKETVEALNLPVVSSLMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGV
FT                   RFDDRTTNNLAKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESA
FT                   HQPLDEIRDWWQQIEQWRARQCLKYDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQ
FT                   MFAALYYPFDKPRRWINSGGLGTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQEL
FT                   STALQYELPVLVVNLNNRYLGMVKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQ
FT                   ISHPHELESKLSEALEQVCNNRLVFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT"
FT   CDS_pept        89128..89619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="ECO26_0081"
FT                   /product="acetolactate synthase III, thiamin-dependent,
FT                   small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23442"
FT                   /protein_id="BAI23442.1"
FT                   /translation="MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSR
FT                   MTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRN
FT                   TEIFRGQIIDVTPSLYTVQLAGTSDKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR
FT                   "
FT   CDS_pept        89631..89717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECO26_0082"
FT                   /product="fruR leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23443"
FT                   /protein_id="BAI23443.1"
FT                   /translation="MRNLQPNMSRWAFFAKSVGTWNKSSCRS"
FT   CDS_pept        89799..90803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="ECO26_0083"
FT                   /product="DNA-binding transcriptional dual regulator FruR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23444"
FT                   /protein_id="BAI23444.1"
FT                   /translation="MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREH
FT                   NYHPNAVAAGLRAGRTRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPD
FT                   NEMRCIEHLLQRQVDAIIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGAD
FT                   QDDAEMLAEELRKFPAETVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYER
FT                   EAAAQLFEKWLETHPMPQALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDF
FT                   LQCPVLAVAQRHRDVAERVLEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS"
FT   CDS_pept        91405..91863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ECO26_0084"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23445"
FT                   /protein_id="BAI23445.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
FT   CDS_pept        91865..92806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="ECO26_0085"
FT                   /product="S-adenosyl-dependent methyltransferase"
FT                   /note="on membrane-located substrates"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23446"
FT                   /protein_id="BAI23446.1"
FT                   /translation="MMENYKHTTVLLDEAVNGLNIRPDGIYIDGTFGRGGHSRLILSQL
FT                   GEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGV
FT                   SSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKR
FT                   IARAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQA
FT                   LKSSLNVLAPGGRLSIISFHSLEDRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQL
FT                   RALGKLMPGEEEVAENPRARSSVLRIAERTNA"
FT   CDS_pept        92803..93168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECO26_0086"
FT                   /product="membrane bound cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23447"
FT                   /protein_id="BAI23447.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
FT   CDS_pept        93184..94950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="ECO26_0087"
FT                   /product="transpeptidase FtsI"
FT                   /note="involved in septal peptidoglycan synthesis
FT                   (penicillin-binding protein 3)"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23448"
FT                   /protein_id="BAI23448.1"
FT                   /translation="MKAAAKTQKPKRQEEHANFISWRFALLCGCILLALAFLLGRVAWL
FT                   QVISPDMLVKEGDMRSLRVQQVSTSRGMITDRSGRPLAVSVPVKAIWADPKEVHDAGGI
FT                   SVGDRWKALANALNIPLDQLSARINANPKGRFIYLARQVNPDMADYIKKLKLPGIHLRE
FT                   ESRRYYPSGEVTAHLIGFTNVDSQGIEGVEKSFDKWLTGQPGERIVRKDRYGRVIEDIS
FT                   STDSQAAHNLALSIDERLQALVYRELNNAVAFNKAESGSAVLVDVNTGEVLAMANSPSY
FT                   NPNNLSGTPKEAMRNRTITDVFEPGSTVKPMVVMTALQRGVVRENSVLNTIPYRINGHE
FT                   IKDVARYSELTLTGVLQKSSNVGVSKLALAMPSSALVDTYSRFGLGKATNLGLVGERSG
FT                   LYPQKQRWSDIERATFSFGYGLMVTPLQLARVYATIGSYGIYRPLSITKVDPPVPGERV
FT                   FPESIVRTVVHMMESVALPGGGGVKAAIKGYRIAIKTGTAKKVGPDGRYINKYIAYTAG
FT                   VAPASQPRFALVVVINDPQAGKYYGGAVSAPVFGAIMGGVLRTMNIEPDALTTGDKNEF
FT                   VINQGEGTGGRS"
FT   CDS_pept        94937..96424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="ECO26_0088"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate:meso-diaminopimelate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23449"
FT                   /protein_id="BAI23449.1"
FT                   /translation="MADRNLRDLLAPWVPDAPSRALREMTLDSRVAAAGDLFVAVVGHQ
FT                   ADGRRYIPQAIAQGVTAIIAEAKGEATDGEIREMHGVPVIYLSQLNERLSALAGRFYHE
FT                   PSDNLRLVGVTGTNGKTTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAV
FT                   DVQHELAGLVDQGATFCAMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMEHYE
FT                   AAKWLLYSEHHCGQAIVNADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKATEVNY
FT                   HDSGATIRFSSSWGDGEIESHLMGAFNVSNLLLALATLLALGYPLADLLKTAARLQPVC
FT                   GRMEVFTAPGKPTVVVDYAHTPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMG
FT                   AIAEEFADVAVVTDDNPRTEEPRAIINDILAGMLDAGHAKVMEGRAEAVTCAVMQAKEN
FT                   DVVLVAGKGHEDYQIVGNQRLDYSDRVTVARLLGVIA"
FT   CDS_pept        96421..97779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="ECO26_0089"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23450"
FT                   /protein_id="BAI23450.1"
FT                   /translation="MISVTLSQLTDILNGELQGADITLDAVTTDTRKLTPGCLFVALKG
FT                   ERFDAHDFADQAKAGGAGALLVSRPLDIDLPQLIVKDTRLAFGELAAWVRQQVPARVVA
FT                   LTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPMTLLRLTPEYDYAVIELGANH
FT                   QGEIAWTVSLTRPEAALVNNLAAAHLEGFGSLAGVAKAKGEIFSGLPENGIAIMNADNN
FT                   DWLNWQSVIGSRKVWRFSPNAANSDFTATNIHVTSHGTEFTLQTPTGSVDVLLPLPGRH
FT                   NIANALAAAALSMSVGATLDAIKAGLANLKAVPGRLFPIQLAENQLLLDDSYNANVGSM
FT                   TAAVQVLAEMPGYRVLVVGDMAELGAESEACHVQVGEAAKAAGIDRVLSVGKQSHAIST
FT                   ASGVGEHFADKTALITRLKSLIAEQQVITILVKGSRSAAMEEVVRALQENGTC"
FT   CDS_pept        97773..98855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="ECO26_0090"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23451"
FT                   /protein_id="BAI23451.1"
FT                   /translation="MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMI
FT                   AHLQKLSFGQVVRNDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVV
FT                   LVGYGVIGFVDDYRKVVRKDTKGLIARWKYFWMSVIALGIAFALYLAGKDTPATQLVVP
FT                   FFKDVMPQLGLFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNM
FT                   NFASYLHIPYLRHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIA
FT                   VLLRQEFLLVIMGGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISLMLVLIGLATLKVR"
FT   CDS_pept        98858..100174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="ECO26_0091"
FT                   /product="UDP-N-acetylmuramoyl-L-alanine: D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23452"
FT                   /protein_id="BAI23452.1"
FT                   /translation="MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLD
FT                   KLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSAAADAGIEIVGDIELFCREAQ
FT                   APIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDAECELYVLELSSFQ
FT                   LETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPIR
FT                   GADERCVSFGVNMGDYHLNHQQGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALAD
FT                   AAGLPRASSLKALTTFTGLPHRFEVVLEHNGVRWINDSKATNVGSTEAALNGLQVDGTL
FT                   HLLLGGDGKSADFSPLARYLNGDNVRLYCFGRDGAQLAALRPEVAEQTETMEQAMRLLA
FT                   PRVQPGDMVLLSPACASLDQFKNFEQRGNEFARLAKELG"
FT   CDS_pept        100174..101418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="ECO26_0092"
FT                   /product="integral membrane protein FtsW"
FT                   /note="involved in stabilizing FstZ ring during cell
FT                   division"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23453"
FT                   /protein_id="BAI23453.1"
FT                   /translation="MRLSLPRLKMPRLPGFSILVWISTALKGWVMGSREKDTDSLIMYD
FT                   RTLLWLTFGLAAIGFIMVTSASMPIGQRLTNDPFFFAKRDGVYLILAFILAIITLRLPM
FT                   EFWQRYSATMLLGSIILLMIVLVVGSSVKGASRWIDLGLLRIQPAELTKLSLFCYIANY
FT                   LVRKGDEVRNNLRGFLKPMGVILVLAVLLLAQPDLGTVVVLFVTTLAMLFLAGAKLWQF
FT                   IAIIGMGISAVVLLILAEPYRIRRVTAFWNPWEDPFGSGYQLTQSLMAFGRGELWGQGL
FT                   GNSVQKLEYLPEAHTDFIFAIIGEELGYVGVVLALLMVFFVAFRAMSIGRKALEIDHRF
FT                   SGFLACSIGIWFSFQALVNVGAAAGMLPTKGLTLPLISYGGSSLLIMSTAIMMLLRIDY
FT                   ETRLEKAQAFVRGSR"
FT   CDS_pept        101415..102482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="ECO26_0093"
FT                   /product="N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23454"
FT                   /protein_id="BAI23454.1"
FT                   /translation="MSGQGKRLMVMAGGTGGHVFPGLAVAHHLMAQGWQVRWLGTADRM
FT                   EADLVPKHGIEIDFIRISGLRGKGIKALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGG
FT                   YVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQAFPGAFPNAEVVGNPVR
FT                   TDVLALPLPQQRLAGREGPVRVLVVGGSQGARILNQTMPQVAAKLGDSVTIWHQSGKGS
FT                   QQSVEQAYAEAGQPQHKVTEFIDDMAAAYAWADVVVCRSGALTVSEIAAAGLPALFVPF
FT                   QHKDRQQYWNALPLEKAGAAKIIEQPQLSVDAVANTLAGWSRETLLTMAERARAASIPD
FT                   ATERVANEVSRAARA"
FT   CDS_pept        102536..104011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="ECO26_0094"
FT                   /product="UDP-N-acetylmuramate:L-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23455"
FT                   /protein_id="BAI23455.1"
FT                   /translation="MNTQQLAKLRSIVPEMRRVRHIHFVGIGGAGMGGIAEVLANEGYQ
FT                   ISGSDLAPNPVTQQLMNLGATIYFNHRPENVRDASVVVVSSAISAYNPEIVAAHEARIP
FT                   VIRRAEMLAELMRFRHGIAIAGTHGKTTTTAMVSSIYAEAGLDPTFVNGGLVKAAGVHA
FT                   RLGHGRYLIAEADESDASFLHLQPMVAIVTNIEADHMDTYQGDFENLKQTFINFLHNLP
FT                   FYGRAVMCVDDPVIRELLPRVGRQTTTYGFSEDADVRVEDYQQIGPQGHFTLLRQDKEP
FT                   MRVTLNAPGRHNALNAAAAVAVATEEGIDDEAILRALESFQGTGRRFDFLGEFPLEPVN
FT                   GKSGTAMLVDDYGHHPTEVDATIKAARAGWPDKNLVMLFQPHRFTRTRDLYDDFANVLT
FT                   QVDTLLMLEVYPAGEAPIPGADSRSLCRTIRGRGKIDPILVPDPAQVAEMLAPVLTGND
FT                   LILVQGAGNIGKIARSLAEIKLKPQTPEEEQHD"
FT   CDS_pept        104004..104924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlB"
FT                   /locus_tag="ECO26_0095"
FT                   /product="D-alanine:D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23456"
FT                   /protein_id="BAI23456.1"
FT                   /translation="MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEV
FT                   DVTQLKSMGFQKVFIALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLW
FT                   QGAGLPVAPWVALTRAEFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENAL
FT                   QDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQ
FT                   YFCPAGLEASQEANLQALVLKAWTTLGCKGWGRIDVMLDSYGQFYLLEANTSPGMTSHS
FT                   LVPMAARQAGMSFSQLVVRILELAD"
FT   CDS_pept        104926..105756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECO26_0096"
FT                   /product="membrane anchored protein FtsQ"
FT                   /note="involved in growth of wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23457"
FT                   /protein_id="BAI23457.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPDRTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNHAQAEQQ"
FT   CDS_pept        105753..107015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="ECO26_0097"
FT                   /product="ATP-binding cell division protein FtsA"
FT                   /note="involved in recruitment of FtsK to Z ring"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23458"
FT                   /protein_id="BAI23458.1"
FT                   /translation="MIKATDRKLVVGLEIGTAKVAALVGEVLPDGMVNIIGVGSCPSRG
FT                   MDKGGVNDLESVVKCVQRAIDQAELMADCQISSVYLALSGKHISCQNEIGMVPISEEEV
FT                   TQEDVENVVHTAKSVRVRDEHRVLHVIPQEYAIDYQEGIKNPVGLSGVRMQAKVHLITC
FT                   HNDMAKNIVKAVERCGLKVDQLIFAGLASSYSVLTEDERELGVCVVDIGGGTMDIAVYT
FT                   GGALRHTKVIPYAGNVVTSDIAYAFGTPPSDAEAIKVRHGCALGSIVGKDESVEVPSVG
FT                   GRPPRSLQRQTLAEVIEPRYTELLNLVNEEILQLQEKLRQQGVKHHLAAGIVLTGGAAQ
FT                   IEGLAACAQRVFHTQVRIGAPLNITGLTDYAQEPYYSTAVGLLHYGKESHLNGEAEVEK
FT                   RVTASVGSWIKRLNSWLRKEF"
FT   CDS_pept        107076..108227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="ECO26_0098"
FT                   /product="GTP-binding tubulin-like cell division protein
FT                   FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23459"
FT                   /protein_id="BAI23459.1"
FT                   /translation="MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTD
FT                   AQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGM
FT                   GGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITI
FT                   PNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGY
FT                   AMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNT
FT                   IRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQ
FT                   QHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD"
FT   CDS_pept        108328..109245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="ECO26_0099"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23460"
FT                   /protein_id="BAI23460.1"
FT                   /translation="MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLN
FT                   PPVDFPADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPEIPIM
FT                   DGSAAPFVYLLLDAGIDELNCAKKFVRIKETVRVEDGDKWAEFKPYNGFSLDFTIDFNH
FT                   PAIDSSNQRYAMNFSADAFMRQISRARTFGFMRDIEYLQSRGLCLGGSFDCAIVVDDYR
FT                   VLNEDGLRFEDEFVRHKMLDAIGDLFMCGHNIIGAFTAYKSGHALNNKLLQAVLAKQEA
FT                   WEYVTFQDDAELPLAFKAPSAVLA"
FT   CDS_pept        109476..109988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secM"
FT                   /locus_tag="ECO26_0100"
FT                   /product="regulator of secA translation SecM"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23461"
FT                   /protein_id="BAI23461.1"
FT                   /translation="MSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALSNAAEPNAPAK
FT                   ATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFAMAPQTLPV
FT                   AEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVWISQAQGIR
FT                   AGPQRLT"
FT   CDS_pept        110050..112755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ECO26_0101"
FT                   /product="preprotein translocase subunit SecA"
FT                   /note="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23462"
FT                   /protein_id="BAI23462.1"
FT                   /translation="MLIKLLTKVFGSRNDRTLRRMRKVVNIINAMEPEMEKLSDEELKG
FT                   KTAEFRARLEKGEVLENLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNERCIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVVTVNDYLAQRDAENNRPLFEFLGLTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKRVNKIIPHLIRQEKEDSETFQGEGHFSVDEKSRQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPANIMLMHHVTAALRAHALFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVQIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDLPDLVYMTEAEKIQAIIEDIKERTAKGQPVLVGTIS
FT                   IEKSELVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPAAVTIATNMAGRGTDIVLGG
FT                   SWQAEVAALENPTVEQIEKIKADWQVRHDAVLEAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDAGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYSQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDLPIAEWLDKEPELHEETLRERILAQSIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFSMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEELEQQRRMEAERLAQMQQLSHQDDDSAAAAALA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLQ"
FT   CDS_pept        112815..113204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="ECO26_0102"
FT                   /product="nucleoside triphosphate pyrophosphohydrolase
FT                   MutT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23463"
FT                   /protein_id="BAI23463.1"
FT                   /translation="MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGET
FT                   PEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVESWEGEPWGKEGQPGEW
FT                   MSLVGLNADDFPPANEPVIAKLKRL"
FT   mobile_element  113283..114559
FT                   /mobile_element_type="insertion sequence:IS621"
FT   CDS_pept        113474..114454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0103"
FT                   /product="putative IS621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23464"
FT                   /protein_id="BAI23464.1"
FT                   /translation="MEHELHYIGIDTAKEKLDVDVLRPDGRHRTKKFANTTKGHDELVS
FT                   WLKGHKIDHAHICIEATGTYMEPVAESLYDAGYIVSVINPALGKAFAQSEGLRNKTDTV
FT                   DARMLAEFCRQKRPAAWEAPHPLERALRALVVRHQALTDMHTQELNRTETAREVQRPSI
FT                   DAHLLWLEAELKRLEKQIKDLTDDDPDMKHRRKLLESIPGIGEKTSAVLLAYIGLKDRF
FT                   AHARQFAAFAGLTPRRYESGSSVRGASRMSKAGHVSLRRALYMPAMVATSKTEWGRAFR
FT                   DRLAANGKKGKVILGAMMRKLAQVAYGVLKSGVPFDASRHNPVAA"
FT   CDS_pept        complement(114583..114780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacG"
FT                   /locus_tag="ECO26_0104"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23465"
FT                   /protein_id="BAI23465.1"
FT                   /translation="MSETITVNCPTCGKTVVWGEISPFRPFCSKRCQLIDLGEWAAEEK
FT                   RIPSSGDLSESDDWSEEPKQ"
FT   CDS_pept        complement(114790..115533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacF"
FT                   /locus_tag="ECO26_0105"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23466"
FT                   /protein_id="BAI23466.1"
FT                   /translation="MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFR
FT                   NVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLIS
FT                   APRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNP
FT                   LTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRF
FT                   AIRFMPLDTENGQVPERLDFELACC"
FT   CDS_pept        complement(115533..116153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ECO26_0106"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23467"
FT                   /protein_id="BAI23467.1"
FT                   /translation="MRYIVALTGGIGSGKSTVANAFADLGINVIDADIIARQVVEPGAP
FT                   ALHAIADHFGANMIAADGTLQRRALRERIFANPEEKNWLNALLHPLIQQETQHQIQQAT
FT                   SPYVLWVVPLLVENSLYKKANRVLVVDVSPETQLKRTMQRDDVTREHVEQILAAQATRE
FT                   ARLAVADDVIDNNGAPDAIASDVARLHAHYLQLASQFVSQEKP"
FT   CDS_pept        116378..117421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaC"
FT                   /locus_tag="ECO26_0107"
FT                   /product="GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23468"
FT                   /protein_id="BAI23468.1"
FT                   /translation="MRIEEDLKLGFKDVLIRPKRSTLKSRSDVELERQFTFKHSGQSWS
FT                   GVPIIAANMDTVGTFSMASALASFDILTAVHKHYSVEEWQAFINNSSADVLKHVMVSTG
FT                   TSDADFEKTKQILDLNPALNFVCIDVANGYSEHFVQFVAKAREAWPTKTICAGNVVTGE
FT                   MCEELILSGADIVKVGIGPGSVCTTRVKTGVGYPQLSAVIECADAAHGLGGMIVSDGGC
FT                   TTPGDVAKAFGGGADFVMLGGMLAGHEESGGRIVEENGEKFMLFYGMSSESAMKRHVGG
FT                   VAEYRAAEGKTVKLPLRGPVENTARDILGGLRSACTYVGASRLKELTKRTTFIRVQEQE
FT                   NRIFNNL"
FT   CDS_pept        complement(117456..118658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC/hcpC"
FT                   /locus_tag="ECO26_0108"
FT                   /product="assembly protein HofC in type IV pilin
FT                   biogenesis, transmembrane protein"
FT                   /note="component of type IV pilin biogenesis pathway,
FT                   probable chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23469"
FT                   /protein_id="BAI23469.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRALLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGHPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRDNTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
FT   CDS_pept        complement(118648..120033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofB/hcpB"
FT                   /locus_tag="ECO26_0109"
FT                   /product="conserved hypothetical protein HofB"
FT                   /note="component of type IV pilin biogenesis pathway,
FT                   probable usher"
FT                   /note="contains nucleosidetriphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23470"
FT                   /protein_id="BAI23470.1"
FT                   /translation="MNIPQLTALCLRYHGVLLDASEEVVHVAVVDAPSHELLDALHFAT
FT                   TKRIEITCWTRQQMEGHASRTQQTLPVAVQEKHQPKAELLTRTLQSALEQRASDIHIEP
FT                   ADNAYRIRLRIDGVLHPLPDVSPDAGVALTARLKVLGNLDIAEHRLPQDGQFTVELAGN
FT                   AVSFRIATLPCRGGEKVVLRLLQQVSQALDVNTLGMQPLQLADFAHALQQPQGLVLVTG
FT                   PTGSGKTVTLYSALQTLNTADINICSVEDPVEIPIAGLNQTQIHPRAGLTFQGVLRALL
FT                   RQDPDVIMIGEIRDGETAEIAIKAAQTGHLVLSTLHTNSTCETLVRLQQMGVARWMLSS
FT                   ALTLVIAQRLVRKLCPHCRRQQGEPIHIPDNVWPSPLPHWQAPGCVHCYHGFYGRTALF
FT                   EVLPITPVIRQLISANTDVESLETHARQAGMRTLFENGCLAVEQGLTTFEELIRVLGMP
FT                   HGE"
FT   CDS_pept        complement(120043..120483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD/hcpA"
FT                   /locus_tag="ECO26_0110"
FT                   /product="predicted major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23471"
FT                   /protein_id="BAI23471.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTRYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALHQACEDVFRFDDAN"
FT   CDS_pept        complement(120686..121579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="ECO26_0111"
FT                   /product="quinolinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23472"
FT                   /protein_id="BAI23472.1"
FT                   /translation="MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDI
FT                   TAKLLPENSRSHATVITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQSL
FT                   FELEGPSRVLLTGERTALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSAL
FT                   KYAVLCGGGANHRLGLSDAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEEL
FT                   DEALKAGADIIMLDNFETEQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVG
FT                   ALTKHVQALDLSMRFR"
FT   CDS_pept        121667..122218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="ECO26_0112"
FT                   /product="N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23473"
FT                   /protein_id="BAI23473.1"
FT                   /translation="MLLEQGWLVGARRVPSPHYDCRPDDETPTLLVVHNISLPPGEFGG
FT                   PWIDALFTGTIDPQAHPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSQYQG
FT                   RERCNDFSIGIELEGTDTLAYTDAQYQQLAAVTRALIDCYPDIAKNMTGHCDIAPDRKT
FT                   DPGPAFDWARFRVLVSKETT"
FT   CDS_pept        122215..123069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="ECO26_0113"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23474"
FT                   /protein_id="BAI23474.1"
FT                   /translation="MTLFTTLLVLIFERLFKLGEHWQLDHRLEAFFRRVKHFSLGRTLG
FT                   MTIIAMGVTFLLLRALQGVLFNVPTLLVWLLIGLLCIGAGKVRLHYHAYLTAASRNDSH
FT                   ARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLAPLFWLIVGGTWGPVTLM
FT                   GYAFLRAWQYWLARYQTPHHRLQSGIDAVLHVLDWVPVRLAGVVYALIGHGEKALPAWF
FT                   ASLGDFHTSQYQVLTRLAQFSLAREPHVDKVETPRAAVSMAKKTSFVVVVVIALLTIYG
FT                   ALV"
FT   CDS_pept        complement(123112..124485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="ECO26_0114"
FT                   /product="aromatic amino acid transporter AroP"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23475"
FT                   /protein_id="BAI23475.1"
FT                   /translation="MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAG
FT                   PGIILGYAIAGFIAFLIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYV
FT                   LVAMAELTAVGKYIQFWYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIA
FT                   VVAMIIFGGWLLFSGNGGPQATVSNLWDQGGFLPHGFTGLVMMMAMIMFSFGGLELVGI
FT                   TAAEADNPEQSIPKATNQVIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGD
FT                   TFVANALNIVVLTAALSVYNSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVS
FT                   ALVTALCVLINYLAPESAFGLLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPA
FT                   LLYPLGNWICLLFMAAVLVIMLMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH"
FT   CDS_pept        125026..125790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="ECO26_0115"
FT                   /product="DNA-binding transcriptional dual regulator PdhR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23476"
FT                   /protein_id="BAI23476.1"
FT                   /translation="MAYSKIRQPKLSDVIEQQLEFLILEGTLRPGEKLPPERELAKQFD
FT                   VSRPSLREAIQRLEAKGLLLRRQGGGTFVQSSLWQSFSDPLVELLSDHPESQYDLLETR
FT                   HALEGIAAYYAALRSTDEDKERIRELHHAIELAQQSGDLDAESNAVLQYQIAVTEAAHN
FT                   VVLLHLLRCMEPMLAQNVRQNFELLYSRREMLPLVSSHRTRIFEAIMAGKPEEAREASH
FT                   RHLAFIEEILLDRSREESRRERSLRRLEQRKN"
FT   CDS_pept        125951..128614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="ECO26_0116"
FT                   /product="pyruvate dehydrogenase, decarboxylase component
FT                   E1, thiamin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23477"
FT                   /protein_id="BAI23477.1"
FT                   /translation="MSERFPNDVDPIETRDWLQAIESVIREEGVERAQYLIDQLLAEAR
FT                   KGGVNVAAGTGISNYINTIPVEEQPEYPGNLELERRIRSAIRWNAIMTVLRASKKDLEL
FT                   GGHMASFQSSATIYDVCFNHFFRARNEQDGGDLVYFQGHISPGVYARAFLEGRLTQEQL
FT                   DNFRQEVHGNGLSSYPHPKLMPEFWQFPTVSMGLGPIGAIYQAKFLKYLEHRGLKDTSK
FT                   QTVYAFLGDGEMDEPESKGAITIATREKLDNLVFVINCNLQRLDGPVTGNGKIINELEG
FT                   IFEGAGWNVIKVMWGSRWDELLRKDTSGKLIQLMNETVDGDYQTFKSKDGAYVREHFFG
FT                   KYPETAALVADWTDEQIWALNRGGHDPKKIYAAFKKAQETKGKATVILAHTIKGYGMGD
FT                   AAEGKNIAHQVKKMNMDGVRHIRDRFNVPVSDADIEKLPYITFPEGSEEHTYLHAQRQK
FT                   LHGYLPSRQPNFTEKLELPSLQDFGALLEEQSKEISTTIAFVRALNVMLKNKSIKDRLV
FT                   PIIADEARTFGMEGLFRQIGIYSPNGQQYTPQDREQVAYYKEDEKGQILQEGINELGAG
FT                   CSWLAAATSYSTNNLPMIPFYIYYSMFGFQRIGDLCWAAGDQQARGFLIGGTSGRTTLN
FT                   GEGLQHEDGHSHIQSLTIPNCISYDPAYAYEVAVIMHDGLERMYGEKQENVYYYITTLN
FT                   ENYHMPAMPEGAEEGIRKGIYKLETIEGSKGKVQLLGSGSILRHVREAAEILAKDYGVG
FT                   SDVYSVTSFTELARDGQDCERWNMLHPLETPRVPYIAQVMNDAPAVASTDYMKLFAEQV
FT                   RTYVPADDYRVLGTDGFGRSDSRENLRHHFEVDASYVVVAALGELAKRGEIDKKVVADA
FT                   IAKFNIDADKVNPRLA"
FT   CDS_pept        128629..130521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="ECO26_0117"
FT                   /product="pyruvate dehydrogenase,
FT                   dihydrolipoyltransacetylase component E2"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23478"
FT                   /protein_id="BAI23478.1"
FT                   /translation="MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASME
FT                   VPSPQAGIVKEIKVSVGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAA
FT                   AKDVNVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVN
FT                   VGDKVSTGSLIMVFEVAGEAGAAAPAAKQEAAPAAAPAPAAGVKEVNVPDIGGDEVEVT
FT                   EVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVE
FT                   GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREF
FT                   GVNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGE
FT                   IEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKIT
FT                   PVVFIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKK
FT                   GIIELSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVS
FT                   KSAMEPVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM"
FT   CDS_pept        130846..132270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpd"
FT                   /locus_tag="ECO26_0118"
FT                   /product="lipoamide dehydrogenase, E3 component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23479"
FT                   /protein_id="BAI23479.1"
FT                   /translation="MSTEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYNTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKALAEHGIVFGEPKTDIDKIRTWKEKVINQLTGGLAGM
FT                   AKGRKVKVVNGLGKFTGANTLEVEGENGKTVINFDNAIIAAGSRPIQLPFIPHEDPRIW
FT                   DSTDALELKEVPERLLVMGGGIIGLEMGTVYHALGSQIDVVEMFDQVIPAADKDIVKVF
FT                   TKRISKKFNLMLETKVTAVEAKEDGIYVTMEGKKAPAEPQRYDAVLVAIGRVPNGKNLD
FT                   AGKAGVEVDDRGFIRVDKQLRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVIAGKKH
FT                   YFDPKVIPSIAYTEPEVAWVGLTEKEAKEKGISYETATFPWAASGRAIASDCADGMTKL
FT                   IFDKESHRVIGGAIVGTNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNPKAKKK"
FT   CDS_pept        complement(132341..134098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECO26_0119"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23480"
FT                   /protein_id="BAI23480.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQQ
FT                   TAPDITAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLT
FT                   ASPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFIDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAENYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVREKMQTNPQIQQRRDAARERIQSASPEQRQVFKEKVQQR
FT                   PLNQQQRDNARQRVQSASPEQRQVFREKVQESRPQRLNDSNHTVRLNNEQRSAVRERLS
FT                   ERGARRQER"
FT   CDS_pept        134453..137050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="ECO26_0120"
FT                   /product="bifunctional aconitate hydratase
FT                   2/2-methylisocitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23481"
FT                   /protein_id="BAI23481.1"
FT                   /translation="MLEEYRKHVAERAAEGIAPKPLDANQMAALVELLKNPPAGEEEFL
FT                   LDLLTNRVPPGVDEAAYVKAGFLAAIAKGEAKSPLLTPEKAIELLGTMQGGYNIHSLID
FT                   ALDDAKLAPIAAKALSHTLLMFDNFYDVEEKAKAGNEYAKQVMQSWADAEWFLNRPALA
FT                   EKLTVTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNAREGIEPDQPGVVGPIKQ
FT                   IEALQQKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPHVPNKRGGGLCLGGKIAPI
FT                   FFNTMEDAGALPIEVDVSNLNMGDVIDVYPYKGEVRNHETGELLATFELKTDVLIDEVR
FT                   AGGRIPLIIGRGLTTKAREALGLPHSDVFRQAKDVAESDRGFSLAQKMVGRACGVKGIR
FT                   PGAYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLVMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKGKKNIFSG
FT                   RILEIEGLPDLKVEQAFELTDASAERSAAGCTIKLNKEPIIEYLNSNIVLLKWMIAEGY
FT                   GDRRTLERRIQGMEKWLANPELLEADADAEYAAVIDIDLADIKEPILCAPNDPDDARPL
FT                   SAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGY
FT                   YSVFGKSGARIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAA
FT                   VAALIGKLPTPEEYQTYVAQVDKTAVDTYRYLNFNQLSQYTEKADGVIFQTAV"
FT   CDS_pept        137225..137587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="ECO26_0121"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23482"
FT                   /protein_id="BAI23482.1"
FT                   /translation="MDYEFLRDITGVVKVRMSMGHEVVGHWFNEEVKENLALLDEVEQA
FT                   AHALKGSERSWQRAGHEYTLWMDGEEVMVRANQLEFAGDEMEEGMNYYDEESLSLCGVE
FT                   DFLQVVAAYRNFVQQK"
FT   CDS_pept        complement(137625..138419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="ECO26_0122"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23483"
FT                   /protein_id="BAI23483.1"
FT                   /translation="MKKLKLHGFNNLTKSLSFCIYDICYAKTAEERDGYIAYIDELYNA
FT                   NRLTEILSETCSIIGANILNIARQDYEPQGASVTILVSEEPVDPKLIDKTEHPGPLPET
FT                   VVAHLDKSHICVHTYPESHPEGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTI
FT                   DYRVRGFTRDINGMKHFIDHEINSIQNFMSDDMKALYDMVDVNVYQENIFHTKMLLKEF
FT                   DLKHYMFHTKPEDLTDSERQEITAALWKEMREIYYGRNMPAV"
FT   CDS_pept        complement(138435..139301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="ECO26_0123"
FT                   /product="spermidine synthase"
FT                   /note="putrescine aminopropyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23484"
FT                   /protein_id="BAI23484.1"
FT                   /translation="MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGR
FT                   VMALDGVVQTTERDEFIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESI
FT                   TMVEIDAGVVSFCRQYLPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPI
FT                   GPGESLFTSAFYEGCKRCLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAA
FT                   IPTYYGGIMTFAWATDNDALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQD
FT                   ALASQPS"
FT   CDS_pept        complement(139407..139754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacC"
FT                   /locus_tag="ECO26_0124"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23485"
FT                   /protein_id="BAI23485.1"
FT                   /translation="MKTFFRTVLFGSLMAVCANSYALSESEAEDMADLTAVFVFLKNDC
FT                   GYQNLPNGQIRRALVFFAQQNQWDLSNYDTFDMKALGEDSYRDLSGIGIPVAKKCKALA
FT                   RDSLSLLAYVK"
FT   CDS_pept        139920..141470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueO"
FT                   /locus_tag="ECO26_0125"
FT                   /product="multicopper oxidase"
FT                   /note="laccase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23486"
FT                   /protein_id="BAI23486.1"
FT                   /translation="MQRRDFLKYSVALGVASALPLWSRAVFAAERPTLPIPDLLTTDAR
FT                   NRIQLTIGAGQSTFGEKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHG
FT                   LEVPGEVDGGPQGIILPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIE
FT                   DDEILKLMLPKQWGIDDVPVIVQDKKFNADGQIDYQLDVMTAAVGWFGDTLLTNGAIYP
FT                   QHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERF
FT                   EVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPAL
FT                   PSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHSQMMGHMGHGNMNHMNHG
FT                   GKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSEN
FT                   GKPPAAHRAGWKDTVKVEGNVSEVLVKFNHNAPKEHAYMAHCHLLEHEDTGMMLGFTV"
FT   CDS_pept        complement(141517..143907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcd"
FT                   /locus_tag="ECO26_0126"
FT                   /product="glucose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23487"
FT                   /protein_id="BAI23487.1"
FT                   /translation="MAINNTGSRRLLVTLTALFAALCGLYLLIGGGWLVAIGGSWYYPI
FT                   AGLVMLGVAWMLWRSKRAALWLYAALLLGTMIWGVWEVGFDFWALTPRSDILVFFGIWL
FT                   ILPFVWRRLVIPASGAVAALVVALLISGSILTWAGFNDPQEINGTLSADATPAEAISPV
FT                   ADQDWPAYGRNQEGQRFSPLKQINADNVHNLKEAWVFRTGDVKQPNDPGEITNEVTPIK
FT                   VGDTLYLCTAHQRLFALDAASGKEKWHYDPELKTNESFQHVTCRGVSYHEAKAETASPE
FT                   VMADCPRRIILPVNDGRLIAINAENGKLCETFANKGVLNLQSNMPDTKPGLYEPTSPPI
FT                   ITDKTIVMAGSVTDNFSTRETSGVIRGFDVNTGELLWAFDPGAKDPNAIPSDEHTFTFN
FT                   SPNSWAPAAYDAKLDLVYLPMGVTTPDIWGGNRTPEQERYASSILALNATTGKLAWSYQ
FT                   TVHHDLWDMDLPAQPTLADITVNGQKVPVIYAPAKTGNIFVLDRRNGELVVPAPEKPVP
FT                   QGAAKGDYVTPTQPFSELSFRPKKDLSGADMWGATMFDQLVCRVMFHQMRYEGIFTPPS
FT                   EQGTLVFPGNLGMFEWGGISVDPNREVAIANPMALPFVSKLIPRGPGNPMEQPKDAKGT
FT                   GTESGIQPQYGVPYGVTLNPFLSPFGLPCKQPAWGYISALDLKTNEVVWKKRIGTPQDS
FT                   MPFPMPVPVPFNMGMPMLGGPISTAGNVLFIAATADNYLRAYNMSNGEKLWQGRLPAGG
FT                   QATPMTYEVNGKQYVVISAGGHGSFGTKMGDYIVAYALPDDVK"
FT   CDS_pept        144113..144649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="ECO26_0127"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23488"
FT                   /protein_id="BAI23488.1"
FT                   /translation="MKHTVEVMIPEAEIKARIAELGRQITERYKDSGSDMVLVGLLRGS
FT                   FMFMADLCREVQVSHEVDFMTASSYGSGMSTTRDVKILKDLDEDIRGKDVLIVEDIIDS
FT                   GNTLSKVREILSLREPKSLAICTLLDKPSRREVNVPVEFIGFSIPDEFVVGYGIDYAQR
FT                   YRHLPYIGKVILLDE"
FT   CDS_pept        complement(144690..145352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="ECO26_0128"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23489"
FT                   /protein_id="BAI23489.1"
FT                   /translation="MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDS
FT                   RVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGV
FT                   QAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTI
FT                   MQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK"
FT   CDS_pept        145461..146387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadG"
FT                   /locus_tag="ECO26_0129"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23490"
FT                   /protein_id="BAI23490.1"
FT                   /translation="MTIALELQQLKKTYPGGVQALRGIDLQVEAGDFYALLGPNGAGKS
FT                   TTIGIISSLVNKTSGRVSVFGYDLEKDVVNAKRQLGLVPQEFNFNPFETVQQIVVNQAG
FT                   YYGVERKEAYIRSEKYLKQLDLWGKRNERARMLSGGMKRRLMIARALMHEPKLLILDEP
FT                   TAGVDIELRRSMWGFLKDLNDKGTTIILTTHYLEEAEMLCRNIGIIQHGELVENTSMKA
FT                   LLAKLKSETFILDLAPKSPLPKLDGYQYRLVDTATLEVEVLREQGINSVFTQLSEQGIQ
FT                   VLSMRNKANRLEELFVSLVNEKQGDRA"
FT   CDS_pept        146384..147154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadH"
FT                   /locus_tag="ECO26_0130"
FT                   /product="predicted transporter subunit"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23491"
FT                   /protein_id="BAI23491.1"
FT                   /translation="MMHLYWVALKSIWAKEIHRFMRIWVQTLVPPVITMTLYFIIFGNL
FT                   IGSRIGDMHGFSYMQFIVPGLIMMSVITNAYANVASSFFGAKFQRNIEELLVAPVPTHV
FT                   IIAGYVGGGVARGLFVGILVTAISLFFVPFQVHSWVFVALTLVLTAVLFSLAGLLNGVF
FT                   AKTFDDISLVPTFVLTPLTYLGGVFYSLTLLPPFWQGLSHLNPIVYMISGFRYGFLGIN
FT                   DVPLVTTFGVLVVFIVAFYLICWSLIQRGRGLRS"
FT   CDS_pept        147259..147699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECO26_0131"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23492"
FT                   /protein_id="BAI23492.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDLAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGGPEVSSLWHQQQKNPPFVLKHNLYEY"
FT   CDS_pept        147763..148992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadE"
FT                   /locus_tag="ECO26_0132"
FT                   /product="predicted polysaccharide deacetylase lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23493"
FT                   /protein_id="BAI23493.1"
FT                   /translation="MYKQAVILLLMLFTASVSAALPARYMQTIENAAIWAQIGDKMVTV
FT                   GNIRAGQIIAVEPTAASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQN
FT                   LITWKDTPVYNAPSAGSAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALD
FT                   AQPDNGLPVLTYHHILRDEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMAQLEGY
FT                   VKNKINLPARAVVITFDDGLKSVSRYAYPVLKQYGMKATAFVVTSRIKRHPQKWNPKSL
FT                   QFMSVSELNEIRDVFDFQSHTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNP
FT                   HVWYLSYPFGGFNDKAVKAANDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETM
FT                   SRLVSNQPQG"
FT   CDS_pept        complement(148996..149376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="ECO26_0133"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23494"
FT                   /protein_id="BAI23494.1"
FT                   /translation="MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAID
FT                   IWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPN
FT                   VAYFEGDNEMKRTAKAIPVQVA"
FT   CDS_pept        149650..150552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadD"
FT                   /locus_tag="ECO26_0134"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23495"
FT                   /protein_id="BAI23495.1"
FT                   /translation="MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLH
FT                   LESGSFIEESLKGHSTDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHR
FT                   HLEADHDKLPLVVPILFYQGEATPYPLSMCWFDIFYSPELARRVYNSPFPLVDITITPD
FT                   DEIMQHRRIAILELLQKHIRQRDLMLLLEQLVTLIDEGYTSGSQLVAMQNYMLQRGHTE
FT                   QADLFYGVLRDRETGGESMMTLAQWFEEKGIEKGIQQGRQEERQEFALRLLSKGMSRED
FT                   VAEMANLPLAEIDKVINLI"
FT   CDS_pept        complement(150626..151477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="ECO26_0135"
FT                   /product="pantothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23496"
FT                   /protein_id="BAI23496.1"
FT                   /translation="MLIIETLPLLRQQIRRLRMEGKRVALVPTMGNLHDGHMKLVDEAK
FT                   ARADVVVVSIFVNPMQFDRPEDLARYPRTLQEDCEKLNKRKVDLVFAPSVKEIYPNGTE
FT                   THTYVDVPGLSTMLEGASRPGHFRGVSTIVSKLFNLVQPDIACFGEKDFQQLALIRKMV
FT                   ADMGFDIEIVGVPIIRAKDGLALSSRNGYLTAEQRKIAPGLYKVLSSIADKLQAGERDL
FT                   DEIITIAGQELNEKGFRADDIQIRDADTLLEVSETSKRAVILVAAWLGDARLIDNKMVE
FT                   LA"
FT   CDS_pept        complement(151489..152283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="ECO26_0136"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23497"
FT                   /protein_id="BAI23497.1"
FT                   /translation="MKPTTIASLQKCKQDKKRFATITAYDYSFAKLFADEGLNVMLVGD
FT                   SLGMTVQGHDSTLPVTVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVM
FT                   RAGANMVKIEGGEWLVETVKMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQL
FT                   LSDALALEAAGAQLLVLECVPVELAKRITDALAIPVIGIGAGNVTDGQILVMHDAFGIT
FT                   GGHIPKFAKNFLAETGDIRAAVRQYMAEVESGVYPGEEHSFH"
FT   CDS_pept        complement(152396..152896)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0137"
FT                   /note="predicted fimbrial-like protein, C-terminal part"
FT   CDS_pept        complement(153128..153670)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0138"
FT                   /note="predicted fimbrial-like protein, N-terminal part"
FT   CDS_pept        complement(153723..154319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadK"
FT                   /locus_tag="ECO26_0139"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23498"
FT                   /protein_id="BAI23498.1"
FT                   /translation="MHPTQRKLMKRIILFLSLQFPITYPAIAGQDIDLVANVKNSTCKS
FT                   GISNQGNIDLGVVGVGYFSDNVTPESYQPGGKEFTVTVSDCALQGTGDVLNQLHIDFRA
FT                   LSGVMAAGSRQIFANEVATGAKNVGVVLFSIQDPTNIFNVISSAGNSRSVYPVMTSALH
FT                   NSSWKFYARMQKIDPALDVISGQVMSHILVDVYYE"
FT   CDS_pept        complement(154346..154948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadL"
FT                   /locus_tag="ECO26_0140"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23499"
FT                   /protein_id="BAI23499.1"
FT                   /translation="MTFKNLRYGLSSSVVLAASLFSVPSYAATDSIGLTVITTVEIGTC
FT                   TATLVNDSDQDISVVDFGDVYISEINAKTKVKTFKLKFKDCAGIPNKKAQIKLTKRATC
FT                   EGTANDGAGFANGSTAADKASAVAVEVWSTETPATGSATQFSCVTPASQEVTISNAANA
FT                   VVYYPMSARLVVEKNKTVSNVTAGKFSAPATFTVTYN"
FT   CDS_pept        complement(154963..155532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadM"
FT                   /locus_tag="ECO26_0141"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23500"
FT                   /protein_id="BAI23500.1"
FT                   /translation="MIKITPHKIAILMGILLSPSVFATDINVEFTATVKATTCNITLTG
FT                   NNVTNDGNNNYTLRIPKMGLDKIANKTTESQADFKLVASGCSSGISWIDTTLSGNASSS
FT                   SPKLIIPQSGDSSSTTSNIGMGFKKRTTDDATFLKPNSAEKIRWSTDEMQPDKGLEMTV
FT                   ALRETDAGQGVPGNFRALATFNFIYQ"
FT   CDS_pept        complement(155549..158149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECO26_0142"
FT                   /product="probable outer membrane porin protein"
FT                   /note="involved in fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23501"
FT                   /protein_id="BAI23501.1"
FT                   /translation="MTIKPTKNYHNHLTRIATFCALLYCNSAFCAELVEYDHTFLMGQN
FT                   ASNIDLSRYSEGNPAIPGMYDVSVYVNDQPIINQSITFIEIEGKKNAQACITLKNLLQF
FT                   HINSPDINNEKAVLLARDETLGNCLNLTEIIPQASVRYDVNEQRLDIDVPQAWVMKNYQ
FT                   NYVDPSLWENGINAAMLSYNLNGYHSETPGRRNDSIYAAFNGGMNLGAWRLRASGNYNW
FT                   MTDSGSNYDFKNRYIQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTL
FT                   ASFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTVEESDG
FT                   SKRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTG
FT                   IQITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETST
FT                   SLNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKF
FT                   EKKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSASWGSYSVSAQRSWNEDGDTDDSVY
FT                   LSFTIPIEKLLGTEQRTSGFQSIDTQMSSDFKGNNQLNVSSSGYSDNARVSYSVNTGYT
FT                   MNKASKDLSYVGGYASYESPWGTLAGSVSANSDNSRQVSLSTDGGFVLHSGGLTFSNDS
FT                   FSDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVEL
FT                   KSTSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQG
FT                   GQAFVRGIEQQGNISIKWLEESKPVSCLAHYQQSSEAEKIAQSIILNGIRCQIQ"
FT   CDS_pept        complement(158184..158924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0143"
FT                   /product="probable pilin chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23502"
FT                   /protein_id="BAI23502.1"
FT                   /translation="MFFNTKHTTALCFVTCMAFSSSSIADIVISGTRVIYKSDQKSVNV
FT                   RLENKGNNPLLVQSWLDTGDDNAEPGSITVPFTATPPVSRIDAKRGQTIKLMYTASTSL
FT                   PKDRESVFWFNVLEVPPKPDAEKVANQSLLQLAFRTRIKLFYRPDGLKGNPSEAPLALK
FT                   WFWSGSEGKASLRVTNPTPYYVSFSSGDLEASGKRYPIDVKMIAPFSDEVMKVTGLNGK
FT                   ASSAKVHFYAINDFGGAIEGNASL"
FT   CDS_pept        complement(159029..159613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadN"
FT                   /locus_tag="ECO26_0144"
FT                   /product="putative fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23503"
FT                   /protein_id="BAI23503.1"
FT                   /translation="MSKKLGFALSGLMLAMVAGTASADMDGGQLNISGLVVDNTCETRV
FT                   DGGNKDGLILLQTATVGEIDAGVLNDTVGAKAKPFSITVDCSKANPNPGSTAKMTFGSV
FT                   FFGNSKGTLNNDMSINNPSDGVNIALHNIDGSTIKQVQINNPGDVYTKALDATTKSAVY
FT                   DFKASYVRAVADQTATAGYVKTNTAYTITYQ"
FT   CDS_pept        complement(159983..160462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="ECO26_0145"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihyropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23504"
FT                   /protein_id="BAI23504.1"
FT                   /translation="MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILAVSSFYRTPP
FT                   LGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGN
FT                   EVINTERLTVPHYDMKNRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW"
FT   CDS_pept        complement(160459..161823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnB"
FT                   /locus_tag="ECO26_0146"
FT                   /product="poly(A) polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23505"
FT                   /protein_id="BAI23505.1"
FT                   /translation="MLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLN
FT                   KAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGP
FT                   EIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVAD
FT                   FTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPR
FT                   LATLLNDIPPARLFEESLKLLQAGYGYDTYKLLCEYHLFQPLFPTITRYFTENGDSPME
FT                   RIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMND
FT                   VLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEV
FT                   ERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA"
FT   CDS_pept        complement(161916..162842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadB"
FT                   /locus_tag="ECO26_0147"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23506"
FT                   /protein_id="BAI23506.1"
FT                   /translation="MLPPYFLFKEMTDTQYIGRFAPSPSGELHFGSLIAALGSYLQARA
FT                   RQGRWLVRIEDIDPPREVPGAAETILRQLEHYGLHWDGDVLWQSQRHHAYREALAWLHE
FT                   QGLSYYCTCTRARIQSIGGIYDGHCRVLHHGPDNAAVRIRQQHPVTQFTDQLRGIIHAD
FT                   EKLAREDFIIHRRDGLFAYNLAVVVDDHFQGVTEIVRGADLIEPTVRQISLYQLFGWKV
FT                   PDYIHLPLALNPQGAKLSKQNHAPALPKGDPRPVLIAALQFLGQQAEAHWQDFSVEQIL
FT                   QSAVKNWRLTAVPESAIVNSTFSNASC"
FT   CDS_pept        complement(162879..163334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="ECO26_0148"
FT                   /product="DNA-binding transcriptional regulator DskA of
FT                   rRNA transcription, DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23507"
FT                   /protein_id="BAI23507.1"
FT                   /translation="MQEGQNRKTSSLSILAIAGVEPYQEKPGEEYMNEAQLAHFRRILE
FT                   AWRNQLRDEVDRTVTHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLK
FT                   KVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG"
FT   CDS_pept        complement(163512..164216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="ECO26_0149"
FT                   /product="predicted DNA-binding transcriptional regulator
FT                   SfsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23508"
FT                   /protein_id="BAI23508.1"
FT                   /translation="MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCA
FT                   TPGDTVWYSTSDNTKRKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGY
FT                   SSLKSEVKYGAERSRIDFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRE
FT                   LMSVAAEGQRAVIFFAVLHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAE
FT                   GMALKKSLPVTL"
FT   CDS_pept        complement(164231..164761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="ECO26_0150"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23509"
FT                   /protein_id="BAI23509.1"
FT                   /translation="MSEPQRLFFAIDLPAEIREQIIHWRATHFPPEAGRPVAADNLHLT
FT                   LAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLAN
FT                   MLRSQAARSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYAVTEFTLYASSFARGR
FT                   TRYTPLKRWALTQ"
FT   CDS_pept        164835..167264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpB"
FT                   /locus_tag="ECO26_0151"
FT                   /product="predicted ATP-dependent helicase HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23510"
FT                   /protein_id="BAI23510.1"
FT                   /translation="MSSLPVAAVLPELLTALDCAPQVLLSAPTGAGKSTWLPLQLLAHP
FT                   GINGKIILLEPRRLAARNVAQRLAELLNEKPGDTVGYRMRAQNCVGPNTRLEVVTEGVL
FT                   TRMIQRDPELSGVGLVILDEFHERSLQADLALALLLDVQQGLRDDLKLLIMSATLDNDR
FT                   LQQMLPEAPVVISEGRSFPVERRYLPLPTHQRFDEAVAVATAEMLRQESGSLLLFLPGV
FT                   GEIQRVQEQLASRIGSDVLLCPLYGALSLNDQRKAILPAPQGMRKVVLATNIAETSLTI
FT                   EGIRLVVDCAQERVARFDPRTGLTRLITQRVSQASMTQRAGRAGRLEPGICLHLIAKEQ
FT                   AERAAAQSEPEILQSDLSGLLMELLQWGCSDPAQMSWLDQPPVVNLLAAKRLLQMLGAL
FT                   EGERLSAQGQKMAALGNDPRLAAMLVSAKNDDEAATAAKIAAILEEPPRMGNSDLGVAF
FT                   SRNQPAWQQRSQQLLKRLNVRGGEADSSLIAPLLAGAFADRIARRRGQDGRYQLANGMG
FT                   AMLDANDALSRHEWLIAPLLLQGSASPDARILLALPVDIDELVQRCPQLVQQSDTVEWD
FT                   DAQGTLKAWRRLQIGLLTVKVQPLAKPSEDELHQAMLNGIRDKDLSVLNWTAEAEQLRL
FT                   RLLCAAKWLPEYDWPAVDDESLLATLETWLLPHMTGVHSLRGLKSLDIYQALRGLLDWG
FT                   MQQRLDSELPAHYTVPTGSRIAIRYHEDNPPALAVRMQEMFGEATNPTIAQGRVPLVLE
FT                   LLSPAQRPLQITRDLSAFWKGAYREVQKEMKGRYPKHVWPDDPANTAPTRRTKKYS"
FT   CDS_pept        167396..169930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcB"
FT                   /locus_tag="ECO26_0152"
FT                   /product="fused glycosyl transferase and transpeptidase"
FT                   /note="penicillin-binding protein 1b"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23511"
FT                   /protein_id="BAI23511.1"
FT                   /translation="MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEP
FT                   MPRKGKGKGKGRKPRGKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPA
FT                   AVYGRMVNLEPDMTISKNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPD
FT                   SKEGQVRARLTFDGDHLATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFP
FT                   DLLVDTLLATEDRHFYEHDGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSE
FT                   RSYWRKANEAYMALIMDARYSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVE
FT                   ELSLDQQALLVGMVKGASIYNPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPL
FT                   GVQPRGGVISPQPAFMQLVRQELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGI
FT                   PALKKQRKLSDLETAIVVVDRFSGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATY
FT                   LTALSQPKIYRLNTWIADAPIALRQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVP
FT                   TVNLGMALGLPAVTETWIKLGVPKDQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRA
FT                   PLSALRSVIAEDGKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLH
FT                   LAGKTGTTNNNVDTWFAGIDGSTVTITWVGRDNNQPTKLYGASGAMSIYQRYLANQTPT
FT                   PLNLVPPEDIADMGVDYDGNFVCSGGMRVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSS
FT                   QPQQQPQQQPAQQEQKDSDGVAGWIKDMFGSN"
FT   CDS_pept        170150..172393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="ECO26_0153"
FT                   /product="ferrichrome outer membrane transporter FhuA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23512"
FT                   /protein_id="BAI23512.1"
FT                   /translation="MARSKTAQPKHSLRKIAVVVATAVSGMSVYAQAAVEPKEDTITVT
FT                   VAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMALHQPKSVKEALS
FT                   YTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAVIDPYMLERAE
FT                   IMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDFSDSLDDDGV
FT                   YSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPETGYYGWLP
FT                   KEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNLRFAENKT
FT                   SQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQLQSKFA
FT                   TGDIDHTLLSGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANSGPYRI
FT                   LNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRGGVNY
FT                   LFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAVYNL
FT                   TKTNNLMADPEGSFFSVEGGEIRARGVEIEAKAALSASVNVVGSYTYTDAEYTTDTTYK
FT                   GNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDAL
FT                   VRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF"
FT   CDS_pept        172444..173241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC"
FT                   /locus_tag="ECO26_0154"
FT                   /product="iron-hydroxamate transporter subunit FhuC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23513"
FT                   /protein_id="BAI23513.1"
FT                   /translation="MQEYTNHSDTTFALRNISFRVPGRTLLHPLSLTFPAGKVTGLIGH
FT                   NGSGKSTLLKMLGRHQPPSEGEILLDAQPLESWSSKAFARKVAYLPQQLPPAEGMTVRE
FT                   LVAIGRYPWHGALGRFGAADREKVEEAISLVGLKPLAHRLVDSLSGGERQRAWIAMLVA
FT                   QDSRCLLLDEPTSALDIAHQVDVLALVHRLSQERGLTVIAVLHDINMAARYCDYLVALR
FT                   GGEMIAQGTPAEIMRGETLEMIYGIPMGILPHPAGAAPVSFVY"
FT   CDS_pept        173241..174131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="ECO26_0155"
FT                   /product="iron-hydroxamate transporter subunit FhuD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23514"
FT                   /protein_id="BAI23514.1"
FT                   /translation="MSGLPLISRRRLLTAMALSPLLWQMNTAHAAAIDPNRIVALEWLP
FT                   VELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSA
FT                   GYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAHYEDFIR
FT                   SMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAV
FT                   SIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRTGRFQRVPAVWFYGATLSA
FT                   MHFVRVLDNAIGGKA"
FT   CDS_pept        174128..176110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="ECO26_0156"
FT                   /product="fused iron-hydroxamate transporter subunits of
FT                   ABC superfamily: membrane components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23515"
FT                   /protein_id="BAI23515.1"
FT                   /translation="MSKRIALFPALLLALLVIVATALTWMNFSQALPRSQWAQAAWSPD
FT                   IDVIEQMIFHYSLLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGVATGAQLGIT
FT                   VTTLWAIPGAMASQFAALVGACVVGLIVFGVAWGKRLSPVTLILAGLVVSLYCGAINQL
FT                   LVIFHHDQLQSMFLWSTGTLTQTDWGGVERLWPQLLGGVMLTLLLLRPLTLMGLDDGVA
FT                   RNLGLALSLARLAALSLAIVISALLVNAVGIIGFIGLFAPLLAKMLGARRLLPRLMLAS
FT                   LIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLRSISAPDMKVNDRV
FT                   AAERQHVLAFALAGGVLLLMAVVVALSFGRDAHGWTWASGALLEDLMPWRWPRIMAALF
FT                   AGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGSLGA
FT                   AVTLLIIMIAAGRGGFSPHRMLLAGMALSTAFTMLLMMLQASGDPRMAQVLTWISGSTY
FT                   NATDAQVWRTGIVMVILLAITPLCRRWLTILPLGGDTARAVGMALTPTRIALLLLAACL
FT                   TATATMTIGPLSFVGLMAPHIARMMGFRRTMPHIVISALVGGLLLVFADWCGRMVLFPF
FT                   QIPAGLLSTFIGAPYFIYLLRKQSR"
FT   CDS_pept        complement(176145..177425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="ECO26_0157"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /note="aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23516"
FT                   /protein_id="BAI23516.1"
FT                   /translation="MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLY
FT                   DVDGKAYIDYVGSWGPMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVP
FT                   TMDMVRMVNSGTEATMSAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQP
FT                   NSPGVPADFAKHTLTCTYNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPG
FT                   LRALCDEFGALLIIDEVMTGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRD
FT                   VMDALAPTGPVYQAGTLSGNPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLLEAAE
FT                   EAGIPLVVNHVGGMFGIFFTDAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFE
FT                   AGFMSVAHSMEDINNTIDAARRVFAKL"
FT   CDS_pept        177650..179071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcA"
FT                   /locus_tag="ECO26_0158"
FT                   /product="chloride channel protein ClcA, voltage-gated"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23517"
FT                   /protein_id="BAI23517.1"
FT                   /translation="MKTDTPSLETPQAARLRRRQLIRQLLERDKTPLAILFMAAVVGTL
FT                   VGLAAVAFDKGVAWLQNQRMGALVHTADNYPLLLTVAFLCSAVLAMFGYFLVRKYAPEA
FT                   GGSGIPEIEGALEDQRPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVL
FT                   DIFRLKGDGARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYTLISIKAVFIGV
FT                   IMSTIMYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLH
FT                   RVHGGNITKWVLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNFSMGMLVFIFVAR
FT                   VITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHLEAGTFAIAGMGALLA
FT                   ASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILARTLAKQEA
FT                   MQLARSKAASASENT"
FT   CDS_pept        179153..179497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadR"
FT                   /locus_tag="ECO26_0159"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23518"
FT                   /protein_id="BAI23518.1"
FT                   /translation="MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGF
FT                   QYGFTFDDQVNEGDMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKS
FT                   TCGCGSSFSI"
FT   CDS_pept        complement(179544..180167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="ECO26_0160"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23519"
FT                   /protein_id="BAI23519.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDHGPVFWVKDPTDLVVAMVTSMLTIVLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFNAEAGPLIAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AYYTFSVPLETASMMGMVVTLLIRLAAIRWHLKLPTFALDENGR"
FT   CDS_pept        complement(180205..181005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="btuF"
FT                   /locus_tag="ECO26_0161"
FT                   /product="vitamin B12 transporter subunit BtuF"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23520"
FT                   /protein_id="BAI23520.1"
FT                   /translation="MAKSLFRALVALSFLAPLWLNAAPRVITLSPANTELAFAAGITPV
FT                   GVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKV
FT                   MWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFG
FT                   INPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIP
FT                   KIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD"
FT   CDS_pept        complement(180998..181696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="ECO26_0162"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase Pfs"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23521"
FT                   /protein_id="BAI23521.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIEKRQTISLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAEACIAELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPQAIAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSLMV
FT                   ESLVQKLAHG"
FT   CDS_pept        181780..183297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="ECO26_0163"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23522"
FT                   /protein_id="BAI23522.1"
FT                   /translation="MAQIDFRKKINWHRRYRSPQGVKTEHEILRIFESDRGRIINSPAI
FT                   RRLQQKTQVFPLERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYGLDELTG
FT                   PFESIVEMSCLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAALRLR
FT                   DGEEPLNELRRKIRQDLCHFEGNAQGIRLVHTLMRMNLTWAQVGGILKYTRPAWWRGET
FT                   PETHHYLMKKPGYYLSEEAYIARLRKELNLALYSRFPLTWIMEAADDISYCVADLEDAV
FT                   EKRIFTVEQLYHHLHEAWGQHEKGSLFSLVVENAWEKSRSNSLSRSTEDQFFMYLRVNT
FT                   LNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVAVKHVFSHPDVEQL
FT                   ELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEA
FT                   VSKLPSDSPEFPLWEYYYRCRLLQDYISGMTDLYAWDEYRRLMAVEQ"
FT   CDS_pept        183427..184851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="ECO26_0164"
FT                   /product="serine endoprotease, membrane-associated"
FT                   /note="protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23523"
FT                   /protein_id="BAI23523.1"
FT                   /translation="MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPML
FT                   EKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGG
FT                   GQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLGDGRKFDAKMVGKDPRSDIA
FT                   LIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYE
FT                   NFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMV
FT                   EYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLN
FT                   GKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEG
FT                   AEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVL
FT                   ALNIQRGDSSIYLLMQ"
FT   CDS_pept        185029..186159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdaR"
FT                   /locus_tag="ECO26_0165"
FT                   /product="DNA-binding transcriptional activator CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23524"
FT                   /protein_id="BAI23524.1"
FT                   /translation="MAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLV
FT                   LSQGRVVDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAE
FT                   MMLEQSRLMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVD
FT                   SGQLGVDSAMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDAEDHRKRV
FT                   EQLITRMKEYGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPESRCYFYQDLM
FT                   LPVLLDSLRGDWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRN
FT                   TLEYRLNRISELTGLDLGNFDDRLLLYVALQLDEER"
FT   CDS_pept        complement(186248..186634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeH"
FT                   /locus_tag="ECO26_0166"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23525"
FT                   /protein_id="BAI23525.1"
FT                   /translation="MYDNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKS
FT                   VKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDL
FT                   RHLESVVTNKISEIEADLEKLTRK"
FT   CDS_pept        complement(186796..187608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeI"
FT                   /locus_tag="ECO26_0167"
FT                   /product="predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23526"
FT                   /protein_id="BAI23526.1"
FT                   /translation="MISRRRLLQATAATIATSSGFGYMHYWEPGWFELIRHRLAFFKDN
FT                   AAPFKILFLADLHYSRFVPLSLISDAIALGIEQKPDLILLGGDYVLFDMPLNFSAFSDV
FT                   LSPLAECAPTFACFGNHDRPVGTEKNHLIGETLKSAGITVLFNQATVIATPNRQFELVG
FT                   TGDLWAGQCKPPPASEANLPRLVLAHNPDSKEVMRDEPWDLMLCGHTHGGQLRVPLVGE
FT                   PFAPVEDKRYVAGLNAFGERHIYTTRGVGSLYGLRLNCRPEVTMLELV"
FT   CDS_pept        complement(187663..188487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="ECO26_0168"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23527"
FT                   /protein_id="BAI23527.1"
FT                   /translation="MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRV
FT                   AEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFR
FT                   VVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEI
FT                   HYGRVPAGSVVVSGNLPSKDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID"
FT   CDS_pept        complement(188518..191190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="ECO26_0169"
FT                   /product="uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23528"
FT                   /protein_id="BAI23528.1"
FT                   /translation="MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQR
FT                   WLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLS
FT                   DIDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLI
FT                   ESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSS
FT                   PGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVS
FT                   RYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILA
FT                   LPADEKPRPLDDEFQLRGTLIDLRDETLFMRQPEAILRMFYTMVRNSAITGIYSTTLRQ
FT                   LRHARRHLQQPLCNIPEARKLFLSILRHPGAVRRGLLPMHRHSVLGAYMPQWSHIVGQM
FT                   QFDLFHAYTVDEHTIRVMLKLESFASEETRQRHPLCVDVWPRLPSTELIFIAALFHDIA
FT                   KGRGGDHSILGAQDVVHFAELHGLNSRETQLVAWLVRQHLLMSVTAQRRDIQDPEVIKQ
FT                   FAEEVQTENRLRYLVCLTVADICATNETLWNSWKQSLLRELYFATEKQLRRGMQNTPDM
FT                   RERVRHHQLQALALLRMDNIDEEALHQIWSRCRANYFVRHSPNQLAWHARHLLQHDLSK
FT                   PLVLLSPQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTTRDGMAMDTFI
FT                   VLEPDGSPLSADRHEVIRFGLEQVLTQSSWQPPQPRRQPAKLRHFTVETEVTFLPTHTD
FT                   RKSFLELIALDQPGLLARVGKIFADLGISLHGARITTIGERVEDLFIIATADRRALNNE
FT                   LQQEVHQRLTEALNPNDKG"
FT   CDS_pept        complement(191252..192046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ECO26_0170"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23529"
FT                   /protein_id="BAI23529.1"
FT                   /translation="MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRIC
FT                   NDYIVNEQHTVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDG
FT                   FHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFS
FT                   VVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWT
FT                   VKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE"
FT   ncRNA           192252..192387
FT                   /gene="tff"
FT                   /locus_tag="ECO26_ncRNA02"
FT                   /note="Novel sRNA, function unknown"
FT                   /inference="similar to DNA sequence:INSD:U00096.2"
FT                   /ncRNA_class="other"
FT   CDS_pept        192414..193139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="ECO26_0171"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23530"
FT                   /protein_id="BAI23530.1"
FT                   /translation="MATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEK
FT                   TVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFEKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFV
FT                   IDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVR
FT                   EGRSQDLASQAEESFVEAE"
FT   CDS_pept        193397..194248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="ECO26_0172"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23531"
FT                   /protein_id="BAI23531.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
FT   CDS_pept        194395..195120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="ECO26_0173"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23532"
FT                   /protein_id="BAI23532.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
FT   CDS_pept        195412..195969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="ECO26_0174"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23533"
FT                   /protein_id="BAI23533.1"
FT                   /translation="MISDIRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYY
FT                   GTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLNPNSAGSDIRVPLPP
FT                   LTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKVKALLKDKEISEDDDRRSQDDVQKL
FT                   TDAAIKKIEAALADKEAELMQF"
FT   CDS_pept        196061..197257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="ECO26_0175"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23534"
FT                   /protein_id="BAI23534.1"
FT                   /translation="MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQ
FT                   CLEFSPRYAVMDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGA
FT                   AGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQP
FT                   IQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDS
FT                   ATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIA
FT                   HTMAWPNRVNSGVKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANE
FT                   ITVAAFLAQQIRFTDIAALNLSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS"
FT   CDS_pept        197443..198204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispU"
FT                   /locus_tag="ECO26_0176"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23535"
FT                   /protein_id="BAI23535.1"
FT                   /translation="MMLSATQPLSEKLPAHGCRHVAIIMDGNGRWAKKQGKIRAFGHKA
FT                   GAKSVRRAVSFAANNGIEALTLYAFSSENWNRPAQEVSALMELFVWALDSEVKSLHRHN
FT                   VRLRIIGDTSRFNSRLQERIRKSEALTAGNSGLTLNIAANYGGRWDIVQGVRQLAEKVQ
FT                   QGNLQPDQIDEEMLNQHVCMHELAPVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWP
FT                   DFDEQDFEGALNAFANRERRFGGTEPGDETA"
FT   CDS_pept        198247..199074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="ECO26_0177"
FT                   /product="CDP-diglyceride synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23536"
FT                   /protein_id="BAI23536.1"
FT                   /translation="MLIPVVIAALFLLPPVGFAIVTLVVCMLAAWEWGQLSGFTTRSQR
FT                   VWLAVLCGLLLALMLFLLPEYHRNIHQPLVEISLWASLGWWIVALLLVLFYPGSAAIWR
FT                   NSKTLRLIFGVLTIVPFFWGMLALRAWHYDENHYSGAIWLLYVMILVWGADSGAYMFGK
FT                   LFGKHKLAPKVSPGKTWQGFIGGLATAAVISWGYGMWANLDVAPVTLLICSIVAALASV
FT                   LGDLTESMFKREAGIKDSGHLIPGHGGILDRIDSLTAAVPVFACLLLLVFRTL"
FT   CDS_pept        199086..200438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="ECO26_0178"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23537"
FT                   /protein_id="BAI23537.1"
FT                   /translation="MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFG
FT                   KALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPVVPELRHHAFNNKSVGQRAAIIAAG
FT                   PVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETPDWD
FT                   AVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQI
FT                   EPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGS
FT                   PLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQYGPFNAIVEATDKTWQLMKL
FT                   TVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLP
FT                   VLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL"
FT   CDS_pept        200468..202900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamA"
FT                   /locus_tag="ECO26_0179"
FT                   /product="Omp85 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23538"
FT                   /protein_id="BAI23538.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHS
FT                   AEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGI
FT                   NGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGW
FT                   TYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRW
FT                   GYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQD
FT                   GAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQ
FT                   YSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
FT   CDS_pept        203022..203507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="skp"
FT                   /locus_tag="ECO26_0180"
FT                   /product="periplasmic chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23539"
FT                   /protein_id="BAI23539.1"
FT                   /translation="MKKWLLAAGLGLALATSAQAADKIAIVNMGSLFQQVAQKTGVSNT
FT                   LENEFKGRASELQRMETDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQAFEQD
FT                   RARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDVKDITADVLKQVK"
FT   CDS_pept        203511..204536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="ECO26_0181"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23540"
FT                   /protein_id="BAI23540.1"
FT                   /translation="MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNP
FT                   KYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSA
FT                   VIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHE
FT                   IQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDD
FT                   TIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICD
FT                   KVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQ
FT                   D"
FT   CDS_pept        204641..205096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="ECO26_0182"
FT                   /product="(3R)-hydroxymyristol acyl carrier protein
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23541"
FT                   /protein_id="BAI23541.1"
FT                   /translation="MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVS
FT                   VNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRP
FT                   VVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEATMMCARSREA"
FT   CDS_pept        205100..205888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="ECO26_0183"
FT                   /product="UDP-N-acetylglucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23542"
FT                   /protein_id="BAI23542.1"
FT                   /translation="MIDKSAFVHPTAIVEEGASIGANAHIGPFCIVGPHVEIGEGTVLK
FT                   SHVVVNGHTKIGRDNEIYQFASIGEVNQDLKYAGEPTRVEIGDRNRIRESVTIHRGTVQ
FT                   GGGLTKVGSDNLLMINAHIAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFC
FT                   IIGAHVMVGGCSGVAQDVPPYVIAQGNHATPFGVNIEGLKRRGFSREAITAIRNAYKLI
FT                   YRSGKTLDEVKPEIAELAETYPEVKAFTDFFARSTRGLIR"
FT   CDS_pept        205888..207036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="ECO26_0184"
FT                   /product="tetraacyldisaccharide-1-P synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23543"
FT                   /protein_id="BAI23543.1"
FT                   /translation="MTEQRPLTIALVAGETSGDILGAGLIRALKERVPNARFVGVAGPR
FT                   MQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRADLTKRFGELKPDIFVGIDAPDFNI
FT                   TLEGNLKKQGIKTIHYVSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKYNVPCRF
FT                   IGHTMADAMPLDPDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQT
FT                   YPDLEIVVPLVNAKRREQFERIKAEVAPDLSVHLLDGMGREAMVASDAALLASGTAALE
FT                   CMLAKCPMVVGYRMKPFTFWLAKRLVKTDYVSLPNLLAGRELVKELLQEECEPQKLAAA
FT                   LLPLLANGKTSHAMHDTFRELHQQIRCNADEQAAQAVLELAQ"
FT   CDS_pept        207033..207629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="ECO26_0185"
FT                   /product="ribonuclease HII"
FT                   /note="degrades RNA of DNA-RNA hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23544"
FT                   /protein_id="BAI23544.1"
FT                   /translation="MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLND
FT                   SKKLSEKRRLALYEEIKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEY
FT                   VLIDGNRCPKLPMPAMAVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHK
FT                   GYPTAFHLEKLAEHGATEHHRRSFGPVKRALGLAS"
FT   CDS_pept        207666..211148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="ECO26_0186"
FT                   /product="DNA polymerase III, alpha subunit DnaE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23545"
FT                   /protein_id="BAI23545.1"
FT                   /translation="MSEPRFVHLRVHSDYSMIDGLAKTAPLVKKAAALGMPALAITDFT
FT                   NLCGLVKFYGAGHGAGIKPIVGADFNVQCDLLGDELTHLTVLAANNTGYQNLTLLISKA
FT                   YQRGYGAAGPIIDRDWLIELNEGLILLSGGRMGDVGRSLLRGNRALVDECVAFYEEHFP
FT                   DRYFLELIRTGRPDEESYLHAAVELAEARGLPVVATNDVRFIDSSDFDAHEIRVAIHDG
FT                   FTLDDPKRPRNYSPQQYMRSEEEMCELFADIPEALANTVEIAKRCNVTVRLGEYFLPQF
FT                   PTGDMSTEDYLVKRAKEGLEERLAFLFPDEEERVKRRPEYDERLETELQVINQMGFPGY
FT                   FLIVMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMEKRDQVIEHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLPEIYEADEEVKALIDMARKLEGVTRNAGKHAGGVVI
FT                   APTKITDFAPLYCDEEGKHPVTQFDKSDVEYAGLVKFDFLGLRTLTIINWALEMINKRR
FT                   AKNGEPPLDIAAIPLDDKKSFDMLQRSETTAVFQLESRGMKDLIKRLQPDCFEDMIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEISYPDVQWQHESLKPVLEPTYGIILYQEQVMQIA
FT                   QVLSGYTLGGADMLRRAMGKKKPEEMAKQRSVFAEGAEKNGINAELAMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKIL
FT                   PPDINSGLYHFHVNDDGEIVYGIGAIKGVGEGPIEAIIEARNKGGYFRELFDLCARTDT
FT                   KKLNRRVLEKLIMSGAFDRLGPHRAALMNSLGDALKAADQHAKAEAIGQADMFGVLAEE
FT                   PEQIEQSYASCQPWPEQVVLDGERETLGLYLTGHPINQYLKEIERYVGGVRLKDMHPTE
FT                   RGKVITAAGLVVAARVMVTKRGNRIGICTLDDRSGRLEVMLFTDALDKYQQLLEKDRIL
FT                   IVSGQVSFDDFSGGLKMTAREVMDIDEAREKYARGLAISLTDRQIDDQLLNRLRQSLEP
FT                   HRSGTIPVHLYYQRADARARLRFGATWRVSPSDRLLNDLRGLIGSEQVELEFD"
FT   CDS_pept        211161..212120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="ECO26_0187"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase
FT                   component, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23546"
FT                   /protein_id="BAI23546.1"
FT                   /translation="MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLRE
FT                   KSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGG
FT                   IARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDT
FT                   PGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQY
FT                   STYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEA
FT                   MAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA"
FT   CDS_pept        212219..214360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcC"
FT                   /locus_tag="ECO26_0188"
FT                   /product="lysine decarboxylase 2, constitutive"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23547"
FT                   /protein_id="BAI23547.1"
FT                   /translation="MNIIAIMGPHGVFYKDEPIKELESALVAQGFQIIWPQNSVDLLKF
FT                   IEHNPRICGVIFDWDEYSLDLCSDINQLNEYLPLYAFINTHSTMDVSVQDMRMALWFFE
FT                   YALGQAEDIAIRMRQYTDEYLDNITPPFTKALFTYVKERKYTFCTPGHMGGTAYQKSPV
FT                   GCLFYDFFGGNTLKADVSISVTELGSLLDHTGPHLEAEEYIARTFGAEQSYIVTNGTST
FT                   SNKIVGMYAAPSGSTLLIDRNCHKSLAHLLMMNDVVPVWLKPTRNALGILGGIPRREFT
FT                   RDSIEEKVAATTQAQWPVHAVITNSTYDGLLYNTDWIKQTLDVPSIHFDSAWVPYTHFH
FT                   PIYQGKSGMSGERVAGKVIFETQSTHKMLAALSQASLIHIKGEYDEEAFNEAFMMHTTT
FT                   SPSYPIVASVETAAAMLRGNPGKRLINRSVERALHFRKEVQRLREESDGWFFDIWQPPQ
FT                   VDEAECWPVALGEQWHGFNDADADHMFLDPVKVTILTPGMDEQGNMSEEGIPAALVAKF
FT                   LDERGIVVEKTGPYNLLFLFSIGIDKTKAMGLLRGLTEFKRSYDLNLRIKNMLPDLYAE
FT                   DPDFYRNMRIQDLAQGIHKLIRKHDLPGLMLRAFDTLPEMIMTPHQAWQRQIKGEVETI
FT                   ALEQLVGRVSANMILPYPPGVPLLMPGEMLTKESRTVLDFLLMLCSVGQHYPGFETDIH
FT                   GAKQDEDGVYRVRVLKMAG"
FT   CDS_pept        214417..214806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="ECO26_0189"
FT                   /product="predicted lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23548"
FT                   /protein_id="BAI23548.1"
FT                   /translation="MLGLKQVHHIAIIATDYAVSKAFYCDILGFTLQSEVYREARDSWK
FT                   GDLALNGQYVIELFSFPFPPERPSRPEACGLRHLAFSVDDIDAAVAHLESHNVKCEAIR
FT                   VDPYTQKRFTFFNDPDGLPLELYEQ"
FT   CDS_pept        214871..216169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="ECO26_0190"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23549"
FT                   /protein_id="BAI23549.1"
FT                   /translation="MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGVTLR
FT                   AIHVHHGLSANADAWVTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFART
FT                   LLPGEVLVTAQHLDDQCETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGEL
FT                   EQWALAHGLRWIEDESNQDDSYDRNFLRLRVVPLLQQRWPHFAEATARSAALCAEQESL
FT                   LDELLADDLAHCQTSQGTLQIAPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQE
FT                   VALAREDASPCLRLGAFEIRRYQSQLWWIKSVTGQSETIVPWQTWLQPLELPAGLGSVQ
FT                   LTAGGDIRPPRADEAVSVRFKAAGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFY
FT                   GETLIAAAGVFVTQEGVAEGENGVSFVWQKTLS"
FT   CDS_pept        complement(216218..216472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rof"
FT                   /locus_tag="ECO26_0191"
FT                   /product="Rho-dependent transcription termination modulator
FT                   Rof"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23550"
FT                   /protein_id="BAI23550.1"
FT                   /translation="MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVS
FT                   RKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES"
FT   CDS_pept        complement(216465..216665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="ECO26_0192"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23551"
FT                   /protein_id="BAI23551.1"
FT                   /translation="MEKYCELIRKRYAEIASGDLGYVPDALGCVLKVLNEMAADDALSE
FT                   AVREKAAYAAANLLVSDYVNE"
FT   CDS_pept        216831..217376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="ECO26_0193"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23552"
FT                   /protein_id="BAI23552.1"
FT                   /translation="MALKATIYKATVNVADLDRNQFLDASLTLARHPSETQERMMLRLL
FT                   AWLKYADERLQFTRGLCADDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQAAEVAL
FT                   FTYNSRAAQIWWQQNQSKCVQFANLSVWYLDDEQLAKVSAFADRTMTLQATIQDGVIWL
FT                   SDDKNNLEVNLTAWQQPS"
FT   CDS_pept        217373..217795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECO26_0194"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23553"
FT                   /protein_id="BAI23553.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKERRLASKAQKSSVKAMRGKVRSGRE"
FT   CDS_pept        217809..218519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpE"
FT                   /locus_tag="ECO26_0195"
FT                   /product="lipoprotein NlpE"
FT                   /note="involved with copper homeostasis and adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23554"
FT                   /protein_id="BAI23554.1"
FT                   /translation="MVKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSW
FT                   RGVLPCADCEGIETSLFLEKDGTWVMNERYLGAREEPSSFASYGTWARTADKLVLTDSK
FT                   GEKSYYRAKGDALEMLDREGNPIESQFNYTLEPAQSSLPMTPMTLRGMYFYMADAATFT
FT                   DCATGKRFMVANNAELERSYLAARGHSEKPVLLSVEGHFTLEANPDTGAPTKVLAPDTA
FT                   GKFYPNKDCSSLGQ"
FT   mobile_element  218578..219854
FT                   /mobile_element_type="insertion sequence:IS621"
FT   CDS_pept        218769..219749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0196"
FT                   /product="putative IS621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23555"
FT                   /protein_id="BAI23555.1"
FT                   /translation="MEHELHYIGIDTAKEKLDVDVLRPDGRHRTKKFANTTKGHDELVS
FT                   WLKGHKIDHAHICIEATGTYMEPVAESLYDAGYIVSVINPALGKAFAQSEGLRNKTDTV
FT                   DARMLAEFCRQKRPAAWEAPHPLERALRALVVRHQALTDMHTQELNRTETAREVQRPSI
FT                   DAHLLWLEAELKRLEKQIKDLTDDDPDMKHRRKLLESIPGIGEKTSAVLLAYIGLKDRF
FT                   AHARQFAAFAGLTPRRYESGSSVRGASRMSKAGHVSLRRALYMPAMVATSKTEWGRAFR
FT                   DRLAANGKKGKVILGAMMRKLAQVAYGVLKSGVPFDASRHNPVAA"
FT   CDS_pept        complement(219952..220188)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="ECO26_0197"
FT                   /note="predicted lipoprotein, C-terminal part"
FT   CDS_pept        complement(220194..220775)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yaeF"
FT                   /locus_tag="ECO26_0198"
FT                   /note="predicted lipoprotein, N-terminal part"
FT   CDS_pept        complement(220829..222547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="ECO26_0199"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23556"
FT                   /protein_id="BAI23556.1"
FT                   /translation="MRTSQYLLSTLKETPADAEVISHQLMLRAGMIRKLASGLYTWLPT
FT                   GVRVLKKVENIVREEMNNAGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRGERPF
FT                   VLGPTHEEVITDLIRNELSSYKQLPLNFYQIQTKFRDEVRPRFGVMRSREFLMKDAYSF
FT                   HTSQESLQETYDAMYAAYSKIFSRMGLDFRAVQADTGSIGGSASHEFQVLAQSGEDDVV
FT                   FSDTSDYAANIELAEAIAPKEPRAAATQEMTLVDTPNAKTIAELVEQFNLPIEKTVKTL
FT                   LVKAVEGSSFPLVALLVRGDHELNEVKAEKLPQVASPLTFATEEEIRAVVKAGPGSLGP
FT                   VNMPIPVVIDRTVAAMSDFAAGANIDGKHYFGINWDRDVATPEVADIRNVVAGDPSPDG
FT                   QGTLLIKRGIEVGHIFQLGTKYSEALKASVQGEDGRNQILTMGCYGIGVTRVVAAAIEQ
FT                   NYDERGIVWPDAIAPFQVAILPMNMHKSFRVQELAEKLYSELRAQGIEVLLDDRKERPG
FT                   VMFADMELIGIPHTIVLGDRNLDNDDIEYKYRRNGEKQLIKTGDIVEYLVKQIKG"
FT   CDS_pept        complement(222659..223366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeB"
FT                   /locus_tag="ECO26_0200"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23557"
FT                   /protein_id="BAI23557.1"
FT                   /translation="MSSFQFEQIGVIRSPYKEKFAVPRQPGLVKSANGELHLIAPYNQA
FT                   DAVRGLEAFSHLWILFVFHQTMEGGWRPTVRPPRLGGNARMGVFATRSTFRPNPIGMSL
FT                   VELKEVVCHKDSVILKLGSLDLVDGTPVVDIKPYLPFAESLPDASASYAQSAPAAEMAV
FT                   SFTAEVEKQLLTLEKRYPQLTLFIREVLAQDPRPAYRKGEETGKTYAVWLHDFNVRWRV
FT                   TDAGFEVFALEPR"
FT   CDS_pept        complement(223363..223767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rcsF"
FT                   /locus_tag="ECO26_0201"
FT                   /product="predicted outer membrane protein RcsF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23558"
FT                   /protein_id="BAI23558.1"
FT                   /translation="MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPR
FT                   ATPVRIYTNAEELVGKPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAV
FT                   LLHSCEVTSGTPGCYRQAVCIGSALNITAK"
FT   CDS_pept        complement(223885..224700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="ECO26_0202"
FT                   /product="DL-methionine transporter subunit MetQ"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23559"
FT                   /protein_id="BAI23559.1"
FT                   /translation="MAFKFKTFAAVGALIGSLALVGCGQDEKDPNHIKVGVIVGAEQQV
FT                   AEVAQKVAKDKYGLDVELVTFNDYVLPNEALSKGDIDANAFQHKPYLDQQLKDRGYKLV
FT                   AVGNTFVYPIAGYSKKIKSLDELQDGSQVAVPNDPTNLGRSLLLLQKVGLIKLKDGVGL
FT                   LPTVLDVVENPKNLKIVELEAPQLPRSLDDAQIALAVINTTYASQIGLTPAKDGIFVED
FT                   KDSPYVNLIVTREDNKDAENVKKFVQAYQSDEVYEAANKVFNGGAVKGW"
FT   CDS_pept        complement(224740..225393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="ECO26_0203"
FT                   /product="DL-methionine transporter subunit MetI"
FT                   /note="membrane component protein of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23560"
FT                   /protein_id="BAI23560.1"
FT                   /translation="MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IIANAKLYRTVSAIVNIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPTGLIEASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK"
FT   CDS_pept        complement(225386..226417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="ECO26_0204"
FT                   /product="DL-methionine transporter subunit MetN"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23561"
FT                   /protein_id="BAI23561.1"
FT                   /translation="MIKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKS
FT                   TLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVA
FT                   LPLELDNTPKDEIKRRVTELLSLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLL
FT                   CDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQ
FT                   DTVSEVFSHPKTPLAQKFIQSTLHLDIPEDYQERLQAEPFTDCVPMLRLEFTGQSVDAP
FT                   LLSETARRFNVNNNIISAQMDYAGGVKFGIMLTEMHGTQQDTQAAIAWLQEHHVKVEVL
FT                   GYV"
FT   CDS_pept        226605..227180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="ECO26_0205"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23562"
FT                   /protein_id="BAI23562.1"
FT                   /translation="MAKSVPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKM
FT                   GFALVVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEEFR
FT                   QVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP
FT                   EAENAADWVLNSLADLPQAIKKQQKPAQ"
FT   rRNA            227542..229083
FT                   /gene="rrsH"
FT                   /locus_tag="ECO26_rRNA01"
FT                   /product="16S ribosomal RNA"
FT   tRNA            229152..229228
FT                   /gene="ileV"
FT                   /locus_tag="ECO26_tRNA001"
FT                   /product="tRNA-Ile (GAU)"
FT   tRNA            229271..229346
FT                   /gene="alaV"
FT                   /locus_tag="ECO26_tRNA002"
FT                   /product="tRNA-Ala (UGC)"
FT   rRNA            229530..232433
FT                   /gene="rrlH"
FT                   /locus_tag="ECO26_rRNA02"
FT                   /product="23S ribosomal RNA"
FT   rRNA            232526..232645
FT                   /gene="rrfH"
FT                   /locus_tag="ECO26_rRNA03"
FT                   /product="5S ribosomal RNA"
FT   tRNA            232837..232913
FT                   /gene="aspU"
FT                   /locus_tag="ECO26_tRNA003"
FT                   /product="tRNA-Asp (GUC)"
FT   CDS_pept        233076..233879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="ECO26_0206"
FT                   /product="2,5-diketo-D-gluconate reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23563"
FT                   /protein_id="BAI23563.1"
FT                   /translation="MAIPAFGLGTFRLKDDVVISSVKTALELGYRAIDTAQIYDNEAAV
FT                   GQAIAESGVPRHELYITTKIWIENLSKDKLIPSLKESLQKLRTDYVDLTLIHWPSPNDE
FT                   VSVEEFMQALLEAKKQGLTREIGISNFTIPLMEKAIAVIGAENIATNQIELSPYLQNRK
FT                   VVAWAKQHGIHITSYMTLAYGKALKDEVIARIAAKHNATPAQVILAWAMGEGYSVIPSS
FT                   TKRENLESNLKAQNLQLDAEDKKAIAALDCNDRLVSPEGLAPEWD"
FT   CDS_pept        complement(233876..234790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafC"
FT                   /locus_tag="ECO26_0207"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23564"
FT                   /protein_id="BAI23564.1"
FT                   /translation="MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKL
FT                   GVSLLNRTTRQLSLTEEGQRYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVV
FT                   LHFLMPLIKPFRERYPEVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSY
FT                   RKIIASPDYISRYGKPETIDDLKQHVCLGFTEPASLNTWPIACSDGQLHEVKYGLSSNS
FT                   GETLKQLCLSGNGIACLSDYMIDKEIVRGELVELMADKVLPVEMPFSAVYYSDRAVSTR
FT                   IRAFIDFLSEHVKTAPGGAVREA"
FT   CDS_pept        235031..235831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafD"
FT                   /locus_tag="ECO26_0208"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23565"
FT                   /protein_id="BAI23565.1"
FT                   /translation="MRKNTYAMRYVAGQPAERILPPGSFASIGQALPPGEPLSTEERIR
FT                   ILVWNIYKQQRAEWLSVLKNYGKDAHLVLLQEAQTTPELVQFATANYLAADQVPAFVLP
FT                   QHPSGVMTLSAAHPVYCCPLREREPILRLAKSALVTVYPLPDTRLLMVVNIHAVNFSLG
FT                   VDVYSKQLLPIGDQIAHHSGPVIMAGDFNAWSRRRMNALYRFAREMSLRQVRFTDDQRR
FT                   RAFGRPLDFVFYRGLNVSEASVLVTRASDHNPLLVEFSPGKPDK"
FT   CDS_pept        235909..236679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafE"
FT                   /locus_tag="ECO26_0209"
FT                   /product="predicted S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23566"
FT                   /protein_id="BAI23566.1"
FT                   /translation="MTIQSHHDHVEKQFSSQASEYLTSTVHASGRDLQRLAVRLADYPG
FT                   ASVLDMGCGAGHASFVAAQNVSTVVAYDLSAHMLDVVAQAAEVRQLKNITTRQGYAESL
FT                   PFADNAFDIVISRYSAHHWHDVGAALREVNRILKPGGRLIVMDVMSPGHPVRDIWLQTV
FT                   EALRDTSHVRNYASGEWLTLINEANLIVDNLITDKLPLEFSSWVVRMRTPEALIDAIRI
FT                   YQQSASTEVRTYFALQNDGSFTSDIIMVEAHKAA"
FT   CDS_pept        complement(236727..238085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="ECO26_0210"
FT                   /product="predicted membrane-bound lytic murein
FT                   transglycosylase D"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23567"
FT                   /protein_id="BAI23567.1"
FT                   /translation="MKAKAILLASVLLVGCQSTGNVQQHAQSLSAAGQGEAAKFTSQAR
FT                   WMDDGTSIAPDGDLWAFIGDELKMGIPENDRIREQKQKYLRNKSYLHDVTLRAEPYMYW
FT                   IAGQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRNYDAR
FT                   RDVVASTTAALNMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKSTDFWSLP
FT                   LPQETKQYVPKMLALSDILKNSKRYGVRLPTTDESRALARVHLSSPVEMAKVADMAGIS
FT                   VSKLKTFNAGVKGSTLGASGPQYVMVPKKHADQLRESLASGEIAAVQSTLVADNTPLNS
FT                   RVYTVRSGDTLSSIASRLGVSTKDLQQWNKLRGSKLKPGQSLTIGAGSSAQRLANNSDS
FT                   ITYRVRKGDSLSSIAKRHGVNIKDVMRWNSDTANLQPGDKLTLFVKNNNMPDS"
FT   CDS_pept        complement(238157..238912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="ECO26_0211"
FT                   /product="predicted hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23568"
FT                   /protein_id="BAI23568.1"
FT                   /translation="MNLNSIPAFDDNYIWVLNDEAGRCLIVDPGDAEPVLNAIAANNWQ
FT                   PEAIFLTHHHHDHVGGVKELVEKFPQIVVYGPQETQDKGTTQVVKDGETAFVLGHEFSV
FT                   IATPGHTLGHICYFSKPYLFCGDTLFSGGCGRLFEGTASQMYQSLNKLSALPDDTLVCC
FT                   AHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNERQINVFLRTEDI
FT                   DLINVINEETLLQQPEERFAWLRSKKDRF"
FT   CDS_pept        238946..239668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="ECO26_0212"
FT                   /product="predicted S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23569"
FT                   /protein_id="BAI23569.1"
FT                   /translation="MKPARVPQTVVAPDRWGDLPWGELYRKALERQLNPWFTKMYGFHL
FT                   LKIGNLSAEINCEACAVSHQVNVSAQGMPVQVQADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLRETDRVLIDDGWLVISGFNPISLMGLRKLVPVLRKTSPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHASRFHVLPWNKHGGKLLNAHIPALGCLQLIVARKRTIPLTLNPMKQSKNK
FT                   PRIRQAVGATRQYRKPQA"
FT   CDS_pept        complement(239665..240132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="ECO26_0213"
FT                   /product="ribonuclease HI"
FT                   /note="degrades RNA of DNA-RNA hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23570"
FT                   /protein_id="BAI23570.1"
FT                   /translation="MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNN
FT                   RMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLW
FT                   QRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV"
FT   CDS_pept        240197..240928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECO26_0214"
FT                   /product="DNA polymerase III, epsilon subunit DnaQ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23571"
FT                   /protein_id="BAI23571.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEL
FT                   AAHEARLDLVEKKGGSCLWRA"
FT   tRNA            241061..241137
FT                   /gene="aspV"
FT                   /locus_tag="ECO26_tRNA004"
FT                   /product="tRNA-Asp (GUC)"
FT   CDS_pept        241468..242253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafT"
FT                   /locus_tag="ECO26_0215"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23572"
FT                   /protein_id="BAI23572.1"
FT                   /translation="MNSKKLCCICVLFSLLAGCASESSIDEKKKKAQVTQSNINKNTPQ
FT                   QLTDKDLFGNETTLAVSEEDIQAALDGDEFRVPLNSPVILVQSGNRAPETIMQEEMRKY
FT                   YTVSTFSGIPDRQKPLTCNKNKDKNENEDVASAENMNWMQALRFVAAKGHQKAIIVFQD
FT                   TLQTGKYDSALKSTVWSDYKNEKLTDAISLRYLVRFTLVDVATGEWATWSPVNYEYKVL
FT                   PPLPDKNEASTTDMTEQQIMQLKQKTYKAMVKDLVNRYQ"
FT   CDS_pept        complement(242390..242869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfM"
FT                   /locus_tag="ECO26_0216"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23573"
FT                   /protein_id="BAI23573.1"
FT                   /translation="MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTE
FT                   IFYDWRMLILCFGFMSFSFLNIHVILLTIIKSFLIKKTKVVNFATDITIQLTLIFLLIA
FT                   IVIAPLIAPFVTGYVNANYHPCGNNTGIFPGAIYIKNGMKCNNEYISRKEDSAVK"
FT   CDS_pept        complement(242879..243793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23574"
FT                   /protein_id="BAI23574.1"
FT                   /translation="MAGLRNNNNTQNAQWADYVGDILRGAQPINQLVPQHPYLNDVPLI
FT                   DELRHQNTHHVILLTLDVAKKILSPITSFDYIHFITTHPSGIKDTLAWLVNAGKLMTEF
FT                   DDNGKIIFNLNALKYTKASYFEILGEKYIKITTSSPWLLEKLGKYIFSSRAPQVLELAI
FT                   GWRGALSESIKGVKFCIWFSVAWRTIEFIMSSERDLVNFLGDFSMDVAKAVIAGGVATA
FT                   IGSLASFACVSFGFPVILVGGAILLTGIVCTVVLNEIDAQCHLSEKLKYAIRDGLKRQQ
FT                   ELDKWKRENMTPFMYVLNTPPVI"
FT   CDS_pept        complement(243837..244319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0218"
FT                   /product="Hcp-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23575"
FT                   /protein_id="BAI23575.1"
FT                   /translation="MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALM
FT                   HSISRSQNVNHHELIITKPVDKSSPLLAKALSDNEKMAICEFILYRTSKAGIYQPYYKI
FT                   NLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDISWEHTLAGTNAMSKWQDRVQ"
FT   CDS_pept        complement(244343..245695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0219"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23576"
FT                   /protein_id="BAI23576.1"
FT                   /translation="MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLV
FT                   ESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPA
FT                   RTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLL
FT                   YFMQNTRKRLGPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVR
FT                   SLTENPPQASVINQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAAT
FT                   VWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALK
FT                   TRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESL
FT                   LTQYHDARAQKQNTDALEKQINERLEGVLSRWLLLKNNVMPEAATGTTAEK"
FT   CDS_pept        complement(245706..249230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0220"
FT                   /product="IcmF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23577"
FT                   /protein_id="BAI23577.1"
FT                   /translation="MFRLPTPRLLSGLKSALRPAMPRFKVSAFWLLILAWIFLLVWIWW
FT                   KGPMWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQQLEKMQKQQREEAVDP
FT                   LSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIY
FT                   APEGARGAEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQ
FT                   PLNGIILTLDLPDLLTADKRRREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGF
FT                   AALFQSLNRQDRDAILGVTFTRRAHENDDWRTELNAFWQTWVDRMNLALPDLMVAQTHT
FT                   RASLFSFSRQMQGSREPLVSLLEGLLDGENMNVMLRGVYLTSSLQRGQMDDIFTQSAAR
FT                   QYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESRAWLIRSRRRLTVFSATGG
FT                   VAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDFGNLQLPLLNPVRDATL
FT                   AYGDWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEE
FT                   KLAVLRVMRMLEDKSGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHA
FT                   ERQAGDGDAISRWTPYDKPVVSAQKELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVG
FT                   PTFDQVFTSADDNKLVVPQFITRYGLQSYFVKQRDELVELTAMDSWVLNLTRNVKYSDA
FT                   DRAEIQHQLTEQYISDYTATWRAGMDNLNIRNFESIGQLTGALEQVISGDQPLQRALTV
FT                   LRDNTQPGVFSEKLSAKEREEALAEPDYQLLTRLGHEFAPENSTLAVQKDKESTMQAVY
FT                   QQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGR
FT                   LADQAWHVVMVEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPD
FT                   GILDTFYQQNLKLFIDNDLSLEDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSF
FT                   AVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIGTSGNAP
FT                   RSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFSVDGGAMTYRVHTDTEDNPFSGGLFSQ
FT                   FGLSDTLY"
FT   CDS_pept        complement(249249..249962)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0221"
FT                   /note="conserved predicted protein, C-terminal part"
FT   CDS_pept        complement(249981..250661)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0222"
FT                   /note="conserved predicted protein, N-terminal part"
FT   CDS_pept        complement(250666..251409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0223"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23578"
FT                   /protein_id="BAI23578.1"
FT                   /translation="MSRLRVFRQTGWFIAGLMTGLPATAAPAEASSMAGVAVAVATTTP
FT                   PDATATLQAMQSCRRESAALERLDCYDRLLAPLSPSGFDGALVKAGFVGEAWTRATEQE
FT                   KRREGNTTELLVTQVPGERPTVVITTPAIGHVPPRPVLMFSCVDNITRMQVALMHPLDV
FT                   HDIAVTLNADNRALRSHWFVRENGTLLESSRGLSGIDEIKQLFGAKTLTVDTGADNAAG
FT                   KLTFNIDGLARAIAPLRDACHWAGE"
FT   CDS_pept        complement(251406..254261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0224"
FT                   /product="putative ATP-dependent Clp proteinase ATP-binding
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23579"
FT                   /protein_id="BAI23579.1"
FT                   /translation="MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQM
FT                   LAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLAS
FT                   AEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPD
FT                   ADGKGAGTLTDAADTLLARYAKNMTADARNGRLDPVLCRDHEIDLMIDILCRRRKNNPV
FT                   VVGEAGVGKSALIEGLALRIVAGHVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGL
FT                   MAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERY
FT                   LSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRT
FT                   DTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADT
FT                   VEDTQPESESESESESESESESESESESESESESESESESEQDNTGAEPADEAGSEQPE
FT                   ETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMS
FT                   VITDLTKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVL
FT                   QLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVL
FT                   LDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPET
FT                   MQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVII
FT                   EPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGA
FT                   FTADVEDAQNDESVTKDETVL"
FT   CDS_pept        complement(254270..255031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0225"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23580"
FT                   /protein_id="BAI23580.1"
FT                   /translation="MDEGSLSLPPFTGYDEKSQRDYHLALRGNSLNPMIDAATPLLGMV
FT                   MRLSTMNSQTMPEHLFAQVVTDVQAVEQLLQEQGYEPGVIISFRYILCTFIDEAALGNG
FT                   WSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIREPKRYQDLLEFLWLCFSLGFRGRY
FT                   KVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLISRLTIKHIFCGG
FT                   VVVLALFYLFYLLRLDSQTQDILHQLNKLLR"
FT   CDS_pept        complement(255036..255908)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0226"
FT                   /note="conserved predicted protein, C-terminal part"
FT   CDS_pept        complement(255905..256366)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0227"
FT                   /note="conserved predicted protein, N-terminal part"
FT   CDS_pept        complement(256369..256893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0228"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23581"
FT                   /protein_id="BAI23581.1"
FT                   /translation="MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSE
FT                   ITVTLLTEPDTNTNAEGESAAVDVQLVYLTDDSKLLAADYDQIASTPLPDVLGKKYIDH
FT                   QDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVR
FT                   QSSIEMKKEDE"
FT   CDS_pept        complement(256890..257546)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0229"
FT                   /note="conserved predicted protein, C-terminal part
FT                   (pseudogene)"
FT   CDS_pept        257682..260303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0230"
FT                   /product="Rhs core protein with extension"
FT                   /note="Rhs"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23582"
FT                   /protein_id="BAI23582.1"
FT                   /translation="MAWSRYGQLLAFTDCSGYTTRYEYDRYGQQIAVHREEGISTYSSY
FT                   NPRGQLVSQKDAQGRETRYEYSAAGDLTATVSPDGKRSTIAYDKRGRPVSVTEGGLTRS
FT                   MGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTRKLTQSEDEGL
FT                   ITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTG
FT                   ERQTVENPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTP
FT                   LVEYTRDRLHRETVRSFGSRAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNG
FT                   DLVRISGPRQTREYGYSATGRLESVRTLAPGLDIRIPYATDPAGNRLPDPELHPDSTLT
FT                   AWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDDERTHHYHYDSQHRLVFHTRI
FT                   QHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQTD
FT                   TTRIQTVYQPGSFAPLIRIETDNGEREKAQCRSLAEKIQQEGSEDGHGVVFPAELVGLL
FT                   DRLEGEIRANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALI
FT                   SEDGNTAWSAEYDEWGNQLNEENPHHLHQPYRLPGQQYDKESGLYYNRHRYYDPLQGRY
FT                   ITPDPIGLRGGWNMYQYPLNPIQVIDPMGLDAIENMTSGGLIYAVSGVPGLIAANSITN
FT                   SAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTKTFGSTIADVIGKNHEAAGDRQGQP
FT                   AKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKADNPIKAKQGSSDAS
FT                   NY"
FT   CDS_pept        260287..260457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0231"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23583"
FT                   /protein_id="BAI23583.1"
FT                   /translation="MLQIIRGKLVIFLITLCLFVVYLGFDNNSNSDIVFYGHKTPKSVE
FT                   IYLSEKILFIK"
FT   CDS_pept        260505..260768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0232"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23584"
FT                   /protein_id="BAI23584.1"
FT                   /translation="MVNNYRTHCGVVDINLNFFNDILYSVRLKNISKLENMEFCATKQR
FT                   VYFSDKNKKASYKIINYGDYYDVDYYDNNLKNEVFDWIGKWS"
FT   CDS_pept        260950..261696
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0233"
FT                   /note="Rhs, IS677, putative H repeat-associated protein,
FT                   N-terminal fragment"
FT   mobile_element  260958..262004
FT                   /mobile_element_type="insertion sequence:IS677"
FT   mobile_element  262061..263325
FT                   /mobile_element_type="insertion sequence:IS677"
FT   CDS_pept        262254..263315
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0234"
FT                   /note="RhsG, IS677, H repeat-associated protein, C-terminal
FT                   part"
FT   CDS_pept        complement(263539..264306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="ECO26_0235"
FT                   /product="predicted C-N hydrolase family amidase,
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23585"
FT                   /protein_id="BAI23585.1"
FT                   /translation="MPGLKITLLQQPLVWMDGPANLRHFDRQLEGITGRDVIVLPEMFT
FT                   SGFAMEAAASSLAQDDVVNWMTAKAQQCNALIAGSVALQTESGSVNRFLLVEPGGTVHF
FT                   YDKRHLFRMADEHLHYKAGNARVIVEWRGWRILPLVCYDLRFPVWSRNLNDYDLALYVA
FT                   NWPAPRSLHWQALLTARAIENQAYVAGCNRVGSDGNGCHYRGDSRVINPQGEIIATADA
FT                   HQATRIDAELSMAVLREYRDKFPAWRDADEFRL"
FT   CDS_pept        264460..264933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ivy"
FT                   /locus_tag="ECO26_0236"
FT                   /product="inhibitor of vertebrate C-lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23586"
FT                   /protein_id="BAI23586.1"
FT                   /translation="MGRISSGGMMFKAITTVAALVIATSAMAQDDLTISSLAKGETTKA
FT                   AFNQMVQGHKLPAWVMKGGTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSN
FT                   QMTGLFSTIDEKTSQEKLTWLNVNDALSIDGKTVLFAALTGSLENHPDGFNFK"
FT   CDS_pept        complement(264976..267420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadE"
FT                   /locus_tag="ECO26_0237"
FT                   /product="acyl coenzyme A dehydrogenase FadE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23587"
FT                   /protein_id="BAI23587.1"
FT                   /translation="MMILSILATVVLLGALFYHRVSLFISSLILLAWTASLGVAGLWSA
FT                   WVLVPLAIILVPFNFAPMRKSMISAPVFRGFRKVMPPMSRTEKEAIDAGTTWWEGDLFQ
FT                   GKPDWKKLHNYPQPRLTAEEQAFLDGPVEEACRMANDFQITHELADLPPELWAYLKEHR
FT                   FFAMIIKKEYGGLEFSAYAQSRVLQKLSGVSGILAITVGVPNSLGPGELLQHYGTDEQK
FT                   DHYLPRLARGQEIPCFALTSPEAGSDAGAIPDTGIVCMGEWQGQQVLGMRLTWNKRYIT
FT                   LAPIATVLGLAFKLSDPEKLLGGAEDLGITCALIPTTTPGVEIGRRHFPLNVPFQNGPT
FT                   RGKDVFVPIDYIIGGPKMAGQGWRMLVECLSVGRGITLPSNSTGGVKSVALATGAYAHI
FT                   RRQFKISIGKMEGIEEPLARIAGNAYVMDAAASLITYGIMLGEKPAVLSAIVKYHCTHR
FT                   GQQSIIDAMDITGGKGIMLGQSNFLARAYQGAPIAITVEGANILTRSMMIFGQGAIRCH
FT                   PYVLEEMEAAKNNDVNAFDKLLFKHIGHVGSNKVRSFWLGLTRGLTSSTPTGDATKRYY
FT                   QHLNRLSANLALLSDVSMAVLGGSLKRRERISARLGDILSQLYLASAVLKRYDDEGRNE
FT                   ADLPLVHWGVQDALYQAEQAMDDLLQNFPNRVVAGLLNVVIFPTGRHYLAPSDKLDHKV
FT                   AKILQVPNATRSRIGRGQYLTPSEHNPVGLLEEALVDVIAADPIHQRICKELGKNLPFT
FT                   RLDELAHNALAKGLIDKDEAAILVKAEESRLRSINVDDFDPEELATKPVKLPEKVRKVE
FT                   AA"
FT   CDS_pept        267660..268238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpcA"
FT                   /locus_tag="ECO26_0238"
FT                   /product="D-sedoheptulose 7-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23588"
FT                   /protein_id="BAI23588.1"
FT                   /translation="MYQDLIRNELNEAAETLANFLKDDANIHAIQRAAVLLADSFKAGG
FT                   KVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHISCVGNDFGFNDIFSRY
FT                   VEAVGREGDVLLGISTSGNSANVIKAIAAAREKGMKVITLTGKDGGKMAGTADIEIRVP
FT                   HFGYADRIQEIHIKVIHILIQLIEKEMVK"
FT   CDS_pept        268444..269211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="ECO26_0239"
FT                   /product="predicted amidotransfease"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23589"
FT                   /protein_id="BAI23589.1"
FT                   /translation="MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKG
FT                   CRTFKDPQPSFNSPIAKLVQDYPIKSCSVVAHIRQANRGEVALENTHPFTRELWGRNWT
FT                   YAHNGQLTGYKSLETGNFRPVGETDSEKAFCWLLHKLTQRYPRTPGNMAAVFKYIASLA
FT                   DELRQKGVFNMLLSDGRYVMAYCSTNLHWITRRAPFGVATLLDQDVEIDFSSQTTPNDV
FT                   VTVIATQPLTGNETWQKIMPGEWRLFCLGERVV"
FT   CDS_pept        complement(269182..269922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="ECO26_0240"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23590"
FT                   /protein_id="BAI23590.1"
FT                   /translation="MRKIALILAMLLIPCVSFAGLLGSSSSTTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICKYSGGLGPKQRQGDFKSPEGFYSVQRNQLK
FT                   PDSRYYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSIGCYAMTNQGIDEIFQFVTGALV
FT                   FGQPSVQVSIYPFRMTDANMKRHKYSNFKDFWEQLKPGYDYFEQTRKPPTVSVVNGRYV
FT                   VSKPLSHEVVQPQLASNYTLPEAK"
FT   CDS_pept        complement(270078..270281)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yafQ"
FT                   /locus_tag="ECO26_0241"
FT                   /note="predicted toxin of the YafQ-DinJ toxin-antitoxin
FT                   system, C-terminal part"
FT   CDS_pept        complement(270353..270613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinJ"
FT                   /locus_tag="ECO26_0242"
FT                   /product="predicted antitoxin of YafQ-DinJ toxin-antitoxin
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23591"
FT                   /protein_id="BAI23591.1"
FT                   /translation="MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREK
FT                   ALPFDLREPNQLTIQSIKNSEAGVDVHKAKDADDLFDKLGI"
FT   CDS_pept        270799..271572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafL"
FT                   /locus_tag="ECO26_0243"
FT                   /product="predicted lipoprotein and C40 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23592"
FT                   /protein_id="BAI23592.1"
FT                   /translation="MHDQPLLSMSLPSIPSFVLSGLLLLCLPFSSFASATTSHITFSYA
FT                   ARQRMQNRARLLKQYQTHLKKQASYIVEGNAESRRALRQHNREQIKQHPEWFPAPLKAS
FT                   DRRWQALAENNHFLSSDHLHNITEVAIHRLEQQLGKPYVWGGTRPDQGFDCSGLVFYAY
FT                   NKILEAKLPRTANEMYHYRRATIVANNDLRRGDLLFFHIHSREIADHMGVYLGDGQFIE
FT                   SPRTGETIRVSQLAEPFWQDHFLGARRILTEETIL"
FT   CDS_pept        complement(271629..271985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0244"
FT                   /product="probable HicB"
FT                   /note="involved in toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23593"
FT                   /protein_id="BAI23593.1"
FT                   /translation="MNKASNIITIKGQPAAVTFEADINAFRGKFLNVNGYCDFVATSIE
FT                   ALYREGESALDEWMADCEEDGIAPFREEEEQKRLTLRVPHHIDSRLTIVARQHSISKNQ
FT                   LIVDVLEREFSAQM"
FT   CDS_pept        complement(271978..272256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0245"
FT                   /product="probable HicA"
FT                   /note="involved in toxin-antitoxin system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23594"
FT                   /protein_id="BAI23594.1"
FT                   /translation="MIKVSALGSRHRKTFDDVMTEPPKSGIKWDDVVALIKAVGGTIKN
FT                   NNGSRRKFQIGTTKFSTHEPHPKNVMDKGAVAGLKEWFVNCVGVDYE"
FT   CDS_pept        complement(272361..274454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhA"
FT                   /locus_tag="ECO26_0246"
FT                   /product="predicted lateral flagellar system protein"
FT                   /note="FlhA-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23595"
FT                   /protein_id="BAI23595.1"
FT                   /translation="MAKTTKSFLALLRGGNLGVPLVILCILAMVILPLPPALLDILFTF
FT                   NIVLAVMVLLVAVSAKRPLEFSLFPTILLITTLMRLTLNVASTRVVLLHGHLGADAAGK
FT                   VIESFGQVVIGGNFVVGFVVFIILMIINFIVVTKGAERISEVSARFTLDAMPGKQMAID
FT                   ADLNAGLINQAQAQTRRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIG
FT                   IFKYNLSADAAFQQYVLMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLL
FT                   ASPSVLYTATGIMFVLAVVPGMPHLPFLLFSALLGFTGWRMSKRPQAAEAEEKSLETLT
FT                   RTITETSEQQVSWETIPLIEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGV
FT                   LLPEIRIRENFRLKPSQYAIFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAY
FT                   GMPVTWIQPAQKAKALNMGYQVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLAS
FT                   MAPRLAEDLSAVLNYSQLLKVYRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADV
FT                   RLALRRSITHPFVRKQELTVYTLNNELENLLTNLVNQAQQGGKVMLDSVPVDPNMLNQF
FT                   QSTMPQVKEQMKAAGKDPVLLVPPQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMG
FT                   ALS"
FT   CDS_pept        complement(274438..275577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfhB"
FT                   /locus_tag="ECO26_0247"
FT                   /product="predicted lateral flagellar export pore protein"
FT                   /note="FlhB-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23596"
FT                   /protein_id="BAI23596.1"
FT                   /translation="MADSSSEEKTEKPSAQKLRKAREEGQLPRSKDMGLAASLFAAFVV
FT                   ISSSFPWYADFVRESFISVHQYAQEINNPEVIGQFLRHHLLILGKFILTLLPMPAAALL
FT                   SSLVPGGWLFLPKKILPDFSKISPLKGIERLFSSEHLAETGKMTVKSVVVLVMLWVSLR
FT                   NNFASFLGLQALPFKLAMNEGLSLYACVMRNFVILFIFFALIDVPLAKALFTKGLKMTK
FT                   QELKEEYKNQEGKPEVKARVRRLQRQLAMGQIRKVVPKANVVITNPTHYAVALQYDSSR
FT                   AAAPFVVAKGTDEIALYIRQVAAENQVEVVEFPRLARSVYYTTQVNQQIPFQLYRAIAH
FT                   VLTYVLQMKHWREGAQPRPALNRHISIPKEVLKLDGENN"
FT   CDS_pept        complement(275567..276349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiR"
FT                   /locus_tag="ECO26_0248"
FT                   /product="predicted lateral flagellar export pore protein"
FT                   /note="FliR-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23597"
FT                   /protein_id="BAI23597.1"
FT                   /translation="MRTSDVTQLMDLALGLWFPFVRIMAFLRYVPVLDNSALTVRVRII
FT                   LSLALAIIITPLIPHPVPHDLISLNSLILTVEQILWGMLFGLMFQFLFLALQLAGQILS
FT                   FNMGMSMAVMNDPSSGASTTVLAELINVYAILLFFAMDGHLLLVSVLYKGFTYWPIGNA
FT                   LHPQTLRTIALAFSWVLASASLLALPTTFIMLIVQGCFGLLNRIAPPLNLFSLGFPINM
FT                   LAGLVCFATLLYNLPDHYLHLANFVLQQLDALKGHYGG"
FT   CDS_pept        complement(276351..276626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiQ"
FT                   /locus_tag="ECO26_0249"
FT                   /product="predicted lateral flagellar biosynthesis protein"
FT                   /note="FliQ-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23598"
FT                   /protein_id="BAI23598.1"
FT                   /translation="MMLTIDVAADIVASGIKVVILLVSVLVVPSLLVGLLVSVFQAVTQ
FT                   INEQTLSFLPRLIVTLVVLGVCGKWMIIQLHDLCIHLFTQAALLVH"
FT   CDS_pept        complement(276626..277378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiP"
FT                   /locus_tag="ECO26_0250"
FT                   /product="predicted lateral flagellar biosynthesis protein"
FT                   /note="FliP-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23599"
FT                   /protein_id="BAI23599.1"
FT                   /translation="MKRRTQLTLGLGLLALAPVALAQGGDIALLNVVTHGNTQEYSVKI
FT                   QVLILMTLVGLLPTMVLMMTCFTRFIIVLSLLRQALGLQQTPPNRILIGIALSLTMLVM
FT                   RPIWLNIYDHAVVPFENDQITLTDALSTAATPLKRFMLAQTDKKAMAQIMTIGGAKGHA
FT                   ADQDLSIVVPAYVLSELKTAFQIGFMIYIPFLVIDLIVASVLMAMGMMMLSPLIVSLPF
FT                   KLMLFVLIDGWSLTIGTLTTSIRGLGLG"
FT   CDS_pept        complement(277375..277746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiN"
FT                   /locus_tag="ECO26_0251"
FT                   /product="predicted lateral flagellar motor switching and
FT                   energizing component"
FT                   /note="FliN-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23600"
FT                   /protein_id="BAI23600.1"
FT                   /translation="MSKQEDILAGDFGLTDEVAPVAKSADAETLVTRLEDRFSDSMTLL
FT                   KRIPVTLTLEVSSVEIMLADLLNIDDDTVIELDKLAGEPLDIKVNNILLGKAEVVVVNE
FT                   KYGLRVLEFNTRDINDLAP"
FT   CDS_pept        complement(277739..278590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiM"
FT                   /locus_tag="ECO26_0252"
FT                   /product="predicted lateral flagellar export/assembly
FT                   protein"
FT                   /note="FliM-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23601"
FT                   /protein_id="BAI23601.1"
FT                   /translation="MLKYSKTPGIFKLEGNRLGRPYHRLPTLFTGNFDVIDSHLGSYFL
FT                   KKHRSNITLKKIGCEMDIINKNAELMVSQVGHLAFDIDRSLLLMLLGNFYGLESSLEEA
FT                   KAHNGLPTKTETRLKNRLALDICTLIFNLQTSGIALKLKLDSSTVITHWAYQLTFTLAG
FT                   DEESCFRILLDDAHTDFILNLIRHSEHSKPQQVAKSVNKPALIKEIIRSLPLTLNVKIA
FT                   ELSMNVADLTQIKAGDILPISLGETFPVAIGQSELFSALIVEDKDKLFLSELAGKNENS
FT                   HE"
FT   CDS_pept        278977..279963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafK"
FT                   /locus_tag="ECO26_0253"
FT                   /product="predicted lateral flagellar RpoN-interacting
FT                   regulatory protein"
FT                   /note="FhlA-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23602"
FT                   /protein_id="BAI23602.1"
FT                   /translation="MSELIATAASSINAFTLAKRVAAFNVPVLIQGETGAGKECVAKYI
FT                   HTVAFGENENAPYIGVNCAAIPENMLEATLFGYDKGAFTGAIASVPGKMELANNGTLLL
FT                   DEIGDMPLALQAKILRVLQEQQVERLGSNRQIKLNFRLIACTNKNLEQEVAAGRFREDL
FT                   YYRLAVIPITMPPLRERLNDIIPLAESFIKKYSTVLVKNITLSESTRRAMLNYRWPGNV
FT                   RQLENAIQRGMILNRDGVIYPDALGLPENDIADHSELQWPAQPAVHIAETSDLGQHGRS
FT                   AQYQYIADLMRKYQGNRSKIADLLGITPRALRYRLASMRKHGIEVFS"
FT   CDS_pept        279978..280319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiE"
FT                   /locus_tag="ECO26_0254"
FT                   /product="predicted lateral flagellar basal-body component
FT                   protein"
FT                   /note="FliE-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23603"
FT                   /protein_id="BAI23603.1"
FT                   /translation="MSITTINSTMQAQIMQDVQRMQANAQAPVLPAMTFSSTDPDVSFH
FT                   RIMQGALGHVDQFQQVAEQQQTAIDMGKSDDLAGAMIASQQASLSFSALVQVRNKIATG
FT                   FNDLMSMSI"
FT   CDS_pept        280324..281970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiF"
FT                   /locus_tag="ECO26_0255"
FT                   /product="predicted lateral flagellar basal-body M-ring and
FT                   collar protein"
FT                   /note="FliF-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23604"
FT                   /protein_id="BAI23604.1"
FT                   /translation="MNAQIKKLTLAFPAFRLRLADNKRWALMAGVGLAVAATAIIVSVL
FT                   WTGNRGYVSLYGRQENLPVSQIVTVLDGEKLTYRIDPQSGQILVPEEALSKTRMTLAAK
FT                   GVQAILPSGYELMDKDEVLGSSQFVQNVRYKRSLEGELAQSIMSLDAVESARVHLALNE
FT                   ESSFVVSDEPQNSASVVVRLHYGAKLNMDQVNAIVHLVSGSIPGLHASKVSVVDQAGNL
FT                   LTDGIGAGEAVSAATRKRDQILKDIQDKTHASVANVLDSLVGSGNYRVSVMPDLDLSTI
FT                   DETQEHYGDAPKINREESVLDSDTNQVAMGVPGSLSNRPPVAANQMTNGTEENRSPEAL
FT                   SKHSESKRDYSYDRSVQHIQHPGFAVKRLNVAVVLNQNAPALKNWKPEQTAQLTALLNN
FT                   AAGIDAQRGDNLTLSLLNFVPQAVPVEPIIPLWKDDSVLAWVRLIGCGLLALLLLFFVV
FT                   RPVMKRLTAVRAPIITPESEAVSEPWIAMPEEERKNVDLPSLPGDDSLPSQSSGLEVKL
FT                   EFLQKLAMSDTDRVAEVLRQWITSNERIDNK"
FT   CDS_pept        281948..282958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiG"
FT                   /locus_tag="ECO26_0256"
FT                   /product="predicted lateral flagellar motor switching and
FT                   energizing component protein"
FT                   /note="FliG-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23605"
FT                   /protein_id="BAI23605.1"
FT                   /translation="MSELTTNKSNSYLEQAAILLLCLGEEAAATVMQKLSREEVVRLSE
FT                   NMARLSGVKTSMARKVINNFFDEFREQSGINGASRSMLQGILNKALGTEIASSVINGIY
FT                   GDEIRSRMARLQWVEPRQLAMLISEEHLQLQAVFLAFLTPEISAAVLSYLNESVQNEIL
FT                   YRVAKLNDVNRDVVDELDRLIERGLSVLSEHGSKVKGIKQAADIVNRFQGNQQVILDQM
FT                   RERDEEVLEQLQDEMYDFFILSRQNEEVRRRLLDEVPMEDWAVALKGTEALLRRSIYAV
FT                   MPKRQAQQLEAITARLGPVPVSRIEQIRREIMGIARELEEAGEIQLQLFAEQTAE"
FT   CDS_pept        282961..283671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiH"
FT                   /locus_tag="ECO26_0257"
FT                   /product="predicted lateral flagellar biosynthesis protein"
FT                   /note="FliH-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23606"
FT                   /protein_id="BAI23606.1"
FT                   /translation="MTIETLRGRYRLHRFPPRQRAVTGEPLTTSISAADYQRQLMDGFQ
FT                   EGLQKGFAQGMTEGQEQGFSEGHQQGFAEGRRQGYTEGSLAGQQEGRKQFVEAAQPLEA
FT                   ITGKVNDFLAHIERKQREDLLQLVEKVTRQVIRCELALQPTQLLALVEEALAAFPAMPE
FT                   TLQVMLSTEEFNRLRDAVPEKVSEWGLTPSPDLPPGECRVITDKSELDIGCEHRLEQCM
FT                   TALKETLTPESQGE"
FT   CDS_pept        283664..285001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiI"
FT                   /locus_tag="ECO26_0258"
FT                   /product="predicted lateral flagellum-specific ATP
FT                   synthase"
FT                   /note="FliI-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23607"
FT                   /protein_id="BAI23607.1"
FT                   /translation="MSDFSAFDNALRSLESIPLARVAGRLVRLNGILLESVGCPLMTGQ
FT                   LCRIESANHTLIDAQAVGFNRDITYLMPFKQPVGLMAGARVFPEEKAHDILIGESCLGR
FT                   VVNGLGEPLDGKGRLNGNDLLPPLPPSVNPLTRRSVDEPLDVGVKAINGLLTIGKGQRV
FT                   GLMAGSGVGKSVLLGMITRQTKADIVVVGLIGERGREVKEFIDHSLGADGLAKSIVVVA
FT                   PADESPLMRLKATELCHSIAAWFRDRGHHVLLLVDSLTRYAMAQREIALSLGEPPATKG
FT                   YPPSAFGMIPKLVESAGNSESAGSMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLTRK
FT                   LAEAGHYPAIDIGQSISRCMNQVTSLEHQQSARALKQNYAAYMEIKPLIPLGGYVAGAD
FT                   ASVDKAVKMFPAIERFLRQEMREPASLELVQSRLQILFPGVKKAEQ"
FT   CDS_pept        285004..285438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfiJ"
FT                   /locus_tag="ECO26_0259"
FT                   /product="predicted lateral flagellar export/assembly
FT                   protein"
FT                   /note="FliJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23608"
FT                   /protein_id="BAI23608.1"
FT                   /translation="MRQIIDTLTQLQRLRDKSVKDKTVELAKQKQICAGYDNNIKALGY
FT                   LVEKTSAGAAVSVESLKNVSGYKGTLRKIIAWQEQEKTLANIKATRMQKNLTAAACEEK
FT                   VVALTLDDKRREQQESATAKAQKAVDDIAVQCWLRHKLAE"
FT   CDS_pept        285441..285836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0260"
FT                   /product="predicted glycerol-3-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23609"
FT                   /protein_id="BAI23609.1"
FT                   /translation="MKTVITFGTFDVFHVGHLRLLQRARALGERLLVGVSSDALNIAKK
FT                   GRAPVYHQDDRMAIIAGLACVDGVFLEESLEQKAEYLRGYSADILVMGDDWAGKFDSFA
FT                   YICEVVYFPRTPSVSTTGIIEVIRGLL"
FT   CDS_pept        complement(285954..286970)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0261"
FT                   /note="predicted glycosyltransferase, C-terminal part"
FT   CDS_pept        complement(287018..288397)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0262"
FT                   /note="predicted glycosyltransferase, N-terminal part"
FT   CDS_pept        complement(288576..289505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafV"
FT                   /locus_tag="ECO26_0263"
FT                   /product="predicted lateral flagellar associated protein"
FT                   /note="FliB/FliUV-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23610"
FT                   /protein_id="BAI23610.1"
FT                   /translation="MSFIECYEPEYVRKFLARHPGSPLYVRKVWKNEIRLSLSLTDIAS
FT                   CEAVLNDVRAFDLQLTYRPVEDNSAELSARDAIVNQVILSTLTLRDLTPELSLYAVGIL
FT                   LSCASKMPGRDGDILARLTTLPQALADHAKKGTLQAQYAQLPPVPQLARQLMTLLGGCA
FT                   FDWSILPESPRKASLPLQVTLLTLHDANSEALLQQQLQTQWQTTWQQHFATAPWMMRNW
FT                   LIYRVYHDMIGQTDGADYFPLVCDFYLLRTLISLWTLDGSPLRQEDIFALFAMFERWRA
FT                   SENALLVRQQIQSLCAADPLLSAFSLLT"
FT   CDS_pept        complement(289632..290060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgN"
FT                   /locus_tag="ECO26_0264"
FT                   /product="predicted lateral flagellar chaperone protein"
FT                   /note="FlgN-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23611"
FT                   /protein_id="BAI23611.1"
FT                   /translation="MSIRLQQVKALLQGIRDDDALYDSLRELLQRQRICMIRRASEELL
FT                   AVNDEITHHYEQLHGHSHQRHSLLKMLGVSVNRDGLAQVFTWLPAVQKAAAQQLWQRLE
FT                   QKAERCKAYNDKNGELLIRQYEFIQSFLGSEADFLYQE"
FT   CDS_pept        complement(290073..290351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgM"
FT                   /locus_tag="ECO26_0265"
FT                   /product="predicted lateral flagellar anti-sigma factor 28
FT                   protein"
FT                   /note="FlgM-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23612"
FT                   /protein_id="BAI23612.1"
FT                   /translation="MKITPTMPGNRPTATTAGSSQPRKTTVTTTTTLSADDITQAGLQS
FT                   AQQTLNDQQESDIDSNKVAQVQAMLASGSPQVDTEQLASDMLSFFQN"
FT   CDS_pept        complement(290432..291169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgA"
FT                   /locus_tag="ECO26_0266"
FT                   /product="predicted lateral flagellar P-ring addition
FT                   protein"
FT                   /note="FlgA-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23613"
FT                   /protein_id="BAI23613.1"
FT                   /translation="MSFQFCRRKFYFLLALALPGYAAVHPVQHSAREQVNAQVLNAASQ
FT                   KIESLAQQRQWHDYRYTFKIYIPSQIATAAPCTKTPGVTLTSPAEIALNRMNFTVSCPQ
FT                   SWQMNVAVRPDVLVPVVMTKSLVARDMPLTANDVELKPYNVSAQRRDVLMELDDAIGLS
FT                   SKHALQPGRPITKEELVSPVLVGRDQPVMIVYQSAGITASMPGVALKNGRKGEMVKVRN
FT                   ASSQRVISAMVAESGVVTTVSAE"
FT   CDS_pept        291251..291586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgB"
FT                   /locus_tag="ECO26_0267"
FT                   /product="predicted lateral flagellar rod protein"
FT                   /note="FlgB-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23614"
FT                   /protein_id="BAI23614.1"
FT                   /translation="MGISFQQALGVHPQAVKLRLERTELLTANLANVDTPNFKAKDIDF
FT                   AREMQRANNAAVDVQYRVPMQPSEDGNTVELNSEQARFSQNSMDYQSSLTFLNLQISGI
FT                   REAIEGK"
FT   CDS_pept        291589..292020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgC"
FT                   /locus_tag="ECO26_0268"
FT                   /product="predicted lateral flagellar component of
FT                   cell-proximal portion of basal-body rod"
FT                   /note="FlgC-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23615"
FT                   /protein_id="BAI23615.1"
FT                   /translation="MSFTDIYQISGSAMTAQTLRLNTVASNLANANAPASSEAQAYKAR
FT                   SPVFAAVYHHSLLAGTHRHAIDGASVQVQDVLQTGGAVKRYEPHSPLADANGDVWYPDV
FT                   NVVEQMADMMSASRDFETNVDVLNNVKSMQQSLLKLGEA"
FT   CDS_pept        292020..292733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgD"
FT                   /locus_tag="ECO26_0269"
FT                   /product="predicted lateral flagellar hook assembly
FT                   protein"
FT                   /note="FlgD-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23616"
FT                   /protein_id="BAI23616.1"
FT                   /translation="MNTLALNAQSPQPTATAESNNVAASDTQSSSDSSPVDTFLTLFVA
FT                   EIQNQDPTDPTDATEYIDQLSSMAQVAMMEEMSVQANTNAVLMSNIQVMALGNLVGDDI
FT                   MVQTTALQVSDQTINGRATLDDACTTADLHFTDAAGDDYTVSLIPEGSSSVGPGQVDFS
FT                   VNPADYGIPPGDYDVSVVTNTGEEEVPIEVSGEVEDVRIPLDGSSPVLNVAGVGEVPFT
FT                   MISQFGVPDADSDVA"
FT   CDS_pept        292757..293959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgE"
FT                   /locus_tag="ECO26_0270"
FT                   /product="predicted lateral flagellar hook protein"
FT                   /note="FlgE-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23617"
FT                   /protein_id="BAI23617.1"
FT                   /translation="MSYEIAATGLNAVNEQLDGISNNIANAGTVGYKSMTTQFSAMYAG
FT                   SQAMGVSVAGTAQSISRGGSLVSTGNALDLAINDDGFFVMCDSAGNISYTRAGSFETDK
FT                   NGYIVNASGAYLQGYPVDDTGTLQTGTVTDIQIKTGNIPAQASSSLTFTANFNASDEAI
FT                   DRTTVPFDATNSSSYTDSYTTTVYDSLGNEHSVCQYFTKTSDNTWEVQYTFDGQQQTGV
FT                   PATTLTFDPNTGKLTSPTTPQTIEFQTDAAAPVDLTVDYSTCTQYGSEFSVTTNAANGY
FT                   ASATQNGVQVDDDGKVYATYSNGERMLQGQVVLATFPNENGLEAVSGTAWVQTGESGTP
FT                   LIGVPGSGTCGTLSSGVLESSNVDITSELVNLMTAQRNYQANTKVIATSTQLDDALFQA
FT                   M"
FT   CDS_pept        293959..294696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgF"
FT                   /locus_tag="ECO26_0271"
FT                   /product="predicted lateral flagellar component of
FT                   cell-proximal portion of basal-body rod"
FT                   /note="FlgF-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23618"
FT                   /protein_id="BAI23618.1"
FT                   /translation="MDRLIYTALSGASQTLYEQQISANNLANVNTNGFRADMAMATNDK
FT                   VKGGGFDTRYMAQEGASGVNDSTGVAEKTERPLDVAIQGAGYIAVQDKNGNEVYTRNGN
FT                   IQQDDQGQLTIDGNLVLGDNGPIILPPNAIASFGSDGTLSVTPDDGDVTATMDIDRLKL
FT                   VDIPVANLEKNAEGMLVTADGVPAQRDENIKVSGGFLEGSNVSAVSEMMSSIAMNRQFE
FT                   AQIKMMKTAEDISDAGNRLLRGS"
FT   CDS_pept        294775..295560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgG"
FT                   /locus_tag="ECO26_0272"
FT                   /product="predicted lateral flagellar component of
FT                   cell-distal portion of basal-body rod"
FT                   /note="FlgG-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23619"
FT                   /protein_id="BAI23619.1"
FT                   /translation="MNAALWISKTGLSAQDAEMSAIANNIANVNTTGFKRDRVMFQDLF
FT                   YQTQEAPGAMLDQNNIMPTGLQFGSGVRIVGTQKTFTEGNVETTDNAMNVAIMGQGFLQ
FT                   VQKANGDIAYTRDGNLQVNADGVLTNSQGLPLQPEIDVPAGATNVAFGEDGTVTAILPG
FT                   DSDVTELGQLTLVNFANPAGLSAEGDNLYLETAASGQPTEGVPGEDGLGTLQDNALEGS
FT                   NVDIVNEMVAMITVQRAYEMNAKMVSAADDMLQYISQTL"
FT   CDS_pept        295568..296308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgH"
FT                   /locus_tag="ECO26_0273"
FT                   /product="predicted lateral flagellar protein of basal-body
FT                   outer-membrane L ring"
FT                   /note="FlgH-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23620"
FT                   /protein_id="BAI23620.1"
FT                   /translation="MSDATLTRLIRPTKAHNSLYLNRQNVKNYLWLVALLPLLSGCESQ
FT                   AILVKKDDAYFAPPKTEAPPPADGRAGGVFETGYNWSLTADRRAYRVGDILTVILEEST
FT                   QSSKQAKTNFGKSNTVDIGAPTIFSHTKDKLSGSIDANRDFDGSATSQQQNSLRGEITV
FT                   SVHAVQPNGILEIRGEKWLTLNQGDEYIRLSGLVRADDIQNDNSVSSQRIADACISYAG
FT                   RGALSDANAAGWLTRLFNHPLFPI"
FT   CDS_pept        296323..297423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgI"
FT                   /locus_tag="ECO26_0274"
FT                   /product="predicted lateral flagellar P-ring protein"
FT                   /note="FlgI-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23621"
FT                   /protein_id="BAI23621.1"
FT                   /translation="MQNWIKAAVIAVSLALPGVALAQSLESLVNVQGVRENQLVGYSLV
FT                   VGLDGTGDKNQVKFTNQTITNMLRQFGVQLPNKIDPKVKNVAAVAVSATLPPMYSRGQT
FT                   IDVTVSSIGDAKSIRGGTLLLTQLHGADGEVYALAQGSVVVGGMNATGASGSSVTVNTP
FT                   TAGLIPNGATVEREIPSDFQMGDTITLNLKRPSFKDANNIAAAINASFGGIATAQSSTN
FT                   VTVRAPTSPGARVAFMSQLDDVQVQAEKIRARVVFNSRTGTVVMGDGVALHAAAVSHGS
FT                   LTVSINETSNVSQPNAFAGGRTAVTPQSNIAVNHARPGVVSLPESSSLKTLVNALNSLG
FT                   ATPDDIMSILQALHEAGALDADLEVI"
FT   CDS_pept        297423..297722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgJ"
FT                   /locus_tag="ECO26_0275"
FT                   /product="predicted lateral flagellar peptidoglycan
FT                   hydrolase"
FT                   /note="FlgJ-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23622"
FT                   /protein_id="BAI23622.1"
FT                   /translation="MKVNASGGIDGSDALMGPKVQANDIKQAAEQFEAIFLRNMLKEMR
FT                   KTNELFDSKDNPFNSDSVRMMQGFYDDELCNTLAQQHGIGIAAMIVKQLSPKHK"
FT   mobile_element  297772..297843
FT                   /mobile_element_type="insertion sequence:IS621"
FT   CDS_pept        297976..299352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgK"
FT                   /locus_tag="ECO26_0276"
FT                   /product="predicted lateral flagellar hook-filament
FT                   junction protein"
FT                   /note="FlgK-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23623"
FT                   /protein_id="BAI23623.1"
FT                   /translation="MDMINIGYSGASTAQVELNVTAQNTANAMTTGYTRQVAEISTIGA
FT                   SGGSPNSAGNGVQVDSIRRVSNQYQVNQVWYAASDYGYYSTQQGDLSQLEAVLSDDNSS
FT                   LSGGFDNFFAALNEATTSPDDSALREQVISEAGALSLRIDNTLDYIDSQSTEIISQQQA
FT                   MVSQINTLTSGIASYNQQIAQAEANGDNASALYDARDQMVEELSGMMDVQVNIDDQGNY
FT                   NVTLKNGQPLVSGQQSSTIALETNADGTSTMSLTFAGTTSTMTTDTGGSLGALFDYQND
FT                   VLTPLTDTINSMASQFADAVNNQLAQGYDLNGNPGEPLFIYDASNADGPLTVNPNITAD
FT                   ELAFSSSPDESGNSDNLQALINISTEPLEIANLGSVTVGQACSSIISNIGIYSQQNQTE
FT                   VDAASNVYSAAQNQQSSVSGVSMDEEAVNLITYQQIYEANLKVISAGAEIFDSVLEMCS
FT                   "
FT   CDS_pept        299367..300296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lfgL"
FT                   /locus_tag="ECO26_0277"
FT                   /product="predicted lateral flagellar hook-filament
FT                   junction protein"
FT                   /note="FlgL-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23624"
FT                   /protein_id="BAI23624.1"
FT                   /translation="MRVTTQQTYVSMTQSFNNLSGDLAHVVEQMATGKQILQPSDDPIA
FT                   ATRITQLNRQQSAIEQYQSNIDSASAGLSQQESILDGVNNSLLAVRDDLLEAANGTNTA
FT                   DSLASLGQDIESLTESMVAALNYQDEDGHYVFGGTINDQPPIVAVDDDGDGVTDSYSYQ
FT                   GNSDHRQTTVSNGVEVDTNVAASDFFGSNLDVLNTLNSLSQELQNPDVDPADPQVQSDI
FT                   QNAVDVVDTASDDLNASIASLGETQNTMSMLSDAQTDISTSNDELIGSLQDLDYGPASI
FT                   TFTGLEVAMEVTLKTYSKVSELNLFSVL"
FT   CDS_pept        300313..301290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafW"
FT                   /locus_tag="ECO26_0278"
FT                   /product="predicted lateral flagellar hook associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23625"
FT                   /protein_id="BAI23625.1"
FT                   /translation="MQVGLTSSSLATGGAHSAAVSSSTVAPTQAVRQKLPATASEYPAS
FT                   PLITTRPQRYSVQLNDQLTTLQQADHYLGQLEQQLLDYRHSQRKGGQAQNTALMQMLDK
FT                   RTALSGGAVDRQLQPVLQGEARVTFHSPDLANLVHNPTPGTRMFSVSDGRQTQLSAVML
FT                   SEDDSAAQYQTRLTNALRRVGVQLHQQADGISFSTTEKQWPHIERTLSVRTDGDKSAFM
FT                   PLKTFAEPSEADRLAQSLQQGGAGISQTLESINQQRAQMAVQQEKARQLIDGMSRFPQT
FT                   ENAVQASENLGGVLDSANHNYQVLLQAVNGQARISSQTVRNLLG"
FT   CDS_pept        complement(301345..302187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafZ"
FT                   /locus_tag="ECO26_0279"
FT                   /product="predicted lateral flagellar putative
FT                   transmembrane regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23626"
FT                   /protein_id="BAI23626.1"
FT                   /translation="MSIIINNWRMDPSLNALIHCETGETRRLGEYHFILLEKLAKNADV
FT                   VLSRSYLCAEVWKNRIVGGNSLPTAIHALRVAIDDDGKQQNIIKTIPKKGYLCNKEYVS
FT                   LPDSSPAKKLIITDQIQETVPEEISSTTPPVPVRKKHKVIMGLALAAAVIFIGSTVGYS
FT                   HLKSTPDAPQLVKESINSPRIKIFHLSSGKENNSVPLLSQTLAPGKDKLDNLLSAHNMT
FT                   MTTYYKYVRNRLESDIVLRNQCNGSWQLTFNVEGWQNSDINSAMYQNLEKLLNTLQKC"
FT   CDS_pept        302673..303587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafA"
FT                   /locus_tag="ECO26_0280"
FT                   /product="predicted lateral flagellin"
FT                   /note="FliC-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23627"
FT                   /protein_id="BAI23627.1"
FT                   /translation="MLSINTNNASMAAVNAISKSSSSLSTSMERLATGNRINSSADDAA
FT                   GKQIANRLTAQSSGMGVALSNINDATAMLQTADSMFDEMSDVLGRMKDLSTQAANGTYS
FT                   DDDLQAMQDEYDELGQQMSDMLQNTTYGGTNLFGVSGTSNTGTDGLFQSAVTFQVGAES
FT                   SDTMTVNISSQLNTLVTDLSAISNSFSADQADTTGTAGVSGGTELTASGSANQMITSIS
FT                   TAMDDVSQIQSKLGASINRLNDTANNLTSMQDNTEVAIGNIMDTDYATEASNMTKQQVL
FT                   MQTGITMLKQSNSMSSMVSSLLQ"
FT   CDS_pept        303794..305110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafB"
FT                   /locus_tag="ECO26_0281"
FT                   /product="predicted lateral flagellar filament capping
FT                   protein"
FT                   /note="FliD-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23628"
FT                   /protein_id="BAI23628.1"
FT                   /translation="MINPRTIAQEIAYADVATQAANLQEKQTELDAESSGLDSLSSALS
FT                   DFQSAVDALNSDTDGPVTFAATSNNDSASVSANSQAQAGSYSFFVEQLAQGQQTTFSMG
FT                   DDAFSATGTFELTMGDSTMDIDLSAADQNGDGDGFIDASELVNAINDSDDNPGVSAALV
FT                   KTDGTTTIMLTSDSTGAQSAFSVSVTGHDASNDSTSAPVATDVSSAQDAIIHLGSATGP
FT                   EITNSSNTFDDVIPGVTMTFTEVSDSDSDLTTFNISEDSSASQEKVQTFVDAYNTLIDT
FT                   VDSLTTHGDDSTSAGVFAGDAGLSSLANQLDDIAHASYNGVSIVDYGITLDSHGHLQID
FT                   SDQFNDEMAKNPDGLTSIFVGDNSMVAQMDDLINTYTDSSNGIITLRQQNIDDQMSKIQ
FT                   DEGDQLTDTYNANYDRYLEEYTNTLVEVYTMKASMAAFA"
FT   CDS_pept        305133..305525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafC"
FT                   /locus_tag="ECO26_0282"
FT                   /product="predicted lateral flagellar protein, potentiates
FT                   polymerization"
FT                   /note="FliS-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23629"
FT                   /protein_id="BAI23629.1"
FT                   /translation="MYQVQDGYSQYKEIDLAARTAAASPLELVLVLFSGLMDELERAKS
FT                   HIEGRRFEKKAQSINKCIDILNALTSSLEFETGGELVVNLSRLYDHCVYRLYEASGELS
FT                   AEKIDEVMLILSNLREGWEGLSGKLG"
FT   CDS_pept        305572..305841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafD"
FT                   /locus_tag="ECO26_0283"
FT                   /product="predicted lateral flagellar chaperone protein"
FT                   /note="FliT-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23630"
FT                   /protein_id="BAI23630.1"
FT                   /translation="MNEALDKQRWRRLPALHQQLIRQFHDYAAAETDAAQLDAVKARLY
FT                   DAFNALIKRREQRAEVLKARMEQHQRHQEGVLAYSIVNLLSEKS"
FT   CDS_pept        305838..306899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafE"
FT                   /locus_tag="ECO26_0284"
FT                   /product="predicted lateral flagellar hook-length control
FT                   protein"
FT                   /note="FliK-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23631"
FT                   /protein_id="BAI23631.1"
FT                   /translation="MNPTLLATLGTLAETASLKADILPPVSGENAPAFTLPKMAVAAVA
FT                   ERVHSAKTSQQQATRPQENDPVAMQALMALLLPQPAAPHQDTPQPRNVATSPVIQQLTK
FT                   AVVQNAPQRQTQQQELTPLPPQLQELISQLPQAKPEQQARLATYASEDLHAITPTQPRV
FT                   STQPARPKSELTRVTARPQVERKTEKVPDSEPVIARAVLQVKTPELLSDHQEIVAKPAT
FT                   LSMDELGEKLTTLLKDQIHFQLNKQQQISTIRLDPPSLGKLEIAVQLDNGKLMVHIGAN
FT                   QSEVCRALQQFSDDLRQHLTAQNFMEVNVQVSSEGQSQQQQQSGHQQEEVSAALQLDDA
FT                   PQFQQNESVLIKV"
FT   CDS_pept        306907..307374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafF"
FT                   /locus_tag="ECO26_0285"
FT                   /product="predicted lateral flagellar biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23632"
FT                   /protein_id="BAI23632.1"
FT                   /translation="MKKIVVAGVVSAVLALVVGAGAGWGVWHHYAGKGKPTAAAQTETV
FT                   ETLDESKSVFVTLPETIVTLHDNNGADHYLSAELVMVVASDKEAEKIKHQEPLYQSIAV
FT                   ECLTEMKFEDLRGMKISAIRKLISDALKKDLQRRKMSAPYKDLLVKKVVFQ"
FT   CDS_pept        307394..308110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafS"
FT                   /locus_tag="ECO26_0286"
FT                   /product="predicted RNA polymerase, sigma 28 factor"
FT                   /note="sigma F; FliA-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23633"
FT                   /protein_id="BAI23633.1"
FT                   /translation="MLQDVFESEEFAAAPVLTPQQESHYLQAYLPLVRKVVRQLAPQCN
FT                   CIIDRQDMEQTALMGLLNAIRRYGLPDEGFAGYAVHRIRGAILDELRALDWRPRQLRQK
FT                   YHQMKDLIRETRKKLGHEPEWSELAVEGISHEDYLEYQQLEGAETLASLDELLNGEGPG
FT                   IPLVGRELEDQFVTQQMLQQALSQLSEKEQLILSMYYQHEMNLKEIALVLGLTEARICQ
FT                   LNKQIAQKIRDFVYPN"
FT   CDS_pept        308123..308986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafT"
FT                   /locus_tag="ECO26_0287"
FT                   /product="predicted lateral flagellar motor protein"
FT                   /note="MotA-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23634"
FT                   /protein_id="BAI23634.1"
FT                   /translation="MQKILGLLVVLGCVFGGYFEAGGQLVAIWQPAEMIIILGAGFGAM
FT                   IIGNPKHVLKEIAHQIKGVISKKQLGPEFQRQLLMCLYELLEMVQNGGLRMLDQHIEQP
FT                   EESTIFQKYPLVLTQKRLVTFIADNFRLMAMGKIDAHELEGILDQELDTAEESLLTPSR
FT                   SLQRTAEAMPGFGICAAVLGIIITMQSIDGSIALIGLKVAAALVGTFLGVFICYCLMDP
FT                   LANAMEQQARAEHSLLECVRTVLVAQAGGKPTLLAVDAGRKLLHLASKPTFANLDAWVN
FT                   AMLEQE"
FT   CDS_pept        308989..309912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lafU"
FT                   /locus_tag="ECO26_0288"
FT                   /product="predicted lateral flagellar motor protein"
FT                   /note="MotB-like"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23635"
FT                   /protein_id="BAI23635.1"
FT                   /translation="MRKTGNRRERGAKTTIVRRQIKKNHAGHHGGAWKVAFADFTLAMM
FT                   ALFMTLWIVNSVSKSERESIIAALHGQSIFNGGGLSPLNKISPSHPPKPATVAVPEETE
FT                   KKARDVNEKTALLKKKSATELGELATSINTIARDAHMEANLEMEIVPQGLRVLIKDDQN
FT                   RNMFERGSAQIMPFFKTLLVELAPVFDSLDNKIIITGHTDAMAYKNNIYNNWNLSGDRA
FT                   LSARRVLEEAGMPEDKVMQVSAMADQMLLDSKNPQSAGNRRIEIMVLTKSASDTLYQYF
FT                   GQHGDKVVQPLVQKLDKQQVLSQRTR"
FT   CDS_pept        309983..311038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="ECO26_0289"
FT                   /product="DNA polymerase IV DinB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23636"
FT                   /protein_id="BAI23636.1"
FT                   /translation="MRKIIHVDMDCFFAAVEMRDNPALRDIPIAIGGSRERRGVISTAN
FT                   YPARKFGVRSAMPTGMALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDE
FT                   AYLDVTDSVHCHGSATLIAQEIRQTIFSELQLTASAGVAPVKFLAKIASDMNKPNGQFV
FT                   ITPAEVPAFLQTLPLAKIPGVGKVSAAKLEAMGLRTCGDVQKCDLVMLLKRFGKFGRIL
FT                   WERSQGIDERDVNSERLRKSVGVERTMAEDIHHWSECEAIIERLYPELERRLAKVKPDL
FT                   LIARQGVKLKFDDFQQTTQEHVWPRLNKADLIATARKTWDERRGGRGVRLVGLHVTLLD
FT                   PQMERQLVLGL"
FT   CDS_pept        311035..311487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafP"
FT                   /locus_tag="ECO26_0290"
FT                   /product="predicted acyltransferase"
FT                   /note="contains acyl-CoA N-acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23637"
FT                   /protein_id="BAI23637.1"
FT                   /translation="MNNIQIRDYQPGDFQQLCAIFIRAVTMTASQHYSPQQIAAWAQID
FT                   ESRWKEKLAKSQVRVAVINAKLVGFITCVEHYIDMLFVDPEYTRRGVASALLKPLIKSE
FT                   SELTVDASITAKPFFERYGFQTVKQQRVECRGEWFINFYMRYKQQH"
FT   CDS_pept        311733..312872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="ECO26_0291"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23638"
FT                   /protein_id="BAI23638.1"
FT                   /translation="MGNYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGM
FT                   PDLHPGRGYPIGAAFFSVGRFYPALVGNDIGCGMALWQTDILARKYNADKFEKRLSDLD
FT                   DVAEESWLEENLPSAFAQHPWRSSLGSIGGGNHFAELQQVDQIINAELFALAGLDAQHL
FT                   QLLVHSGSRGVGQSILQRHIASFSHHGLPQGSDDALRYIAEHDDALAFACINRQMIALR
FT                   IMQQVKATGSPVLDVAHNFVSACQIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWIVQ
FT                   PVANEKTLHSLAHGAGRKWGRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAP
FT                   QAYKSAESVVQCLVQAGLIIPVARLRPVLTLKNSGGKKG"
FT   CDS_pept        312869..313483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfH"
FT                   /locus_tag="ECO26_0292"
FT                   /product="predicted peptide chain release factor RF-1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23639"
FT                   /protein_id="BAI23639.1"
FT                   /translation="MILLQLSSAQGPEECCLAVKKALDRLIKEAARQDVAVTVLETETG
FT                   HYSDTLRSALISLDGDNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQE
FT                   QSDAIRYETLRSSGPGGQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAW
FT                   KLEQQQQENSAVLKSLRRMFHHQIERGNPRRTFTGMAFIEG"
FT   CDS_pept        complement(313540..314997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="ECO26_0293"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="peptidase D"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23640"
FT                   /protein_id="BAI23640.1"
FT                   /translation="MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEYIVGWAKEKGF
FT                   HVERDQVGNILIRKPATAGMENRKPVVLQAHLDMVPQKNNDTVHDFTKDPIQPYIDGEW
FT                   VKARGTTLGADNGIGMASALAVLADENVVHGPLEVLLTMTEEAGMDGAFGLQSNWLQAD
FT                   ILINTDSEEEGEIYMGCAGGIDFTSNLHLDREAVPAGFETFKLTLKGLKGGHSGGEIHV
FT                   GLGNANKLLVRFLAGHAEELDLRLIDFNGGTLRNAIPREAFATIAVAADKVDVLKSLVN
FT                   TYQEILKNELAEKEKNLALLLDSVANDKAALIAKSRDTFIRLLNATPNGVIRNSDVAKG
FT                   VVETSLNVGVVTMTDNNVEIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGW
FT                   QPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHS
FT                   PDEQVHIESVGHYWTLLTELLKEIPAK"
FT   CDS_pept        315258..315716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpt"
FT                   /locus_tag="ECO26_0294"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23641"
FT                   /protein_id="BAI23641.1"
FT                   /translation="MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGAL
FT                   LARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMY
FT                   PKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR"
FT   CDS_pept        315808..317052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frsA"
FT                   /locus_tag="ECO26_0295"
FT                   /product="hydrolase FrsA"
FT                   /note="binds to enzyme IIA(Glc)"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23642"
FT                   /protein_id="BAI23642.1"
FT                   /translation="MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIP
FT                   HWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQ
FT                   AMVWQQKACAEEDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
FT                   LPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRG
FT                   IAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDDALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFD
FT                   KGLQEITGWIEKRLC"
FT   CDS_pept        317110..317511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crl"
FT                   /locus_tag="ECO26_0296"
FT                   /product="DNA-binding transcriptional regulator Crl"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23643"
FT                   /protein_id="BAI23643.1"
FT                   /translation="MTLPSGHPKSRLIKKFTALGPYIREGKCEDNRFFFDCLAVCVNVK
FT                   PAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFH
FT                   EKLRELLTTLNLKLEPADDFRDEPVKLTA"
FT   CDS_pept        complement(317550..318605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ECO26_0297"
FT                   /product="outer membrane phosphoporin PhoE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23644"
FT                   /protein_id="BAI23644.1"
FT                   /translation="MKKSTLALVVMGIVASASVQAAEIYNKDGNKLDVYGKVKAMHYMS
FT                   DNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKY
FT                   KDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVI
FT                   DGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSR
FT                   GTGKRAEAWATGLKYDANNFYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLR
FT                   PSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINND
FT                   DIVAVGMTYQF"
FT   CDS_pept        318893..319996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="ECO26_0298"
FT                   /product="gamma-glutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23645"
FT                   /protein_id="BAI23645.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIAAGSKPGVIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVD
FT                   EGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAG
FT                   HHSQEIDAILGYEYGPVAVHRDDMITR"
FT   CDS_pept        320008..321261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="ECO26_0299"
FT                   /product="gamma-glutamylphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23646"
FT                   /protein_id="BAI23646.1"
FT                   /translation="MLEQMGIAAKQASYKLAQLSSREKNRVLEKIADELEAQSEIILNA
FT                   NAQDVADARANGLGEAMLDRLALTPARLKGIADDVRQVCNLADPVGQVIDGSVLDSGLR
FT                   LERRRVPLGVIGVIYEARPNVTVDVASLCLKTGNAVILRGGKETCRTNAATVAVIQDAL
FT                   KSCGLPAGAVQAIDNPDRALVSEMLRMDKYIDMLIPRGGAGLHKLCREQSTIPVITGGI
FT                   GVCHIYVDESVEIAEALKVIVNAKTQRPSTCNTVETLLVNKNIADSFLPALSKQMAESG
FT                   VTLHADAAALAQLQAGPAKVVAVKAEEYDDEFLSLDLNVKIVSDLDDAIAHIREHGTQH
FT                   SDAILTRDMRNAQRFVNEVDSSAVYVNASTRFTDGGQFGLGAEVAVSTQKLHARGPMGL
FT                   EALTTYKWIGIGDYTIRA"
FT   tRNA            321376..321451
FT                   /gene="thrW"
FT                   /locus_tag="ECO26_tRNA005"
FT                   /product="tRNA-Thr (CGU)"
FT   misc_feature    complement(321433..333862)
FT                   /note="Integrative element ECO26_IE01"
FT   CDS_pept        complement(321510..321749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0300"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23647"
FT                   /protein_id="BAI23647.1"
FT                   /translation="MHLKLFPSFSLFILCNVSRRVASLDTAPGVEHLAKSFGRRFRDGG
FT                   TSSSFKGTCYEVEPGNYSPIRVTLPKPITTYRRL"
FT   CDS_pept        322056..322214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0301"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23648"
FT                   /protein_id="BAI23648.1"
FT                   /translation="MKNIAAIKRNNRKIHARKFLSTPEGKAWLERKQRENEERKLLSEL
FT                   KWLREDF"
FT   CDS_pept        322560..322943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0302"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23649"
FT                   /protein_id="BAI23649.1"
FT                   /translation="MARLREVLNAIFSAPRSGKSRIPKYQQGIFLRNQHRFYLLNHYTE
FT                   SLSVMSLTKLSLNTRMIGFMSDQMLETAPRLTRAVSDETSVYAGAGQNIGQNPFNIIIV
FT                   ICTKEHIERLELMYQGKSDGFFT"
FT   CDS_pept        complement(323077..323289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0303"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23650"
FT                   /protein_id="BAI23650.1"
FT                   /translation="MRLTEHHQKLLAKNCSACFLMSFLVCANFKIYFVFTALFRVMRGI
FT                   ASPFLVLSRHLATFKHLFRNAKLLI"
FT   CDS_pept        324072..324344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0304"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23651"
FT                   /protein_id="BAI23651.1"
FT                   /translation="MIFCLPALASLSGKQPYSATFRASWLARSAHTESKALLSSCNYRG
FT                   GNAHEEILLRCAQKSNHLTNHTDCLCVTLYLLIPLPTFNNSRYSL"
FT   CDS_pept        325428..325598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0305"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23652"
FT                   /protein_id="BAI23652.1"
FT                   /translation="MSETTEKKRQPRTCFHIPDEVFQVLFKEARSRRITVTDYILDMLK
FT                   REAETLSNKSK"
FT   CDS_pept        325652..326344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0306"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23653"
FT                   /protein_id="BAI23653.1"
FT                   /translation="MINQLTFTKHYDTFDNVSKIYSDKFPQGKDLDLLHIVLYFRFLSY
FT                   QENNLNCYESHETLAKIFKSSASTIKRKINDLKEMGLLETSPHPDPYISSLIYNALPLT
FT                   DAHITPPGESSLSDLSEAEEAQEQPKGHKQPSFDVLDDDWDTPLPWETEETPVSSSEKV
FT                   ANDNEEDVLKNFASLIIKQKNTRTGGASFIEFATSLAYKHRLKLPNGIEAYFAKKHPKV
FT                   YEDFDIPF"
FT   CDS_pept        326356..326634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0307"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23654"
FT                   /protein_id="BAI23654.1"
FT                   /translation="MIQYLVKNQVDRIQCNDTGKRIYETLAYLYKGKPTPLKYSDVLHR
FT                   AGCSEDGLKFWLKQLSNFGVIEIKELSFSTFNLKRLDKEIEFIYSTL"
FT   CDS_pept        326767..327177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0308"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23655"
FT                   /protein_id="BAI23655.1"
FT                   /translation="MAKRKNNVVKKIGDSASLLSKPKSILRRKDFKELVTLTKQNSAPG
FT                   EWKTEIIEHSPSVPCGDEFNALQEILSSTPGVFWKPRKRKEYIVDSSDLRKYQILGFED
FT                   YNHYVGYLATNGLNNLVPDFQILDNADHYGDF"
FT   CDS_pept        327179..327514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0309"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23656"
FT                   /protein_id="BAI23656.1"
FT                   /translation="MNKNTYDTIYSLINYYEDDYLLPLNRAELEAYKENTPASLNEAFK
FT                   HWDLAVNAFEHLSKRVEMLCKRENAYLTADQIWELSNWIEDIESDVRYVGDGLVELAQR
FT                   LGTITEE"
FT   CDS_pept        327864..328076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0310"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23657"
FT                   /protein_id="BAI23657.1"
FT                   /translation="MLFLNDKEQIIKYKDEMLKINPQITEMVAKYAGCSVEEVERCVEK
FT                   YFSPSSPSTPSLNELIKLKAKEITK"
FT   CDS_pept        328073..328435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0311"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23658"
FT                   /protein_id="BAI23658.1"
FT                   /translation="MIIDLDTLFPVRKTFTDIVSYCTDPFASVESKVFASLPADVECGD
FT                   LITSTGAKYVSGDDIYVVMSEFVTAGENKPVDVLRSNAGLVCIKADALNAVSEAAKTAL
FT                   IKKGFQLEGFHSVFTS"
FT   CDS_pept        328454..329482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0312"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23659"
FT                   /protein_id="BAI23659.1"
FT                   /translation="MILGNDYVDLIPLFQTHSTRNFLLSTLDFTDSVGVTSHKVAVSQL
FT                   VESNESLFNKETSRFSSEHNVTKREQGKEWLIEIPYFLREDVIRPSDVQGKRKPGTDFQ
FT                   ETLTDIYAEYIAKHHVAYQRTKESVLAASLFSGKTYTPKTDDVLIEWGKLFNVSAMKAT
FT                   VNASSTDTTKIFKEFDQIATDIIEKAQSQASAVERIVVFCKPEAFSAIRFSAGMANAFQ
FT                   YVSPLEEGNVVYQRRDLLPGVTAFTIPGTNIDVVKLVDPLHLAHMTSDAVAIPKFAKGS
FT                   NVYQNIYGAASSTFELINAAPAEVYSYSYESSRGDAVNVVTENSQMVVNHGVGFSVQIT
FT                   VK"
FT   CDS_pept        329567..329770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0313"
FT                   /product="hypothetical protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23660"
FT                   /protein_id="BAI23660.1"
FT                   /translation="MEVILKSKNGVHVHLDANDSRGLLNLKYLCSLLDVPYEGVKARMF
FT                   RLNESIDQALHHFLSKEGDKND"
FT   CDS_pept        329785..331614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0314"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23661"
FT                   /protein_id="BAI23661.1"
FT                   /translation="MLEINTSKIKNTVTFSVDKDSLKKAKDSITGLKEFAENIKPAKLR
FT                   FDNVTKGYKKAQNEVDKIAQQKAKTEKQNQRAQAAAARAQARQQQQIAARKEKAELKLL
FT                   DVSSSISAMHRLSVAEQYKAIAQAREIAKQYEQGAISLARMNSQMKRLQQQQRKINGNR
FT                   KTQLAPVKGGSGNSATMGALLFGGATAAAGVMAVSKTSEFMANSFANAETQGELIQRAK
FT                   LGGVDVNQMYNITEWAYRNGVDSMMGDQGARKYLDQMKDVRERAAKSYSEAEFLKDKKG
FT                   KSEWKGGDNAINELLNIGVINKSDLKKFADNPAGLISKAVNGMMKKGFSDSQIGQRLED
FT                   LGDDLMLTSKYWQRSVKDVQESINQQKASGKWLTETQQESIVKFRELNRQLSQLSDARQ
FT                   VAFVDGFMKSLDPKVTEEFMKNLSNLTPYFTKLGEAVGSLFEAIMKIVNWFNRNDDKTD
FT                   AIQKNLGDAPPLSNEGMKQHLSNLVPDQYKGAGTATTAPDNSHSLFNTIKGLLFDDNAS
FT                   SVSDVKMSVSEAPITNLKQGALNNLAMTTPAYNLSPVFNINPTFEVVTEVPLTINSDTS
FT                   RLSDYVDFTARASRDSFLKSLTLTSLSGQSNGG"
FT   CDS_pept        331649..332362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0315"
FT                   /product="conserved predicted protein"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23662"
FT                   /protein_id="BAI23662.1"
FT                   /translation="MATAGILTIRAANTPEQHVQAVYKAEQDINSTKNENSKANTTKGE
FT                   NGFAIVTSGLASSGNDVYENYMALAFDSVDDVNVRRSADVTSYPVENGATVSDHVQIKN
FT                   NKFSLKGRITETPIKSDPGLLKSAGVNGNRRSLAIDYLNQIMDSRQPFLLVTENKTFEN
FT                   VVLTGIEYTEEASESLVFDLSFEQIRLVSYGTVNTVALKTQPSKNIGANMKKRVNTEKS
FT                   SSEGEDTITPAFKQE"
FT   CDS_pept        complement(332443..333720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0316"
FT                   /product="putative integrase"
FT                   /note="Integrative element ECO26_IE01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23663"
FT                   /protein_id="BAI23663.1"
FT                   /translation="MRYKPNQYLICDSYGNYYLRITLPVYMQPFFEGKRTFVRSLHTSN
FT                   LRVARRKRDQIADEYHCLRESVAPVNSTIENTLELLRSKAKYAKTATRMQDTASSCPSL
FT                   LKILEIYLTINSTKKKPATLAKARKAVEMFLSYRKKPDIALQDVSRTTVTGWIEHMQKT
FT                   LSQQSIANYISPMAQLWELASSRYHDAPERALSPWRGHRLDVAQSRESYEAFSNKELLQ
FT                   VLQVFSGNSAENKEMMALCLIGAYTGMRINEIASLTIDDVKEIEGVLCFEITQGKTKAA
FT                   ARVVPVHSLITPLVLSLREKPHNGFLFYHASITERADGKRSTWHTQRFTRAKRKALGEK
FT                   GTERKVFHSLRHGVAQLLDRNQIPEDRIALLLGHTRGNTETFRTYSKNAASPVELKKYI
FT                   ELLRYPEIEKGLSINKKSNLRRKTTP"
FT   CDS_pept        complement(334008..334418)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0317"
FT                   /note="predicted transcriptional regulator, LYSR-type,
FT                   C-terminal fragment"
FT   CDS_pept        complement(334397..335353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagQ"
FT                   /locus_tag="ECO26_0318"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23664"
FT                   /protein_id="BAI23664.1"
FT                   /translation="MSYPLFDKDEHWHKPEQAFLTDDHRTILRFAVEALMSGKGAVLVT
FT                   LVEIHGGAARPLGAQMVVREDGRYCGFVSGGCVEAAAAFEALEMMGSGRDREIRYGEGS
FT                   PWFDIVLPCGGGITLTLHKLRSAQPLLAVLNRLEQRKPAGLRYDPQAQSLVCLPTQTRT
FT                   GWNLNGFEVGFRPCVRLMIYGRSLEAQATASLAAATGYDSHIFDLFPASASAQIDTDTA
FT                   VILLCHDLNRELPALQAAREAKPFYLGALGSHRTHTLRLQKLHELGWSREETAQIRAPV
FT                   GIFPKARDAHTLALSVLAEIASVRLHHEEDSCLPPSS"
FT   CDS_pept        complement(335363..337561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagR"
FT                   /locus_tag="ECO26_0319"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains molybdenum-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23665"
FT                   /protein_id="BAI23665.1"
FT                   /translation="MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEEA
FT                   PNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPT
FT                   IEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVNQPPEDTPDKNVG
FT                   DFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAK
FT                   TLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTH
FT                   RPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLAT
FT                   LDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRR
FT                   QLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGT
FT                   VTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTS
FT                   GVYAACMKLREMIASAVGFDPEQSQFADGKITNGTRSATLHEATAGGRLTAEESIEFGT
FT                   LSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMG
FT                   AALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELG
FT                   LCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV"
FT   CDS_pept        complement(337558..338514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagS"
FT                   /locus_tag="ECO26_0320"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23666"
FT                   /protein_id="BAI23666.1"
FT                   /translation="MKAFTYERVNTPAEAALSAQRVPGAKFIAGGTNLLDLMKLEIETP
FT                   THLIDVNGLGLDKIEVTDAGGLRIGALVRNTDLAAHERVRRDYAVLSRALLAGASGQLR
FT                   NQATTAGNLLQRTRCPYFYDTNQPCNKRLPGSGCAALEGFSRQHAVVGVSEACIATHPS
FT                   DMAVAMRLLDAVVETITPEGKTRSITLADFYHPPGKTPHIETALLPGELIVAVTLPPPL
FT                   GGKHIYRKVRDRASYAFALVSVAAIIHPDGSGRVALGGVAHKPWRIEAADAQLSQGAQA
FT                   VYDTLFASAHPTAENTFKLLLAKRTLASVLAEARAQA"
FT   CDS_pept        complement(338511..339200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagT"
FT                   /locus_tag="ECO26_0321"
FT                   /product="predicted xanthine dehydrogenase, 2Fe-2S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23667"
FT                   /protein_id="BAI23667.1"
FT                   /translation="MSNQGEYPEDNRVGKHEPHDLSLTRRDLIKVSAATAATAVVYPHS
FT                   TLAASVPAATPAPEIMPLTLKVNGKTELLEVDTRTTLLDALRENLHLIGTKKGCDHGQC
FT                   GACTVLVNGRRLNACLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKHDGFQCGYCTS
FT                   GQICSSVAVLKEIQDGIPSHVTVDLVSAPETTADEIRERMSGNICRCGAYANILAAIED
FT                   AAGEIKS"
FT   CDS_pept        339618..340232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yagU"
FT                   /locus_tag="ECO26_0322"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23668"
FT                   /protein_id="BAI23668.1"
FT                   /translation="MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPV
FT                   DMFNAACGPESLIRAAGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWY
FT                   ENVSEIFGHLVWFWSIEIIRRDLRNRITHEPDPEIPLGSNR"
FT   CDS_pept        complement(340480..340809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgJ"
FT                   /locus_tag="ECO26_0323"
FT                   /product="predicted ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23669"
FT                   /protein_id="BAI23669.1"
FT                   /translation="MSNLNPCMTCGACCAFFRVSFYWAEADDAGGTIPARLTEQISPFH
FT                   RCMSGTNQKNPRCIALAGTPGKNACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKY
FT                   GLTPL"
FT   CDS_pept        complement(341122..341832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpE"
FT                   /locus_tag="ECO26_0324"
FT                   /product="predicted chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23670"
FT                   /protein_id="BAI23670.1"
FT                   /translation="MFRRRGVTLTKALLTAVCMLAAPLTQAISVGNLTFSLPSETDFVS
FT                   KRVVNNNKSARIYRIAISAIDSPGSSELRTRPVDGELLFAPRQLALQAGESEYFKFYYH
FT                   GPRDNRERYYRVSFREVPTRNQTRRSPTGGEVSTEPVVVMDTILVVRPRQVQFKWSFDK
FT                   VTGTVSNTGNTWFKLLIKPGCDSTEEEGDAWYLRPGDVVHQPELRQPGNHYLVYNDKFI
FT                   KISDSCPAKPPSAD"
FT   CDS_pept        complement(341801..343444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpD"
FT                   /locus_tag="ECO26_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23671"
FT                   /protein_id="BAI23671.1"
FT                   /translation="MRVNLLITMIIFALIWPVTELRAAVSKTTWADAPAREFVFVENNS
FT                   DDNFFVTPGGALDPRLTGANRWTGLKYTGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWL
FT                   ENSPVSSPLTGLRCINWYAGCNMTTSLILPQTTDASGFYGATVTSGGAKWMHGMLSDAF
FT                   YQYLQQMPVGSSFTMTINACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLIN
FT                   THSLAEVFINSDGVPTLGEGNADCRTQTIGSLSGLSCKMVNYTLQTNGLSNTSIHIFPA
FT                   IANSSLASAVGAYDMQFSLNGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVN
FT                   LGISDINTKDLFNFRFQNTTSPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREG
FT                   YVGSGESALDFGYIVTTSGKTAADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPAT
FT                   LSFITRNGATKTYDAGCDDSWRDMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAI
FT                   SLRTVDDNGWFGEVSASGEIHVQATWRNIN"
FT   CDS_pept        complement(343434..345959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpC"
FT                   /locus_tag="ECO26_0326"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23672"
FT                   /protein_id="BAI23672.1"
FT                   /translation="MPLRRFSPGLKAQFAFGMVFLFVQPDASAADISAQQIGGVIIPQA
FT                   FSQALQDGMSVPLYIHLAGSQGRQDDQRIGSAFIWLDDGQLRIRKIQLEESEDNASVSE
FT                   QTRQQLMALANAPFNEALTIPLTDNAQLDLSLRQLLLQLVVKREALGTVLRSRSEDIGQ
FT                   SSVNTLSSNLSYNLGVYNNQLRNGGSNTSSYLSLNNVTALREHHVVLDGSLYGIGSGQQ
FT                   DSELYKAMYERDFAGHRFAGGMLDTWNLQSLGPMTAISAGKIYGLSWGNQASSTIFDSS
FT                   QSATPVIAFLPAAGEVHLTRDGRLLSVQNFTMGNHEVDTRGLPYGIYDVEVEVIVNGRV
FT                   ISKRPQRVNKLFSRGRGVGAPLAWQVWGGSFHMDRWSENGKKTRPAKESWLAGASTSGS
FT                   LSTLSWAATGYGYDNQAVGETRLTLPLGGAINVNLQNMLASDSSWSSIGSISATLPGGF
FT                   SSLWVNQEKTRIGNQLRRSDADNRAIGGTLNLNSLWSKLGTFSISYNDDRRYNSHYYTA
FT                   DYYQNVYSGTFGSLGLRAGIQRYNNGDSNANTGKYIALDLSLPLGNWFSAGMTHQNGYT
FT                   MANLSARKQFDEGTIRTVGANLSRAISGDTGDDKTLSGGAYAQFDARYASGTLNVNSAA
FT                   DGYINTNLTANGSVGWQGKNIAASGRTDGNAGVIFNTGLEDDGQISAKINGRIFPLNGK
FT                   RNYLPLSPYGRYEVELQNSKNSLDSYDIVSGRKSHLTLYPGNVAVIEPEVKQMVTVSGR
FT                   IRAEDGTLLANARINNHIGRTRTDENGEFVMDVDKKYPTIDFRYSGNKTCEVALELNQA
FT                   RGAVWVGDVVCSGLSSWAEVTQTGEENES"
FT   CDS_pept        complement(345985..346653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpB/matC"
FT                   /locus_tag="ECO26_0327"
FT                   /product="predicted chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23673"
FT                   /protein_id="BAI23673.1"
FT                   /translation="MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
FT   CDS_pept        complement(346711..347298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB/ecpA"
FT                   /locus_tag="ECO26_0328"
FT                   /product="predicted fimbrillin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23674"
FT                   /protein_id="BAI23674.1"
FT                   /translation="MKKKVLAIALVTVFTGIGVAQAADVTAQAVATWSATAKKDTTSKL
FT                   VVTPLGSLAFQYAEGIKGFNSQKGLFDVAIEGDSTATAFKLTSRLITNTLTQLDTSGST
FT                   LNVGVDYNGAAVEKTGDTVMIDTANGVLGGNLSPLANGYNASNRTTAQDGFTFSIISGT
FT                   TNGTTAVTDYSTLPEGIWSGDVSVQFDATWTS"
FT   CDS_pept        complement(347372..347962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecpR/matA"
FT                   /locus_tag="ECO26_0329"
FT                   /product="predicted regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23675"
FT                   /protein_id="BAI23675.1"
FT                   /translation="MTWQSDYSRDYEVKNHMECQNRSDKYIWSPHDAYFYKGLSELIVD
FT                   IDRLIYLSLEKIRKDFVFINLNTDSLSEFINRDNEWLSAVKGKQVVLIAARKSEALANY
FT                   WYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKIPDREMEIIRMTAQGMQPK
FT                   SIARIENCSVKTVYTHRRNAEAKLYSKIYKLVQ"
FT   CDS_pept        348736..348963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0330"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23676"
FT                   /protein_id="BAI23676.1"
FT                   /translation="MQAAPQREETEWRVQSKRGLMPAYRGEAGQQVNIKIMEYSERNVR
FT                   QLASNEQEEYIPRKINVGVINTPTLIRSDY"
FT   CDS_pept        complement(348998..349138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgO"
FT                   /locus_tag="ECO26_0331"
FT                   /product="RpmJ (L36) paralog"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23677"
FT                   /protein_id="BAI23677.1"
FT                   /translation="MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKK
FT                   R"
FT   CDS_pept        complement(349138..349401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECO26_0332"
FT                   /product="RpmE (L31) paralog"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23678"
FT                   /protein_id="BAI23678.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVTSEGNVARFTQRFGRFVSTKKGA"
FT   CDS_pept        350981..355234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0333"
FT                   /product="putative invasin"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23679"
FT                   /protein_id="BAI23679.1"
FT                   /translation="MSHYKTGHKQPRFRYSVLTRCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDVEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLLTLSAGHKQGKSGENDTRFGLEVNYRIGEPLAKQLDTDSIRERRVLAG
FT                   SRYDLVERNNNIVLEYRKSEVIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAP
FT                   SLLAEGGKITGQGSQWQVTLPAYRPGKDNYYAISAVAYDNKGNASKRVQTEVVITGAGM
FT                   SADRTALTLDGQSRIQMLANGNEQRPLVLSLRDAEGQPVTGMKDQIKTELAFKPAGNIV
FT                   TRSLKATKSQAKPTLGEFTETEAGVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRAT
FT                   MMDVANSTLSANEPSGDVVADGQQAYTLTLTAVDSEGNPVTGEASRLRFVPQDTNGVTV
FT                   GAISEIKPGVYSATVSSTRAGNVVVRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNP
FT                   DKPVVGGTVTAIWTAKDANDNPVTGLNPDAPSLSGAAAVGSTASGWTDNGDGTWTAQIS
FT                   LGTTAGELEVMPKLNGQDAAANAAKVTVVADALSSGQSTVSVAADRVKAGESTTVTLIA
FT                   KDAHGNAISGLSLSASLTGAASEGATVSGWTEKGDGSYVATLTTGGKTGELLVMPLFNG
FT                   QPAATEAAQLTVIAGEMSSANSTLVADNKAPTVKTTTKLTFTVKDAYGNLVTGLKPDAP
FT                   QFSGAASTGTERPSTGDWTETSNGVYVATLTLGSAAGQLSVMPRVNGQNAVAQPLVLNV
FT                   AGDASKAEIRDMTVKVDNQLANGQSTNQVTLTVVDTYGNPLQGQNVTLTLPKGVTSKTG
FT                   NTVTTDAAGKADIELMSTVAGEHSITASVNNAQKTVTVKFNADASTGQANLQVDTAAQK
FT                   VANGKDAFTLTANVEDKNGNPVPGSLVTFNLPRGVKPLTGDNVWVKANDEGKAELQVVS
FT                   VTAGTYEITASAGNSQPSNTQTITFVADKATATVSGIEVMGNYALADGKAKQTYKVTVT
FT                   DANNNLVKDSEVTLTASPASLNLEPNGTATTNEQGQAIFTATTTVAATYTLKAQVSQTN
FT                   GQVSTKTAESKFVADDKNAVLTASSDMQSLVADGKSTAKLEVTLMSANNPVGGNMWVDI
FT                   QTPEGVTEKDYQFLPSKNDHFVSGKITRKFSTSKPGVYTFTFNALTYGGYEMKPVTVTI
FT                   TAVDADTAKDEEAMK"
FT   CDS_pept        complement(355355..356212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgA"
FT                   /locus_tag="ECO26_0334"
FT                   /product="predicted DNA-binding transcriptional regulator,
FT                   ARAC-type"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23680"
FT                   /protein_id="BAI23680.1"
FT                   /translation="MIRQKILQQLLEWIECNLEHPISIEDIAQKSGYSRRNIQLLFRNF
FT                   MHVPLGEYIRKRRLCRAAILVRLTAKSMLDIALSLHFDSQQSFSREFKKLFGCSPRVYR
FT                   HRDYWDLANIFPSFLIRQQQKTECRLVNFPETPIFGNSFKYDIEVSNKSPDEEVKLRRH
FT                   HLARCMNNFKTDIYFVSTFEPSTKSVDLLTVETFAGTVCKQTDSEMPKEWTINRGLYAS
FT                   FRYEGEWEHYPEWARNLYLMELPARGLARVNGSDIERFYYNENFVEIDSNNIVCEIFIP
FT                   VRPV"
FT   CDS_pept        356461..357330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0335"
FT                   /product="putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23681"
FT                   /protein_id="BAI23681.1"
FT                   /translation="MEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGYRLIDT
FT                   AAVYGNEDAVGEAVREAISEGLCTRDELFITSKLWVQDMLNQDTAAAGIEASLKKSGLE
FT                   YFDLYLLHQAMRDYFSAWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKPMVNQV
FT                   ELHPYFAQPEALATMKYYNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQVILRW
FT                   NIQRGVVVIPKSTHQQRIEENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNPEFVRG
FT                   CLAVKIHD"
FT   CDS_pept        complement(357490..358083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgB"
FT                   /locus_tag="ECO26_0336"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23682"
FT                   /protein_id="BAI23682.1"
FT                   /translation="MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITP
FT                   FVANSPLMSFFYEHPEDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLV
FT                   LANPVNRWLGLLGGLMAFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKD
FT                   TLMLAGAVMIMADSAREILKQRSNESSSTLKTEY"
FT   CDS_pept        complement(358095..358331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgI"
FT                   /locus_tag="ECO26_0337"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23683"
FT                   /protein_id="BAI23683.1"
FT                   /translation="MFKKSVLFATLLSGVMAFSTNADDKIILKHISVSSVSASPTVLED
FT                   TIADIARKYNASSWKVTSMRIDNNSTATAVLYK"
FT   CDS_pept        complement(358440..359765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgC"
FT                   /locus_tag="ECO26_0338"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains FAD/NAD(P)-binding domain and dimerization
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23684"
FT                   /protein_id="BAI23684.1"
FT                   /translation="MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCIN
FT                   IGCIPTKTLVHDAQQHTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINN
FT                   HSLRVHRPEANLEIHGEKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGI
FT                   LGGGYIGVEFASMFANFGSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHV
FT                   ERISHHENQVQVHSEHAQLAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLH
FT                   TTADNIWAMGDVTGGLQFTYISLDDYRIVRDELLGEGRRSTDDRKNVPYSVFMTPPLSR
FT                   VGMTEEQARESGADIQVVTLPVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDS
FT                   HEMINIVKMVMDAGLPYSILRDQIFTHPSMSESLNDLFSLVK"
FT   CDS_pept        359991..360845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgD"
FT                   /locus_tag="ECO26_0339"
FT                   /product="predicted DNA-binding transcriptional regulator,
FT                   ARAC-type"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23685"
FT                   /protein_id="BAI23685.1"
FT                   /translation="MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALT
FT                   QGAAKLEMPTGEIFTLRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTS
FT                   LPETLFLAPVNHSVEYNWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQ
FT                   VNTEKNILSLLLHPRLGAVIQQMLEMPGHAWTVESLASIAHMSRASFAQLFRDVSGTTP
FT                   LAVLTKLRLQIAAQMFTREMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQ
FT                   LAP"
FT   CDS_pept        361372..362091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECO26_0340"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23686"
FT                   /protein_id="BAI23686.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVVHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
FT   CDS_pept        362102..363529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECO26_0341"
FT                   /product="predicted amino acid dehydrogenase"
FT                   /note="contains NAD(P)-binding domain and ferridoxin-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23687"
FT                   /protein_id="BAI23687.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFAKTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDSVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
FT   CDS_pept        363522..364217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECO26_0342"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23688"
FT                   /protein_id="BAI23688.1"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAGRGRSLSLLPESS
FT                   LFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
FT   CDS_pept        complement(364172..364384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0343"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23689"
FT                   /protein_id="BAI23689.1"
FT                   /translation="MDACLFHCKYPGITNARIFTEEQHNHDGTGLSQVVLNAIFNLVCL
FT                   LQVYVQISYLSQQSSIIRYTAFTGP"
FT   CDS_pept        complement(364463..365128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgH"
FT                   /locus_tag="ECO26_0344"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23690"
FT                   /protein_id="BAI23690.1"
FT                   /translation="MREQIKQDIDLIEILFYLKKKVRVILFIIAICMAMMLLFLYINKD
FT                   NIKVSYSLKINQTTPGILVNCDSNNNFACQTTMTEDVIQRITTFFHTSPDVKNREIKLE
FT                   WSGDKRDLPTAEAEISRVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTR
FT                   NWSLYPNGDGCVTISSPEIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSG"
FT   CDS_pept        complement(365341..367011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betA"
FT                   /locus_tag="ECO26_0345"
FT                   /product="choline dehydrogenase"
FT                   /note="flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23691"
FT                   /protein_id="BAI23691.1"
FT                   /translation="MQFDYIIIGAGSAGNVLATRLTEDPNTSVLLLEAGGPDYRFDFRT
FT                   QMPAALAFPLQGKRYNWAYETEPEPFMNNRRMECGRGKGLGGSSLINGMCYIRGNALDL
FT                   DNWAQEPGLENWSYLDCLPYYRKAETRDVGENDYHGGDGPVSVTTSKPGVNPLFEAMIE
FT                   AGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQAKSRPNLTIRIHAMT
FT                   DHIIFDGKRAVGVEWLEGDSTIPTRATANKEVLLCAGAIASPQILQRSGVGNAELLAEF
FT                   DIPLVHELPGVGENLQDHLEMYLQYECKEPVSLYPALQWWNQPKIGAEWLFGGTGVGAS
FT                   NHFEAGGFIRSREEFAWPNIQYHFLPVAINYNGSNAVKEHGFQCHVGSMRSPSRGHVRI
FT                   KSRDPHQHPAILFNYMSHEQDWQEFRDAIRITREIMHQPALDQYRGREISPGTECQTDE
FT                   QLDEFVRNHAETAFHPCGTCKMGYDEMSVVDGEGRVHGLEGLRVVDASIMPQIITGNLN
FT                   ATTIMIGEKIADMIRGQEALPRSTAGYFVANGMPVRAKK"
FT   CDS_pept        complement(367025..368497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="ECO26_0346"
FT                   /product="betaine aldehyde dehydrogenase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23692"
FT                   /protein_id="BAI23692.1"
FT                   /translation="MSRMAEQQLYIHGGYTSATSGRTFETINPANGNVLATVQAAGRED
FT                   VDRAVKSAQQGQKIWAAMTAMERSRILRRAVDILRERNDELAKLETLDTGKAYSETSTV
FT                   DIVTGADVLEYYAGLIPALEGSQIPLRETSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTALKLAEIYSEAGLPDGVFNVLPGGGAETGQYLTEHPGI
FT                   AKVSFTGGVASGKKVMANSAASSLKEVTMELGGKSPLIVFDDADLDLAADIAMMANFFS
FT                   SGQVCTNGTRVFVPAKCKAAFEQKILARVERIRAGDVFDPQTNFSPLVSFPHRDNVLRY
FT                   IAKGKEEGARVLCGGDVLKGDGFDNGAWVAPTVFTDCRDEMTIVREEIFGPVMSLLTYE
FT                   SEDEVIRRANDTDYGLAAGIVTADLNRAHRVIHQLEAGICWINTWGESPAEMPVGGYKH
FT                   SGIGRENGVMTLQSYTQVKSIQVEMAKFQSIF"
FT   CDS_pept        complement(368511..369098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betI"
FT                   /locus_tag="ECO26_0347"
FT                   /product="DNA-binding transcriptional repressor BetI"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23693"
FT                   /protein_id="BAI23693.1"
FT                   /translation="MPKLGMQSIRRRQLIDATLEAINEVGMHDATIAQIARRAGVSTGI
FT                   ISHYFRDKNGLLEATMRDITSQLRDAVLNRLHALPQGSAEQRLQAIVGGNFDETQVSSA
FT                   AMKAWLAFWASSMHQPMLYRLQQVSSRRLLSNLVSEFRRELPRQQAQEAGYGLAALIDG
FT                   LWLRAALSGKPLDKPLAHSLTRHFITQHLPTD"
FT   CDS_pept        369227..371260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betT"
FT                   /locus_tag="ECO26_0348"
FT                   /product="high affinity choline transporter BetT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23694"
FT                   /protein_id="BAI23694.1"
FT                   /translation="MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGR
FT                   TLDWVSKTFGWYYLLAATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAG
FT                   IGIDLMFFSVAEPVTQYMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGY
FT                   FSYRYNLPLTIRSALYPIFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLS
FT                   VLFDIPDSMAAKAALIALSVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDT
FT                   SFLLNALVLNVGDYVNRFMGMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLAR
FT                   ISRGRTIRQFVLGTLIIPFTFTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSL
FT                   LAQYPAFTFSASVATITGLLFYVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAI
FT                   GLLTLGMLMTNGISALQNTTVIMGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPR
FT                   PLGLQDRLSWKKRLSRLMNYPGTRYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPP
FT                   EEGQQLGHLDLLVHMGEEQNFVYQIWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQG
FT                   NDLMDYSKEQVITDILDQYERHLNFIHLHREAPGHSVMFPDA"
FT   CDS_pept        371833..375816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0349"
FT                   /product="AidA-I adhesin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23695"
FT                   /protein_id="BAI23695.1"
FT                   /translation="MNKIYRLKWNRSRNCWSVCSELGSRVKGKKSRAVLISAISLYSSL
FT                   VFADDVIVNQDKTIDFGKENQSIDYRITVTDNANLVINTTDTSRPRLTLASGGGLDITG
FT                   GKVTINGPLNFLLKGTGFLNVSNAGSELYADDLYESNSGMRHDQGYFNVSNGGKIHVKG
FT                   TSRLTYTQGNVSGEGSQVNAGTFFMGVYGGYGGNQFLSVNNGGEVNAREHISLGYYDQR
FT                   SDTTLVVSDGGKISAPKISLSTNSELALGAQEGSAAKAAGIIDAEKIEFVWAKTSDKKI
FT                   TLNHTDKNATISADIVSGSEGLGYINALNGTTYLTGDNSAFSGKVKIEQNGALGITKNI
FT                   GTAEINNRGKLHLKADDSMTFANKISGNGTISIDSGTVALTGNNYAFSGYIDVASGAVA
FT                   VISEDKNIGRADLDVDGKLQINANKDWVFDNDLQGRGIVEINMGNHEFSFDEFAYTDWF
FT                   QGSLAFQNTTFNLEKNAEFLQRGGITAGQGSQVTVGKGAHSISTLGFSGGTVDFGALTA
FT                   GAQMTEGTVNVSKTLDLRGEGVIQVSDSDVVRSVSRDIDSALSLTEVDDGNSAIKLVDA
FT                   QGAEVLGDAGNLQLQDKNGQILSSSAQRDIQQNGQKAAVGTYDYRLTSGVNNDGLYIGY
FT                   GLTQLDLHATDSDALVLSSNGKSENAADLSAKITGSGDLAFSSQKGQTVSLSNKDNDYT
FT                   GVTDLRSGTLLLNNDNVLGNTHELRLAAETELDMNGHSQTVGTLNGSADSLLSLNGGSL
FT                   TVTNGGTSTGSLTGSGELNIQGGTLDIAGDNSNLTANVNIANSANVLVSHAQGLGSANV
FT                   ENNGTLALNNSTEKRAAASVNYTLGGNLTNNGTLMTGMSGQQAGNVLVVKGNYHGNNGQ
FT                   LVMNTVLNGDDSVTDKLVVEGDTSGTTAVTVNNAGGTGAKTLNGIELIHVDGKSEGEFV
FT                   QAGRIVAGAYDYTLARGQGANSGNWYLTSGSDSPELQPEPDPMPNPEPNPNPEPNPNPT
FT                   PTPGPDLNVDNDLRPEAGSYIANLAAANTMFTTRLHERLGNTYYTDMVTGEQKQTTMWM
FT                   RHEGGHNKWRDGSGQLKTQSNRYVLQLGGDVAQWSQNGSDSWHVGVMAGYGNSDSKTIS
FT                   SRTGYRAKASVNGYSTGLYATWYADDESRNGAYLDSWAQYSWFDNTVKGDDLQSESYKS
FT                   KGFTASLEAGYKHKLAEFNGSQGTRNEWYVQPQAQVTWMGVKADKHRESNGTLVHSNGD
FT                   GNVQTRLGVKTWLKSHHKMDDGKSREFQPFVEVNWLHNSKDFSTSMDGVSVTQDGARNI
FT                   AEIKTGVEGQLNANLNVWGNVGVQVADRGYNDTSAMVGIKWQF"
FT   CDS_pept        375958..377046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahA"
FT                   /locus_tag="ECO26_0350"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23696"
FT                   /protein_id="BAI23696.1"
FT                   /translation="MASHDLSVFLEEFGATVNLTLPGIVSEKERLLLKLLMEGMSVTEI
FT                   SQYRNRSAKTISHQKKQLYEKLGIQSDITFWRDIFFQYHPQVISGTGNKNNFYIPDNRC
FT                   HHIVTPEAISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLA
FT                   ESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVKKL
FT                   GNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDF
FT                   IKIDKSFVQMASVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQG
FT                   YLYSPPVPGNKFISEWVMKAGG"
FT   CDS_pept        complement(377088..378020)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yahB"
FT                   /locus_tag="ECO26_0351"
FT                   /note="predicted DNA-binding transcriptional regulator,
FT                   LYSR-type, N-terminal fragment"
FT   CDS_pept        complement(378112..378609)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yahC"
FT                   /locus_tag="ECO26_0352"
FT                   /note="predicted inner membrane protein, C-terminal
FT                   fragment"
FT   CDS_pept        378867..379472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECO26_0353"
FT                   /product="predicted transcriptional regulator"
FT                   /note="contains ankyrin domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23697"
FT                   /protein_id="BAI23697.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELAREQGFEEIAQLLIAAGA"
FT   CDS_pept        379512..380375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECO26_0354"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23698"
FT                   /protein_id="BAI23698.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWLQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNEKQNIAAA
FT                   VASMIGLGIGLTPSADDYLTGLALILFIPGHPSEKYKEEFYLGMQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
FT   CDS_pept        380365..381912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahF"
FT                   /locus_tag="ECO26_0355"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding domain and succinyl-CoA
FT                   synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23699"
FT                   /protein_id="BAI23699.1"
FT                   /translation="MSVKIVIKPNTYFDSVSLMSISTRANKLDGVEQAFVAMATEMNKG
FT                   VLKNLGLLTPELEQAKNGDLMIVINGKSGADNEQLLVEIEELFNTKAQSGSHEARYATI
FT                   ASAKKHIPESNLAVISVNGLFAAREARQALQNDLNVMLFSDNVSVEDELALKQLAHEKG
FT                   LLMMGPDCGTAIINGAALCFGNAVRRGNIGIVGASGTGSQELSVRIHEFGGGVSQLIGT
FT                   GGRDLSEKIGGLMMLDAIGMLENDPQTEIIALISKPPAPAVARKVLERARACRKPVVVC
FT                   FLGRVETPVDEQGLQFARGSKEAALKAVMLSGVKQENLDLHTLNQPLIADVRARLQPQQ
FT                   KYIRGLFCGGTLCDETMFAVMEKHGDVYSNIQPDPEFRLQDINRSIKHTFLDFGDDDFT
FT                   NGKPHPMIDPTNRISRLIEEARDPEVAVIVMDFVLGFGSHEDPVGSTIEAIKEAKAIAA
FT                   AEGRELIILAYVLGTDLDTPSLEQQSQMLLDAGVILASSSTNTGLLAREFICKGEEA"
FT   CDS_pept        381912..383330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahG"
FT                   /locus_tag="ECO26_0356"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23700"
FT                   /protein_id="BAI23700.1"
FT                   /translation="MSQSLFSQPLNVINVGIAMFSDDLKKQHVEVTQLDWTPPGQGNMQ
FT                   VVQALDNIADSPLADKIAAANQQALERIIQSHPVLIGFDQAINVVPGMTPKTILHAGPP
FT                   ITWEKMCGAMKGAVTGALVFEGLAKDLDEAAELAASGEITFSPCHEHDCVGSMAGVTSA
FT                   SMFMHIVKNKTYGNIAYTNMSEQMAKILRMGANDQSVIDRLNWMRDVQGPMLRDAMKII
FT                   GEIDLRLMLAQALHMGDECHNRNNAGTTLLIQALTPGIIQAGYSVEKQREVFEFVASSD
FT                   YFSGPTWMAMCKAAMDAAHGIEYSTVVTTMARNGVEFGLRVSGLPGQWFTGPAQQVIGP
FT                   MFAGYKPEDSGLDIGDSAITETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREITL
FT                   GENPNVTIPLLGFMGVPSAIDITRVGSSGILPVINTAIAHKDAGVGMIGAGIVHPPFAC
FT                   FEKAILGWCERYGV"
FT   CDS_pept        383473..384423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECO26_0357"
FT                   /product="predicted carbamate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23701"
FT                   /protein_id="BAI23701.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDKLQKANPDWCFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTEAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
FT   CDS_pept        384433..385815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahJ"
FT                   /locus_tag="ECO26_0358"
FT                   /product="predicted deaminase"
FT                   /note="contains metallo-dependent hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23702"
FT                   /protein_id="BAI23702.1"
FT                   /translation="MKESNSRREFLSQSGKMVTAAALFGTSVPLAHAAVAGTLNCEANN
FT                   TMKITDPHYYLDNVLLETGFDYENGVAVQTRTARQTVEIQDGKIVALRENKQHPDATLP
FT                   HYDAGGKLMLPTTRDMHIHLDKTFYGGPWRSLNRPAGTTIQDMIKLEQKMLPELQPYTQ
FT                   ERAEKLIDLLQSKGTTIARSHCNIEPVSGLKNLQNLQAVLARRQAGFECEIVAFPQHGL
FT                   LLSKSEPLMREAMQAGAHYVGGLDPTSVDGAMEKSLDTMFQIALDYDKGVDIHLHETTP
FT                   SGVAAINYMVETVEKTPQLKGKLTISHAFALATLNEQQVDALANRMAAQQISIASTVPI
FT                   GTLHMPLKQLHDKGVKVMTGTDSVIDHWSPYGLGDMLEKANLYAQLYIRPNEQNLSRSL
FT                   FLATGDVLPLNEKGERVWPKAQDDASFVLVDASCSAEAVARISPRTATFHKGQLVWGSV
FT                   AG"
FT   CDS_pept        386084..386524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23703"
FT                   /protein_id="BAI23703.1"
FT                   /translation="MFFRNRKNIAMTIKEKFSQKYPHASFCTFGDSAALADHLATLIAT
FT                   GVKTASCGSLAGCIEDNAFPMIGEYKIVENSRGEPVCVIRVIGLHLLRFSDVTVELARK
FT                   EGEGDLSLEYWRNEHRRFFQAEGSYSPEMDVIFEEYALIDVV"
FT   CDS_pept        386778..387761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0360"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23704"
FT                   /protein_id="BAI23704.1"
FT                   /translation="MNKRFVINMVSSLLLGAALISAPLQAAEKVVVNISKVDGMPWFNR
FT                   MGEGVVEAGNAFGVNASQVGPSSTDAPQQVKIIEDLIARKVNAITIVPNDANVLEPVFK
FT                   KARDAGIVVLTNESPGQPSANWDIEIIDNEKFAAEYVEHMAKRMGGKGGYVIYVGSLTV
FT                   PQHNLWADLLVKYQKEHYPDMHEVTRRMPVAESVDDSRRTTLDLMKTYPDLKAVVSFGS
FT                   NGPIGAGRAVKEKRAKNKVAVYGMMIPSQAASLIKSGDITEGITYDSASAGYALAAVAS
FT                   TLLKGEEIKPGLEMQNLGKADVDMDKRIIRFHKVLLVNKDNIDSLY"
FT   CDS_pept        387810..389294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0361"
FT                   /product="putative ATP-binding component of sugar ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23705"
FT                   /protein_id="BAI23705.1"
FT                   /translation="METFLSLRHINKTFHATRALRDVSLDFMSGEVHCLAGQNGCGKST
FT                   LIKIMSGVYRPDEGAEITLGGKNWSKLTPAASVAQGIQVIYQDLSLFPNLSVWENIAVN
FT                   HYHHGLFVNRRRLREVAQAAMTSINVTLPLDTLVSELSIARCQLVAICRALAQDARLIV
FT                   MDEPTASLTHQEVQGLLQVVHQLRERGICVVFVSHRLEEVMEVSDRISVLKDGELVGTF
FT                   PAAEMTTKQLGFLMTGQEFEYQVRELWQGKSSTPVLEVRNLSRHGEYLNINLRVEAGEV
FT                   VSIVGLLGAGRTELCLSLFGMTRPDAGEILINGQPVTLHSNQDAIRHGIGYVSEDRMSR
FT                   GLVMAQSIEDNIISTVFHKVKDRFGFLSETKVRDLVDRLIKALTIKVSDPHLPVNTLSG
FT                   GNAQRVSIAKWLAIGPRLLILDSPTVGVDIANKAGIYGIISDLAAHGIAVLMICDEIEE
FT                   AWYQSHRILVMQKGQITHSFLPDSSSQARIAEVVNG"
FT   CDS_pept        389287..390258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0362"
FT                   /product="putative permease"
FT                   /note="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23706"
FT                   /protein_id="BAI23706.1"
FT                   /translation="MAELKKRHEFWLALLIVVLFVGLAWRSDEFLTFGNLYDLANNYAM
FT                   LTILACGLFVVLISGGIDISFPAMTIIAQYGMVLLLQKIGGNFAVAFALAGCIGILLGL
FT                   INALLVNRLRVPSIIITISTLNIFYGLLLWLSKGVWLYDFPPWFEQGVMLFKYTDADGY
FT                   DYGLGLPLIAMITVVLLTAFIMNFTSVGRKIYALGGNRESASRIGFSVLKLQLFVYGYM
FT                   GLMSGAAGVVQSWTVMTVAPDSLLGYELTVLAAVVLGGTSLLGGRGTLTGTLLGVVLLA
FT                   VMQNGLNLLGVSSYWQTLITGIIIVASISATAWSQHQNRSLL"
FT   CDS_pept        390255..391211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0363"
FT                   /product="putative permease"
FT                   /note="ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23707"
FT                   /protein_id="BAI23707.1"
FT                   /translation="MKKSWRNNVEFYLIGLLVLTVAAFSITMPEIFWSISNFQSVASQM
FT                   PVLGILALAMAVTMLCGGINLSIIATANACSLVMAWVATQYPPGIATVVATLLAGAGAA
FT                   VIIGLCNGVLIAGIRVSPILATLGMMTLLKGINILVTGGSAIANYPSWVLWLNHAQWFG
FT                   IPLPMWLFAAVALGLWILLEKTPLGKAIYLIGSNERATLYSGINTRRVLIWVYVISALL
FT                   CAVAAFLMMSKLNSAKASYGESYLLVSILAAVLGGVNPDGGSGRIIGMVLALFLLQIIE
FT                   SGFNILGISPYLTMALWGTLLLCFIQVRGMLGLDRVV"
FT   CDS_pept        391298..392347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahK"
FT                   /locus_tag="ECO26_0364"
FT                   /product="predicted oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23708"
FT                   /protein_id="BAI23708.1"
FT                   /translation="MKIKAVGAYSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLH
FT                   QVRSEWAGTVYPCVPGHEIVGRVVAVGDQVEKHAPGDLVGVGCIVDSCKHCEECEDGLE
FT                   NYCDHMTGTYNSPTPDEPGHTLGGYSQQIVVHERYVLRIRHPQEQLAAVAPLLCAGITT
FT                   YSPLRHWQAGPGKKVGVVGIGGLGHMGIKLAHAMGAHVVAFTTSEAKREAAKALGADEV
FT                   VNSRNADEMAAHVKSFDFILNTVAAPHNLDDFTTLLKRDGTMTLVGAPATPHKSPEVFN
FT                   LIMKRRAIAGSMIGGIPETQEMLDFCAEHGIVADIEMIRADQINEAYERMLRGDVKYRF
FT                   VIDNRTLTD"
FT   CDS_pept        392590..393405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECO26_0365"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23709"
FT                   /protein_id="BAI23709.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFIDSVRTDCKCI
FT                   LLEHHMPLLRIFPKGKECMRVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIHPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNEWISNRVQELGDRYYPVNKHVKIRYTL"
FT   CDS_pept        complement(394079..394750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahN"
FT                   /locus_tag="ECO26_0366"
FT                   /product="neutral amino-acid efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23710"
FT                   /protein_id="BAI23710.1"
FT                   /translation="MMKLLHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTS
FT                   LASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCS
FT                   MRRQSTPQMSTLQQPISAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARL
FT                   MAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQ
FT                   R"
FT   CDS_pept        394897..395172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahO"
FT                   /locus_tag="ECO26_0367"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23711"
FT                   /protein_id="BAI23711.1"
FT                   /translation="MKIISKMLVGALALAVTNVYAAELMTKAEFEKVESQYEKIGDIST
FT                   SNEMSTADAKEDLIKKADEKGADVLVLTSGQTDNKIHGTANIYKKK"
FT   CDS_pept        complement(395270..396856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpR"
FT                   /locus_tag="ECO26_0368"
FT                   /product="DNA-binding transcriptional activator PrpR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23712"
FT                   /protein_id="BAI23712.1"
FT                   /translation="MAHPPRLNDDKPVIWTVSVTRLFELFRDISLEFDHLANITPIQLG
FT                   FEKAVTYIHKKLANERCDAIIAAGSNGAYLKSRLSVPVILIKPSGYDVLQALAKAGKLT
FT                   SSIGVVTYQETIPALVAFQKTFNLRLDQRSYITEEDARGQINELKANGTEAVVGAGLIT
FT                   DLAEEAGMTGIFIYSAATVRQAFSDALDMTRMSLRHNTHDATRNALRTRYVLGDMLGQS
FT                   PQMEQVRQTILLYARSSAAVLIEGETGTGKELAAQAIHREYFARHDARQGKKSHPFVAV
FT                   NCGAIAESLLEAELFGYEEGAFTGSRRGGRAGLFEIAHGGTLFLDEIGEMPLPLQTRLL
FT                   RVLEEKEVTRVGGHQPVPVDVRVISATHCKLEEDMRQGQFRRDLFYRLSILRLQLPPLR
FT                   ERVADILPLAESFLKVSLAALSAPFSAALRLGLQASETVLVHYDWPGNIRELRNMMERL
FT                   ALFLSVEPTPDLTPQFLQLLLPELARESAKTPAPRLLTPQQALEKFNGDKTAAANYLGI
FT                   SRTTFWRRLKS"
FT   CDS_pept        397095..397985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="ECO26_0369"
FT                   /product="2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23713"
FT                   /protein_id="BAI23713.1"
FT                   /translation="MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLS
FT                   GGGVAAGSLGLPDLGISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSM
FT                   IKAGAAGLHIEDQVGAKRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALA
FT                   VEGLDAAIERAQAYVEAGAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTI
FT                   DELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYQ
FT                   YEAKLDDLFARSQVK"
FT   CDS_pept        398030..399199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="ECO26_0370"
FT                   /product="2-methylcitrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23714"
FT                   /protein_id="BAI23714.1"
FT                   /translation="MSDTTILQNSTHVIKPKKSVALSGVPAGNTALCTVGKSGNDLHYR
FT                   GYDILDLAEHCEFEEVAHLLIHGKLPTRDELAAYKTKLKALRGLPANVRTVLEALPAAS
FT                   YPMDVMRTGVSALGCTLPEKEGHTVSGARDIADKLLASLSSILLYWYHYSHNGERIQPE
FT                   TDDDSIGGHFLHLLHGEKPSQSWEKAMHISLVLYAEHEFNASTFTSRVIAGTGSDMYSA
FT                   IIGAIGALRGPKHGGANEVSLEIQQRYETPDEAEADIRKRVENKEVVIGFGHPVYTIAD
FT                   PRHQVIKRVAKQLSQEGGSLKMYNIANRLETVMWESKKMFPNLDWFSAVSYNMMGVPTE
FT                   MFTPLFVIARVTGWAAHIIEQRQDNKIIRPSANYVGPEDRQFVALDKRQ"
FT   CDS_pept        399233..400684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="ECO26_0371"
FT                   /product="2-methylcitrate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23715"
FT                   /protein_id="BAI23715.1"
FT                   /translation="MSAQINNIRPEFDREIVDIVDYVMNYEISSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGVRVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVASGKAPLTMKQVLTAMIKAHEIQGCIALENS
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTREEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAPVWGFYDVSFKGESFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACIRIIDKKGPLNN
FT                   PADRDHCIQYMVAIPLLFGRLTAADYEDNVAQDKRIDALREKINCFEDPAFTADYHDPE
FT                   KRAIANAITLEFTDGTRFEEVVVEYPIGHARRRQDGIPKLVDKFKINLARQFPTRQQQR
FT                   ILEVSLDRTRLEQMPVNEYLDLYVI"
FT   CDS_pept        400724..402610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpE"
FT                   /locus_tag="ECO26_0372"
FT                   /product="predicted propionyl-CoA synthetase"
FT                   /note="contains ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23716"
FT                   /protein_id="BAI23716.1"
FT                   /translation="MSFSEFYQRSINEPEQFWAEQARRIDWQTPFTQTLDHSNPPFARW
FT                   FCEGRTNLCHNAIDRWLEKQPEALALIAVSSETEEERTFTFRQLHDEVNAVASMLRSLG
FT                   VQRGDRVLVYMPMIAEAHITLLACARIGAIHSVVFGGFASHSVAARIDDAKPVLIVSAD
FT                   AGARGGKIIPYKKLLDDAISQAQHQPRHVLLVDRGLAKMARVSGRDVDFASLRHQHIGA
FT                   RVPVAWLESNETSCILYTSGTTGKPKGVQRDVGGYAVALATSMDTIFGGKAGSVFFCAS
FT                   DIGWVVGHSYIVYAPLLAGMATIVYEGLPTWPDCGVWWKIVEKYQVSRMFSAPTAIRVL
FT                   KKFPTAEIRKHDLSSLEVLYLAGEPLDEPTASWVSNTLDVPVIDNYWQTESGWPIMAIA
FT                   RGLDDRPTRLGSPGVPMYGYNVQLLNEVTGEPCGVNEKGMLVVEGPLPPGCIQTIWGDD
FT                   DRFVKTYWSLFSRPVYATFDWGIRDADGYHFILGRTDDVINVAGHRLGTREIEESISSH
FT                   PGVAEVAVVGVKDALKGQVAVAFVIPKESDSLEDRDVAHSQEKAIMALVDSQIGNFGRP
FT                   AHVWFVSQLPKTRSGKMLRRTIQAICEGRDPGDLTTIDDPASLDQIRQAMEE"
FT   CDS_pept        402949..404208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="ECO26_0373"
FT                   /product="cytosine transporter CodB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23717"
FT                   /protein_id="BAI23717.1"
FT                   /translation="MSQDNNFSQGPVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGT
FT                   GLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGT
FT                   QVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSVIAVPAIAC
FT                   LGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAK
FT                   LAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTND
FT                   NALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVII
FT                   ADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLILN
FT                   PILNRKTTAAMTHVEVNSVE"
FT   CDS_pept        404198..405481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="codA"
FT                   /locus_tag="ECO26_0374"
FT                   /product="cytosine deaminase CodA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23718"
FT                   /protein_id="BAI23718.1"
FT                   /translation="MSNNALQTIINARLPGKEGLWQIHLQDGKISAIDAQSGVMPITEN
FT                   SLDAEQGLVIPPFVEPHIHLDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQR
FT                   AWQTLKWQIANGIQHVRTHVDVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSY
FT                   PNGEALLEEALRLGADVVGAIPHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDE
FT                   QSRFVETVAALAHREGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNI
FT                   HLQGRFDTYPKRRGITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQ
FT                   LMGYGQINDGLNLITHHSARTLNLQDYGIAAGNSANLIILPAENGFDALRRQVPVRYSV
FT                   RGGKVIASTQPAQTTVYLEQPEAIDYKR"
FT   CDS_pept        complement(405521..406420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynR"
FT                   /locus_tag="ECO26_0375"
FT                   /product="DNA-binding transcriptional dual regulator CynR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23719"
FT                   /protein_id="BAI23719.1"
FT                   /translation="MLSRHINYFLAVAEHGSFTRAASALHVSQPALSQQIRQLEESLGV
FT                   PLFDRSGRTIRLTDAGEVWRQYASRALQELGAGKRAIHDVADLTRGSLRIAVTPTFTSY
FT                   FIGPLMADFYARYPGITLQLQEMSQEKIEDLLCRDELDVGIAFAPVHSPELEAIPLLTE
FT                   SLALVVAQHHPLAACEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEAN
FT                   SISAVLELIRRTSLSTLLPAAIATQHDGLKAISLAPPLLERTAVLLRRKNSWQTAAAKA
FT                   FLHMALEECADVGENESR"
FT   CDS_pept        406530..407189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="ECO26_0376"
FT                   /product="carbonic anhydrase CynT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23720"
FT                   /protein_id="BAI23720.1"
FT                   /translation="MKEIIDGFLKFQREAFPKREALFKQLATQQSPRTLFISCSDSRLV
FT                   PELVTQREPGDLFVIRNAGNIVPSYGPEPGGVSASVEYAVAALRVSDIVICGHSNCGAM
FT                   TAIASCQCMDHMPAVSHWLRYADSARVVNEARPHSDLPSKAAAMVRENVIAQLANLQTH
FT                   PSVRLALEEGRIALHGWVYDIESGSIAAFDGATRQFVPLAANPRVCAIPLRQPTAA"
FT   CDS_pept        407220..407690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynS"
FT                   /locus_tag="ECO26_0377"
FT                   /product="cyanate aminohydrolase CynS"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23721"
FT                   /protein_id="BAI23721.1"
FT                   /translation="MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTA
FT                   ALLGQQALPADAARLVGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVY
FT                   GTTLKALVHEKFGDGIISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF"
FT   CDS_pept        407723..408877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="ECO26_0378"
FT                   /product="predicted cyanate transporter CynX"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23722"
FT                   /protein_id="BAI23722.1"
FT                   /translation="MLLVLVLIGLNMRPLLTSVGPLLPQLRQASGMSFSVAALLTALPV
FT                   VTMGGLALAGSWLHQHVSERRSVAISLLLIAVGALMRELYPQSVLLLSSALLGGVGIGI
FT                   IQAVMPSVIKRRFQQRTPLVMGLWSAALMGGGGLGAAITPWLVQHSETWYQTLAWWALP
FT                   AVVALFAWWWQSAREVASSHKTTTTPVRVVFTPRAWTLGVYFGLINGGYASLIAWLPAF
FT                   YIEIGASAQYSGSLLALMTLGQAAGALLMPAMARHQDRRKLLMLALVLQLVGFCGFIWL
FT                   PLQLPVSWAMVCGLGLGGAFPLCLLLALDHSVQPAIAGKLVAFMQGIGFIIAGLAPWFS
FT                   GVLRSISGNYLMDWAFHALCVVGLMIITLRFAPARFPQLWVKEV"
FT   CDS_pept        complement(408956..410209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacY"
FT                   /locus_tag="ECO26_0379"
FT                   /product="lactose/galactose transporter LacY"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23723"
FT                   /protein_id="BAI23723.1"
FT                   /translation="MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDT
FT                   GIIFAAISLFSLLFQPLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNIL
FT                   VGSIVGGIYLGFCFNAGAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALCASIVGIMFT
FT                   INNQFVFWLGSGCALILAVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKL
FT                   WFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPL
FT                   IINRIGGKNALLLAGTIMSVRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQ
FT                   FEVRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFT
FT                   LSGPGPLSLLRRQVNEVA"
FT   CDS_pept        complement(410261..413335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="ECO26_0380"
FT                   /product="beta-D-galactosidase LacZ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23724"
FT                   /protein_id="BAI23724.1"
FT                   /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
FT                   DRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNV
FT                   TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
FT                   QDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
FT                   ISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIID
FT                   ERGSYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIEN
FT                   GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
FT                   YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
FT                   LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTFATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSLPGELRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSL
FT                   IKYDENGNPWLAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKYQQQFFQFRLSGQ
FT                   TIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPGLPQPESAGQ
FT                   LWLTVHVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELG
FT                   NKRWQFNRQSGLLSQMWIGDEKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
FT                   AAGHYQAEAALLQCSADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
FT                   EVASDTPHPARIGLTCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
FT                   VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
FT                   FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
FT   CDS_pept        complement(413458..414540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="ECO26_0381"
FT                   /product="DNA-binding transcriptional repressor LacI"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23725"
FT                   /protein_id="BAI23725.1"
FT                   /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
FT                   NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
FT                   EACKAAVHNLLAQRVSGLLINYPLDDQDATAVEAACANVPALFLDVSDQTPINSIIFSH
FT                   EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
FT                   MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
FT                   YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
FT                   ALADSLMQLARQVSRLESGQ"
FT   CDS_pept        complement(414617..415450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpR"
FT                   /locus_tag="ECO26_0382"
FT                   /product="DNA-binding transcriptional activator MhpR,
FT                   3HPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23726"
FT                   /protein_id="BAI23726.1"
FT                   /translation="MQNNEQTEYKTVRGLTRGLMLLNMLNKLDGGASVGLLAELSGLHR
FT                   TTVRRLLETLQEEGYVRRSPSDDSFRLTIKVRQLSEGFRDEQWISALAAPLLGDLLREV
FT                   VWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLPLLKTASGLTWLAFCPEQDRKE
FT                   LIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYRGWDQEEKIASIAVPLRSEQR
FT                   VIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVESQAILVAGRRSGVHLR"
FT   CDS_pept        415641..417305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="ECO26_0383"
FT                   /product="3-(3-hydroxyphenyl)propionate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23727"
FT                   /protein_id="BAI23727.1"
FT                   /translation="MAIQHPDIQPAVNHSVQVAIAGAGPVGLMMANYLGQMGIDVLVVE
FT                   KLDKLIDYPRAIGIDDEALRTMQSVGLVENVLPHTTPWHAMRFLTPKGRCFADIQPMTD
FT                   EFGWPRRNAFIQPQVDAVMLEGVSRFPNVRCLFSRELEAFSQQNDEVTLHLKTAEGQRE
FT                   IVKAQWLVACDGGASFVRRTLNVPFEGKTAPNQWIVVDIANDPLSTPHIYLCCDPVRPY
FT                   VSAALPHAVRRFEFMVMPGETEEQLREPQNMRKLLSKVLPNPDNVELIRQRVYTHNARL
FT                   AQRFRIDRVLLAGDAAHIMPVWQGQGYNSGMRDAFNLAWKLALVIQGKARDVLLDTYQQ
FT                   ERRDHAKAMIDLSVTAGNVLAPPKRWQGTLRDGVSWLLNYLPPVKRYFLEMRFKPMPQY
FT                   YGGALVREGEAKHSPVGKMFIQPKVTLENGDVTLLDNAIGANFAVIGWGCNPLWGMSDE
FT                   QIQQWRALGTRFIQVVPEVQIHTAQDNHDGVLRVGDTQGRLRSWFAQHNASLVVMRPDR
FT                   FVAATAIPQTLGNTLNKLASVMTLTRPDADVSVEKVA"
FT   CDS_pept        417307..418251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpB"
FT                   /locus_tag="ECO26_0384"
FT                   /product="2,3-dihydroxyphenylpropionate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23728"
FT                   /protein_id="BAI23728.1"
FT                   /translation="MHAYLHCLSHSPLVGYVDPAQEVLDEVNGVIASARERIAAFSPEL
FT                   VVLFAPDHYNGFFYDVMPPFCLGVGATAIGDFGSAAGELPVPVELAEACAHAVMKSGID
FT                   LAVSYCMQVDHGFAQPLEFLLGGLDKVPVLPVFINGVATPLPGFQRTRMLGEAIGRFTS
FT                   TLNKRVLFLGSGGLSHQPPVPELAKADAHMRDRLLGSGKDLPASERELRQQRVISAAEK
FT                   FVEDQRTLHPLNPIWDNQFMTLLEQGRIQELDAVSNEELSAIAGKSTHEIKTWVAAFAA
FT                   ISTFGNWRSEGRYYRPIPEWIAGFGSLSARTEN"
FT   CDS_pept        418254..419135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="ECO26_0385"
FT                   /product="2-hydroxy-6-ketonona-2,4-dienedioic acid
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23729"
FT                   /protein_id="BAI23729.1"
FT                   /translation="MQEKMMSYQPQTEAATSRFLNVEEAGKTLRIHFNDCGQGDETVVL
FT                   LHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIVNSGSRSDLNARILKSV
FT                   VDQLDIAKIHLLGNSMGGHSSVAFTLNWPERVGKLVLMGGGTGGMSLFTPMPTEGIKRL
FT                   NQLYRQPTIENLKLMMDIFVFDTSDLTDALFEARLNNMLSRRDHQENFVKSLEANPKQF
FT                   PDFGPRLAEIKAQTLIVWGRNDRFVPMDAGLRLLSGIAGSELHIFRDCGHWAQWEHADA
FT                   FNQLVLNFLARP"
FT   CDS_pept        419145..419954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpD"
FT                   /locus_tag="ECO26_0386"
FT                   /product="2-keto-4-pentenoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23730"
FT                   /protein_id="BAI23730.1"
FT                   /translation="MTKHTLEQLAADLRRAAEQGEAIAPLRDLIGIDNAEAAYAIQHIN
FT                   VQYDVVQGRRVVGRKVGLTHPKVQQQLGVDQPDFGTLFADMCYGDNEIIPFSRVLQPRI
FT                   EAEIALVLNRDLPATDITFDELYNAIEWVLPALEVVGSRIRDWSIQFVDTVADNASCGV
FT                   YVIGGPAQRPAGLDLKNCAMKMTRNNEEVSSGRGSECLGHPLNAAVWLARKMASLGEPL
FT                   RAGDIILTGALGPMVAVNAGDRFEAHIEGIGSVAATFSSAAPKGSLS"
FT   CDS_pept        419951..420901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpF"
FT                   /locus_tag="ECO26_0387"
FT                   /product="acetaldehyde-CoA dehydrogenase II, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23731"
FT                   /protein_id="BAI23731.1"
FT                   /translation="MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLA
FT                   SARRMGVATTHEGVIGLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTP
FT                   AAIGPYCVPVVNLEANVDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSA
FT                   GPGTRANIDEFTETTSRAIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDI
FT                   EASINEMAEAVQAYVPGYRLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAH
FT                   YLPAYAGNLDIMTSSALATAEKMAQSLARKAGEAA"
FT   CDS_pept        420898..421911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpE"
FT                   /locus_tag="ECO26_0388"
FT                   /product="4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoicacid
FT                   aldolase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23732"
FT                   /protein_id="BAI23732.1"
FT                   /translation="MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIE
FT                   VAHGDGLQGSSFNYGFGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGA
FT                   RVVRVATHCTEADVSAQHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCI
FT                   YVVDSGGAMNMSDIRDRFRALKAELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDA
FT                   SLAGMGAGAGNAPLEVFIAAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLA
FT                   LGYAGVYSSFLRHCETAAARYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK"
FT   CDS_pept        422186..423397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpT"
FT                   /locus_tag="ECO26_0389"
FT                   /product="predicted 3-hydroxyphenylpropionic transporter
FT                   MhpT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23733"
FT                   /protein_id="BAI23733.1"
FT                   /translation="MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAF
FT                   ALDKMQMGWIFSAGILGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFP
FT                   SLVFARLMTGVGLGAALPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGA
FT                   NLAWQTVFWVGGVVPLILVPLLMRWLPESAVFAGDKQAAPPLRALFAPETATATLLLWL
FT                   CYFFTLLVVYMLINWLPLLLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVT
FT                   MSLLIYSGMLASLLALGTVSSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATG
FT                   VGTAVAVGRLGAMSGPLLAGKMLALGTGTVGVMAASAPGILVAGLAVFILMSRRSRMQP
FT                   CADA"
FT   CDS_pept        423499..424038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiL"
FT                   /locus_tag="ECO26_0390"
FT                   /product="nucleoprotein/polynucleotide-associated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23734"
FT                   /protein_id="BAI23734.1"
FT                   /translation="MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEEN
FT                   KKAQLERDKQLSEQQKQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFV
FT                   DKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQD
FT                   EDDPYADFKVPDDLMW"
FT   CDS_pept        complement(424163..424996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmB"
FT                   /locus_tag="ECO26_0391"
FT                   /product="predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23735"
FT                   /protein_id="BAI23735.1"
FT                   /translation="MELIEKHASFGGWQNVYRHYSQSLKCEMNVGVYLPPKAANEKLPV
FT                   LYWLSGLTCNEQNFITKSGMQRYAAEHNIIVVAPDTSPRGSHVADADRYDLGQGAGFYL
FT                   NATQAPWNEHYKMYDYIRNELPDLVMQHFPATTRKSISGHSMGGLGALVLALRNPDEYV
FT                   SVSAFSPIVSPSQVPWGQQAFAAYLGENKDAWLNYDPVSLISQGQRVAEIMVDQGLSDD
FT                   FYAEQLRTPNLEKICQEMNIKTLIRYHEGYDHSYYFVSSFIGEHIAYHANKLNMR"
FT   CDS_pept        complement(425089..426198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmA"
FT                   /locus_tag="ECO26_0392"
FT                   /product="alcohol dehydrogenase class
FT                   III/glutathione-dependent formaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23736"
FT                   /protein_id="BAI23736.1"
FT                   /translation="MKSRAAVAFAPGKPLEIVEIDVAPPKKGEVLIKVTHTGVCHTDAF
FT                   TLSGDDPEGVFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECEFCRSGKTN
FT                   LCVAVRETQGKGLMPDGTTRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPEANHEH
FT                   VCLLGCGVTTGIGAVHNTAKVQPGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPK
FT                   KFDLARRFGATDCINPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRAALESAHRGW
FT                   GQSVIIGVAGSGQEISTRPFQLVTGRVWKGSAFGGVKGRSQLPGMVEDAMKGDIDLEPF
FT                   VTHTMSLDEINDAFDLMHEGKSIRTVIRY"
FT   CDS_pept        complement(426233..426508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frmR"
FT                   /locus_tag="ECO26_0393"
FT                   /product="regulator protein that represses frmRAB operon"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23737"
FT                   /protein_id="BAI23737.1"
FT                   /translation="MPSTPEEKKKVLTRVRRIRGQIDALERSMEGDAECRAILQQIAAV
FT                   RGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVRAYLK"
FT   CDS_pept        complement(426694..427467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiO"
FT                   /locus_tag="ECO26_0394"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23738"
FT                   /protein_id="BAI23738.1"
FT                   /translation="MIKRTLLAAAIFSALPAYAGLTSITAGYDFTDYSGDHGNRNLAYA
FT                   ELVAKVENATLLFNLSQGRRDYETEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVF
FT                   ARQNFRQDINLALLPKTLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVITSYRYTHYDS
FT                   SDAGGSYSNMISVRLNDPRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPL
FT                   TEQLNLGLTAGKVWYDTPTDDYNGLQLAAHLTWKF"
FT   CDS_pept        complement(427469..427909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0395"
FT                   /product="putative acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23739"
FT                   /protein_id="BAI23739.1"
FT                   /translation="MIGANCLIGNYAFIRPGTIISNGVKIGFATEIKNAVIEAEATIGP
FT                   QCFIADSVVANQAYLGAQVRTSNHRLDEQPVSVRTPEGIIATGCDKLGCYIGQRSRLGV
FT                   QVIILPGRIISPNTQLGPRVIVERNLPAGTYSLRQELIRTGD"
FT   CDS_pept        complement(428028..429224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiP"
FT                   /locus_tag="ECO26_0396"
FT                   /product="predicted glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23740"
FT                   /protein_id="BAI23740.1"
FT                   /translation="MKTWIFICMSIAMLLWFLSTLRRKPSQKKGCIDAIIPAYNEGPCL
FT                   AQSLDNLLRNPYFCRVICVNDGSTDNTEAVMAEVKRKWGDRFVAVTQKNTGKGGALMNG
FT                   LNYATCDQVFLSDADTYVPPDQDGMGYMLAEIERGADAVGGIPSTALKGAGLLPHIRAT
FT                   VKLPMIVMKRTLQQLLGGAPFIISGACGMFRTDVLRKFGFSDRTKVEDLDLTWTLVANG
FT                   YRIRQANRCIVYPQECNSPREEWRRWRRWIVGYAVCMRLHKRLLFSRFGIFSIFPMLLV
FT                   VLYGVGIYLTTWFNEFITTGPHGVVLAMFPLIWIGVVCVIGAFSAWFHRCWLLVPLAPL
FT                   SVVYVLLAYAIWIIYGLIAFFTGREPQRDKPTRYSALVEASTAYSQPSVTGTEKLSEA"
FT   CDS_pept        complement(429234..429905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiS"
FT                   /locus_tag="ECO26_0397"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23741"
FT                   /protein_id="BAI23741.1"
FT                   /translation="MDKVLDSALPSSANKRKGILAIGAHPDDIELGCGASLARLAQKGI
FT                   YIAAVVMTTGNSGTDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALED
FT                   IIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVACRTIPQILGYETPSTWLSFMPQ
FT                   VFESVKEEYFTVKLAALKKHKSQERRDYMRHDRLRAVAQFRGQQVNSDLGEGFVIHKMI
FT                   L"
FT   CDS_pept        430521..431483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECO26_0398"
FT                   /product="taurine transporter subunit TauA"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /note="tauA, GeneHacker: Min.length=50, Min.score =15,
FT                   overlap=0.4"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23742"
FT                   /protein_id="BAI23742.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDAWLKQPENISKLARLSGVPECDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
FT   CDS_pept        431496..432263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauB"
FT                   /locus_tag="ECO26_0399"
FT                   /product="taurine transporter subunit TauB"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23743"
FT                   /protein_id="BAI23743.1"
FT                   /translation="MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLN
FT                   LIAGFVPYQHGSIQLAGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQ
FT                   RLEIAHQMLKKVGLEGAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFT
FT                   RDQMQTLLLKLWQETGKQVLLITHDIEEAVFMATELVLLSPGPGRVLERLPLNFARRFV
FT                   AGESSRSIKSDPQFIAMREYVLSRVFEQREAFS"
FT   CDS_pept        432260..433087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauC"
FT                   /locus_tag="ECO26_0400"
FT                   /product="taurine transporter subunit TauC"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23744"
FT                   /protein_id="BAI23744.1"
FT                   /translation="MSVLINEKLHSRRLKWRWPLSRQVTLSIGTLAVLLTVWWTVAALQ
FT                   LISPLFLPPPQQVLAKLLTIAGPQGFMDATLWQHLAASLTRIVLALLAAVVIGIPVGIA
FT                   MGLSPTVRGILDPVIELYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIFAPVAMSALA
FT                   GVKSAQQVRIRAAQSLGASRAQVLWFVILPGALPEILTGLRIGLGVGWSTLVAAELIAA
FT                   TRGLGFMVQSAGEFLATDVVLAGIAVIAIIAFLLELGLRALQRRLTPWHGEVQ"
FT   CDS_pept        433084..433935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauD"
FT                   /locus_tag="ECO26_0401"
FT                   /product="taurine dioxygenase, 2-oxoglutarate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23745"
FT                   /protein_id="BAI23745.1"
FT                   /translation="MSERLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVV
FT                   FLRDQTIAPQQQRALAQRFGELHIHPVYPHAEGVDEIIVLDTHNDNPPDNDNWHTDVTF
FT                   IETPPAGAILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYK
FT                   YRKTEEEHQRWREAVAKNPPLLHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALL
FT                   GFLFAHITKPEFQVRWRWQPNDIAIWDNRVTQHYANADYLPQRRIMHRATILGDKPFYR
FT                   AG"
FT   CDS_pept        complement(434041..435015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="ECO26_0402"
FT                   /product="porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23746"
FT                   /protein_id="BAI23746.1"
FT                   /translation="MTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYK
FT                   AVEAMPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSR
FT                   ICKQTVPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIA
FT                   PSAAMDGQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMN
FT                   PMNRREAIRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKF
FT                   AALAGAIDEEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR"
FT   mobile_element  435825..437082
FT                   /mobile_element_type="insertion sequence:IS3"
FT   CDS_pept        435890..436189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insE"
FT                   /locus_tag="ECO26_0403"
FT                   /product="putative IS3 transposase InsE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23747"
FT                   /protein_id="BAI23747.1"
FT                   /translation="MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQ
FT                   LYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK"
FT   CDS_pept        436186..436650
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0404"
FT                   /note="predicted transposase InsF of insertion sequence
FT                   IS3, N-terminal part"
FT   CDS_pept        436675..437052
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0405"
FT                   /note="predicted transposase InsF of insertion sequence
FT                   IS3, C-terminal part"
FT   CDS_pept        437160..437858
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="yaiT"
FT                   /locus_tag="ECO26_0406"
FT                   /note="predicted flagellin structural protein, N-terminal
FT                   part"
FT   CDS_pept        437824..439779
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0407"
FT                   /note="predicted flagellin structural protein, C-terminal
FT                   part"
FT   CDS_pept        439867..440490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiV"
FT                   /locus_tag="ECO26_0408"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23748"
FT                   /protein_id="BAI23748.1"
FT                   /translation="MLSVVKPLQEFGKLDKCLSRYGTRFEFNNEKQVIFSSDVNNEDTF
FT                   VILEGVISLRREENVLIGITQAPYIMGLADGLMKNDIPYKLISEGNCTGYHLPAKQTIT
FT                   LIEQNQLWRDAFYWLAWQNRILELRDVQLIGHNSYEQIRATLLSMIDWNEELRSRIGVM
FT                   NYIHQRTRISRSVVAEVLAALRKGGYIEMNKGKLVAINRLPSEY"
FT   CDS_pept        complement(440491..441648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="ECO26_0409"
FT                   /product="beta-lactamase/D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23749"
FT                   /protein_id="BAI23749.1"
FT                   /translation="MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYG
FT                   SGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQG
FT                   TVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQ
FT                   RWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTY
FT                   TPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQAD
FT                   RMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMVPKEGRPGIIQKTGGGGGFITYMAM
FT                   IPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS"
FT   CDS_pept        442000..443220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbmA"
FT                   /locus_tag="ECO26_0410"
FT                   /product="predicted transporter SbmA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23750"
FT                   /protein_id="BAI23750.1"
FT                   /translation="MFKSFFPKPGTFFLSAFVWALIAVIFWQAGGGDWVARITGASGQI
FT                   PISAARFWSLDFLIFYAYYIVCVGLFAFFWFIYSPHRWQYWSILGTALIIFVTWFLVEV
FT                   GVAVNAWYAPFYDLIQTALSSPHKVTIEQFYREVGVFLGIALIAVVISVLNNFFVSHYV
FT                   FRWRTAMNEYYMANWQQLRHIEGAAQRVQEDTMRFASTLENMGVSFINAIMTLIAFLPV
FT                   LVTLSAHVPELPIIGHIPYGLVIAAIVWSLMGTGLLAVVGIKLPGLEFKNQRVEAAYRK
FT                   ELVYGEDDATRATPPTVRELFSAVRKNYFRLYFHYMYFNIARILYLQVDNVFGLFLLFP
FT                   SIVAGTITLGLMTQITNVFGQVRGAFQYLINSWTTLVELMSIYKRLRSFEHELDGDKIQ
FT                   EVTHTLS"
FT   CDS_pept        443233..444327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiW"
FT                   /locus_tag="ECO26_0411"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23751"
FT                   /protein_id="BAI23751.1"
FT                   /translation="MSRVNHLSSLSLLAVLVLAGCSSQAPQPLKKGEKAIDVASVVRQK
FT                   MPASVKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQ
FT                   EIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLISMVPMGQT
FT                   LFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPA
FT                   SYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRK
FT                   LAGKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAEAKTGKSLPREMLPGIQLESPK
FT                   ITRNLTTAWFAKRVDERRARCMKQ"
FT   CDS_pept        complement(444386..444694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECO26_0412"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23752"
FT                   /protein_id="BAI23752.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
FT   CDS_pept        444954..445166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiZ"
FT                   /locus_tag="ECO26_0413"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23753"
FT                   /protein_id="BAI23753.1"
FT                   /translation="MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGL
FT                   VTWVISFWLAGLIIRRRDEETENAQ"
FT   CDS_pept        complement(445190..446284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="ECO26_0414"
FT                   /product="D-alanine-D-alanine ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23754"
FT                   /protein_id="BAI23754.1"
FT                   /translation="MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDK
FT                   QGQWHVSDASNYLLNADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFP
FT                   IVHGTLGEDGSLQGMLRVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTR
FT                   ANRHNISFAEVESKLGLPLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQ
FT                   GIKGREIECAVLGNDNPQASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDK
FT                   IRAIAVQAYQTLGCAGMARVDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYT
FT                   DLITRLIELALERHAADNALKTTM"
FT   CDS_pept        446747..447007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiB"
FT                   /locus_tag="ECO26_0415"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23755"
FT                   /protein_id="BAI23755.1"
FT                   /translation="MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQ
FT                   QRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPRQ"
FT   CDS_pept        447108..448523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="ECO26_0416"
FT                   /product="bacterial alkaline phosphatase PhoA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23756"
FT                   /protein_id="BAI23756.1"
FT                   /translation="MKQSTIALALLSLLFTPVTKARTPEMPVLENRAAQGDITASGGAR
FT                   RLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTG
FT                   QYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEMAKAAGL
FT                   ATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQLLNARA
FT                   DVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPLLGLF
FT                   ADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEKGFF
FT                   LQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQIV
FT                   APDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQT
FT                   DLFYTMKAALGLK"
FT   CDS_pept        448642..448962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psiF"
FT                   /locus_tag="ECO26_0417"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23757"
FT                   /protein_id="BAI23757.1"
FT                   /translation="MKITLLVTLLFGLVFLTTVGAAERTLTPQQQRMTSCNQQATAQAL
FT                   KGDARKTYMSDCLKNSKSAPGEKSLTPQQQKMRECNNQATQQSLKGDDRNKFMSACLKK
FT                   AA"
FT   CDS_pept        449064..450179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiC"
FT                   /locus_tag="ECO26_0418"
FT                   /product="predicted diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23758"
FT                   /protein_id="BAI23758.1"
FT                   /translation="MFPKIMNDENFFKKAAAHGEEPPLTPQNEHQRSGLRFARRVRLPR
FT                   AVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKT
FT                   DAVLAGMWVGVMGVNVLPSTAMLMIMCLNLMGAGGPRLFVAGLVLMVVSCLVTLELTGI
FT                   TVSFNSAPLEWWLSLPIIVVYPLLFGWVSYQTATKLAEHKRRLQVMSTRDGMTGVYNRR
FT                   HWETMLRNEFDNCRRHNRDATLLIIDIDHFKSINDTWGHDVGDEAIVALTRQLQITLRG
FT                   SDVIGRFGGDEFAVIMSGTPAESAITAMLRVREGLNTLRLPNTPQVTLRISVGVAPLNP
FT                   QMSHYREWLKSADLALYKAKKAGRNRTEVAA"
FT   CDS_pept        complement(450196..451005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="ECO26_0419"
FT                   /product="pyrroline-5-carboxylate reductase,
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23759"
FT                   /protein_id="BAI23759.1"
FT                   /translation="MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAAL
FT                   HDQFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGVTLDQ
FT                   LARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEP
FT                   MIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHP
FT                   GALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS"
FT   CDS_pept        451125..451583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiI"
FT                   /locus_tag="ECO26_0420"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23760"
FT                   /protein_id="BAI23760.1"
FT                   /translation="MTIWVDADACPNVIKEILYRAAERMQMPLVLVANQSLRVPPSRFI
FT                   RTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRE
FT                   RLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKWWLEVQRSRG"
FT   CDS_pept        451766..452290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroL"
FT                   /locus_tag="ECO26_0421"
FT                   /product="shikimate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23761"
FT                   /protein_id="BAI23761.1"
FT                   /translation="MTQPLFLIGPRGCGKTTVGMALADSLNRRFVDTDQWLQSQLNMTV
FT                   AEIVEREEWAGFRARETAALEAVTAPSTVIATGGGIILTEFNRHFMQNNGIVVYLCAPV
FT                   SVLVNRLQAAPEEDLRPTLTGKPLSEEVQEVLEERDALYREVAHIIIDATNEPSQVISE
FT                   IRSALAQTINC"
FT   CDS_pept        452340..452531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="ECO26_0422"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23762"
FT                   /protein_id="BAI23762.1"
FT                   /translation="MPTKPPYPREAYIVTIEKGKPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAQEAMDAKKRYEDPDKE"
FT   CDS_pept        452789..453466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECO26_0423"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23763"
FT                   /protein_id="BAI23763.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNQGYDVILLMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEEMLTVQAQKWQILQKSPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFHQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
FT   CDS_pept        453538..453822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECO26_0424"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23764"
FT                   /protein_id="BAI23764.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
FT   CDS_pept        454030..454311
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECO26_0425"
FT                   /note="conserved predicted protein, C-terminal part"
FT   CDS_pept        complement(454469..455380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ECO26_0426"
FT                   /product="DNA-binding protein RdgC, non-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23765"
FT                   /protein_id="BAI23765.1"
FT                   /translation="MLWFKNLMVYRLSREISLRAEEMEKQLASMAFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHVANGQIVICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLSMENPIELTLTEWVRSGSAAQGFQLLDEAELKSLLEDGGVIRAKKQDLTSEEITNH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSLKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLIEGLGGEAQR"
FT   CDS_pept        455505..456413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECO26_0427"
FT                   /product="manno (fructo) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23766"
FT                   /protein_id="BAI23766.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFATDYRRLSGHALKGSEIISLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVPQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
FT   CDS_pept        complement(456556..457740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araJ"
FT                   /locus_tag="ECO26_0428"
FT                   /product="predicted transporter AraJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23767"
FT                   /protein_id="BAI23767.1"
FT                   /translation="MKKVILSLALGTFGLGMAEFGIMGVLTELAHNVGISIPAAGHMIS
FT                   YYALGVVVGAPIIALFSSRYSLKHILLFLVALCVIGNAMFTLSSSYLMLAIGRLVSGFP
FT                   HGAFFGVGAIVLSKIIKPGKVTAAVAGMVSGMTVANLLGIPLGTYLSQEFSWRYTFLLI
FT                   AVFNIAVMASVYFWVPDIRDEAKGKLREQFHFLRSPAPWLIFAATMFGNAGVFAWFSYV
FT                   KPYMMFISGFSETAMTFIMMLVGLGMVLGNMLSGRISGRYSPLRIAAVTDFIIVLALLM
FT                   LFFCCGMKTTSLIFAFICCAGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAVG
FT                   AYCGGMMLTLGLAYNYVALPAALLSFAAMSSLLLYGRYKRQQAADSPVLAKPLG"
FT   CDS_pept        complement(457866..461009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="ECO26_0429"
FT                   /product="ATP-dependent dsDNA exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23768"
FT                   /protein_id="BAI23768.1"
FT                   /translation="MKILSLRLKNLNSLKGEWKIDFTREPFASNGLFAITGPTGAGKTT
FT                   LLDAICLALYHETPRLSNVSQSQNDLMTRDTAECLAEVEFEVKGEAYRAFWSQNRARNQ
FT                   PDGNLQVPRVELARCADGKILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQFAAFLN
FT                   AKPKERAELLEELTGTEIYGQISAMVFEQHKSARTELEKLQAQASGVALLTPEQVQSLT
FT                   ASLQVLTDEEKQLLTAQQQEQQSLNWLTRQDELQQEASRRQQALQQVLAEEEKAQPQLA
FT                   ALSLAQPARNLRPHWERIAEHSAALAHIRQRIEEVNTRLQSTMALRASIRHHAAKQSAE
FT                   LQQQQQSLNTWLQEHDRFRQWNNELAGWRAQFSQQTSDREHLRQWQQQLTHAEQKLNAL
FT                   AAITLTLTADEVATALAQHAEQRPLRQRLVALHGQIVPQQKRLAQLMVTIQNVTLEQTQ
FT                   RNVALNEMRQRYKEKTQQLADVKTICEQEARIKTLEAQRAQLQAGQPCPLCGSTSHPAV
FT                   EAYQALEPGVNQSRLLALENEVKKLGEEGAALRGQLDALTKQLQRDENEAQSLRQDEQA
FT                   LTQQWQAVTASLNITLQPQDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQIIQY
FT                   QQQIEQRQQQLLTALAGYALTLPQEDEEESWLATRQQEAQSWQQRQNELTALQNRIQQL
FT                   TPILETLPQSDDLPHSEETVALDNWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQ
FT                   FDTALQASVFDDQQAFLAALMDEQTLTQLEQLKQNLENQRRQAQTLVTQTAETLAQHQQ
FT                   HRPDGLALTVTVEQIQQELAQTHQKLRENTTSQGEIRQQLKQDADNRQQQQTLMQQIAQ
FT                   MTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKASET
FT                   LEVEVVDTWQADAVRDTRTLSGGESFLVSLALALALSDLVSHKTRIDSLFLDEGFGTLD
FT                   SETLDTALDALDALNASGKTIGVISHVEAMKERIPVQIKVKKINGLGYSKLESTFAVK"
FT   CDS_pept        complement(461006..462208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="ECO26_0430"
FT                   /product="ATP-dependent dsDNA exonuclease SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23769"
FT                   /protein_id="BAI23769.1"
FT                   /translation="MRILHTSDWHLGQNFYSKSREAEHQAFLDWLLETAQTHQVDAIIV
FT                   AGDVFDTGSPPSYARTLYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDIMAFLNTTV
FT                   VASAGHAPQILPRRDGTPGAVLCPIPFLRPRDIITSQAGLNGIEKQQHLLAAITDYYQQ
FT                   HYADACKLRGDQPLPIIATGHLTTVGASKSDAVRDIYIGTLDAFPAQNFPPADYIALGH
FT                   IHRAQIIGGMEHVRYCGSPIPLSFDECGKSKYVHLVTFSNGKLESVENLNVPVTQPMAV
FT                   LKGDLASITAQLEQWRDVSQEPPVWLDIEITTDEYLHDIQRKIQALTESLPVEVLLVRR
FT                   SREQRERVLASQQRETLSELSVEEVFNRRLALEELDESQQQRLQHLFTTTLHTLAGEHE
FT                   A"
FT   CDS_pept        462398..463087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="ECO26_0431"
FT                   /product="DNA-binding response regulator PhoB"
FT                   /note="two-component regulatory system; associates with
FT                   PhoR (or CreC)"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23770"
FT                   /protein_id="BAI23770.1"
FT                   /translation="MARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP
FT                   WPDLILLDWMLPGGSGIQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIT
FT                   KPFSPKELVARIKAVMRRISPMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLL
FT                   HFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGGHDRMVQTVRGTG
FT                   YRFSTRF"
FT   CDS_pept        463145..464440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECO26_0432"
FT                   /product="sensory histidine kinase PhoR in two-component
FT                   regulatory system with PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23771"
FT                   /protein_id="BAI23771.1"
FT                   /translation="MLERLSWKRLVLELLLCCLPAFILGAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTQLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWLRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
FT   CDS_pept        464847..466166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ"
FT                   /locus_tag="ECO26_0433"
FT                   /product="predicted branched chain amino acid transporter"
FT                   /note="LIV-II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23772"
FT                   /protein_id="BAI23772.1"
FT                   /translation="MTHQLRSRDIIALGFMTFALFVGAGNIIFPPMVGLQAGEHVWTAA
FT                   FGFLITAVGLPVLTVVALAKVGGGVDSLSTPIGKVAGVLLATVCYLAVGPLFATPRTAT
FT                   VSFEVGIAPLTGDSALPLFIYSLVYFAIVILVSLYPGKLLDTVGNFLAPLKIIALVILS
FT                   VAAIVWPAGSISTATEAYQNAAFSNGFVNGYLTMDTLGAMVFGIVIVNAARSRGVTEAR
FT                   LLTRYTVWAGLMAGVGLTLLYLALFRLGSDSASLVDQSANGAAILHAYVQHTFGGGGSF
FT                   LLAALIFIACLVTAVGLTCACAEFFAQYVPLSYRTLVFILGGFSMVVSNLGLSQLIQIS
FT                   VPVLTAIYPPCIALVVLSFTRSWWHNSSRVIAPPMFISLLFGILDGIKASAFSDILPSW
FT                   AQRLPLAEQGLAWLMPTVVMVVLAIIWDRAAGRQVTSSAH"
FT   CDS_pept        466242..467615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="ECO26_0434"
FT                   /product="predicted proline transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23773"
FT                   /protein_id="BAI23773.1"
FT                   /translation="MESKNKLKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVL
FT                   LAYIIGGIAAYIIMRALGEMSVHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAI
FT                   ADVTAFGIYMGVWFPTVPHWIWVLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIM
FT                   IVAGFGIIIWGIGNGGQPTGIHNLWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITA
FT                   GEAKDPEKSIPRAINSVPMRILVFYVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITF
FT                   AASILNFVVLTASLSAINSDVFGVGRMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTT
FT                   ALLFAVYLNYIMPENVFLVIASLATFATVWVWIMILLSQIAFRRRLPPEEVKALKFKVP
FT                   GGVATTIGGLIFLLFIIGLIGYHPDTRISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ"
FT   CDS_pept        467771..469588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malZ"
FT                   /locus_tag="ECO26_0435"
FT                   /product="maltodextrin glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23774"
FT                   /protein_id="BAI23774.1"
FT                   /translation="MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNE
FT                   EMSVSMHKQRSQQQPGVTAWRAAIDLSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPA
FT                   RLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPREAEQDHVYYHHAAGQEIILRDWD
FT                   EPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDP
FT                   QFDGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRDW
FT                   YSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWSMDGWRLDVVH
FT                   MLGEAGGARNNMQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTF
FT                   PLWGFLANTDISYDPQQIDAQTCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLG
FT                   RDIARLPLAVVWLFTWPGVPCIYYGDEVGLDGKNDPFCRKPFPWQVEKQDTALFALYQR
FT                   MIALRKKSQALRHGGCQVLYAEDNVVVFVRVLNQQRVLVAINRGEACEVVLPASPLLNA
FT                   VQWQCKEGHGQLTDGILALPAISATVWMN"
FT   CDS_pept        complement(469593..470174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajB"
FT                   /locus_tag="ECO26_0436"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23775"
FT                   /protein_id="BAI23775.1"
FT                   /translation="MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMH
FT                   RRIDVLTDNLPEVREAREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCY
FT                   AREQVMTILPDSPPRFINLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSW
FT                   YDLDAHYDALETRFWQFYPRMMAQASHKAL"
FT   CDS_pept        470267..471337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="ECO26_0437"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23776"
FT                   /protein_id="BAI23776.1"
FT                   /translation="MRVTDFSFELPESLIAHYPMPERSSCRLLSLDGPTGALTHGTFTD
FT                   LLDKLNPGDLLVFNNTRVIPARLFGRKASGGKIEVLVERMLDDKRILAHIRASKAPKPG
FT                   AELLLGDDESINATMTARHGALFEVEFNDERSVLDILNSIGHMPLPPYIDRPDEDADRE
FT                   LYQTVYSEKPGAVAAPTAGLHFDEPLLEKLRAKGVEMAFVTLHVGAGTFQPVRVDTIED
FT                   HIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQ
FT                   IFIYPGFQYKVVDALVTNFHLPESTLIMLVSAFAGYQHTMNAYKAAVEEKYRFFSYGDA
FT                   MFITYNPQAINERVGE"
FT   CDS_pept        471393..472520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="ECO26_0438"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23777"
FT                   /protein_id="BAI23777.1"
FT                   /translation="MKFELDTTDGRARRGRLVFDCGVVETPCFMPVGTYGTVKGMTPEE
FT                   VEATGAQIILGNTFHLWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKI
FT                   TEQGVHFRNPINGDPIFLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSL
FT                   RWAKRSRERFDSLGNKNALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKA
FT                   DMHRILEHVCPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTD
FT                   GVVKIRNAKYKSDTGPLDPECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQR
FT                   LMAGLRKAIEEGKLESFVTDFYQRQGREVPPLNVD"
FT   CDS_pept        472543..472875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECO26_0439"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23778"
FT                   /protein_id="BAI23778.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
FT   CDS_pept        472903..474750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="ECO26_0440"
FT                   /product="SecYEG protein translocase auxillary subunit
FT                   SecD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23779"
FT                   /protein_id="BAI23779.1"
FT                   /translation="MLNRYPLWKYVMLIVVIVIGLLYALPNLFGEDPAVQITGARGVAA
FT                   SEQTLIQVQKTLQEEKITAKSVALEEGAILARFDSTDTQLRAREALMGVMGDKYVVALN
FT                   LAPATPRWLAAIHAEPMKLGLDLRGGVHFLMEVDMDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDAKARDEAIAYLSKRHPDLVISSQGSNQLRAVMSDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAASGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGINNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIEQGLEACL
FT                   AGLLVSILFMIIFYKKFGLIATSALIANLILIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAIDEGYRGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIVGTRAIVNLLYGGKRVKKLSI"
FT   CDS_pept        474761..475732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="ECO26_0441"
FT                   /product="SecYEG protein translocase auxillary subunit
FT                   SecF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23780"
FT                   /protein_id="BAI23780.1"
FT                   /translation="MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRG
FT                   FNWGLDFTGGTVIEITLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGE
FT                   TGGQVLGSQVLKVINESTNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGF
FT                   RFEWRLAAGVVIALAHDVIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIR
FT                   ENFRKIRRGTPYEIFNVSLTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGV
FT                   SIGTASSIYVASALALKLGMKREHMLQQKVEKEGADQPSILP"
FT   CDS_pept        475861..476208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECO26_0442"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23781"
FT                   /protein_id="BAI23781.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
FT   CDS_pept        complement(476385..477269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ECO26_0443"
FT                   /product="nucleoside channel-forming protein T"
FT                   /note="receptor of phage T6 and colicin K"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23782"
FT                   /protein_id="BAI23782.1"
FT                   /translation="MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPQIRNDTYLEYEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEP
FT                   RFSIDKLTNTDLSFGPFKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSM
FT                   NVYAKYQWQNYGAANENEWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSG
FT                   NAINGIKTRTNNSIASSHILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRS
FT                   TGWGGYLVVGYNF"
FT   CDS_pept        complement(477568..478107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajI"
FT                   /locus_tag="ECO26_0444"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23783"
FT                   /protein_id="BAI23783.1"
FT                   /translation="MNTNVFRLLLLGSLFSLSACVQQSEVRQMKHSVSTLNQEMTQLNK
FT                   ETVKITQQNRLNAKSSSGVYLLPGAKTPARLESQIGTLRMSLVNITPDADGTTLTLRIQ
FT                   GESNDPLPAFSGTVEYGQIQGTIDNFQEINVQNQLINAPASVLAPSDVDIPLQLKGISV
FT                   EQLDFVRIHDIQPVMQ"
FT   CDS_pept        478258..478707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaD"
FT                   /locus_tag="ECO26_0445"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23784"
FT                   /protein_id="BAI23784.1"
FT                   /translation="MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAE
FT                   LVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVSSDDVEMAINHIKSQLRATGEREVP
FT                   SKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARLED"
FT   CDS_pept        478711..479814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="ECO26_0446"
FT                   /product="fused diaminohydroxyphosphoribosylaminopyrimidin
FT                   e deaminase and 5-amino-6-(5-phosphoribosylamino) uracil
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23785"
FT                   /protein_id="BAI23785.1"
FT                   /translation="MQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQR
FT                   AGEPHAEVHALRMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVASMQDPN
FT                   PQVAGRGLYRLQQAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAM
FT                   ASGESQWITSPQARRDVQRQRAQSHAILTSSATVLADDPALTVRWSELDEQTQALYPQQ
FT                   NLRQPVRIVIDSQNRVTPEHRIVQQPGETWFARTQEDSSEWPETVRTLLIPEHKGHLDL
FT                   VVLMMQLGKQQINSIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLE
FT                   KLADAPQFKFKEIRHVGPDVCLHLVGA"
FT   CDS_pept        479903..480373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="ECO26_0447"
FT                   /product="riboflavin synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23786"
FT                   /protein_id="BAI23786.1"
FT                   /translation="MNIIEANVATPDARVAITIARFNNFINDSLLEGAIDALKRIGQVK
FT                   DENITVVWVPGAYELPLAAGALAKTGKYDAVIALGTVIRGGTAHFEYVAGGASNGLAHV
FT                   AQDSEIPVAFGVLTTESIEQAIERAGTKAGNKGAEAALTALEMINVLKAIKA"
FT   CDS_pept        480393..480812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="ECO26_0448"
FT                   /product="transcription antitermination protein NusB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23787"
FT                   /protein_id="BAI23787.1"
FT                   /translation="MKPAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDV
FT                   LYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAI
FT                   NEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPNKK"
FT   CDS_pept        480890..481867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ECO26_0449"
FT                   /product="thiamin-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23788"
FT                   /protein_id="BAI23788.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRLDVELGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFLHDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFVPMGRALTRSGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLG
FT                   HIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALGHLGVPFTCIGQMTADIEGLCFIRDGEPVTFDWKGYDHFATP"
FT   CDS_pept        481845..482363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA"
FT                   /locus_tag="ECO26_0450"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23789"
FT                   /protein_id="BAI23789.1"
FT                   /translation="MTILPRHKDVAKSRLKMSNPWHLLAVGFGSGLSPIVPGTMGSLAA
FT                   IPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMA
FT                   LPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFIG
FT                   HHWPLGILS"
FT   CDS_pept        complement(482417..483391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajO"
FT                   /locus_tag="ECO26_0451"
FT                   /product="predicted oxidoreductase, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23790"
FT                   /protein_id="BAI23790.1"
FT                   /translation="MQYNPLGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIK
FT                   RALEGGINFFDTANSYSDGSSEEIVGRALRDFARREDVVVATKVFHRVGDLPEGLSRAQ
FT                   ILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQ
FT                   FAQALKLQKQHGWAQFVSMQDHYNLIYREEESEMLPLCYQEGVAVIPWSPLARGRLTRP
FT                   WGETTARLVSDEVGKNLYKESDENDAQIAERLTGVSEELGATRAQVALAWLLSKPGIAA
FT                   PIIGTSREEQLDELLNAVDITLKPEQIAELETPYKPHAVVGFK"
FT   CDS_pept        complement(483571..485433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="ECO26_0452"
FT                   /product="1-deoxyxylulose-5-phosphate synthase,
FT                   thiamine-requiring, FAD-requiring"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23791"
FT                   /protein_id="BAI23791.1"
FT                   /translation="MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSR
FT                   SSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGL
FT                   HPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEA
FT                   MNHAGDIRPDMLVVLNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPI
FT                   KELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIM
FT                   TKKGRGYEPAEKDPITFHAVPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLM
FT                   AITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRA
FT                   YDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECR
FT                   QMLYTGYHYNDGPSAVRYPRGNAVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPD
FT                   AAKVAESLNATLVDMRFVKPLDEALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAH
FT                   RKPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA"
FT   CDS_pept        complement(485458..486357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="ECO26_0453"
FT                   /product="geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23792"
FT                   /protein_id="BAI23792.1"
FT                   /translation="MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGK
FT                   RLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVK
FT                   FGEANAILAGDALQTLAFSILSDANMPEVSDRDRISMISELASASGIAGMCGGQALDLD
FT                   AEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQ
FT                   DDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQS
FT                   LDTSALEALADYIIQRNK"
FT   CDS_pept        complement(486357..486599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="ECO26_0454"
FT                   /product="exonuclease VII, small subunit XseB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23793"
FT                   /protein_id="BAI23793.1"
FT                   /translation="MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQL
FT                   ARQGQAKLQQAEQRVQILLSDNEDASLTPFTPDNE"
FT   CDS_pept        486805..488253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiI"
FT                   /locus_tag="ECO26_0455"
FT                   /product="sulfurtransferase"
FT                   /note="required for thiamine and 4-thiouridine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23794"
FT                   /protein_id="BAI23794.1"
FT                   /translation="MKFIIKLFPEITIKSQSVRLRFIKILTGNIRNVLKHYDETLAVVR
FT                   HWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEG
FT                   KTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPEVTVHLEVEDDRLLLIK
FT                   GRYEGIGGFPIGTQEDVLSLISGGFDSGVSSYMLMRRGCRVHYCFFNLGGAAHEIGVRQ
FT                   VVHYLWNRFGSSHRVRFVAINFEPVVGEILEKIDDGQMGVILKRMMVRAASKVAERYGV
FT                   QALVTGEALGQVSSQTLTNLRLIDNVSDTLILRPLISYDKEHIINLARQIGTEDFARTM
FT                   PEYCGVISKSPTVKAVKSKIEAEEEKFDFSILDKVVEEANNVDIREIAQQTEQEVVEVE
FT                   TVNGFGPNDVILDIRSIDEQEDKPLKVEGIDVVSLPFYKLSTKFGDLDQNRTWLLWCER
FT                   GVMSRLQALYLREQGFNNVKVYRP"
FT   CDS_pept        complement(488307..488897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajL"
FT                   /locus_tag="ECO26_0456"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23795"
FT                   /protein_id="BAI23795.1"
FT                   /translation="MSASALVCLAPGSEETEAVTTIDLLVRGGIKVTTASVASDGNLAI
FT                   TCSRGVKLLADAPLVEVADGEYDVIVLPGGIKGAECFRDSTLLVETVKQFHRSGRIVAA
FT                   ICAAPATVLVPHDIFPIGNMTGFPTLKDKIPAEQWQDKRVVWDARVKLLTSQGPGTAID
FT                   FGLKIIDLLVGREKAHEVASQLVMAAGIYNYYE"
FT   CDS_pept        complement(488860..489771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="ECO26_0457"
FT                   /product="2-dehydropantoate reductase, NADPH-specific"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23796"
FT                   /protein_id="BAI23796.1"
FT                   /translation="MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETD
FT                   GSIFNESLTANDPDFLATSDLLLVTLKAWQVYDAVKSLASTLPVTTPILLIHNGMGTIE
FT                   ELQNIQQPLLMGTTTHAARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDV
FT                   AWHNNIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHT
FT                   SAEDLRDYVMQVIDATAENISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRL
FT                   FEMVKRKESEYERIGTGLPRPW"
FT   CDS_pept        489939..490430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajQ"
FT                   /locus_tag="ECO26_0458"
FT                   /product="predicted nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23797"
FT                   /protein_id="BAI23797.1"
FT                   /translation="MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDAS
FT                   KTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIES
FT                   ATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD
FT                   "
FT   CDS_pept        complement(490558..491922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajR"
FT                   /locus_tag="ECO26_0459"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23798"
FT                   /protein_id="BAI23798.1"
FT                   /translation="MNDYKMTPGERRATWGLGTVFSLRMLGMFMVLPVLTTYGMALQGA
FT                   SEALIGIAIGIYGLTQAVFQIPFGLLSDRIGRKPLIVGGLAVFAAGSVIAALSDSIWGI
FT                   ILGRALQGSGAIAAAVMALLSDLTREQNRTKAMAFIGVSFGITFAIAMVLGPIITHKLG
FT                   LHALFWMIAILATTGIALTIWVVPNSSTHVLNRESGMVKGSFSKVLAEPRLLKLNFGIM
FT                   CLHMLLMSTFVALPGQLADAGFPAAEHWKVYLATMLIAFGSVVPFIIYAEVKRKMKQVF
FT                   VFCVGLIVVAEIVLWNAQTQFWQLVVGVQLFFVAFNLMEALLPSLISKESPAGYKGTAM
FT                   GVYSTSQFLGVAIGGSLGGWIDGMFDGQGVFLAGAMLAAVWLAVASTMKEPPYVSSLRI
FT                   EIPADIAANEALKVRLLETEGVKEVLIAEEEHSAYVKIDSKVTNRFEIEQAIRQA"
FT   CDS_pept        492330..493265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23799"
FT                   /protein_id="BAI23799.1"
FT                   /translation="MLTKRILFSVMLIVSPSVVASEKAHELYDSIYGGKPAPDVINTLH
FT                   KMAESGDIDAQSLLGWEYYQPRYDTKPDVQEAIKWFELVAKQGDREAPLALGGIYYDGE
FT                   QVRVDYAKAYALFNQAAQHGVNLARSRLGIMYANGQYVEVDCKKAKEYLDKGVHIYGGP
FT                   EDFLATCRKDMIDRKTVDDTLPVITVTRSGMRDNFLDKGFSCMDSLFATTNKLGEVANL
FT                   RVTFSIRRPSGKEINQTVGFAPFGLNRLNISFTDYLFGSFTSNSSLILYKPEFERKSCA
FT                   TVRTTIVAATATINGKDVELLKAGAIEQKW"
FT   CDS_pept        complement(493321..493863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23800"
FT                   /protein_id="BAI23800.1"
FT                   /translation="MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASL
FT                   KKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEKQRVSGVLQGSQPSEIGVVRLVMLG
FT                   VARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSATPN
FT                   AFGAVPMFLAIQHILAA"
FT   CDS_pept        complement(493847..494158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23801"
FT                   /protein_id="BAI23801.1"
FT                   /translation="MPGKTATLPDVDKTLKNARVELKTSPDAKNKLREAAQAVGVDLSA
FT                   FILSAAMERAESVLDNQRRRELSNQSWELMNQLIAEPAQPTLALKALMKRKNSDGRQA"
FT   CDS_pept        complement(494343..495233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="ECO26_0463"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23802"
FT                   /protein_id="BAI23802.1"
FT                   /translation="MMFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVG
FT                   VSLVVASGCVFNNYIDRDIDRKMERTKNRVLVKGLISPAVSLVYATLLGIAGFMLLWFG
FT                   ANPLACWLGVMGFVVYVGVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGEFDSGAA
FT                   ILLAIFSLWQMPHSYAIAIFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLM
FT                   LSLGGYAGYKYLVVAAAVSVWWLGMALRGYKVADDRIWARKLFGFSIIAITALSVMMSV
FT                   DFMVPDSHTLLAAVW"
FT   CDS_pept        complement(495245..495574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECO26_0464"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23803"
FT                   /protein_id="BAI23803.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
FT   CDS_pept        complement(495574..496188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECO26_0465"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23804"
FT                   /protein_id="BAI23804.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
FT   CDS_pept        complement(496178..498169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="ECO26_0466"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23805"
FT                   /protein_id="BAI23805.1"
FT                   /translation="MFGKLSLDAVPFHEPIVMVTIAGIILGGLALVGLITYFGKWTYLW
FT                   KEWLTSVDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFT
FT                   AHGVIMIFFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVG
FT                   EFAQTGWLAYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTM
FT                   FKMPVFTWASLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWA
FT                   WGHPEVYILILPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGA
FT                   GANVNAFFGITTMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGV
FT                   LLAVPGADFVLHNSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFW
FT                   FWIIGFFVAFMPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMY
FT                   VSIRDRDQNRDLTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKK
FT                   PDHYEEIHMPKNSGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVD
FT                   YYVPVAEIEKLENQHFDEITKAGLKNGN"
FT   CDS_pept        complement(498191..499138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="ECO26_0467"
FT                   /product="cytochrome o ubiquinol oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23806"
FT                   /protein_id="BAI23806.1"
FT                   /translation="MRLRKYNKSLGWLSLFAGTVLLSGCNSALLDPKGQIGLEQRSLIL
FT                   TAFGLMLIVVIPAILMAVGFAWKYRASNKDAKYSPNWSHSNKVEAVVWTVPILIIIFLA
FT                   VLTWKTTHALEPSKPLAHDEKPITIEVVSMDWKWFFIYPEQGIATVNEIAFPANTPVYF
FT                   KVTSNSVMNSFFIPRLGSQIYAMAGMQTRLHLIANEPGTYDGISASYSGPGFSGMKFKA
FT                   IATPDRAEFDQWVAKAKQSPNTMSDMAAFEKLAAPSEYNQVEYFSNVKPDLFADVINKF
FT                   MAHGKSMDMTQPEGEHSAHEGMEGMDMSHAESAH"
FT   CDS_pept        complement(499598..501073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampG"
FT                   /locus_tag="ECO26_0468"
FT                   /product="muropeptide transporter AmpG"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23807"
FT                   /protein_id="BAI23807.1"
FT                   /translation="MSSQYLRIFQQPRSAILLILGFASGLPLALTSGTLQAWMTVENID
FT                   LKTIGFFSLVGQAYVFKFLWSPLMDRYTPPFFGRRRGWLLATQILLLVAIAAMGFLEPG
FT                   TQLRWMAALAVVIAFCSASQDIVFDAWKTDVLPAEERGAGAAISVLGYRLGMLVSGGLA
FT                   LWLADKWLGWQGMYWLMAALLIPCIIATLLAPEPTDTIPVPKTLEQAVVAPLRDFFGRN
FT                   NAWLILLLIVLYKLGDAFAMSLTTTFLIRGVGFDAGEVGVVNKTLGLLATIVGALYGGI
FT                   LMQRLSLFRALLIFGILQGASNAGYWLLSITDKHLYSMGAAVFFENLCGGMGTSAFVAL
FT                   LMTLCNKSFSATQFALLSALSAVGRVYVGPVAGWFVEAHGWSTFYLFSVAAAVPGLILL
FT                   LVCRQTLEYTGVNDNFISRTEYPAGYAFAMWTLAAGVSLLAVWLLLLTMDALDLTHFSF
FT                   LPALLEVGVLVALSGVVLGGLLDYLALRKTHLT"
FT   CDS_pept        complement(501117..501695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajG"
FT                   /locus_tag="ECO26_0469"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23808"
FT                   /protein_id="BAI23808.1"
FT                   /translation="MFKKILFPLVALFMLAGCAKPPTTIEVSPTITLPQQDPSLMGVTV
FT                   SINGADQRTDQALAKVTRDNQIVTLTASRDLRFLLQEVLEKQMTARGYMVGPNGPVNLQ
FT                   IIVSQLYADVSQGNVRYNIATKADIAIIATAQNGNKMTKNYRASYNVEGAFQASNKNIA
FT                   DAVNSVLTDTIADMSQDTSIHEFIKQNAR"
FT   CDS_pept        502000..502317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bolA"
FT                   /locus_tag="ECO26_0470"
FT                   /product="regulator of penicillin binding proteins and
FT                   beta-lactamase transcription"
FT                   /note="morphogene"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23809"
FT                   /protein_id="BAI23809.1"
FT                   /translation="MMIRERIEEKLRAAFQPVFLEVVDESYRHNVPAGSESHFKVVLVS
FT                   DRFTGERFLNRHRMIYSTLAEELSTTVHALALHTYTIKEWEGLQDTVFASPPCRGAGSI
FT                   A"
FT   CDS_pept        502661..503959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="ECO26_0471"
FT                   /product="peptidyl-prolyl cis/trans isomerase"
FT                   /note="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23810"
FT                   /protein_id="BAI23810.1"
FT                   /translation="MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKARIDGFR
FT                   KGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGEDFT
FT                   YSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDR
FT                   VTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYH
FT                   AENLKGKAAKFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSA
FT                   IRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQALELPRELFEEQ
FT                   AKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYEDPKEVIEFYSKNKELMDNMR
FT                   NVALEEQAVEAVLAKAKVTEKETTFNELMNQQA"
FT   CDS_pept        504206..504829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECO26_0472"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="subunit of ClpA-ClpP and ClpX-ClpP; ATP-dependent
FT                   serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23811"
FT                   /protein_id="BAI23811.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
FT   CDS_pept        504955..506229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="ECO26_0473"
FT                   /product="ATPase and specificity subunit of ClpX-ClpP
FT                   ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23812"
FT                   /protein_id="BAI23812.1"
FT                   /translation="MTDKRKDGSGKLLYCSFCGKSQHEVRKLIAGPSVYICDECVDLCN
FT                   DIIREEIKEVAPHRERSALPTPHEIRNHLDDYVIGQEQAKKVLAVAVYNHYKRLRNGDT
FT                   SNGVELGKSNILLIGPTGSGKTLLAETLARLLDVPFTMADATTLTEAGYVGEDVENIIQ
FT                   KLLQKCDYDVQKAQRGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAV
FT                   PPQGGRKHPQQEFLQVDTSKILFICGGAFAGLDKVISHRVETGSGIGFGATVKAKSDKA
FT                   SEGELLAQVEPEDLIKFGLIPEFIGRLPVVATLNELSEEALIQILKEPKNALTKQYQAL
FT                   FNLEGVDLEFRDEALDAIAKKAMARKTGARGLRSIVEAALLDTMYDLPSMEDVEKVVID
FT                   ESVIDGQSKPLLIYGKPEAQQASGE"
FT   CDS_pept        506417..508771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="ECO26_0474"
FT                   /product="DNA-binding ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23813"
FT                   /protein_id="BAI23813.1"
FT                   /translation="MNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMD
FT                   HDKKIMLVAQKEASTDEPGVNDLFTVGTVASILQMLKLPDGTVKVLVEGLQRARISALS
FT                   DNGEHFSAKAEYLESPTIDEREQEVLVRTAISQFEGYIKLNKKIPPEVLTSLNSIDDPA
FT                   RLADTIAAHMPLKLADKQSVLEMSDVNERLEYLMAMMESEIDLLQVEKRIRNRVKKQME
FT                   KSQREYYLNEQMKAIQKELGEMDDAPDENEALKRKIDAAKMPKEAKEKAEAELQKLKMM
FT                   SPMSAEATVVRGYIDWMVQVPWNARSKVKKDLRQAQEILDTDHYGLERVKDRILEYLAV
FT                   QSRVNKIKGPILCLVGPPGVGKTSLGQSIAKATGRKYVRMALGGVRDEAEIRGHRRTYI
FT                   GSMPGKLIQKMAKVGVKNPLFLLDEIDKMSSDMRGDPASALLEVLDPEQNVAFSDHYLE
FT                   VDYDLSDVMFVATSNSMNIPAPLLDRMEVIRLSGYTEDEKLNIAKRHLLPKQIERNALK
FT                   KGELTVDDSAIIGIIRYYTREAGVRGLEREISKLCRKAVKQLLLDKSLKHIEINGDNLH
FT                   DYLGVQRFDYGRADNENRVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQ
FT                   ESIQAALTVVRARAEKLGINPDFYEKRDIHVHVPEGATPKDGPSAGIAMCTALVSCLTG
FT                   NPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIA
FT                   DLDIHPVKRIEEVLTLALQNEPSGMQVVTAK"
FT   CDS_pept        508980..509252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECO26_0475"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23814"
FT                   /protein_id="BAI23814.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
FT   CDS_pept        509444..511315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="ECO26_0476"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="rotamase D"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23815"
FT                   /protein_id="BAI23815.1"
FT                   /translation="MMDSLRTAANSLVLKIIFGIIIVSFILTGVSGYLIGGGNNYAAKV
FT                   NDQEISRGQFENAFNSERNRMQQQLGDQYSELAANEGYMKTLRQQVLNRLIDEALLDQY
FT                   ARELKLGISDEQVKQAIFATPAFQVDGKFDNSRYNGILNQMGMTADQYAQALRNQLTTQ
FT                   QLINGVAGTDFMLKGETDELAALVAQQRVVREATIDVNALAAKQPVTEQEIASYYEQNK
FT                   NNFMTPEQFRVSYIKLDAATMQQPVSDADIQSYYDQHQDQFTQPQRTRYSIIQTKTEDE
FT                   AKVVLDELNKGGDFAALAKEKSADIISARNGGDMGWLEDATIPDELKNAGLKEKGQLSG
FT                   VIKSSVGFLIVRLDDIQPAKVKSLDEVRDDIAAKVKHEKALDAYYALQQKVSDAASNDT
FT                   ESLAGAEQAAGVKATQTGWFSKDNLPEELNFKPVADAIFNGGLVGENGAPGINSDIITV
FT                   DGDRAFVLRISEHKPEAVKPLADVQEQVKALVQHNKAEQQAKVDAEKLLVDLKAGKGAE
FT                   AMQAAGLKFGEPKILSRSGRDPISQAAFALPLPAKDKPSYGMATDMQGNVVLLALDEVK
FT                   QGSMPEDQKKAMVQGITQNNAQIVFEALMSNLRKEAKIKIGDALEQQ"
FT   CDS_pept        511466..511837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECO26_0477"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23816"
FT                   /protein_id="BAI23816.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTAVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
FT   CDS_pept        511931..512329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECO26_0478"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23817"
FT                   /protein_id="BAI23817.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
FT   CDS_pept        complement(512381..513076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="ECO26_0479"
FT                   /product="predicted aluminum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23818"
FT                   /protein_id="BAI23818.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGFKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
FT   CDS_pept        complement(513141..514841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaE"
FT                   /locus_tag="ECO26_0480"
FT                   /product="predicted transporter subunit"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23819"
FT                   /protein_id="BAI23819.1"
FT                   /translation="MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLR
FT                   QAQEAGWLEWQAQSGRGKRGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGEL
FT                   RTLLQPFMGGQWQNDTPTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQ
FT                   RPIGDLAHHWETSTDGLRWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFIS
FT                   VKHIEVTHPQCLTFFLHRPDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRL
FT                   ESHDYYHLRHPLLKAVEYWITPPLFEKDLGNSCRHPVQITIGKPEELQRVSQVSSGISL
FT                   GFCYLTLRKSPRLSLWQARKVISIIHQSGLLQTLEVGENLITASHALLPGWTIPYWQVP
FT                   DEVKLPKTLTLVYHLPIELHTMAERLQATLAAEGCELTIIFHNAKNWDDTTLLAHADLM
FT                   MGDRLIGEAPEYTLEQWLRCDPLWPHVFDAPAYAHLQSTLDAVQVMPDEENRFNALKAV
FT                   FSQLMADATLTPLFNYHYRISAPPGVNGVRLTPRGWFEFTEAWLPAPSQ"
FT   CDS_pept        514941..515759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cof"
FT                   /locus_tag="ECO26_0481"
FT                   /product="thiamin pyrimidine pyrophosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23820"
FT                   /protein_id="BAI23820.1"
FT                   /translation="MARLAAFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRH
FT                   ALEMQHILGALSLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHI
FT                   FNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGRVTKICFCGGHDDLTRLQIQLY
FT                   EALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDREMLGS
FT                   VGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYLTHWLDYPHLPYSPE"
FT   CDS_pept        515912..516370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaO"
FT                   /locus_tag="ECO26_0482"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23821"
FT                   /protein_id="BAI23821.1"
FT                   /translation="MLDKIDHKLLALLQQDCTLSLQALAEAVNLTTTPCWKRLKRLEDD
FT                   GILIGKVALLDPEKIGLGLTAFVLIKTQHHSSEWYCRFVTVVTEMPEVLGFWRMAGEYD
FT                   YLMRVQVADMKRYDEFYKRLVNSVPGLSDVTSSFAMEQIKYTTSLPIE"
FT   CDS_pept        516400..518172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlA"
FT                   /locus_tag="ECO26_0483"
FT                   /product="fused predicted multidrug transporter subunits of
FT                   ABC superfamily: ATP-binding components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23822"
FT                   /protein_id="BAI23822.1"
FT                   /translation="MRLFAQLSWYFRREWRRYLGAVALLVIIAMLQLVPPKVVGIVVDG
FT                   VTEQHFTTGLILMWIATMVLIAVVVYLLRYVWRVLLFGASYQLAVELREDYYRQLSRQH
FT                   PEFYLRHRTGDLMARATNDVDRVVFAAGEGVLTLVDSLVMGCAVLIMMSTQISWQLTLF
FT                   ALLPMPVMAIMIKRNGDALHERFKLAQAAFSSLNDRTQESLTSIRMIKAFGLEDRQSAL
FT                   FAADAEDTGKKNMRVARIDARFDPTIYIAIGMANLLAIGGGSWMVVQGSLTLGQLTSFM
FT                   MYLGLMIWPMLALAWMFNIVERGSAAYSRIRAMLAEAPVVNDGSEPVPEGRGELDVNIH
FT                   QFTYPQTDHRALENVNFALKPGQMLGICGPTGSGKSTLLSLIQRHFDVSEGDIRFHDIP
FT                   LTKLQLDSWRSRLAVVSQTPFLFSDTVANNIALGCPNATQQEIEHVARLASVHDDILRL
FT                   PQGYDTEVGERGVMLSGGQKQRISIARALLVNAEILILDDALSAVDGRTEHQILHNLRQ
FT                   WGQGRTVIISAHRLSALTEASEIIVMQHGHIAQRGNHDELAQQSGWYRDMYRYQQLEAA
FT                   LDDAPEIREEAVDA"
FT   CDS_pept        518165..519946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlB"
FT                   /locus_tag="ECO26_0484"
FT                   /product="fused predicted multidrug transporter subunits of
FT                   ABC superfamily: ATP-binding components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23823"
FT                   /protein_id="BAI23823.1"
FT                   /translation="MRSFSQLWPTLKRLLAYGSPWRKPLGIAVLMMWVAAAAEVSGPLL
FT                   ISYFIDNMVAKNNLPLKMVAGLAAAYVGLQLFAAGLHYAQSLLFNRAAVGVVQQLRTDV
FT                   MDAALRQPLSEFDTQPVGQVISRVTNDTEVIRDLYVTVVATVLRSAALVGAMLVAMFSL
FT                   DWRMALVAIMIFPVVLVVMVIYQRYSTPIVRRVRAYLADINDGFNEIINGMSVIQQFRQ
FT                   QARFGERMGEASRSHYMARMQTLRLDGFLLRPLLSLFSSLILCGLLMLFGFSASGTIEV
FT                   GVLYAFISYLGRLNEPLIELTTQQAMLQQAVVAGERVFELMDGPRQQYGNDDRPLQSGT
FT                   IEVDNVSFAYRDDNLVLKNINLSVPSRNFVALVGHTGSGKSTLASLLMGYYPLTEGEIR
FT                   LDGRPLSSLSHSALRQGVAMVQQDPVVLADTFLANVTLGRDISEERVWQALETVQLAEL
FT                   ARSMSDGIYTPLGEQGNNLSVGQKQLLALARVLVETPQILILDEATASIDSGTEQAIQH
FT                   ALAAVREHTTLVVIAHRLSTIVDADTILVLHRGQAVEQGTHQQLLAAQGRYWQMYQLQL
FT                   AGEELAASVREEESLSA"
FT   CDS_pept        520127..520465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="ECO26_0485"
FT                   /product="nitrogen assimilation regulatory protein GlnK for
FT                   GlnL, GlnE, and AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23824"
FT                   /protein_id="BAI23824.1"
FT                   /translation="MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAEL
FT                   YRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRT
FT                   GEADEAAL"
FT   CDS_pept        520495..521781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amtB"
FT                   /locus_tag="ECO26_0486"
FT                   /product="ammonium transporter AmtB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23825"
FT                   /protein_id="BAI23825.1"
FT                   /translation="MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFM
FT                   TIPGIALFYGGLIRGKNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLM
FT                   LKNIELTAVMGSIYQYIHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYI
FT                   PIAHMVWGGGLLASHGALDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPM
FT                   VFTGTAILYIGWFGFNAGSAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLL
FT                   GACSGAIAGLVGVTPACGYIGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVH
FT                   GVCGIVGCIMTGIFAASSLGGVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLA
FT                   DLTVGLRVPEEQEREGLDVNSHGENAYNA"
FT   CDS_pept        complement(521830..522690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ECO26_0487"
FT                   /product="acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23826"
FT                   /protein_id="BAI23826.1"
FT                   /translation="MSQALKNLLTLLNLEKIEEGLFRGQSEDLGLRQVFGGQVVGQALY
FT                   AAKETVPEERLVHSFHSYFLRPGDSKKPIIYDVETLRDGNSFSARRVAAIQNGKPIFYM
FT                   TASFQAPEAGFEHQKTMPSAPAPDGLPSETQIAQSLAHLLPPVLKDKFICDRPLEVRPV
FT                   EFHNPLKGHVAEPHRQVWIRANGSVPDDLRVHQYLLGYASDLNFLPVALQPHGIGFLEP
FT                   GIQIATIDHSMWFHRPFNLNEWLLYSVESTSASSARGFVRGEFYTQDGVLVASTVQEGV
FT                   MRNHN"
FT   CDS_pept        522908..523480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaY"
FT                   /locus_tag="ECO26_0488"
FT                   /product="predicted outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23827"
FT                   /protein_id="BAI23827.1"
FT                   /translation="MKLVHMASGLAVAIALAACADKSADIQTPAPAANTSISATQQPAI
FT                   QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLP
FT                   FNPADVQPNARILLSAAITVNDKLVFITDTVQPVINKGGTKADLTLVPVQQTAVPVQAS
FT                   GGATTTVPSTSPTQVNPSSAVPAPTQY"
FT   CDS_pept        complement(523511..523900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaZ"
FT                   /locus_tag="ECO26_0489"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23828"
FT                   /protein_id="BAI23828.1"
FT                   /translation="MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIP
FT                   EGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQR
FT                   QALLAEGVMVSGSGQIDLQRYRWNY"
FT   ncRNA           523976..524089
FT                   /gene="ffs"
FT                   /locus_tag="ECO26_ncRNA03"
FT                   /note="4.5S sRNA component of Signal Recognition Particle
FT                   (SRP); works with the Ffh protein; involved in
FT                   co-translational protein translocation into and possibly
FT                   through membranes"
FT                   /inference="nucleotide motif:Rfam:RF00169"
FT                   /ncRNA_class="SRP_RNA"
FT   CDS_pept        524200..524553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECO26_0490"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23829"
FT                   /protein_id="BAI23829.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
FT   CDS_pept        complement(524595..526145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaB"
FT                   /locus_tag="ECO26_0491"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23830"
FT                   /protein_id="BAI23830.1"
FT                   /translation="MRTRHLVGLISGVLILSVLLPVGLSIWLAHQQVETSFIEELDTYS
FT                   SRVAIRANKVATQGKDALQELERWQGAACSEAHLMEMRRVSYSYRYIQEVVYIDNNVPQ
FT                   CSSLEHESPPDTFPEPGKISKDGYRVWLTSHNDLGIIRYMVAMGTAHYVVMIDPASFID
FT                   VIPYSSWQIDAAIIGNAHNVVITSSDEIAQGIITRLQKTPGEHIENNGIIYDILPFPEM
FT                   NISIITWASTKMLQKGWHRQVFIWLPLGLVIGQLAAMFVLRILRRIQSPHHRLQDAIEN
FT                   RDICVHYQPIVSLANGKIVGAEALARWPQTDGSWLSPDSFIPLAQQTGLSEPLTLLIIR
FT                   SVFEDMGDWLRQHPQQHISINLESTVLTSEKIPQLLREMINHYQVNPRQIALELTEREF
FT                   ADPKTSAPIISRYREAGHEIYLDDFGTGYSSLSYLQDLDVDILKIDKSFVDALEYKNVT
FT                   PHIIEMAKTLKLKMVAEGIETSKQEEWLRQHGVHYGQGWLYSKALPKEDFLRWAEQHL"
FT   CDS_pept        complement(526309..526779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaC"
FT                   /locus_tag="ECO26_0492"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23831"
FT                   /protein_id="BAI23831.1"
FT                   /translation="MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVA
FT                   FFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWY
FT                   NTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS"
FT   CDS_pept        complement(526895..527446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="ECO26_0493"
FT                   /product="maltose O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23832"
FT                   /protein_id="BAI23832.1"
FT                   /translation="MSTEKEKMIAGELYRSADETLSRDRLRARQLIHRYNHSLAEEHTL
FT                   RQQILADLFGQVTEAYIEPTFRCDYGYNIFLGNNFFANFDCVMLDVCPIRIGDNCMLAP
FT                   GVHIYTATHPIDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVT
FT                   KDVPDNVVVGGNPARIIKKL"
FT   CDS_pept        complement(527618..527836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ECO26_0494"
FT                   /product="gene expression modulator Hha"
FT                   /note="interact with H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23833"
FT                   /protein_id="BAI23833.1"
FT                   /translation="MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
FT   CDS_pept        complement(527862..528236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaJ"
FT                   /locus_tag="ECO26_0495"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23834"
FT                   /protein_id="BAI23834.1"
FT                   /translation="MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAIN
FT                   LQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYLDDTFMLFSSYGINMQDLQKWRKSG
FT                   NRLFRCFVNATKENPASLSC"
FT   CDS_pept        complement(528782..531931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="ECO26_0496"
FT                   /product="multidrug efflux system protein AcrB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23835"
FT                   /protein_id="BAI23835.1"
FT                   /translation="MPNFFIDRPIFAWVIAIIIMLAGGLAILKLPVAQYPTIAPPAVTI
FT                   SASYPGADAKTVQDTVTQVIEQNMNGIDNLMYMSSNSDSTGTVQITLTFESGTDADIAQ
FT                   VQVQNKLQLAMPLLPQEVQQQGVSVEKSSSSFLMVVGVINTDGTMTQEDISDYVAANMK
FT                   DAISRTSGVGDVQLFGSQYAMRIWMNPNELNKFQLTPVDVITAIKAQNAQVAAGQLGGT
FT                   PPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGGENYDIIAEF
FT                   NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDTTPFVKISIHEV
FT                   VKTLVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAF
FT                   FGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLKPIAKGDHGEGKKGFFGWFN
FT                   RMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDEDQGVFMTMV
FT                   QLPAGATQERTQKVLNEVTHYYLTKEKNNVESVFAVNGFGFAGRGQNTGIAFVSLKDWA
FT                   DRPGEENKVEAITMRATRAFSQIKDAMVFAFNLPAIVELGTATGFDFELIDQAGLGHEK
FT                   LTQARNQLLAEAAKHPDMLTSVRPNGLEDTPQFKIDIDREKAQALGVSINDINTTLGAA
FT                   WGGSYVNDFIDRGRVKKVYVMSEAKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG
FT                   SPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQLASKLPTGVGYDWTGMSYQERLSGN
FT                   QAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVG
FT                   LLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPL
FT                   VISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRRRFSRKNEDIEHSHTVDH
FT                   H"
FT   CDS_pept        complement(531954..533147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="ECO26_0497"
FT                   /product="multidrug efflux system protein AcrA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23836"
FT                   /protein_id="BAI23836.1"
FT                   /translation="MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTV
FT                   KTEPLQITTELPGRTSAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQAT
FT                   YDSAKGDLAKAQAAANIAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAA
FT                   VETARINLAYTKVTSPISGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSND
FT                   FLRLKQELANGTLKQENGKAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFP
FT                   NPDHTLLPGMFVRARLEEGLNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVAS
FT                   QAIGDKWLVTEGLKAGDRVVISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS"
FT   CDS_pept        533289..533936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="ECO26_0498"
FT                   /product="DNA-binding transcriptional repressor AcrR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23837"
FT                   /protein_id="BAI23837.1"
FT                   /translation="MARKTKQEAQETRQHILDVALRLFSQQGVSSTSLGEIAKAAGVTR
FT                   GAIYWHFKDKSDLFSEIWELSESNIGELELEYQAKFPGDPLSVLREILIHVLESTVTEE
FT                   RRRLLMEIIFHKCEFVGEMAVVQQAQRNLCLESYDRIEQTLKHCIEAKMLPADLMTRRA
FT                   AIIMRGYISGLMENWLFAPQSFDLKKEARDYVAILLEMYLLCPTLRNPATNE"
FT   CDS_pept        534064..537426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefA"
FT                   /locus_tag="ECO26_0499"
FT                   /product="mechanosensitive channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23838"
FT                   /protein_id="BAI23838.1"
FT                   /translation="MTMFQYYKRSRHFVFSAFIAFVFVLLCQNTAFARASSNGDLPTKA
FT                   DLQAQLDSLNKQKDLSAQDKLVQQDLTDTLATLDKIDRIKEETVQLRQKVAEAPEKMRQ
FT                   ATAALTALSDVDNDEETRKILSTLSLRQLETRVAQALDDLQNAQNDLASYNSQLVSLQT
FT                   QPERVQNAMYNASQQLQQIRSRLDGTDVGETALRPSQKVLMQAQQALLNAEIDQQRKSL
FT                   EGNTVLQDTLQKQRDYVTANSARLEHQLQLLQEAVNSKRLTLTEKTAQEAVSPDEAARI
FT                   QANPLVKQELEINQQLSQRLITATENGNQLMQQNIKVKNWLERALQSERNIKEQIAVLK
FT                   GSLLLSRILYQQQQTLPSADELENMTNRIADLRLEQFEVNQQRDALFQSDAFVNKLEEG
FT                   HTNEVNSEVHDALLQVVDMRRELLDQLNKQLGNQLMMAINLQINQQQLMSVSKNLKSIL
FT                   TQQIFWVNSNRPMDWDWIKAFPQSLKDEFKSMKITVNWEKAWPAVFIAFLAGLPLLLIA
FT                   GLIHWRLGWLKAYQQKLASAVGSLRNDSQLNTPKAILIDLIRALPVCLIILAVGLILLT
FT                   MQLNISELLWSFSKKLAIFWLVFGLCWKVLEKNGVAVRHFGMPEQQTSHWRRQIVRISL
FT                   ALLPIHFWSVVAELSPLHLMDDVLGQAMIFFNLLLIAFLVWPMCRESWRDKESHTMRLV
FT                   TITVLSIIPIALMVLTATGYFYTTLRLSGRWIETVYLVIIWNLLYQTVLRGLSVAARRI
FT                   AWRRALARRQNLVKEGAEGAEPPEEPTIALEQVNQQTLRITMLLMFALFGVMFWAIWSD
FT                   LITVFSYLDSITLWHYNGTEAGAAVVKNVTMGSLLFAIIASMVAWALIRNLPGLLEVLV
FT                   LSRLNMRQGASYAITTILNYIIIAVGAMTVFGSLGVSWDKLQWLAAALSVGLGFGLQEI
FT                   FGNFVSGLIILFERPVRIGDTVTIGSFSGTVSKIRIRATTITDFDRKEVIIPNKAFVTE
FT                   RLINWSLTDTTTRLVIRLGVAYGSDLEKVRKVLLKAATEHPRVMHEPMPEVFFTAFGAS
FT                   TLDHELRLYVRELRDRSRTVDELNRTIDQLCRENDINIAFNQLEVHLHNEKGDEVTEVK
FT                   RDYKGDDPTPAVG"
FT   mobile_element  complement(537560..538836)
FT                   /mobile_element_type="insertion sequence:IS621"
FT   CDS_pept        complement(537665..538645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0500"
FT                   /product="putative IS621 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23839"
FT                   /protein_id="BAI23839.1"
FT                   /translation="MEHELHYIGIDTAKEKLDVDVLRPDGRHRTKKFANTTKGHDELVS
FT                   WLKGHKIDHAHICIEATGTYMEPVAECLYDAGYIVSVINPALGKAFAQSEGLRNKTDTV
FT                   DARMLAEFCRQKRPAAWEAPHPLERALRALVVRHQALTDMHTQELNRTETAREVQRPSI
FT                   DAHLLWLEAELKRLEKQIKDLTDDDPDMKHRRKLLESIPGIGEKTSAVLLAYIGLKDRF
FT                   AHARQFAAFAGLTPRRYESGSSVRGASRMSKAGHVSLRRALYMPAMVATSKTEWGRAFR
FT                   DRLAANGKKGKVILGAMMRKLAQVAYGVLKSGVPFDASRHNPVAA"
FT   CDS_pept        complement(538918..539079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaM"
FT                   /locus_tag="ECO26_0501"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23840"
FT                   /protein_id="BAI23840.1"
FT                   /translation="MSLENAPDDVKLAVDLIVLLEENQIPARTVLRALDIVKRDYEKKL
FT                   TRDDEAEK"
FT   CDS_pept        complement(539093..539620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECO26_0502"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23841"
FT                   /protein_id="BAI23841.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVAQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
FT   CDS_pept        539690..540067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECO26_0503"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23842"
FT                   /protein_id="BAI23842.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
FT   CDS_pept        540220..540771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="ECO26_0504"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23843"
FT                   /protein_id="BAI23843.1"
FT                   /translation="MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSI
FT                   DLLVERYKNAGITKVVGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEY
FT                   GTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGG
FT                   EQRLEKQGITSYSLVPFPGH"
FT   CDS_pept        540900..542831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="ECO26_0505"
FT                   /product="DNA polymerase III/DNA elongation factor III, tau
FT                   and gamma subunits"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23844"
FT                   /protein_id="BAI23844.1"
FT                   /translation="MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSG
FT                   TRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDT
FT                   RDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTD
FT                   QAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEAL
FT                   LVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELP
FT                   YAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQ
FT                   APTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQ
FT                   ARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEA
FT                   IERDAWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEAL
FT                   STLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAEL
FT                   DEESIRPI"
FT   CDS_pept        542884..543213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECO26_0506"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23845"
FT                   /protein_id="BAI23845.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
FT   CDS_pept        543213..543818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECO26_0507"
FT                   /product="gap repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23846"
FT                   /protein_id="BAI23846.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
FT   CDS_pept        543928..545802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="ECO26_0508"
FT                   /product="HSP90 family molecular chaperone HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23847"
FT                   /protein_id="BAI23847.1"
FT                   /translation="MKGQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADK
FT                   LRFRALSNPDLYEGDGELRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKS
FT                   FLESLGSDQAKDSQLIGQFGVGFYSAFIVADKVTVRTRAAGEKPENGVFWESAGEGEYT
FT                   VADITKEDRGTEITLHLREGEDEFLDDWRVRSIISKYSDHIALPVEIEKREEKDGETVI
FT                   SWEKINKAQALWTRNKSEITDEEYKEFYKHIAHDFNDPLTWSHNRVEGKQEYTSLLYIP
FT                   SQAPWDMWNRDHKHGLKLYVQRVFIMDDAEQFMPNYLRFVRGLIDSSDLPLNVSREILQ
FT                   DSTVTRNLRNALTKRVLQMLEKLAKDDADKYQTFWQQFGLVLKEGPAEDFANQEAIAKL
FT                   LRFASTYTDSSAQTVSLEDYVSRMKEGQEKIYYITADSYAAAKSSPHLELLRKKGIEVL
FT                   LLSDRIDEWMMNYLTEFDGKPFQSVSKVDESLEKLADEVDESAKEAEKALTPFIDRVKA
FT                   LLGERVKDVRLTHRLTDTPAIVSTDADEMSTQMAKLFAAAGQKVPEVKYIFELNPDHVL
FT                   VKRAADTEDEAKFSEWVELLLDQALLAERGTLEDPNLFIRRMNQLLVS"
FT   CDS_pept        545983..546627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="ECO26_0509"
FT                   /product="adenylate kinase Adk"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23848"
FT                   /protein_id="BAI23848.1"
FT                   /translation="MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSEL
FT                   GKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVD
FT                   YVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEET
FT                   VRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG"
FT   CDS_pept        546863..547825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="ECO26_0510"
FT                   /product="ferrochelatase HemH"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23849"
FT                   /protein_id="BAI23849.1"
FT                   /translation="MRQTKTGILLANLGTPDAPTPEAVKRYLKQFLSDRRVVDTSRLLW
FT                   WPLLRGVILPLRSPRVAKMYASVWMEDGSPLMVYSRQQQQALAQRLPDTPVALGMSYGS
FT                   PSLESAVDELLAEHVDHIVVLPLYPQFSCSTVGAVWDELARILARKRSIPGISFIRDYA
FT                   DNHDYINALANSVRASFAKHGEPDLLLLSYHGIPQRYADEGDDYPQRCRTTTRELASAL
FT                   GMAPEKVMMTFQSRFGREPWLMPYTDETLKMLGEKGVGHIQVMCPGFAADCLETLEEIA
FT                   EQNREVFLGAGGKKYEYIPALNATPEHIEMMANLVAAYR"
FT   CDS_pept        complement(547822..548781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="ECO26_0511"
FT                   /product="acetyl esterase Aes"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23850"
FT                   /protein_id="BAI23850.1"
FT                   /translation="MKPENKLPVLDLISAEMKTVVNTLQPDLPSWPATGTIAEQRQYYT
FT                   LERRFWNAGAPEMATRAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHD
FT                   RIMRLLASYSQCTVIGIDYPLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAG
FT                   DSAGAMLALASALWLRDKQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQ
FT                   MYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQP
FT                   CEFKLYPGTLHAFLHYSRMMKTADEALRDGAQFFTAQL"
FT   CDS_pept        548933..550237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsk"
FT                   /locus_tag="ECO26_0512"
FT                   /product="inosine/guanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23851"
FT                   /protein_id="BAI23851.1"
FT                   /translation="MKFPGKRKSKHYFPVNARDPLLQQFQPENETSAAWVVGIDQTLVD
FT                   IEAKVDDEFIERYGLSAGHSLVIEDDVAEALYQELKQKNLITHQFAGGTIGNTMHNYSV
FT                   LADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERT
FT                   FAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVP
FT                   VVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLV
FT                   LCTAGPIGLYMAGFTEDEAKRKTQHPLLPGAIAEFNQYEFSRAMRHKDCQNPLRVYSHI
FT                   APYMGGPEKIMNTNGAGDGALAALLHDITANSYHRSNVPNSSKHKFTWLTYSSLAQVCK
FT                   YANRVSYQVLNQHSPRLTRGLPEREDSLEESYWDR"
FT   CDS_pept        complement(550370..552046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaL"
FT                   /locus_tag="ECO26_0513"
FT                   /product="predicted transporter"
FT                   /note="contains NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23852"
FT                   /protein_id="BAI23852.1"
FT                   /translation="MHHATPLITTIVGGLVLAFILGMLANKLRISPLVGYLLAGVLAGP
FT                   FTPGFVADTKLAPELAELGVILLMFGVGLHFSLKDLMAVKSIAIPGAIAQIAVATLLGM
FT                   ALSAVLGWSLMTGIVFGLCLSTASTVVLLRALEERQLIDSQRGQIAIGWLIVEDLVMVL
FT                   TLVLLPAVAGMMEQGDVGFATLAVDMGITIGKVIAFIAIMMLVGRRLVPWIMARSAATG
FT                   SRELFTLSVLALALGIAFGAVELFDVSFALGAFFAGMVLNESELSHRAAHDTLPLRDAF
FT                   AVLFFVSVGMLFDPLILIQQPLAVLATLAIILFGKSLAAFFLVRLFGHSQRTALTIAAS
FT                   LAQIGEFAFILAGLGMALNLLPQAGQNLVLAGAILSIMLNPVLFALLEKYLAKTETLEE
FT                   QTLEEAIEEEKQIPVDICNHALLVGYGRVGSLLGEKLLASDIPLVVIETSRTRVDELRE
FT                   RGVRAVLGNAANEEIMQLAHLECAKWLILTIPNGYEAGEIVASARAKNPDIEIIARAHY
FT                   DDEVAYITERGANQVVMGEREIARTMLELLETPPAGEVVTG"
FT   CDS_pept        complement(552284..553504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="ECO26_0514"
FT                   /product="predicted fosmidomycin efflux system protein Fsr"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23853"
FT                   /protein_id="BAI23853.1"
FT                   /translation="MAMSEQPQPVAGAAASTTKARTSFGILGAISLSHLLNDMIQSLIL
FT                   AIYPLLQSEFSLTFMQIGMITLTFQLASSLLQPVVGYWTDKYPMPWSLPIGMCFTLSGL
FT                   VLLALAGSFGAVLLAAALVGTGSSVFHPESSRVARMASGGRHGLAQSIFQVGGNFGSSL
FT                   GPLLAAVIIAPYGKGNVAWFVLAALLAIVVLAQISRWYSAQHRMNKGKPKATIINPLPR
FT                   NKVVLAVSILLILIFSKYFYMASISSYYTFYLMQKFGLSIQNAQLHLFAFLFAVAAGTV
FT                   IGGPVGDKIGRKYVIWGSILGVAPFTLILPYASLHWTGVLTVIIGFILASAFSAILVYA
FT                   QELLPGRIGMVSGLFFGFAFGMGGLGAAVLGLIADHTSIELVYKICAFLPLLGMLTIFL
FT                   PDNRHKD"
FT   CDS_pept        553722..555374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ushA"
FT                   /locus_tag="ECO26_0515"
FT                   /product="bifunctional UDP-sugar hydrolase and
FT                   5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23854"
FT                   /protein_id="BAI23854.1"
FT                   /translation="MKLLQRGVALALLTTFTLASETALAYEQDKTYKITVLHTNDHHGH
FT                   FWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGM
FT                   NLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDL
FT                   KIAVIGLTTDDTAKIGNPEYFTDVEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYD
FT                   NGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQN
FT                   GIWIVQAHEWGKYVGRADFEFRNGKMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIA
FT                   ENQQMISLLSPFQNKGKAQLEVKIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGA
FT                   DFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSG
FT                   AYPQFANVSFVAKDGRLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRLDNKPGYVN
FT                   TGFIDAEVLKAYIQKSSPLDVSVYEPKGEVSWQ"
FT   CDS_pept        complement(555411..555890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="ECO26_0516"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23855"
FT                   /protein_id="BAI23855.1"
FT                   /translation="MTPAVKLLEKNKISFQIHTYEHDPAETNFGDEVVKKLGLNPDQVY
FT                   KTLLVAVNGDMKHLAVAVTPVAGQLDLKKVAKALGAKKVEMADPMVAQRSTGYLVGGIS
FT                   PLGQKKRLPTIIDAPAQEFATIYVSGGKRGLDIELAAGDLAKILDAKFADIARRD"
FT   ncRNA           556013..556095
FT                   /gene="sroB"
FT                   /locus_tag="ECO26_ncRNA04"
FT                   /note="Novel sRNA, function unknown"
FT                   /inference="nucleotide motif:Rfam:RF00368"
FT                   /ncRNA_class="other"
FT   CDS_pept        complement(556094..556888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaP"
FT                   /locus_tag="ECO26_0517"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23856"
FT                   /protein_id="BAI23856.1"
FT                   /translation="MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSH
FT                   DMAPLPTRLLKKLKNADALIVEADVSTSDTPFANLPACEALEERISEEQLQNLQHISQE
FT                   MGISPSLFSTQPLWQIAMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAEN
FT                   QIAMLLQLPDKGLALLDDTLTHWHTNARLLQQMMSWWLNAPPQNNEITLPNTFSQSLYD
FT                   VLMHQRNLAWRDKLRAMPPGRYVVAVGALHLYGEGNLPQMLR"
FT   CDS_pept        557026..557367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaQ"
FT                   /locus_tag="ECO26_0518"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23857"
FT                   /protein_id="BAI23857.1"
FT                   /translation="MKQATRKPTTPGDILLYEYLVPLDLKINELAELLHVHRNSVSALI
FT                   NNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLWEVENNMRTQEELGRIETVAEYLAR
FT                   REERAKKVA"
FT   CDS_pept        complement(557481..559985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="ECO26_0519"
FT                   /product="copper transporter CopA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23858"
FT                   /protein_id="BAI23858.1"
FT                   /translation="MSQIIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTG
FT                   TASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLL
FT                   LSGMSCASCVTRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAVEKAGYGAEA
FT                   IEDDAKRRERQQETAVATMKRFRWQAIVALAVGIPVMVWGMIGDNMMVTADNRSLWLVI
FT                   GLITLAVMVFAGGHFYRSAWKSLLNGAATMDTLVALGTGVAWLYSMSVNLWPQWFPMEA
FT                   RHLYYEASAMIIGLINLGHMLEARARQRSSKALEKLLDLTPPTARLVTDEGEKSVPLAE
FT                   VQPGMLLRLTTGDRVPVDGEITQGEAWLDEAMLTGEPIPQQKGEGESVHAGTVVQDGSV
FT                   LFRASAVGSHTTLSRIIRMVRQAQSSKPEIGQLADKISAVFVPVVVVIALVSAAIWYFF
FT                   GPAPQIVYTLVIATTVLIIACPCALGLATPMSIISGVGRAAEFGVLVRDADALQRASTL
FT                   DTVVFDKTGTLTEGKPQVVAVKTFADVDEAQALRLAAALEQGSSHPLARAILDKAGDMQ
FT                   LPQVNGFRTLRGLGVSGEAEGHALLLGNQALLNEQQVGTKAIEAEITAQASQGATPVLL
FT                   AVDGKAVALLAVRDPLRSDSVAALQRLHKAGYRLVMLTGDNPTTANAIAKEAGIDEVIA
FT                   GVLPDGKAEAIKRLQSEGRQVAMVGDGINDAPALAQADVGIAMGGGSDVAIETAAITLM
FT                   RHSLMGVADALAISRATLRNMKQNLLGAFIYNSIGIPVAAGILWPFTGTLLNPVVAGAA
FT                   MALSSITVVSNANRLLRFKPKE"
FT   CDS_pept        560247..561179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaS"
FT                   /locus_tag="ECO26_0520"
FT                   /product="predicted glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23859"
FT                   /protein_id="BAI23859.1"
FT                   /translation="MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPSQLAAVAI
FT                   VTCDGNIYRAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIAL
FT                   ELHGGKPLSPLVNAGAIATTSLINAENIEQRWQRILHIQQQLAGEQVALSDEVNQSEQT
FT                   TNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLINTVELATLGATLAAGGVNPLTH
FT                   KRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSP
FT                   PLDEEGNSVRGQKMVASVAKQLGYNVFKG"
FT   CDS_pept        561182..562474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaT"
FT                   /locus_tag="ECO26_0521"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23860"
FT                   /protein_id="BAI23860.1"
FT                   /translation="MMNTEGNNGNKPLGLWNVVSIGIGAMVGAGIFALLGQAALLMEAS
FT                   TWVAFAFGGIVAMFSGYAYARLGASYPSNGGIIDFFRRGLGNGVFSLALSLLYLLTLAV
FT                   SIAMVARAFGAYAVQFLHEGSQEEHLILLYALGIIAVMTLFNSLSNHAVGRLEVILVGI
FT                   KMMILLLLIIAGVWSLQPAHISVSAPPSSGAFFSCIGITFLAYAGFGMMANAADKVKDP
FT                   QVIMPRAFLVAIGVTTLLYISLALVLLSDVSALELEKYADTAVAQAASPLLGHVGYVIV
FT                   VIGALLATASAINANLFAVFNIMDNMGSERELPKLMNKSLWRQSTWGNIIVVVLIMLMT
FT                   AALNLGSLASVASATFLICYLAVFVVAIRLRHDIHASLPILIVGTLVMLLVIVGFIYSL
FT                   WSQGSRALIWIIGSLLLSLIVAMVMKRNKTV"
FT   CDS_pept        562599..563006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cueR"
FT                   /locus_tag="ECO26_0522"
FT                   /product="DNA-binding transcriptional activator CueR of
FT                   copper-responsive regulon genes"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23861"
FT                   /protein_id="BAI23861.1"
FT                   /translation="MNISDVAKITGLTSKAIRFYEEKGLVTPPMRSENGYRTYTQQHLN
FT                   ELTLLRQARQVGFNLEESGELVNLFNDPQRHSADVKRRTLEKVAEIERHIEELQSMRDQ
FT                   LLALANACPGDDSADCPIIENLSGCCHHRAG"
FT   CDS_pept        complement(563007..563462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECO26_0523"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23862"
FT                   /protein_id="BAI23862.1"
FT                   /translation="MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLVPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
FT   CDS_pept        complement(563462..564379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbK"
FT                   /locus_tag="ECO26_0524"
FT                   /product="predicted membrane anchored protease"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23863"
FT                   /protein_id="BAI23863.1"
FT                   /translation="MLIFIPILIFVALVIVGAGVKIVPQGYQWTVERFGRYTKTLQPGL
FT                   SLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNL
FT                   ELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVR
FT                   PPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEGEKQSQILKAEGERQSAFLQA
FT                   EARERSAEAEARATKMVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEA
FT                   SSLMGSIAGIAELVKDSANKRTQP"
FT   CDS_pept        564525..565202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECO26_0525"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23864"
FT                   /protein_id="BAI23864.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTNGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
FT   CDS_pept        565189..565968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="ECO26_0526"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23865"
FT                   /protein_id="BAI23865.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDIFWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
FT   CDS_pept        complement(566031..566885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbN"
FT                   /locus_tag="ECO26_0527"
FT                   /product="predicted thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23866"
FT                   /protein_id="BAI23866.1"
FT                   /translation="MSVENIVNINESNLQQVLEQSMTTPVLFYFWSERSQHCLQLTPIL
FT                   ESLAAQYNGQFILAKLDCDAEQMIAAQFGLRAIPTVYLFQNGQPVDGFQGPQPEEAIRA
FT                   LLDKVLPREEELKAQQAMQLMQEGNYTDALPLLKDAWQLSNQNGEIGLLLAETLIALNR
FT                   SEDAETVLKTIPLQDQDTRYQGLVAQIELLKQAADTPEIQQLQQQVAENPEDAALATQL
FT                   ALQLHQVGRNEEALELLFGHLRKDLTAADGQTRKTFQEILAALGTGDALASKYRRQLYA
FT                   LLY"
FT   CDS_pept        complement(566946..567755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbO"
FT                   /locus_tag="ECO26_0528"
FT                   /product="predicted oxidoreductase"
FT                   /note="contains NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23867"
FT                   /protein_id="BAI23867.1"
FT                   /translation="MTHKATEILTGKVMQKSVLITGCSSGIGLESALELKRQGFHVLAG
FT                   CRKPDDVERMNNMGFTGVLIDLDSPESVDRAADEVIALTDNCLYGIFNNAGFGMYGPLS
FT                   TISRAQMEQQFSANFFGAHQLTMRLLPAMLPHGEGRIVMTSSVMGLISTPGRGAYAASK
FT                   YALEAWSDALRMELRHSGIKVSLIEPGPIRTRFTDNVNQTQSDKPVENPGIAARFTLGP
FT                   EAVVDKVRHAFISEKPKMRYPVTLVTWAVMVLKRLLPGRVMDKILQG"
FT   CDS_pept        complement(567745..568371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="ECO26_0529"
FT                   /product="multifunctional acyl-CoA thioesterase I and
FT                   protease I and lysophospholipase L1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23868"
FT                   /protein_id="BAI23868.1"
FT                   /translation="MMNFNNVFRWHLPFLFLVLLTFRAAAADTLLILGDSLSAGYRMSA
FT                   SAAWPALLNDKWQSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRG
FT                   FQPQQTEQTLRQILQDVKAANAEPLLMQIRLPANYGRRYNEAFSAIYPKLAKEFDVPLL
FT                   PFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVNHDS"
FT   CDS_pept        568339..569025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECO26_0530"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23869"
FT                   /protein_id="BAI23869.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLDHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
FT   CDS_pept        569022..571436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbP"
FT                   /locus_tag="ECO26_0531"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23870"
FT                   /protein_id="BAI23870.1"
FT                   /translation="MIARWFWREWRSPSLLIVWLALSLAVACVLALGNISDRMEKGLSQ
FT                   QSREFMAGDRALRSSREVPQAWLEEAQKRGLKVGKQLTFATMTFAGDTPQLANVKAVDD
FT                   IYPMYGDLQTNPPGLKPQAGSVLLAPRLMALLNLKTGDTIDVGDATLRIAGEVIQEPDS
FT                   GFNPFQMAPRLMMNLADVDKTGAVQPGSRVTWRYKFGGNENQLDGYEKWLLPQLKPEQR
FT                   WYGLEQDEGALGRSMERSQQFLLLSALLTLLLAVAAVAVAMNHYCRSRYDLVAILKTLG
FT                   AGRAQLRKLIVGQWLMVLALSAVTGGAIGLLFENVLMVLLKPVLPAALPPASLWPWLWA
FT                   LGTMTVISLLVGLRPYRLLLATQPLRVLRNDVVANVWPLKFYLPIVSVVVVLLLAGLMG
FT                   GSMLLWAVLAGAVVLALLCGVLGWMLLNVLRRMTLKSLPLRLAVSRLLRQPWSTLSQLS
FT                   AFSLSFMLLALLLVLRGDLLDRWQQQLPPESPNYFLINIATEQVEPLKAFLAEHQIVPE
FT                   SFYPVVRARLTAINDKPTEGNEDEALNRELNLTWQNTRPDHNPIVAGNWPPKADEVSME
FT                   EGLAKRLNVALGDTVTFMGDTQEFRAKVTSLRKVDWESLRPNFYFIFPEGALDGQPQSW
FT                   LTSFRWENGNGMLTQLNRQFPTISLLDIGAILKQVGQVLEQVSRALEVMVVLVTACGML
FT                   LLLAQVQVGMRQRHQELVVWRTLGAGKKLLRTTLWCEFAMLGFVSGLVAAIGAETALAV
FT                   LQAKVFDFPWEPDWRLWIVLPCSGALLLSLFGGWLGARLVKGKALFRQFAG"
FT   CDS_pept        571866..575636
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0532"
FT                   /note="RhsD core protein with extension, C-terminal part
FT                   truncated"
FT   CDS_pept        576059..576295
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0533"
FT                   /note="conserved predicted protein, N-terminal fragment"
FT   CDS_pept        576378..576551
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0534"
FT                   /note="conserved predicted protein, N-terminal fragment"
FT   CDS_pept        complement(577066..577437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbG"
FT                   /locus_tag="ECO26_0535"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23871"
FT                   /protein_id="BAI23871.1"
FT                   /translation="MLHTANPVIKHKAGLLNLAEELSNVSKACKIMGVSRDTFYRYREL
FT                   VAEGGVDAQINRSRRAPNLKNRTDEATEQAVVDYAVAFPTHGQHRASNELRKQGVFISD
FT                   SGVRSVWLLHNLENLKRRY"
FT   CDS_pept        complement(577553..578647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="ECO26_0536"
FT                   /product="tRNA 2-selenouridine synthase,
FT                   selenophosphate-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23872"
FT                   /protein_id="BAI23872.1"
FT                   /translation="MQERHTEQDYRALLIADTPIIDVRAPIEFEQGAMPAAINLPLMNN
FT                   DERAAVGTCYKQQGSDAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRS
FT                   HIVQSWLYAAGIDYPLVEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQP
FT                   NGVDLEGLARHRGSAFGRTLQPQLSQASFENLLAAEMLKTDARQDLRLWVLEDESRMIG
FT                   SNHLPECLRERMTQAAIAVVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEY
FT                   LHHGLSAIKRRLGLQRYNELAAQLDTALTTQLTTGSTDGHLAWLVPLLKEYYDPMYRYQ
FT                   LEKKAEKVVFRGEWAEVAEWVKAR"
FT   CDS_pept        complement(578716..579642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbS"
FT                   /locus_tag="ECO26_0537"
FT                   /product="DNA-binding transcriptional activator of the allD
FT                   operon, LYSR-type"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23873"
FT                   /protein_id="BAI23873.1"
FT                   /translation="MFDPETLRTFIAVAETGSFSKAAERLCKTTATISYRIKLLEENTG
FT                   VALFFRTTRSVTLTAAGEHLLSQARDWLSWLESMPSELQQVNDGVERQVNIVINNLLYN
FT                   PQAVAQLLAWLNERYPFTQFHISRQIYMGVWDSLLYEGFSLAIGVTGTEALANTFSLDP
FT                   LGSVQWRFVMAADHPLANVEEPLTEAQLRRFPAVNIEDSARTLTKRVAWRLPGQKEIIV
FT                   PDMETKIAAHLAGVGIGFLPKSLCQSMIDNQQLVSRVIPTMRPPSPLSLAWRKFGSGKA
FT                   VEDIVTLFTQRRPEISGFLEIFGNPRS"
FT   CDS_pept        579872..580354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="ECO26_0538"
FT                   /product="ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23874"
FT                   /protein_id="BAI23874.1"
FT                   /translation="MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVE
FT                   ILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLST
FT                   LRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA"
FT   CDS_pept        580432..581247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allR"
FT                   /locus_tag="ECO26_0539"
FT                   /product="DNA-binding transcriptional repressor AllR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23875"
FT                   /protein_id="BAI23875.1"
FT                   /translation="MTEVRRRGRPGQAEPVAQKGAQALERGIAILQYLEKSGGSSSVSD
FT                   ISLNLDLPLSTTFRLLKVLQAADFVYQDSQLGWWHIGLGVFNVGAAYIHNRDVLSVAGP
FT                   FMRRLMLLSGETVNVAIRNGNEAVLIGQLECKSMVRMCAPLGSRLPLHASGAGKALLYP
FT                   LAEEELMSIILQTGLQQFTPTTLVDMPTLLKDLEQARELGYTVDKEEHVVGLNCIASAI
FT                   YDDVGSVVAAISISGPSSRLTEDRFVSQGELVRDTARDISTALGLKAHP"
FT   CDS_pept        581337..583118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="ECO26_0540"
FT                   /product="glyoxylate carboligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23876"
FT                   /protein_id="BAI23876.1"
FT                   /translation="MAKMRAVDAAMYVLEKEGITTAFGVPGAAINPFYSAMRKHGGIRH
FT                   ILARHVEGASHMAEGYTRATAGNIGVCLGTSGPAGTDMITALYSASADSIPILCITGQA
FT                   PRARLHKEDFQAVDIEAIAKPVSKMAVTVREAALVPRVLQQAFHLMRSGRPGPVLVDLP
FT                   FDVQVAEIEFDPDMYEPLPVYKPAASRMQIEKAVEMLIQAERPVIVAGGGVINADAAAL
FT                   LQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMVFGIGNRF
FT                   ANRHTGSVEKYTEGRKIVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAG
FT                   RLPCRKEWVADCQQRKRTLLRKTHFDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIA
FT                   AAQMLHVFKDRHWINCGQAGPLGWTIPAALGVCAADPERNVVAISGDFDFQFLIEELAV
FT                   GAQFNIPYIHVLVNNAYLGLIRQSQRAFDMDYCVQLAFENINSSEVNGYGVDHVKVAEG
FT                   LGCKAIRVFKPEDIAPAFEQAKALMAQYRVPVVVEVILERVTNISMGSELDNVMEFEDI
FT                   ADNAADAPTETCFMHYE"
FT   CDS_pept        583131..583907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="ECO26_0541"
FT                   /product="hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23877"
FT                   /protein_id="BAI23877.1"
FT                   /translation="MLRFSANLSMLFGEYDFLARFEKAAQCGFRGVEFMFPYDYDIEEL
FT                   KQVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINC
FT                   LVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALK
FT                   LIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEINYD
FT                   YLFKVIENSDYNGWVGCEYTPQTTTEAGLRWMDPYR"
FT   CDS_pept        584007..584885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="ECO26_0542"
FT                   /product="tartronate semialdehyde reductase,
FT                   NADH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23878"
FT                   /protein_id="BAI23878.1"
FT                   /translation="MKLGFIGLGIMGTPMAINLARAGHQLHVTTIGPVADELLSLGAVS
FT                   VETARQVTEASDIIFIMVPDTPQVEEVLFGENGCTKASLKGKTIVDMSSISPIETKRFA
FT                   RQVNELGGDYLDAPVSGGEIGAREGTLSIMVGGDEAVFERVKPLFELLGKNITLVGGNG
FT                   DGQTCKVANQIIVALNIEAVSEALLFASKAGADPVRVRQALMGGFASSRILEVHGERMI
FT                   KRTFNPGFKIALHQKDLNLALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSALVQ
FT                   ALELMANHKLA"
FT   CDS_pept        585054..586508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbW"
FT                   /locus_tag="ECO26_0543"
FT                   /product="predicted allantoin transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23879"
FT                   /protein_id="BAI23879.1"
FT                   /translation="MEHQRKLFQQRGYSEDLLPKTQSQRTWKTFNYFTLWMGSVHNVPN
FT                   YVMVGGFFILGLSTFSIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGA
FT                   LFPGLLRGGIAAIMWFGLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFL
FT                   IFWLVNVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGIGPIFDYIPSGIQKA
FT                   ENGGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVC
FT                   IIAGASIHYGADTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAI
FT                   APTKLTYKNGVLIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVM
FT                   RGQINLDELYTAPGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIHFMEPLSRVSWFVGV
FT                   IVAFAAYALLKKRTTAEKTGEQKTIG"
FT   CDS_pept        586568..587929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allB"
FT                   /locus_tag="ECO26_0544"
FT                   /product="allantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23880"
FT                   /protein_id="BAI23880.1"
FT                   /translation="MSFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDAKEVMD
FT                   ASGLVVSPGMVDAHTHISEPGRSHWEGYETGTRAAAKGGITTMIEMPLNQLPATVDRAS
FT                   IELKFDAAKGKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFKCFVATCGDRGIDNDFRD
FT                   VNDWQFFKGAQKLGELGQPVLVHCENALICDALGEEAKREGRVTAHDYVASRPVFTEVE
FT                   AIRRVLYLAKVAGCRLHVCHISSPEGVEEVTRARQEGQDVTCESCPHYFVLDTDQFEEI
FT                   GTLAKCSPPIRDLENQKGMWEKLFNGEIDCLVSDHSPCPPEMKAGNIMEAWGGIAGLQN
FT                   CMDVMFDEAVQKRGMSLPMFGKLMATNAADIFGLQQKGRIAPGKDADFVFIQPNSSYVL
FT                   TNDDLEYRHKVSPYVGRTIGARITKTILRGDVIYDIEQGFPVAPKGQFILKHQQ"
FT   CDS_pept        587986..588846
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="ECO26_0545"
FT                   /note="predicted uracil/xanthine transporter, N-terminal
FT                   part"
FT   CDS_pept        588843..589286
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="ybbY"
FT                   /locus_tag="ECO26_0546"
FT                   /note="predicted uracil/xanthine transporter, C-terminal
FT                   part"
FT   CDS_pept        589308..590453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECO26_0547"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23881"
FT                   /protein_id="BAI23881.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGETVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNGIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQVLAA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLRAVNLEQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
FT   CDS_pept        complement(590582..591367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbA"
FT                   /locus_tag="ECO26_0548"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23882"
FT                   /protein_id="BAI23882.1"
FT                   /translation="MGYLNNVTGYRDDLLANRAIVKHGNFALLTPDGLVKNIIPGFENC
FT                   DATILSTPKLGASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALS
FT                   EGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRYVPVEGHAPWLVSGNASELERIHYEGMD
FT                   DVILLDFLPKELGFDMNMHILSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPV
FT                   KKGDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI"
FT   CDS_pept        complement(591378..592613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allC"
FT                   /locus_tag="ECO26_0549"
FT                   /product="allantoate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23883"
FT                   /protein_id="BAI23883.1"
FT                   /translation="MITHFRQAIEETLPWLSSFGADPTGGMTRLLYSPEWLETQQQFKK
FT                   RMAASGLETRFDEVGNLYGRLSGTEYPQEVVLSGSHIDTVVNGGNLDGQFGALAAWLAI
FT                   DWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNSFVD
FT                   AMKACGFTLPNAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVGQRRYTVTLNG
FT                   ESNHAGTTPMGYRRDTVYAFSRICHQSVEKAKRMGDPLVLTFGKVEPRPNTVNVVPGKT
FT                   TFTIDCRHTDAAVLRDFTQQLENDMRAICDEMDIGIDIDLWMDEEPVPMNKELVATLTE
FT                   LCEREKLNYRVMHSGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKT
FT                   LALMLYQLAWQK"
FT   CDS_pept        complement(592635..593684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allD"
FT                   /locus_tag="ECO26_0550"
FT                   /product="ureidoglycolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23884"
FT                   /protein_id="BAI23884.1"
FT                   /translation="MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHG
FT                   AVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQN
FT                   GVAVVGISRMGHSGAISYFVQQAARAGLIGISMCQSDPMVVPFGGAEIYYGTNPLAFAA
FT                   PGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGAPTTDPFAVHALLPAAG
FT                   PKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFFSSKLFRQ
FT                   HLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALYNTS
FT                   YETKNPFAQ"
FT   CDS_pept        594000..595667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdrA"
FT                   /locus_tag="ECO26_0551"
FT                   /product="predicted acyl-CoA synthetase"
FT                   /note="contains NAD(P)-binding Rossmann-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23885"
FT                   /protein_id="BAI23885.1"
FT                   /translation="MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKAL
FT                   LDTTGFWHDDFNNATPNDICVAIRSEAADAGIAQAIMQQLEEALKQLAQGSGSSQALTQ
FT                   VRRWDSACQKLPDANLALISVAGEYAAELTNQALDRNLNVMMFSDNVTLEDEIQLKTRA
FT                   REKGLLVMGPDCGTSMIAGTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITH
FT                   AIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKP
FT                   TVALFLGYTPAVARDENVWFASSLDEAARLACLLSRVTARRNAIAPVSSGFICGLYTGG
FT                   TLAAEAAGLLAGHLGVEADDTHHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQ
FT                   LIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARSDSQPLYAIATVTGTE
FT                   RDPQCRSQQIATLEDAGIAVVSSLPEATLLAAALIHPLSSATQQHTPSLLENVAVINIG
FT                   LRSFALELQSASKPVVHYQWSPVAGGNKKLARLLERLQ"
FT   CDS_pept        595677..596936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbE"
FT                   /locus_tag="ECO26_0552"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23886"
FT                   /protein_id="BAI23886.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
FT   CDS_pept        596947..597762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECO26_0553"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23887"
FT                   /protein_id="BAI23887.1"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPSH
FT                   PQPLAAAWMQRAEETGLFGPLAMAASDPLPAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARAGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
FT   CDS_pept        597759..598652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECO26_0554"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23888"
FT                   /protein_id="BAI23888.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVDPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQKALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFTKADGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
FT   CDS_pept        complement(598789..599856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="ECO26_0555"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23889"
FT                   /protein_id="BAI23889.1"
FT                   /translation="MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSV
FT                   ITAEIERWPETALTRELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLADRS
FT                   EWPAVFERLGELAIVKRRTGGYDGRGQWRLRANETEQLPAECYGECIVEQGINFSGEVS
FT                   LVGARGFDGSTVFYPLTHNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGV
FT                   MAMECFVTPQGLLINELAPRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNSPSV
FT                   MINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLP
FT                   PEYASGVMWAQSKFS"
FT   CDS_pept        complement(599853..600362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="ECO26_0556"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23890"
FT                   /protein_id="BAI23890.1"
FT                   /translation="MSSRNNPARVAIVMGSKSDWATMQFAAEIFEILNVPHHVEVVSAH
FT                   RTPDKLFSFAESAEENGYQVIIAGAGGAAHLPGMIAAKTLVPVLGVPVQSAALSGVDSL
FT                   YSIVQMPRGIPVGTLAIGKAGAANAALLAAQILATHDKELHQRLNDWRKAQTDEVLENP
FT                   DPRGAA"
FT   CDS_pept        complement(600480..601202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="ECO26_0557"
FT                   /product="UDP-2,3-diacylglucosamine pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23891"
FT                   /protein_id="BAI23891.1"
FT                   /translation="MATLFIADLHLCVEEPAITAGFLRFLAGEARKADALYILGDLFEA
FT                   WIGDDDPNPLHRQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLE
FT                   LYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQMLFLALPLFVRKRIAARMRANSKEA
FT                   NSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQPAFRVVLGAWHTE
FT                   GSMVKVTADDVELIHFPF"
FT   CDS_pept        complement(601205..601699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="ECO26_0558"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /note="rotamase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23892"
FT                   /protein_id="BAI23892.1"
FT                   /translation="MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVI
FT                   NGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVD
FT                   NDFLNFSGESLQGWGYCVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVS
FT                   E"
FT   CDS_pept        601873..603258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="ECO26_0559"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23893"
FT                   /protein_id="BAI23893.1"
FT                   /translation="MLKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFV
FT                   AFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVALVDRMIAEMHKDFDALN
FT                   ILRPDMEPRATHHIAEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQDLDQL
FT                   QAGARVDVVDDKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFD
FT                   IHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFTVRDVL
FT                   KYYDAETVRYFLMSGHYRSQLNYSEENLKQARAALERLYIALRGTDKTVAPAGGEAFEA
FT                   RFIEAMDDDFNTPEAYSVLFDMAREVNRLKAEDMAAANAMASHLRKLSAVLGLLEQEPE
FT                   AFLQSGAQADDSEVAEIEALIQQRLDARKAKDWAAADAARDRLNEMGIVLEDGPQGTTW
FT                   RRK"
FT   CDS_pept        complement(603294..603815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /locus_tag="ECO26_0560"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23894"
FT                   /protein_id="BAI23894.1"
FT                   /translation="MPTVITHAAVPLCIGLGLGSKVIPPRLLFAGIILAMLPDADVLSF
FT                   KFGVAYGNVFGHREFTHSLVFAFVVPLLCVLIGRRWFRAGLIRCWLFLTVSLLSHSLLD
FT                   SVTTGGKGVGWLWPWSDERFFAPWQVIKVAPFALSRYTTPYGHQVIISELMWVWLPGMV
FT                   LMGMLWWRRR"
FT   CDS_pept        complement(603923..604135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcJ"
FT                   /locus_tag="ECO26_0561"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23895"
FT                   /protein_id="BAI23895.1"
FT                   /translation="MATFSLGKHPHVELCDLLKLEGWSESGAQAKIAIAEGQVKVDGAV
FT                   ETRKRCKIVAGQTVSFAGHSVQVVA"
FT   CDS_pept        complement(604137..605003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="ECO26_0562"
FT                   /product="bifunctional 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase and 5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23896"
FT                   /protein_id="BAI23896.1"
FT                   /translation="MAAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNP
FT                   ASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDALNADNTIDGILVQLPLPAG
FT                   IDNVKVLERIHPDKDVDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGLNAV
FT                   VIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIK
FT                   EGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVE
FT                   YHDPQDE"
FT   CDS_pept        605484..606026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmA"
FT                   /locus_tag="ECO26_0563"
FT                   /product="predicted fimbrial-like adhesin protein SfmA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23897"
FT                   /protein_id="BAI23897.1"
FT                   /translation="MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNT
FT                   DSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNL
FT                   LAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTS
FT                   ASAGQANADATFIMRYE"
FT   CDS_pept        606246..606938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmC"
FT                   /locus_tag="ECO26_0564"
FT                   /product="pilin chaperone SfmC, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23898"
FT                   /protein_id="BAI23898.1"
FT                   /translation="MMTKIKLLMLIIFYLIISASAHAAGGIALGATRIIYPADAKQTAV
FT                   WIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRE
FT                   SLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRLIQLQELPAEAPDTLKFSRSGN
FT                   YINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVT
FT                   PVREVNLN"
FT   CDS_pept        606969..609578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECO26_0565"
FT                   /product="predicted outer membrane export usher protein
FT                   SfmD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23899"
FT                   /protein_id="BAI23899.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILPSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERISLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQIALLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGIRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGTVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYGTLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGRKPVPFGSLVRENSTGITSM
FT                   VGDDGQVYLSGAPLSGELLVQWGDGANSRCIAHYVLPKQSLQQAVTVISAVCTHPGS"
FT   CDS_pept        609620..610597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmH"
FT                   /locus_tag="ECO26_0566"
FT                   /product="predicted fimbrial-like adhesin protein SfmH"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23900"
FT                   /protein_id="BAI23900.1"
FT                   /translation="MACLCLANISWATVCANSTGVAEDEHYDLSNIFNSTNNQPGQIVV
FT                   LPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVDSV
FT                   MDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVYVT
FT                   STPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVM
FT                   PQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNS
FT                   VIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ"
FT   CDS_pept        610608..611123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECO26_0567"
FT                   /product="predicted fimbrial-like adhesin protein SfmF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23901"
FT                   /protein_id="BAI23901.1"
FT                   /translation="MRRVLFSCFCGLLWSSIGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
FT   CDS_pept        complement(611126..611758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fimZ"
FT                   /locus_tag="ECO26_0568"
FT                   /product="predicted DNA-binding transcriptional regulator
FT                   FimZ"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23902"
FT                   /protein_id="BAI23902.1"
FT                   /translation="MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYL
FT                   RTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFV
FT                   SKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTVTVLSNREVTILRYLVS
FT                   GLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI"
FT   tRNA            612001..612077
FT                   /gene="argU"
FT                   /locus_tag="ECO26_tRNA006"
FT                   /product="tRNA-Arg (UCU)"
FT   misc_feature    612033..662218
FT                   /note="Prophage ECO26_P01, lambda-like phage"
FT   CDS_pept        complement(612093..613256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0569"
FT                   /product="putative integrase"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23903"
FT                   /protein_id="BAI23903.1"
FT                   /translation="MSLFRRNEIWYASYSLPGGKRIKESLGTKDKRQAQELHDKRKAEL
FT                   WRVEKLGDLPDVTFEEACLRWLEEKADKKSLDSDKSRIEFWLEHFEGIRLKDISEAKIY
FT                   SAVSRMHNRKTKEIWKQKVQAAIRKGKEPPVYEPKPVSTQTKAKHLAMIKAILRAAERD
FT                   WKWLEKAPVIKIPAVRNKRVRWLEKEEAKRLIDECPEPLKSVVKFALATGLRKSNIINL
FT                   EWQQIDMQRRVAWVNPEESKSNRAIGVALNDTACKVLRDQIGKHHKWVFVHTKAAKRAD
FT                   GTSTPAVRKMRIDSKTSWLSACRRAGIEDFRFHDLRHTWASWLIQSGVPLSVLQEMGGW
FT                   ESIEMVRRYAHLAPNHLTEHARKIDDIFGDNVPNMSHSGIMEDIKKA"
FT   CDS_pept        complement(613288..613458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0570"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23904"
FT                   /protein_id="BAI23904.1"
FT                   /translation="MRPVSFLRYPDQPPPTGYEQAAYRQHVKIQPSQNLLTSQHGKPAL
FT                   RRFSLRCILSR"
FT   CDS_pept        complement(613455..613733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0571"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23905"
FT                   /protein_id="BAI23905.1"
FT                   /translation="MFRIIFPNTWYVDHHGTPCKILRSTHNKVHYIRKGRTCIASMFRF
FT                   NHDFEPVNKADADRIAEEIETAEHIKKLRDMRSKSRGNHGIIQPHTR"
FT   CDS_pept        complement(613781..613999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0572"
FT                   /product="predicted C4-type zinc finger protein"
FT                   /note="Prophage ECO26_P01"
FT                   /note="TraR-family"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23906"
FT                   /protein_id="BAI23906.1"
FT                   /translation="MADIIDSASEIEELQRNTAIKMRRQNYQTVSATHCCECGDPIDER
FT                   RRLAVQGCRTCASCQEEIELKNKQWGL"
FT   CDS_pept        complement(614098..614379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0573"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23907"
FT                   /protein_id="BAI23907.1"
FT                   /translation="MHFSGSGLHILCAYACRHGACSMTPQQENALRSIARQANSEIKKA
FT                   RQHFPDKNVDDICRSVLKKHRETVTLMGFTPTHLSLAIGMLNGVFKER"
FT   CDS_pept        complement(614390..614581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0574"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23908"
FT                   /protein_id="BAI23908.1"
FT                   /translation="MHKASPVELRTSIEMAHSLAQIGVRFVPIPVETDEEFHTLATSLS
FT                   QKLEMMVAKAEADERDQV"
FT   CDS_pept        complement(614733..615413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0575"
FT                   /product="putative exonuclease"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23909"
FT                   /protein_id="BAI23909.1"
FT                   /translation="MIPDIILQRTGIDVRAVEQGDDAWHKLRLGVITASEVHNVIAKPR
FT                   SGKKWPDMKMSYFHTLLAEVCTGVAPEVNAKALAWGKQYENDARTLFEFTSGVNITESP
FT                   IIYRDESMRTACSPDGLCSDGNGLELKCPFTSRDFMKFRLGGFEAIKSAYMAQVQYSMW
FT                   VTRKDAWYFANYDPRMKREGLHYVVIERNEKYMASFDEMVPEFIEKMDEALAEIGFVFG
FT                   EQWR"
FT   CDS_pept        complement(615410..616195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0576"
FT                   /product="putative recombination protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23910"
FT                   /protein_id="BAI23910.1"
FT                   /translation="MSTALATLAGKLAERVGMDSVDPQELITTLRQTAFKGDASDAQFI
FT                   ALLIVANQYGLNPWTKEIYAFPDKQNGIVPVVGVDGWSRIINENQQFDGMDFEQDNESC
FT                   TCRIYRKDRNHPICVTEWMDECRREPFKTREGREITGPWQSHPKRMLRHKAMIQCARLA
FT                   FGFAGIYDKDEAERIVENTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLP
FT                   LCSQIFRRDIRASSELTQAEAVKALGFLKQKATEQKVAA"
FT   CDS_pept        complement(616201..616497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0577"
FT                   /product="putative host-nuclease inhibitor protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23911"
FT                   /protein_id="BAI23911.1"
FT                   /translation="MNAYYIQDRLEAQSWARHYQQIAREEKEAELADDMEKGLPQHLFE
FT                   SLCIDHLQRHGASKKAITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV"
FT   CDS_pept        complement(616573..616863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0578"
FT                   /product="predicted prophage Kil protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23912"
FT                   /protein_id="BAI23912.1"
FT                   /translation="MTTGGHPPPEYAQKSLYVQQPSLRAGVFMVHQHYGTQTVNRGAVM
FT                   PGMLVKRKDGTWTASANLRGRLYLHRGIERTYTRDLLVEVFLDGRGNALNH"
FT   CDS_pept        complement(617330..617650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0579"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23913"
FT                   /protein_id="BAI23913.1"
FT                   /translation="MLQSSGSSGSGSDNMPEKVAKLESDVAHIKRDVDELKTDVKAIDK
FT                   NMITILARLDSIKESLTNKPSSDAVDRKISDAKLAVLLGVPAIIAAGTGLYKLSMYFFF
FT                   SA"
FT   CDS_pept        complement(617786..618049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0580"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23914"
FT                   /protein_id="BAI23914.1"
FT                   /translation="MSNKTLVKKSNNCVDAYADAFGYSSFGDGSQRLGSISFFHNVTEW
FT                   PVDESDDVENIKYNIATIRMPEELMLKLADFIRDQHDKAKTN"
FT   CDS_pept        complement(618131..618820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0581"
FT                   /product="putative phage repressor protein CI"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23915"
FT                   /protein_id="BAI23915.1"
FT                   /translation="MKTTLSERLKEARLARGLTQKALGDLVGVSQAAIQKIETGKANQT
FT                   TKIVEIANALGVRAEWLSSGVGNMSDSTVQPIQSTVSHSKYFKIDVLDIEVSAGPGVIN
FT                   REFVEVLRSVEYSFDDARHMFDGRKAENIRIINVRGDSMSGTIEPGDLLFVDITVKSFD
FT                   GDGIYAFLYDDTAHVKRLQMMKDKLLVISDNKSYSPWDPIEKDEMNRVFIFGKVIGSMP
FT                   QTYRKHG"
FT   CDS_pept        618925..619155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0582"
FT                   /product="phage regulatory protein Cro"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23916"
FT                   /protein_id="BAI23916.1"
FT                   /translation="MNPAIKTAINIVGSQKKLGAACEVSQQAVYKWLHNKAKVSPEHVG
FT                   SIVTATGGVVKAYQIRPDLPKLFPHTEKNAA"
FT   CDS_pept        619273..619764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0583"
FT                   /product="predicted regulatory protein CII"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23917"
FT                   /protein_id="BAI23917.1"
FT                   /translation="MINRSQTKQVPGHEKIRDAVRAWSAVDNQDVVATLIVNEYREQGG
FT                   GTIDFPDDVSRTRQKLFRFLDNKFDSEKYRNNVRELTPAILAVLPLEYRGYLVEQDSFM
FT                   ARLAEMEKELSEAKQAVILNAPRHQKLKEISEGIVSMFRVDPELAGPLMAMVTTMLGAI
FT                   "
FT   CDS_pept        619776..620780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0584"
FT                   /product="putative replication protein O"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23918"
FT                   /protein_id="BAI23918.1"
FT                   /translation="MAKAGLLEQNRLSGANRNTLIAGGIMANTAEIFNFPVPDAAQKEP
FT                   RVADLDDGYTRIANELLEAVMLAGLTQHQLLVFLAVMRKTYGFNKKLDWVSNEQLSELT
FT                   GILPHKCSAAKSVLVKRGIFIQSGRNIGINNVVSEWSTLPESGKKNKVYLKEVNLPESG
FT                   KKSLPKSGKGTYPNQVNTKDKLTKDNIKPYSSENSGESSDLPENDLPVVKADAAIQSGS
FT                   KWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWANDIRLMRERDGRNHRDMCVLFRWAC
FT                   QDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTVGKPKLDLTNTDWIYGVDL"
FT   CDS_pept        620777..621478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0585"
FT                   /product="putative replication protein P"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23919"
FT                   /protein_id="BAI23919.1"
FT                   /translation="MKNIAAQMINFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFS
FT                   QLLATFPASLANRDQNELNEIRRQWVLAFRENGITTMEQVSAGMRVARRQNRPFLPSPG
FT                   QFVAWCREEASVNAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQN
FT                   MRANALTDAELRRKAADELTCMTARINRGETIPEPVKQLPVMGGRPLNRAQALAKIAEI
FT                   KAKFGLKGASV"
FT   CDS_pept        622660..623391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0586"
FT                   /product="putative antirepressor protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23920"
FT                   /protein_id="BAI23920.1"
FT                   /translation="MRASSEAPDFVLTGYANLAQSTTSRLASSVVIAQIQNEIIAMVTQ
FT                   LAFRDVKFTPINHNNQIWFTSKELAAALKYASTKAVTDIYNKNIDEFTDGMSQVVESTT
FT                   SGNYRKKTRIFSLRGAHLIAMFARTPVAKEFRRWVLDILDREIQQSPITKQFTDNELCT
FT                   LAWLWRASDTMLTACQNVTPLLQVAEHREAGRFTSIEQEYPRILNKAQAILARETAHVK
FT                   FRPWQDDKWSRVLTHLRSERL"
FT   CDS_pept        623691..624107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0587"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23921"
FT                   /protein_id="BAI23921.1"
FT                   /translation="MNKNDLEALSDTRLNEAKCLLDHGFFHGAYYLCGYAVECALKACI
FT                   AKSFLQHEFPNKKVVNDSYTHDLSQLLKIANLHQILIADAKNDVSLEINWSVVKDWSEQ
FT                   FRYDNNISKAMAEQLFDAVGDQNSGVLKWVKAHW"
FT   CDS_pept        624086..624487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0588"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23922"
FT                   /protein_id="BAI23922.1"
FT                   /translation="MGKSTLVIGRELTKDMEFSGQFLLKKLKLQNLTIDAAMWFYYPDL
FT                   SWRYILVISDFSERGPAEIYRKISEINRNSISKKYKPIPLEAIEAKGDSAFVYKMLKGF
FT                   ARVNDGKVRVSNSMVNGLEIVDCLIYELK"
FT   CDS_pept        624709..625164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0589"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23923"
FT                   /protein_id="BAI23923.1"
FT                   /translation="MNLPQDGIKLHRGNFTAIGQQLQPYLEDGKCFRMVLKPWRERRSL
FT                   SQNALSHMWYSEISEYLIRRGKSFATAAWVKDALKHTYLGYETKDLVDVVTGEITTIQS
FT                   LRHTSDLDTGEMYVFLCKVEAWAMNIGCHLTIPQSCEFQLLRDKQEA"
FT   CDS_pept        625327..625617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0590"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23924"
FT                   /protein_id="BAI23924.1"
FT                   /translation="MADLRKAARGRECQVRIPGVCNGNPETSVLAHIRLAGLCGTGIKP
FT                   PDLIATIACSACHDEIDRRTHFVDAEYAKECALEGMARTQVIWLKEGVIKA"
FT   CDS_pept        625614..625976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0591"
FT                   /product="putative crossover junction
FT                   endodeoxyribonuclease"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23925"
FT                   /protein_id="BAI23925.1"
FT                   /translation="MNTYSITLPWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNA
FT                   MLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPV
FT                   TKGGRLELTITEMGNE"
FT   CDS_pept        626199..626582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0592"
FT                   /product="putative antitermination protein Q"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23926"
FT                   /protein_id="BAI23926.1"
FT                   /translation="MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLITSKVKSRPQC
FT                   CDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEG
FT                   IIEGMLMALDIRLEMDIVVNNSN"
FT   CDS_pept        complement(626771..627853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0593"
FT                   /product="putative outer membrane porin protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23927"
FT                   /protein_id="BAI23927.1"
FT                   /translation="MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHY
FT                   FSSNDADDGDTTYARLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAG
FT                   LKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNNDFF
FT                   GLVDGLNFAAQYQGKNDRTDVTQANGDGFGFSTTYEYEGFGVGATYAKSDRTNNQVIYG
FT                   NNSLNASGQNAEVWAAGLKYDANNIYLATTYSETQNMTVFGKNHIANKAQNFEVVAQYQ
FT                   FDFGLRPSVAYLQSKGKDLGAWGDQDLVEYIDVGATYYFNKNMSTFVDYKINLIDKSDF
FT                   TKASGVATDDIVAVGMVYQF"
FT   CDS_pept        628442..628657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0594"
FT                   /product="putative holin protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23928"
FT                   /protein_id="BAI23928.1"
FT                   /translation="MKSMDKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSL
FT                   VFGLLTYLTNLYFKIKEDKRKAARGE"
FT   CDS_pept        628657..629154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0595"
FT                   /product="putative endolysin"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23929"
FT                   /protein_id="BAI23929.1"
FT                   /translation="MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDI
FT                   VGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIEVDIPETTRGALYS
FT                   FVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREICLWG
FT                   QQ"
FT   CDS_pept        629151..629612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0596"
FT                   /product="putative endopeptidase"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23930"
FT                   /protein_id="BAI23930.1"
FT                   /translation="MNRVTAIISALVICIIVCLSWAVNHYRDNAITYKAQRDKNARELK
FT                   LANAAITDMQMRQRDVAALDAKYTKELADAKAENDALRDDVAAGRRRLHIKAVCQSVRE
FT                   ATTASGVDNAASPRLADTAERDYFTLRERLITMQKQLEGTQTYINEQCR"
FT   CDS_pept        629371..629553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0597"
FT                   /product="putative lipoprotein Rz1 precursor"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23931"
FT                   /protein_id="BAI23931.1"
FT                   /translation="MRKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPD
FT                   WQTPLNGIISPSERG"
FT   CDS_pept        complement(629644..629937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0598"
FT                   /product="putative Bor protein precursor"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23932"
FT                   /protein_id="BAI23932.1"
FT                   /translation="MKKMLFSAALAMLITGCAQQTFTVGNKPTAVTPKETITHHFFVSG
FT                   IGQEKTVDAAKICGGAENVVKTETQQTFVNGLLGFITLGIYTPLEARVYCSQ"
FT   mobile_element  630237..631545
FT                   /mobile_element_type="insertion sequence:IS629"
FT   CDS_pept        complement(630278..631168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0599"
FT                   /product="putative IS629 transposase OrfB"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23933"
FT                   /protein_id="BAI23933.1"
FT                   /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
FT                   QHDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKK
FT                   VRTTVSRKTVATGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGG
FT                   RVSSSMETTFVLDALEQALWARRPSGTIHYSDKGSQYVSLAYTERLKEAGLLASTGSTG
FT                   DSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEA
FT                   EKAYYASIGNDDLAA"
FT   CDS_pept        complement(631165..631491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0600"
FT                   /product="putative IS629 transposase OrfA"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23934"
FT                   /protein_id="BAI23934.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   CDS_pept        632192..632737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0601"
FT                   /product="putative terminase small subunit"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23935"
FT                   /protein_id="BAI23935.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   AIKWYAERDAEIENEKLRREVEELRQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
FT   CDS_pept        632712..634637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0602"
FT                   /product="putative terminase large subunit"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23936"
FT                   /protein_id="BAI23936.1"
FT                   /translation="MNISNSQVNRLRHFVRAGLRSLFRPEPQTAVEWADANYYLPKESA
FT                   YQEGRWETLPFQRAIMNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIW
FT                   LPTDGDAENFMKTHVEPTIRDIPSLLALAPWYGKKHRDNTLTMKRFTNGRGFWCLGGKA
FT                   AKNYREKSVDVAGYDELAAFDDDIEQEGSPTFLGDKRIEGSVWPKSIRGSTPKVRGTCQ
FT                   IERAASESPHFMRFHVACPHCGEEQYLKFGDKETPFGLKWTPDDPSSVFYLCEHNACVI
FT                   RQQELDFTDARYICEKTGIWTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIV
FT                   KDWMKTKGDTGKRKTFVNTTLGETWEAKIGERPDAEVMAERKEHYSAPVPDRVAYLTAG
FT                   IDSQLDRYEMRVWGWGPGEESWLIDRQIIMGRHDDEQTLLRVDEAINKTYTRRNGAEMS
FT                   VSRICWDTGGIDPTIVYERSKKHGLFRVIPIKGASVYGKPVASMPRKRNKNGVYLTEIG
FT                   TDTAKEQIYNRFTLTPEGDEPLPGAVHFPNNPDIFDLTEAQQLTAEEQVEKWVDGRKKI
FT                   LWDSKKRRNEALDCFVYALAALRISISRWQLDLSALLASLQEEDGAATNKKTLADYARA
FT                   LSGEDE"
FT   CDS_pept        634634..634840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0603"
FT                   /product="putative head-tail joining protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23937"
FT                   /protein_id="BAI23937.1"
FT                   /translation="MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKK
FT                   YIAELEVQTGMTQRRRGPAGFYV"
FT   CDS_pept        634837..636438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0604"
FT                   /product="putative portal protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23938"
FT                   /protein_id="BAI23938.1"
FT                   /translation="MKTPTIPTLLGPDGMTSLREYAGYHGGGSGFGGQLRAWNPPSESV
FT                   DAALLPNFTRGNARADDLVRNNGYAANAIQLHQDHIVGSFFRLSHRPSWRYLGIGEEEA
FT                   RAFSREVEAAWKEFAEDDCCCIDVERKRTFTMMIREGVAMHAFNGELFVQATWDTRPSR
FT                   LFRTQFRMVSPKRISNPNNTGDSRNCRAGVQINDSGAALGYYVSEDGYPGWMPQKWTWI
FT                   PRELPGGRASFIHVFEPVEDGQTRGANVFYSVMEQMKMLDTLQNTQLQSAIVKAMYAAT
FT                   IESELDTQSAMDFILGANSQEQRERLTGWIGEIAAYYAAAPVRLGGAKVPHLMPGDSLN
FT                   LQTAQDTDNGYSVFEQSLLRYIAAGLGVSYEQLSRNYAQMSYSTARASANESWAYFMGR
FT                   RKFVASRQASQMFLCWLEEAIVRRVVTLPSKARFSFQEARSAWGNCDWIGSGRMAIDGL
FT                   KEVQEAVMLIEAGLSTYEKECAKRGDDYQEIFAQQVRETMERRAAGLKPPAWAAAAFES
FT                   GLRQSTEEEKSDSRAA"
FT   CDS_pept        636419..636907
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0605"
FT                   /note="Prophage ECO26_P01; predicted minor capsid protein,
FT                   N-terminal fragment"
FT   mobile_element  complement(636881..639579)
FT                   /mobile_element_type="insertion sequence:ISCro1"
FT   CDS_pept        complement(636911..638482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0606"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /note="predicted protein Orf3 in insertion sequence ISCro1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23939"
FT                   /protein_id="BAI23939.1"
FT                   /translation="MDTSLAHENARLRALLQTQQDTIRQMAEYNRLLSQRVAAYASEIN
FT                   RLKALVAKLQRMQFGKSSEKLRAKTERQIQEAQERISALQEEMAETLGEQYDPVLPSAL
FT                   RQSSARKPLPASLPRETRVIRPEEECCPACGGELSSLGCDVSEQLELISSAFKVIETQR
FT                   PKQACCRCDHIVQAPVPSKPIARSYAGAGLLAHVVTGKYADHLPLYRQSEIYRRQGVEL
FT                   SRATLGRWTGAVAELLEPLYDVLRQYVLMPGKVHADDIPVPVQEPGSGKTRTARLWVYV
FT                   RDDRNAGSQMPPAVWFAYSPDRKGIHPQNHLAGYSGVLQADAYGGYRALYESGRITEAA
FT                   CMAHARRKIHDVHARAPTYITTEALQRIGELYAIEAEVRGCSAEQRLAARKARAAPLMQ
FT                   SLYDWIQQQMKTLSRHSDTAKAFAYLLKQWDALNVYCSNGWVEIDNNIAENALRGVAVG
FT                   RKNWMFAGSDSGGEHAAVLYSLIGTCRLNNVEPEKWLRYVIEHIQDWPANRVRDLLPWK
FT                   VDLSSQ"
FT   CDS_pept        complement(638502..638849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0607"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /note="predicted protein Orf2 in insertion sequence ISCro1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23940"
FT                   /protein_id="BAI23940.1"
FT                   /translation="MISLPAGSRIWLVAGITDMRNGFNGLASKVQNVLKDDPFSGHLFI
FT                   FRGRRGDQIKVLWADSDGLCLFTKRLERGRFVWPVTRDGKVHLTPAQLSMLLEGINWKH
FT                   PKRTERAGIRI"
FT   CDS_pept        complement(638849..639496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0608"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P01"
FT                   /note="predicted protein Orf1 in insertion sequence ISCro1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23941"
FT                   /protein_id="BAI23941.1"
FT                   /translation="MKHRTWITEALRLHFEEHLPRVVAGRRLGVPKSTVCSMFVRFRRA
FT                   GLSWPLPAGMSEQELDACLYGQFSTVPVVRPESTVISEAPVVKKRPRRPNFPYEFKIAL
FT                   VEQSLQPGACVAQIARENGINDNLLFNWRHQYRKGGLLPSGKNMPALLPVTLTPEPDNK
FT                   IPAPAQEPEQINTPSDSLCCELVLPAGTLRLKGKLTPALLQTLIREIKGSSH"
FT   CDS_pept        639567..640445
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0609"
FT                   /note="Prophage ECO26_P01; predicted minor capsid protein,
FT                   C-terminal fragment"
FT   CDS_pept        640449..640787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0610"
FT                   /product="putative head-DNA stabilization protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23942"
FT                   /protein_id="BAI23942.1"
FT                   /translation="MFMTSKETFTHYQPLGNSDPAHTATAPGGLSAKAPAMTPLMLDTA
FT                   TRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAF
FT                   AGTAISIV"
FT   CDS_pept        640843..641868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0611"
FT                   /product="putative major capsid protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23943"
FT                   /protein_id="BAI23943.1"
FT                   /translation="MSMYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIP
FT                   GLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHEVNPQMTLRRLPDEDPQNLADP
FT                   AYRRRRIILQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGRSVANNIT
FT                   QSGGTEWSKRDKSTYDPTDDIEAYALNASGVVNIIVFDPKGWALFRSFKAVKEKLDTRR
FT                   GSHSELETAVKDLGEAVSYKGMYGDTAIVVYSGQYVENDVKKNFLPDNTMVLGNTQARG
FT                   LRTYGCIQDADAQREGINASARYPKNWVTTGDPAREFTMIQSAPLMLLADPDAFVSVQL
FT                   A"
FT   CDS_pept        641910..642305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0612"
FT                   /product="putative DNA packaging protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23944"
FT                   /protein_id="BAI23944.1"
FT                   /translation="MTKDELIARLQVLGEQLNRDVSLTGTKEELALRVAELEEELDDTD
FT                   DAAGQDTSVSPENALTGHENEVVSAQPDTVTDTADLVTVVALVTLHTDALHATRDEAVA
FT                   FVLPGTAFRVSAGVAAEMTERGLARMQ"
FT   CDS_pept        642317..642691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0613"
FT                   /product="putative minor capsid protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23945"
FT                   /protein_id="BAI23945.1"
FT                   /translation="MADFDNLFDAAIACADETIRGYMGTSATMTSGEQSGAVIRGVFDD
FT                   PENISYAGQGVRVEGSSPSLFVRTDDVRQLRRGDTLTIGEENFWIDRISPDDGGSCHLW
FT                   LGRGVPPAVNRRRWKGDVWP"
FT   CDS_pept        642682..643260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0614"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23946"
FT                   /protein_id="BAI23946.1"
FT                   /translation="MAIKGLEQAVENLSRISRTAVPGAAAMAINRVASSAISQSVSQVA
FT                   RETKVRRKLVKERARLKRATVKNPQARIKVNRGDLPVIKLGNARVVLSRRRRRKKGQRS
FT                   SLKGGGSVLVVGNRRIPGAFIQQLKNGRWHVMQRVAGKNRYPIDVVKIPMAVPLTTAFK
FT                   QNIERIRRERLPKELGYALQHQLRMVIKR"
FT   CDS_pept        643257..643652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0615"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23947"
FT                   /protein_id="BAI23947.1"
FT                   /translation="MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTG
FT                   AEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSELITSMVA
FT                   SGYDYRRDDDAGLWSSADLTYVITYEM"
FT   CDS_pept        643660..644400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0616"
FT                   /product="putative major tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23948"
FT                   /protein_id="BAI23948.1"
FT                   /translation="MPVPNPVMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDL
FT                   TPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGD
FT                   TRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATG
FT                   MTVTPASTSVVKGQSTTLTVAFQPEGATDKSFRAVSADKTKATVSVSGMTITVKGVAAG
FT                   KVNIPVVSGNGELAAVAEITVTDS"
FT   CDS_pept        644416..644838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0617"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23949"
FT                   /protein_id="BAI23949.1"
FT                   /translation="MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNR
FT                   KFTVEDAIRTGAFVVAMSLWHNHPQKTKQPSMNEAVKQIEQEVLTTWPTEAISHAENVV
FT                   YRLSGMYEFVVNDAPEQAEDAGPAEPVSAGKCSTVS"
FT   CDS_pept        644820..645254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0618"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23950"
FT                   /protein_id="BAI23950.1"
FT                   /translation="MFDGELSFALKLAREMGRPDWRAMLAGMSSTEYADWHRFYSTHYF
FT                   HDVLLDMHFSGLTYTVLSLFFSDPDMHPLDFSLLNRREADEEPEDDVLMQKAAGLAGGV
FT                   RFGPDGNEVIPASPDVADMTEDDVMLMTVSEGIAGGVRYG"
FT   CDS_pept        645247..647808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0619"
FT                   /product="putative tail length tape measure protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23951"
FT                   /protein_id="BAI23951.1"
FT                   /translation="MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVE
FT                   QSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSF
FT                   GGMIPMFRGLAGAITLPMVGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLT
FT                   ADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDK
FT                   VAEAFGKLTTDPTSGLTAMARQFHNVTAEQIAYVAQLQRSGDEAGALQAANEAATKGFD
FT                   DQTRRLKENMGTLETWADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAFKKADDIWN
FT                   LRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTE
FT                   EAQKAYKRLQTPLEKYTARQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSG
FT                   VKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQ
FT                   RRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAI
FT                   DAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGSWMAGLKS
FT                   GWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLK
FT                   QAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHR
FT                   GEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSLADSRSQASGTFEQNNHVVINND
FT                   GTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR"
FT   CDS_pept        647805..648134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0620"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23952"
FT                   /protein_id="BAI23952.1"
FT                   /translation="MKTFRWKVKPGMDVASAPSVRKVRFGDGYSQRAPAGLNANLKTYS
FT                   VTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEF
FT                   EQVVN"
FT   CDS_pept        648134..648832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0621"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23953"
FT                   /protein_id="BAI23953.1"
FT                   /translation="MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEK
FT                   GEPVTWQGRQYQAYPIQGTGFELNGKGSAARPTLTVSNLHGMVTGMVEDMQSLVGGTVV
FT                   RRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVF
FT                   PGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFHNNVGNFG
FT                   GFLSINKLSQ"
FT   CDS_pept        648838..649488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0622"
FT                   /product="putative tail assembly protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23954"
FT                   /protein_id="BAI23954.1"
FT                   /translation="MTQTESAILAHARRCAPAESCGFVVSTPEGERYFPCVNISGEPEA
FT                   YFRMSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGEIHKFR
FT                   CVPHLTGRRFEHGVTDCYTLFRDAYHLAEIEMPDFVREDDWWRNGQNLYLDNLEATGLY
FT                   QVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQ"
FT   CDS_pept        649518..650150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0623"
FT                   /product="putative tail assembly protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23955"
FT                   /protein_id="BAI23955.1"
FT                   /translation="MARICLYGDLQRFGRRIDLRVKTGAEAIRALATQLPAFRQKLSDG
FT                   WYQVRIAGRDVSASGLTAQLHETLPDGAVIHIVPRVAGAKSGGVFQIVLGAAAIAGSFF
FT                   TAGATLAAWGAAIGAGGMTGILFSLGASMVLGGVAQMLAPKARTPRTQTTDNGKQNTYF
FT                   SSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIGR"
FT   CDS_pept        650211..653624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0624"
FT                   /product="putative host specificity protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23956"
FT                   /protein_id="BAI23956.1"
FT                   /translation="MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSV
FT                   LLNSTPVLDSEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTI
FT                   TSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQY
FT                   LASVVVDNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQCYPNTALVGVQV
FT                   DLEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTFKPAYSNNMAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDKVWTYNRSNVVMPDDGAPFRYSFSALKDRHNAV
FT                   EVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLE
FT                   TQTVDFSVGAEGLRHVPGDVIEIFDDDYAGISTGGRVLAVNSQTRTLTLDREITLPSSG
FT                   TTLISLVDGSGNPVSVEVQSVTDGLKVKVNRVPDGVAEYSVWGLKLPTLRQRLFRCVSI
FT                   RDNDDGTYAITAVQHVPEKEAIVDNGAHFDGDQSGTVNGVTPPAVQHLTAEVTADSGEY
FT                   QVLARWDTPKVVKGVSFLLRLTVTADDGSERLVSTARTTETTYRFTQLALGNYRLTVRA
FT                   VNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSETRI
FT                   TDIRQVETTARYLGTALYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEGVGRASDDAE
FT                   GYLDFFKGKITESHLGKELLEKVDLTEDNASRLDEFSKEWKDANDKWNAMWGVKIEQTK
FT                   DGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFL
FT                   KRLTAPTITSGGSPPVFSLTSDGKLTAKNADISGRVNANAGTLNNVTVNENCTIKGMLE
FT                   ATQVRGDFVKAVSKSFPKQAGTWGNTETPNGTVTVTISDDHNFDRQIIIPPIIFNGIAY
FT                   SDPGSGNNPGGTRYTGYGFEVRKNGVLIASRETKGAIPGSYSAVIDMPSGGGSVTLEFK
FT                   IFQKGNQGAGNITDCTVIVTKKAASGISIR"
FT   CDS_pept        653695..654294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0625"
FT                   /product="putative outer membrane precursor Lom"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23957"
FT                   /protein_id="BAI23957.1"
FT                   /translation="MRKLYAAILSAAICLAVSGASAWASEHQSTLSAGYLHASTNVPGS
FT                   DDLNGINVKYRYEFTDTLGLVTSFSYAGDKNRQLTRYSDIRWHEDSVRNRWFSVMAGPS
FT                   VRVNEWFSAYAMAGVSYSRVSTFSGDYLRVTDNKGKTHDVLTGSDDGRHSNTSLAWGAG
FT                   VQFNPTESVAIDIAYEGSGSGDWRTDGFIVGVGYKF"
FT   CDS_pept        654359..657319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0626"
FT                   /product="putative side tail fiber protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23958"
FT                   /protein_id="BAI23958.1"
FT                   /translation="MAVKISGVLKDGTGKPVENCTIQLKAKRNSTTVVVNTLASENPDE
FT                   AGRYSMDVEYGQYSVILLVEGFPPSHAGTITVYEDSRPGTLNDFLGAMTEDDARPEALR
FT                   RFELMVEEVARNASAVAQNTAAAKKSASDASTSAREAATHATDAAGSARAASTSAGQAA
FT                   SSAQSASSSAGTASTKATEASKSAAAAESSKSAAATSAAAAKTSETNAAASQQSAATSA
FT                   STATTKASEAATSARDASASKEAAKSSETNASSSASSAASSATAAGNSAKAAKTSETNA
FT                   KSSETAAGQSASAAAGSKTAAASSASAASTSAGQASASATAAGKSAESAASSASTATTK
FT                   AGEATEQASAAASSASAAKTSETNAKASETSAESSKTAAASSASSAASSASSASASKDE
FT                   ATRQASAAKSSATTASTKATEAAGSATAAAQSKSTAESAATRAETAAKRAEDIASAVAL
FT                   EDASTTKKGIVQLSSATNSTSESLAATPKAVKAAYDLANGKYTAQDATTAQKGIVQLSS
FT                   ATNSTSEMLAATPKSVKAAYDLANGKYTAQDATTAQKGIVQLSSATNSASETLAETPKA
FT                   VKAANDNANGRVPSARKVNGKALSADITLTPKDIGTLNSTTMSFSGGAGWFKLATVTMP
FT                   QASSVVSITLIGGAGFNVGSPQQAGISELVLRAGNGNPKGITGALWQRTSTGFTNFAWV
FT                   NTSGDTYDIYVAIGNYATGVNIQWDYTSNASVTIHTSPAYSANKPEGLTDGTVYSLYTP
FT                   SEQFYPPGAPIPWPSDTVPSGYALMQGQTFDKSAYPKLAAAYPSGVIPDMRGWTIKGKP
FT                   ASGRAVLSQEQDGIKSHTHSASASSTDLGTKTTSSFDYGTKSTNNTGAHTHSLSGSTSS
FT                   AGAHSHVDGRRFNTSTFKDTYQYGSTAVGSNSYQVQGAVGLGIGTMANTNSAGAHTHSL
FT                   SGTAASAGAHAHTVGIGAHTHSVAIGSHGHTITVNAAGNAENTVKNIAFNYIVRLA"
FT   CDS_pept        657331..657903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0627"
FT                   /product="putative tail fiber assembly protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23959"
FT                   /protein_id="BAI23959.1"
FT                   /translation="MSEQARTIKIYNLLAGTNEFIGEGDAYIPPHTGLPANSTDIAPPD
FT                   IPAGFVAVFNSDEASWHLVEDHRGKTVYDVASGDALFISELGPLPENVTWLSPEGEFQK
FT                   WNGTAWVKDAEAEKLFRIREAEEIKNSLMQVASEHIAPLQDAVDLEIATEEETSLLEAW
FT                   KKYRVLLNRVDTSTAPDIEWPTNPVRE"
FT   CDS_pept        complement(657958..658614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0628"
FT                   /product="conserved predicted protein"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23960"
FT                   /protein_id="BAI23960.1"
FT                   /translation="MKKNTDDGAKIYTPLTLKLYDWWVLGVSNRLAWGCPTKEHLLPHF
FT                   LEHLGNNHLDIGVGTGFYLTHVPESSLISLMDLNEASLNAASTRAGESKIKHKISHDVF
FT                   EPYPAALHGQFDSISMFYLLHCLPGNISTKSCVIRNAAQALTDDGTLYGATILGDGVVH
FT                   NSFGQKLMRIYNQKGIFSNTKDSEEGLTHILSEHFENVKTKVQGTVVMFSASGKK"
FT   CDS_pept        658683..658988
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0629"
FT                   /note="Prophage ECO26_P01; predicted tail fiber assembly
FT                   protein, C-terminal fragment"
FT   CDS_pept        complement(659172..660656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0630"
FT                   /product="putative hydrolase homologue"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23961"
FT                   /protein_id="BAI23961.1"
FT                   /translation="MRKIITHFKVVLTLLLPVTVSAQQIQWQSCMASQFNHWFGEEKPS
FT                   PDLLCGYLSVPLKYTDTGGDASYEKKSQVKLALTKLPAKSKHKGSILIISGGPGLPGIN
FT                   PYINFDWPVTNLRESWDIIGFDPRGVGQSTPTINCRQSDTETQENITEKQQVLNKINAC
FT                   IHNTGAEVIRHIGSNEAVYDIDRIRQALGDKQLTAVAYSYGTQIAALYAERFPYNVRSI
FT                   VLDGVVDIDDLEDNFTWQLKQAQSYQETFDRFASWCARTKSCPLSSDRDKAITQFHELL
FT                   SKLHHKPLLDSKRENISSDELISLTTDLLLWRSSWPTLATAIRQFSQGIVSNEIETALS
FT                   APIASEESSDASGVILCVDQGDEQLTPEERKSRKDALANAFPAINFDNGRSDSPDFCEL
FT                   WPIHSDLNKTRLKNTVLPSGLLFIAHKYDPTTPWINARKMAEKFSSPLLTINGDGHTLA
FT                   LTGVNLCVDKAVVHHLITPQKIENIYCPGNSEAEIQ"
FT   CDS_pept        complement(660843..661796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0631"
FT                   /product="putative outer membrane protease OmpT precursor"
FT                   /note="Prophage ECO26_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23962"
FT                   /protein_id="BAI23962.1"
FT                   /translation="MRAKLLGIVLTTPIAISSFASTETISFTPDNINADISLGTLSGKT
FT                   KERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQ
FT                   DWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTA
FT                   RGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSG
FT                   WVEASDNDEHYDPGKRITYRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKG
FT                   NTSLYDHNDNTSDYSKNGAGIENYNFITTAGLKYTF"
FT   CDS_pept        complement(662309..663070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envY"
FT                   /locus_tag="ECO26_0632"
FT                   /product="DNA-binding transcriptional activator EnvY of
FT                   porin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23963"
FT                   /protein_id="BAI23963.1"
FT                   /translation="MQLSSSEPCVVILTEKEVEVSVNNHATFTLPKNYLAAFACNNNVI
FT                   ELSTLNHVLIPHINRNIINDYLLFLNKNLTCVKPWSRLATPVIACHSRTPEVFRLAANH
FT                   SKQQPSKPCEAELTRALLFTVLSNFLEQSRFIALLMYILRSSVRDSVCRIIQSDIQHYW
FT                   NLRIVASSLCLSPSLLKKKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGY
FT                   SSTSYFISVFKAFYGLTPLNYLAKQRQKVMW"
FT   CDS_pept        complement(663253..664143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECO26_0633"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23964"
FT                   /protein_id="BAI23964.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRALLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGVTPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEQVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSPAPASGIVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
FT   CDS_pept        complement(664144..667116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrA"
FT                   /locus_tag="ECO26_0634"
FT                   /product="bacteriophage N4 receptor outer membrane subunit
FT                   NfrA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23965"
FT                   /protein_id="BAI23965.1"
FT                   /translation="MKENNLNRVIGWSGLLLTSLLSTSALADNIGTSAEELGLSDYRHF
FT                   VIYPRLDKALKAQKNNDEATAIREFEYIHQQVPDNIPLTLYLAEAYRHFGHDDRARLLL
FT                   EDQLKRHPGDARLERSLAAIPVEVKSVTTVEELLAQQKACDAAPTLRCRSEVGQNALRL
FT                   AQLPVARAQLNDATFAASPEGKTLRTDLLQRAIYLKQWSQADTLYNEARQQNTLSAAER
FT                   RQWFDVLLAGQLDDRILALQSQGIFTDPQSYITYATALAYRGEKARLQHYLIENKPLFT
FT                   TDAQEKSWLYLLSKYSANPVQALANYTVQFADNRQYVVGATLPVLLKEGQYDAAQKLLA
FT                   TLPANEMLEERYAVSVATRNKAESLRLARLLYQQEPANLTRLDQLTWQLMQNEQSREAA
FT                   DLLLQRYPFQGDARVSQTLMARLASLLESHPYLATPAKVAILSKPLPLAAQRQWQSQLP
FT                   GIADNCPAIVRLLGDMSPSYDAAAWNRLAKCYRDTLPGVALYAWLQAEQRQPNAWQHRA
FT                   VAYQAYQVEDYATALAAWQKISLHDMSNEDLLAAANTAQAAGNGAARDRWLQQAEQRGL
FT                   GNNALYWWLHAQRYIPGQPELALSDLTRSINIAPSANAYVARATIYRQRHNVPAAVSDL
FT                   RAALELEPNNSNIQAALGYALWDSGDIAQSREMLEQAHKGLPDDPALIRQLAYVNQRLD
FT                   DMPATQHYARLVIDDIDNQALITPLTPEQNQQRFNFRRLHEEVGRRWTFSFDSSIGLRS
FT                   GAMSTANNNVGGAAPGKSYRSYGQLEAEYRIGRNMLLEGDLLSVYSRVFADTGENGVMM
FT                   PVKNPMSGTGLRWKPLRDQIFFLAVEQQLPLNGQNGASDTMLRASASFFNGGKYSDEWH
FT                   PNGSGWFAQNLYLDAAQYIRQDIQAWTADYRVSWHQKVANGQTIEPYAHVQDNGYRDKG
FT                   TQGAQLGGVGVRWNIWTGETHYDAWPHKVSLGVEYQHTFKAINQRNGERNNAFLTIGVH
FT                   W"
FT   CDS_pept        complement(667103..669340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrB"
FT                   /locus_tag="ECO26_0635"
FT                   /product="bacteriophage N4 receptor inner membrane subunit
FT                   NfrB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23966"
FT                   /protein_id="BAI23966.1"
FT                   /translation="MDWLLDVFATWLYGLKVIAITLAVIMFISGLDDFFIDVVYWVRRI
FT                   KRKLSVYRRYPRMSYRELYKPDEKPLAIMVPAWNETGVIGNMAELAATTLDYENYHIFV
FT                   GTYPNDPDTQRDVDEVCARFPNVHKVVCARPGPTSKADCLNNVLDAITQFERSANFAFA
FT                   GFILHDAEDVISPMELRLFNYLVERKDLIQIPVYPFEREWTHFTSMTYIDEFSELHGKD
FT                   VPVREALAGQVPSAGVGTCFSRRAVTALLADGDGIAFDVQSLTEDYDIGFRLKEKGMTE
FT                   IFVRFPVVDEAKEREQRKFLQHARTSNMICVREYFPDTFSTAVRQKSRWIIGIVFQGFK
FT                   THKWTSSLTLNYFLWRDRKGAISNFVSFLAMLVMLQLLLLLAYESLWPDAWHFLSIFSG
FT                   SAWLMTLLWLNFGLMFNRIVQRVIFVTGYYGLTQGLLSVLRLFWGNLINFMANWRALKQ
FT                   VLQHGDPRRVAWDKTTHDFPSVTGDTRSLRPLGQILLENQVITEEQLDTALRNRVEGLR
FT                   LGGSMLMQGLISAEQLAQALAEQNGVAWESIDAWQIPSSLIAEMPASVALHYAVLPLRL
FT                   ENDELIVGSEDGIDPVSLAALTRKVGRKVRYVIVLRGQIVTGLRHWYARRRGHDPRAML
FT                   YNAVQHQWLTEQQTGEIWRQYVPHQFLFAEILTTLGHINRSAINVLLLRHERSSLPLGK
FT                   FLVTEGVISQETLDRVLTIQRELQVSMQSLLLKAGLNTEQVAQLESENEGE"
FT   mobile_element  complement(669599..670889)
FT                   /mobile_element_type="insertion sequence:IS677"
FT   CDS_pept        complement(669609..670745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0636"
FT                   /product="H repeat-associated protein"
FT                   /note="RhsJ, IS677"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23967"
FT                   /protein_id="BAI23967.1"
FT                   /translation="MELKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAESWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSNDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEGKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
FT   CDS_pept        complement(670872..671195)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0637"
FT                   /note="putative Rhs core protein, central part"
FT   CDS_pept        complement(671981..672346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23968"
FT                   /protein_id="BAI23968.1"
FT                   /translation="MSRYILIRGWFECDFEQVKKIKEANEEFFKHSEKYLLPENTKRLY
FT                   LNGWCYPEYPINWVSVISLGVNINQIAFDYIKDMIVNVSKTERLDGYFRVNDDEDNLFL
FT                   EWIVKDGYLEEIILSGS"
FT   CDS_pept        complement(672348..677084)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0639"
FT                   /note="RhsK core protein with extension, C-terminal part
FT                   degraded"
FT   CDS_pept        complement(677104..677565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0640"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23969"
FT                   /protein_id="BAI23969.1"
FT                   /translation="MQFTFNEGHIQLPSQWQDQSMQVLVSTDNSGINLVITREAVPQGT
FT                   LTPELYQETLALYQGKLDGYTEHACREITLAEAPAWLLDYSWNGPEDEGNQGRISQIAV
FT                   FQRRGDTLLTFTFSTSLSLKNSQKTMLLEVIKSFTPLPPENDIQKDQPR"
FT   CDS_pept        complement(677593..679494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0641"
FT                   /product="putative Vgr protein"
FT                   /note="RhsK"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23970"
FT                   /protein_id="BAI23970.1"
FT                   /translation="MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQF
FT                   LSLEFAQVLDKMAYLTIWQGDEVQRRVKGVVTWFELGENDKNQMLYSMKVHPPLWRAGL
FT                   RQNFRIFQNEDIKSILGTMLQENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAE
FT                   EGIFFYEEHAYKSTDQSLVLCDTVRHLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRP
FT                   SSVVTKDYTFKRPGWAGRFEQEGQHQDYQRTQYEVYDYPGRFKSAHGQNFARWQMDGWR
FT                   NNAETARGMSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRQGAGTA
FT                   LENHFAVIPADRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVRFNWDRYNP
FT                   ADQDSSCWIRVAQAWAGTGFGHLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPG
FT                   SLPGTKTQMTIRSKTYMGSGFNELKFDDATGREQVYIHAQKNMDTEVLNDRTTTVKHDH
FT                   RETVKNDQTVTIQEGNRLLTVEKGHKITGVLKGSLSEDVFQDRGTIAGSVHVDAVNNGG
FT                   EGDGIQAYTAIKEILLAVEESKIALTPDGIQLQVGESTVIRLSKDGITIVGGSVFIN"
FT   CDS_pept        complement(680231..681679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECO26_0642"
FT                   /product="sensory histidine kinase CusS in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23971"
FT                   /protein_id="BAI23971.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSHGKTVYHSPGA
FT                   PDIREFARDAIPDKDARGGEVYLLSGPTIMMPGHGHGHMEHSNWRMINLSVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDECQVAGDPLMLRRALSNLLSNALRYTPPGEAIVV
FT                   RCQTVDHQVQVTVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVIMLPERE"
FT   CDS_pept        complement(681669..682352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="ECO26_0643"
FT                   /product="DNA-binding response regulator CusR in
FT                   two-component regulatory system with CusS"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23972"
FT                   /protein_id="BAI23972.1"
FT                   /translation="MKLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDY
FT                   DLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFA
FT                   FAELLARVRTLLRRGAAVIIESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFL
FT                   RHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLE
FT                   VPDGQ"
FT   CDS_pept        682509..683882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="ECO26_0644"
FT                   /product="copper/silver efflux system protein CusC"
FT                   /note="outer membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23973"
FT                   /protein_id="BAI23973.1"
FT                   /translation="MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVNA
FT                   ADNYQNVGWRTFFVDNQVKTLISEALVNNRDLRMATLKVQETRAQYRLTDADRYPQLNG
FT                   EGSGSWSGNLKGNTATTREFSTGLNASFDLDFFGRLKNMSEAERQNYLATEEAQRAVHI
FT                   LLVSNVAQSYFNQQLAYAQLQIAEETLRNYQQSYAFVEKQLLTGSSNVLALEQARGVIE
FT                   STRSDIAKRQGELAQANNALQLLLGSYGKLPQAQTVNSDSLQSVKLPAGLSSQILLQRP
FT                   DIMEAEHALMAANANIGAARAAFFPSIRLTSGISTASSDLSSLFNASSGMWNFIPKIEI
FT                   PIFNAGRNQANLDIAEIRQQQSVVNYEQKIQNAFKEVADALALRQSLNDQISAQQRYLA
FT                   SLQITLQRARALYQHGAVSYLEVLDAERSLFATRQTLLDLNYARQVNEISLYTALGGG"
FT   CDS_pept        684040..684372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECO26_0645"
FT                   /product="periplasmic copper-binding protein CusF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23974"
FT                   /protein_id="BAI23974.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEVQPQVISATGVVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
FT   CDS_pept        684388..685611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="ECO26_0646"
FT                   /product="copper/silver efflux system protein CusB"
FT                   /note="membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23975"
FT                   /protein_id="BAI23975.1"
FT                   /translation="MKKIALIIGSMIAGGIISAAGFTWFAKAEPPAEKTSTAERKILFW
FT                   YDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPL
FT                   TFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQS
FT                   EYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFD
FT                   LRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKW
FT                   TLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQR
FT                   VITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMR
FT                   SESATHAH"
FT   CDS_pept        685623..688766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="ECO26_0647"
FT                   /product="copper/silver efflux system protein CusA"
FT                   /note="membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23976"
FT                   /protein_id="BAI23976.1"
FT                   /translation="MIEWIIRRSVANRFLVLMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDPY
FT                   WARSRVLEYLNQVQGKLPAGVSAELGPDATGVGWIYEYALVDRSGKHDLADLRSLQDWF
FT                   LKYELKTIPDVAEVASVGGVVKEYQVVIDPQRLAQYGISLAEVKSALDASNQEAGGSSI
FT                   ELAEAEYMVRASGYLQTLDDFNHIVLKASENGVPVYLRDVAKVLIGPEMRRGIAELNGE
FT                   GEVAGGVVILRSGKNAREVIAAVKDKLETLKSSLPEGVEIVTTYDRSQLIDRAIDNLSG
FT                   KLLEEFIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIA
FT                   VGAMVDAAIVMIENAHKRLEEWQHQHPDATLDNKTRWQVITDASVEVGPALFISLLIIT
FT                   LSFIPIFTLEGQEGRLFGPLAFTKTYAMAGAALLAIVVIPILMGYWIRGKIPPESSNPL
FT                   NRFLIRVYHPLLLKVLHWPKTTLLVAALSVLTVLWPLNKVGGEFLPQINEGDLLYMPST
FT                   LPGISAAEAASMLQKTDKLIMSVPEVARVFGKTGKAETATDSAPLEMVETTIQLKPQEQ
FT                   WRPGMTMDKIIEELDNTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVSGTVLADID
FT                   AMAEQIEEVARTVPGVASALAERLEGGRYINVEINREKAARYGMTVADVQLFVTSAVGG
FT                   AMVGETVEGIARYPINLRYPQSWRDSPQALRQLPILTPMKQQITLADVADIKVSTGPSM
FT                   LKTENARPTSWIYIDARDRDMVSVVHDLQKAIAEKVQLKPGTSVAFSGQFELLERANHK
FT                   LKLMVPMTLMIIFVLLYLAFRRVGEALLIISSVPFALVGGIWLLWWMGFHLSVATGTGF
FT                   IALAGVAAEFGVVMLMYLRHAIEAEPSLNNPQTFSEQKLDEALYHGAVLRVRPKAMTVA
FT                   VIIAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLMWLHRHRVRK"
FT   CDS_pept        688868..690244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheP"
FT                   /locus_tag="ECO26_0648"
FT                   /product="phenylalanine transporter PheP"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23977"
FT                   /protein_id="BAI23977.1"
FT                   /translation="MKNASTVSEDTASNQEPTLHRGLHNRHIQLIALGGAIGTGLFLGI
FT                   GPAIQMAGPAVLLGYGVAGIIAFLIMRQLGEMVVEEPVSGSFAHFAYKYWGPFAGFLSG
FT                   WNYWVMFVLVGMAELTAAGIYMQYWFPDVPTWIWAAAFFIIINAVNLVNVRLYGETEFW
FT                   FALIKVLAIIGMIGFGLWLLFSGHGGEKASIDNLWRYGGFFATGWNGLILSLAVIMFSF
FT                   GGLELIGITAAEARDPEKSIPKAVNQVVYRILLFYIGSLVVLLALYPWVEVKSNSSPFV
FT                   MIFHNLDSNVVASALNFVILVASLSVYNSGVYSNSRMLFGLSVQGNAPKFLTRVSRRGV
FT                   PINSLMLSGAITSLVVLINYLLPQKAFGLLMALVVATLLLNWIMICLAHLRFRAAMRRQ
FT                   GRETQFKALLYPFGNYLCIAFLGMILLLMCTMDDMRLSAILLPVWIVFLFVAFKTLRRK
FT                   "
FT   CDS_pept        complement(690312..691559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /locus_tag="ECO26_0649"
FT                   /product="predicted mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23978"
FT                   /protein_id="BAI23978.1"
FT                   /translation="MQDLISQVEDLAGIEIDHTTSMVMIFGIIFLTAVVVHIILHWVVL
FT                   RTFEKRAIASSRLWLQIITQNKLFHRLAFTLQGIIVNIQAVFWLQKGTEAADILTTCAQ
FT                   LWIMMYALLSVFSLLDVILNLAQKFPAASQLPLKGIFQGIKLIGAILVGILMISLLIGQ
FT                   SPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDI
FT                   GLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDE
FT                   MQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESILNLRRMTNIGTFRAYLNEYLRNHPR
FT                   IRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLRLHQ
FT                   SPTGNDIRSLAGAFKQ"
FT   CDS_pept        complement(691667..692320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfnB"
FT                   /locus_tag="ECO26_0650"
FT                   /product="dihydropteridine reductase, NAD(P)H-dependent,
FT                   oxygen-insensitive"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23979"
FT                   /protein_id="BAI23979.1"
FT                   /translation="MDIISVALKRHSTKAFDASKKLTPEQAEQIKTLLQYSPSSTNSQP
FT                   WHFIVASTEEGKARVAKSAAGNYVFNERKILDASHVVVFCAKTAMDDAWLKLVVDQEDA
FT                   DGRFATPEAKAANDKGRKFFADMHRKDLHDDAEWMAKQVYLNVGNFLLGVAALGLDAVP
FT                   IEGFDAAILDAEFGLKEKGYTSLVVVPVGHHSVEDFNATLPKSRLPQNITLTEV"
FT   CDS_pept        complement(692414..692782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECO26_0651"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23980"
FT                   /protein_id="BAI23980.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
FT   CDS_pept        complement(692847..693095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /locus_tag="ECO26_0652"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23981"
FT                   /protein_id="BAI23981.1"
FT                   /translation="MKHPLETLTTAAGILLMAFLSCLLLPAPALGLTLAQKLVTMFHLM
FT                   DLSQLYTLLFCLWFLVLGAIEYFVLRFIWQRWFSLAD"
FT   CDS_pept        complement(693161..694279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /locus_tag="ECO26_0653"
FT                   /product="gamma-glutamyl:cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23982"
FT                   /protein_id="BAI23982.1"
FT                   /translation="MPLPDFHVSEPFTLGIELEMQVVNPPGYDLSQDSSMLIDAVKNEI
FT                   TAGEVKHDITESMLELATDVCRDINQAAGQFSAMQKVVLQAAADHHLEICGGGTHPFQK
FT                   WQRQEVCDNERYQRTLENFGYLIQQATVFGQHVHVGCASGDDAIYLLHGLSRFVPHFIA
FT                   LSAASPYMQGTDTRFASSRPNIFSAFPDNGPMPWVSNWQQFEALFRCLSYTTMIDSIKD
FT                   LHWDIRPSPHFGTVEVRVMDTPLTLSHAVNMAGLIQATAHWLLTERPFKHQEKDYLLYK
FT                   FNRFQACRYGLEGVITDPHTGDRRPLKEDTLRLLEKIAPSAHKMGASSAIEALHRQVVS
FT                   GLNEAQLMRDFVADGGSLIGLVKKHCEIWAGD"
FT   CDS_pept        694721..694873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECO26_0654"
FT                   /product="small toxic membrane polypeptide HokE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23983"
FT                   /protein_id="BAI23983.1"
FT                   /translation="MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
FT   CDS_pept        695125..695376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mokC"
FT                   /locus_tag="ECO26_0655"
FT                   /product="regulatory peptide MokC"
FT                   /note="The MokC translation enables hok (gef) expression."
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23984"
FT                   /protein_id="BAI23984.1"
FT                   /translation="MKPQEIFLSILGLPLRASTTRMVVPSSHGGNINMLTKYALVAVIV
FT                   LCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLAYEPKK"
FT   CDS_pept        695224..695376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokC2"
FT                   /locus_tag="ECO26_0656"
FT                   /product="small toxic membrane peptide HokC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23985"
FT                   /protein_id="BAI23985.1"
FT                   /translation="MLTKYALVAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
FT   CDS_pept        complement(695498..696127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entD"
FT                   /locus_tag="ECO26_0657"
FT                   /product="phosphopantetheinyltransferase component EntD"
FT                   /note="component of enterobactin synthase multienzyme
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23986"
FT                   /protein_id="BAI23986.1"
FT                   /translation="MVDMKTTHTSLPFAGHTLHFVEFDPANFCEQDLLWLPHYAQLQHA
FT                   GRKRKAEHLAGRIAAIYALREYGYKCVPAIGELRQPVWPAEVYGSISHCGATALAVVSR
FT                   QPIGVDIEEIFSAQTATELTDNIITPAEHERLADCGLAFSLALTLAFSAKESAFKASEI
FT                   QTDAGFLDYQIISWNKQQVIIHRENEMFAVHWQIKEKIVITLCQHD"
FT   CDS_pept        complement(696293..698533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepA"
FT                   /locus_tag="ECO26_0658"
FT                   /product="iron-enterobactin outer membrane transporter
FT                   FepA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23987"
FT                   /protein_id="BAI23987.1"
FT                   /translation="MNKKIHSLALLVNLGIYGVAQAQEPTDTPVSHDDTIVVTAAEQNL
FT                   QAPGVSTITADEIRKNPVARDVSEIIRTMPGVNLTGNSTSGQRGNNRQIDIRGMGPENT
FT                   LILIDGKPVSSRNSVRQGWRGERDTRGDTSWVPPEMIERIEVLRGPAAARYGNGAAGGV
FT                   VNIITKKGSGEWHGSWDAYFNAPEHKEEGATKRTNFSLTGPLGDEFSFRLYGNLDKTQA
FT                   DAWDINQGHQSARAGTYATTLPAGREGVINKDINGVVRWDFAPLQSLELEAGYSRQGNL
FT                   YAGDTQNTNSDAYTRSKYGDETNRLYRQNYALTWNGGWDNGVTTSNWVQYEHTRNSRIP
FT                   EGLAGGTEGKFNEKATQDFVDIDLDDVMLHSEVNLPIDILVNQTLTLGTEWNQQRMKDL
FT                   SSNTQALTGANTGGAIDGMSATDRSPYSKAEIFSLFAENNMELTDSTIVTPGLRFDHHS
FT                   IVGNNWSPALNISQGLGDDFTLKMGIARAYKAPSLYQTNPNYILYSKGQGCYASAGGCY
FT                   LQGNDDLKAETSINKEIGLEFKRDGWLAGVTWFRNDYRNKIEAGYVAVGQNAVGTDLYQ
FT                   WDNVPKAVVEGLEGSLNVPVSETVMWTNNITYMLKSENKTTGDRLSIIPEYTLNSTLSW
FT                   QAREDLSMQTTFTWYGKQQPKKYNYKGQPAVGPETKEISPYSIVGLSATWDVTKNVSLT
FT                   GGVDNLFDKRLWRAGNAQTTGDLAGANYIAGAGAYTYNEPGRTWYMSVNTHF"
FT   CDS_pept        698854..699993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fes"
FT                   /locus_tag="ECO26_0659"
FT                   /product="enterobactin/ferric enterobactin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23988"
FT                   /protein_id="BAI23988.1"
FT                   /translation="MFEVTFWWRDPQGSEEYSTIKRVWIYITGVTDHHQNSQPQSMQRI
FT                   AGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPSPDRLELREGWRKLLPQAIADPLNP
FT                   QSWKGGRGHAVSALEMPQAPLQPGWDCPQAPEIAAKEIIWKSERLKNSRRVWIFTTGDA
FT                   TAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNA
FT                   DFWLAVQQELLPLVKAIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGS
FT                   YWWPHRGGQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESI
FT                   FWRQVDGGHDALCWRGGLMQGLIDLWQPLSMTGVEYGIQ"
FT   CDS_pept        699980..700198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECO26_0660"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23989"
FT                   /protein_id="BAI23989.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCALPAGWDIVCQPQS
FT                   QASCQQWLEVHWRTLTPANFTQLQEAQ"
FT   CDS_pept        700195..704076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entF"
FT                   /locus_tag="ECO26_0661"
FT                   /product="enterobactin synthase multienzyme complex
FT                   component EntF, ATP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23990"
FT                   /protein_id="BAI23990.1"
FT                   /translation="MSQHLPLVAAQPGIWMAEKLSDLPSAWSVAHYVELTGDVDAPLLA
FT                   RAVVVGLAQADTLRMRFTEDNGEVWQWVDDALIFELPEIIDLRTNIDPHGTAQALMLAD
FT                   LQQDLRVDSGKPLVFHQLIHVADNRWYWYQRYHHLLVDGFSFPAITRQIANIYCTWLRG
FT                   EPTPASPFTPFADVVEEYQQYRESEAWQRDAAFWAEQRRQLPPPASLSPAPLAGRSASA
FT                   DILRLKLEFTDGEFRQLATQLSGVQRTDLALALAALWLGRLCNRMDYAAGFIFMRRLGS
FT                   AALTASGPVLNVLPLGIHIAAQETLPELATRLAAQLKKMRRHQRYDAEQIVRDSGRAAG
FT                   EEPLFGPVLNIKVFDYQLDIPGVQTQTHTLATGPVNDLELALFPDEHGDLSIEILANKQ
FT                   RYDEPTLIQHAERLKMLIAQFAADPALLCGDVDIMLPGEYAQLAQINATQVEIPETTLS
FT                   ALVAEQAAKTPDAPALADARYLFSYREMREQVVALANLLRERGVKPGDSVAVALPRSVF
FT                   LTLALHAIVEAGAAWLPLDTGYPDDRLKMMLEDARPSLLITTDDQLPRFSDVPNLTSLC
FT                   YNAPLTPQGSAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLLWMQNHYPLTG
FT                   EDVVAQKTPCSFDVSVWEFFWPFIAGAKLVMAEPEAHRDPLAMQQFFAEYGVTTTHFVP
FT                   SMLAAFVASLTPQTARQNCATLKQVFCSGEALPADLCREWQQLTGAPLHNLYGPTEAAV
FT                   DVSWYPAFGEELAQVRGSSVPIGYPVWNTGLRILDAMMHPVPPGVAGDLYLTGIQLAQG
FT                   YLGRPDLTASRFIADPFAPGERMYRTGDVARWLDNGAVEYLGRSDDQLKIRGQRIELGE
FT                   IDRVMQALPDVEQAVTHACVINQAAATGGDARQLVGYLVSQSGLPLDTSALQAQLRETL
FT                   PPHMVPVVLLQLPQLPLSANGKLDRKALPLPELKTQASGRAPKAGSETIIAAAFASLLG
FT                   CDVQDADADFFALGGHSLLAMKLAAQLSRQFARQVTPGQVMVASTVAKLATIIDGEEDS
FT                   SRRMGFETILPLREGNGPTLFCFHPASGFAWQFSVLSRYLDPQWSIIGIQSPRPHGPMQ
FT                   TATNLDEVCEAHLATLLEQQPHGPYYLLGYSLGGTLAQGIAARLRARGEQVAFLGLLDT
FT                   WPPETQNWQEKEANGLDPEVLAEINREREAFLAAQQGSTSTELFTTIEGNYADAVRLLT
FT                   TAHSVPFDGKATLFVAERTLQEGMSPERAWSPWIAELDIYRQDCAHVDIISPGAFVKIG
FT                   PIIRATLNR"
FT   CDS_pept        704292..705425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepE"
FT                   /locus_tag="ECO26_0662"
FT                   /product="ferric enterobactin transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23991"
FT                   /protein_id="BAI23991.1"
FT                   /translation="MSSLNIKQGSDAHFPEYPLASPSNNEIDLLNLIAVLWRAKKTVMA
FT                   VIFAFACAGLLISFILPQKWTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAF
FT                   NLFIKKFQSVSLLEEYLRSSPYVMDQLKEAKIDELDLHRAIVALSEKMKAVDDNASKKK
FT                   DEPSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESLENVRNKLEIKTQFEKEKL
FT                   AQDRIKTKNQLDANIQRLNYSLDIANAAGIKKPVYSNGQAVKDDPDFSISLGADGIERK
FT                   LEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLPVKKDGPGKAI
FT                   IVILSALIGGMVACGSVLLRYAMASRKQDAMMADHLV"
FT   CDS_pept        complement(705422..706237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepC"
FT                   /locus_tag="ECO26_0663"
FT                   /product="ATP-binding component of ferric enterobactin
FT                   transport FepC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23992"
FT                   /protein_id="BAI23992.1"
FT                   /translation="MNESVARLRGEQLTLGYGKYTVAENLTVEIPDGHFTAIIGPNGCG
FT                   KSTLLRTLSRLMTPAHGHVWLDGEHIQHYASKEVARRIGLLAQNATTPGDITVQELVAR
FT                   GRYPHQPLFTRWRKEDEEAVTKAMQATGITHLADQSVDTLSGGQRQRAWIAMVLAQETA
FT                   IMLLDEPTTWLDISHQIDLLELLSELNREKGYTLAAVLHDLNQACRYASHLIALREGKI
FT                   VAQGAPKEIVTAELIERIYGLRCMIIDDPVAGTPLVVPLGRTAPSTANS"
FT   CDS_pept        complement(706234..707226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="ECO26_0664"
FT                   /product="ferric enterobactin transport protein FepG"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23993"
FT                   /protein_id="BAI23993.1"
FT                   /translation="MIYVSRRLIITCLLLVSACVVAGIWGLRSGAVTLETSQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALAAMVGGIITSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
FT   CDS_pept        complement(707223..708227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepD"
FT                   /locus_tag="ECO26_0665"
FT                   /product="ferric enterobactin (enterochelin) transport
FT                   FepD"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23994"
FT                   /protein_id="BAI23994.1"
FT                   /translation="MSGSVAVTRAIAVPGLLLLLIIATALSLLIGAKSLPASVVLEALS
FT                   GTCQSADCTIVLDARLPRTLAGLLAGGALGLAGALMQTLTRNPLADPGLLGVNAGASFA
FT                   IVLGAALFGYSSAQEQLAMAFAGALVASLIVAFTGSQGGGQLSPVRLTLAGVALAAVLE
FT                   GLTSGIALLNPDVYDQLRFWQAGSLDIRNLHTLKVVLIPVLIAGATALLLSRALNSLSL
FT                   GSDTATALGSRVARTQLIGLLAITVLCGSATAVVGPIAFIGLMMPHMARWLVGADHRWS
FT                   LPVTLLATPALLLFADIIGRVIVPGELRVSVVSAFIGAPVLIFLVRRKTRGGA"
FT   CDS_pept        708338..709588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entS"
FT                   /locus_tag="ECO26_0666"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23995"
FT                   /protein_id="BAI23995.1"
FT                   /translation="MNKQSWLLNLSLLKTHPAFRAVFLARFISIVSLGLLGVAVPVQIQ
FT                   MMTHSTWQVGLSVTLTGGAMFVGLMVGGVLADRYERKKVILLARGTCGIGFIGLCLNAL
FT                   LPEPSLLAIYLLGLWDGFFASLGVTALLAATPALVGRENLMQAGAITMLTVRLGSVISP
FT                   MIGGLLLATGGVAWNYGLAAAGTFITLLPLLSLPALPPPPQPREHPLKSLLAGFRFLLA
FT                   SPLVGGIALLGGLLTMASAVRVLYPALADNWQMSAAQIGFLYAAIPLGAAIGALTSGKL
FT                   AHSARPGLLMLLSTLGSFLAIGLFGLMPMWILGVVCLALFGWLSAVSSLLQYTMLQTQT
FT                   PEAMLGRINGLWTAQNVTGDAIGAALLGGLGAMMTPVASASASGFGLLIIGVLLLLVLV
FT                   ELRRFRQTPPQVTASDS"
FT   CDS_pept        complement(709592..710548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECO26_0667"
FT                   /product="ferric enterobactin (enterochelin) binding
FT                   protein FepB"
FT                   /note="periplasmic component; periplasmic-binding component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23996"
FT                   /protein_id="BAI23996.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSTEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSATQVLERLKALF"
FT   CDS_pept        710917..712092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entC"
FT                   /locus_tag="ECO26_0668"
FT                   /product="isochorismate synthase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23997"
FT                   /protein_id="BAI23997.1"
FT                   /translation="MDTSLAEEVQQTMATLAPNRFFFMSPYRSFTTSGCFARFDEPAVN
FT                   GDSPDSPFQQKLAALFADAKAQGIKNPVMVGAIPFDPRQPSSLYIPESWQSFSRQEKQT
FT                   SARRFTRSQSLNVVERQAIPEQTTFEQMVARAAALTATPQVDKVVLSRLIDITTDAAID
FT                   SGVLLERLIAQNPVSYNFHVPLADGGVLLGASPELLLRKDGERFSSIPLAGSARRQPDE
FT                   VLDREAGNRLLASEKDRHEHELVTQAMKEVLRERSSELHVPSSPQLITTPTLWHLATPF
FT                   EGKANSQENALTLACLLHPTPALSGFPHQAATQVIAELEPFDRELFGGIVGWCDSEGNG
FT                   EWVVTIRCAKLRENQVRLFAGAGIVPASSPLGEWRETGVKLSTMLNVFGLH"
FT   CDS_pept        712102..713712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entE"
FT                   /locus_tag="ECO26_0669"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase component of
FT                   enterobactin synthase multienzyme complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23998"
FT                   /protein_id="BAI23998.1"
FT                   /translation="MSIPFTRWPEEFARRYREKGYWQDLPLTDILTRHAASDSIAVIDG
FT                   ERQLSYRELNQAADNLACSLRRQGIKPGETALVQLGNVAELYITFFALLKLGVAPVLAL
FT                   FSHQRSELNAYASQIEPALLIADRQHALFSGDDFLNTFVTEHSSIRVVQLHNDSGEHNL
FT                   QDAINHPAEDFTATPSPADEVAYFQLSGGTTGTPKLIPRTHNDYYYSVRRSVEICQFTQ
FT                   QTRYLCAIPAAHNYAMSSPGSLGVFLAGGTVVLAADPSATLCFPLIEKHQVNVTALVPP
FT                   AVSLWLQALTEGESRAQLASLKLLQVGGARLSATLAARIPAEIGCQLQQVFGMAEGLVN
FT                   YTRLDDSAEKIIHTQGYPMCPDDEVWVADAEGNPLPQGEVGRLMTRGPYTFRGYYKSPQ
FT                   HNASAFDANGFYCSGDLISIDPEGYITVQGREKDQINRGGEKIAAEEIENLLLRHPAVI
FT                   YAALVSMEDELMGEKSCAYLVVKEPLRAVQVRRFLREQGIAEFKLPDRVECVDSLPLTA
FT                   VGKVDKKQLRQWLASRASA"
FT   CDS_pept        713726..714583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entB"
FT                   /locus_tag="ECO26_0670"
FT                   /product="isochorismatase EntB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI23999"
FT                   /protein_id="BAI23999.1"
FT                   /translation="MAIPKLQAYALPESHDIPKNKVDWAFEPQRAALLIHDMQDYFVSF
FT                   WGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGLTRSPE
FT                   QQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATD
FT                   AFMRDIKPFMVADALADFSRDEHLMSLKYVAGRSGRVVMTEELLPAPVPASKAALREVI
FT                   LPLLDESDEPFDDDNLIDYGLDSVRMMALAARWRKVHGDIDFVMLAKNPTIDAWWKLLS
FT                   REVK"
FT   CDS_pept        714583..715329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entA"
FT                   /locus_tag="ECO26_0671"
FT                   /product="2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
FT                   EntA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24000"
FT                   /protein_id="BAI24000.1"
FT                   /translation="MDFSGKNVWVTGAGKGIGYATALAFVEAGAKVTGFDQAFAQEQYP
FT                   FATEVMDVADAAQVAQVCQRLLAETERLDVLINAAGILRMGATDQLSKEDWQQTFAVNV
FT                   GGAFNLFQQTMNQFRRQRGGAIVTVASDAAHTPRIGMSAYGASKAALKSLALSVGLELA
FT                   GSGVRCNVVSPGSTDTDMQRTLWVSDDAEEQRIRGFGEQFKLGIPLGKIARPQEIANTI
FT                   LFLASDLASHITLQDIVVDGGSTLGA"
FT   CDS_pept        715332..715745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="entH"
FT                   /locus_tag="ECO26_0672"
FT                   /product="thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24001"
FT                   /protein_id="BAI24001.1"
FT                   /translation="MIWKRHLTLDELNATSDNTMVAHLGIVYTRLGDDVLEAEMPVDTR
FT                   THQPFGLLHGGASAALAETLGSMAGFMMTRDGQCVVGTELNATHHRPVSEGKVRGVCQP
FT                   LHLGRQNQSWEIVVFDEQGRRCCTCRLGTAVLG"
FT   CDS_pept        715926..718031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECO26_0673"
FT                   /product="carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24002"
FT                   /protein_id="BAI24002.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFSITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKDPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
FT   CDS_pept        718213..718410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /locus_tag="ECO26_0674"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24003"
FT                   /protein_id="BAI24003.1"
FT                   /translation="MFDSLAKAGKYLGQAAKLMIGMPDYDNYVEHMRVNHPDQTPMTYE
FT                   EFFRERQDARYGGKGGARCC"
FT   CDS_pept        complement(718420..719508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /locus_tag="ECO26_0675"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24004"
FT                   /protein_id="BAI24004.1"
FT                   /translation="MPHNPIRVVVGPANYFSHPGSFNHLHDFFTDEQLSRAVWIYGKRA
FT                   IAAAQTKLPPAFGLPGAKHILFRGHCSESDVQQLAAESGDDRSVVIGVGGGALLDTAKA
FT                   LARRLGLPFVAVPTIAATCAAWTPLSVWYNDAGQALHYEIFDDANFMVLVEPEIILNAP
FT                   QQYLLAGIGDTLAKWYEAVVLAPQPETLPLTVRLGINNAQAIRDVLLNSSEQALSDQQN
FT                   QQLTQSFCDVVDAIIAGGGMVGGLGDRFTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYG
FT                   ILVQSALLGQDDVLAQLTGAYQRFHLPTTLAELEVDINNHAEIDKVITHTLRPVESIHY
FT                   LPVTLTPDTLRAAFEKVESFKA"
FT   CDS_pept        719617..720777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /locus_tag="ECO26_0676"
FT                   /product="methionine aminotransferase, PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24005"
FT                   /protein_id="BAI24005.1"
FT                   /translation="MTNNPLIPQSKLPQLGTTIFTQMSALAQQHQAINLSQGFPDFDGP
FT                   RYLQERLAYHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEAL
FT                   YAAITALVRNGDEVICFDPSYDSYSPAIALSGGIVKRMALQPPHFRVDWQEFAALLSER
FT                   TRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHP
FT                   QLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADML
FT                   RAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSEVSTLDDVEFCQW
FT                   LTQEHGVAAIPLSVFCADPFPHKLIRLCFAKKESTLLAAAERLRQL"
FT   CDS_pept        complement(720778..721407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECO26_0677"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24006"
FT                   /protein_id="BAI24006.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLKKSIEIDGFTQPIVVTHTDKNALEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
FT   CDS_pept        complement(721380..722600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECO26_0678"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24007"
FT                   /protein_id="BAI24007.1"
FT                   /translation="MSIYKIPLPLNILEAARERITWTLNTLPRVCVSFSGGKDSGLMLH
FT                   LTAELARQMGKKICVLFIDWEAQFPCTINYVQSLRELYTDVIEEFYWVALPLTTQNSLS
FT                   QYQPEWQCWEPDVEWVRQPPQDAITDPDFFCFYQPGMTFEQFVREFAEWFSQKRPAAMM
FT                   IGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIWTWYANH
FT                   QNLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARVSGVKSG
FT                   GIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHWYQKKGI
FT                   EVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKAKNYQRYNERIKGKRQEW
FT                   GILCNND"
FT   CDS_pept        complement(722747..723649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /locus_tag="ECO26_0679"
FT                   /product="predicted DNA-binding transcriptional regulator,
FT                   LYSR-type"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24008"
FT                   /protein_id="BAI24008.1"
FT                   /translation="MANLYDLKKFDLNLLVIFECIYQHLSISKAAESLYITPSAVSQSL
FT                   QRLRAQFNDPLFIRSGKGIAPTTTGLNLHHHLEKNLKGLEQTINIVNKSELKKNFIIYG
FT                   PQLISCSNNSMLIRCLRQDASVEIECHDILMSAENAEELLVHRKADLVITQMPVISRSV
FT                   ICMPLHTIRNTLICSNKHPRITDNSTYEQIMAEEFTQLISKSAGVDDIQMEIDEKFMNR
FT                   KISFRGSSLLTIINSIAVTDLLGIVPYELYNSYRDFLNLKEIKLEHPLPSIKLYISYNK
FT                   SSLNNLVFSRFIDRLNESF"
FT   CDS_pept        complement(723858..724604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbG"
FT                   /locus_tag="ECO26_0680"
FT                   /product="periplasmic disulfide
FT                   isomerase/thiol-disulphideoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24009"
FT                   /protein_id="BAI24009.1"
FT                   /translation="MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMK
FT                   GYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQS
FT                   HWLLDGKKDAPVIVYVFADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATA
FT                   AAILASKDPAKTWQEYESSGGKLKLNVPANVSTEQMKVLSANEKLMDDLGANVTPAIYY
FT                   MSKENTLQQAVGLPDQKTLNIIMGNK"
FT   CDS_pept        724976..725539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="ECO26_0681"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24010"
FT                   /protein_id="BAI24010.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
FT   CDS_pept        725710..727275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="ECO26_0682"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit, FAD
FT                   /NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24011"
FT                   /protein_id="BAI24011.1"
FT                   /translation="MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAE
FT                   LSDKVTFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKE
FT                   AQSLLEQIRHIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEI
FT                   TDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGP
FT                   AGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYD
FT                   VDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTK
FT                   GVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDK
FT                   LRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWL
FT                   EGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIR
FT                   TKTA"
FT   CDS_pept        complement(727396..727824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspG"
FT                   /locus_tag="ECO26_0683"
FT                   /product="universal stress protein UP12"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24012"
FT                   /protein_id="BAI24012.1"
FT                   /translation="MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSAS
FT                   LSLHRFAADVRRFEEHLQHEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEEL
FT                   GADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR"
FT   CDS_pept        728045..729283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdR"
FT                   /locus_tag="ECO26_0684"
FT                   /product="predicted oxidoreductase, Zn-dependent and
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24013"
FT                   /protein_id="BAI24013.1"
FT                   /translation="MKALTYHGPHHVQVENVPDPGIEQADDIILRITATAICGSDLHLY
FT                   RGKIPQVKHGDIFGHEFMGEVVETGKDVKNLQKGDRVVIPFVIACGDCFFCRMQQYAAC
FT                   ENTNAGKGAALNKKQIPAPAALFSYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDD
FT                   KALFLSDILPTAWQAAKNAQIQQGSSVAVYGAGPVGLLTIACARLLGAEQIFVVDHHPY
FT                   RLRFAADRYGAIPINFDEDSDPAQSIIEQTAGHRGVDAVIDAVGFEAKGSTTETVLTNL
FT                   KLEGSSGKALRQCIAAVRRGGIVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWL
FT                   GELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVPGAQSAEAAQKA
FT                   VSGLVNAMPGGTI"
FT   CDS_pept        complement(729514..729924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECO26_0685"
FT                   /product="nucleoside diphosphate kinase regulator RnK"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24014"
FT                   /protein_id="BAI24014.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
FT   CDS_pept        complement(730154..730960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rna"
FT                   /locus_tag="ECO26_0686"
FT                   /product="ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24015"
FT                   /protein_id="BAI24015.1"
FT                   /translation="MKAFWRNAALLAVSLLPFSSANALALQAKQYGDFDRYVLALSWQT
FT                   GFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCA
FT                   TRPIPNLPEAHASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFD
FT                   PDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQG
FT                   NPAYLTEIQISIKADAINAPLSANSFLPQPHPGNCGKTFVIDKVGY"
FT   CDS_pept        complement(731074..732537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="ECO26_0687"
FT                   /product="citrate/succinate antiporter CitT"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24016"
FT                   /protein_id="BAI24016.1"
FT                   /translation="MSLAKDNIWKLLAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMI
FT                   VGMILEPIPATAISFIAVTICVIGSNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTV
FT                   WLVFGAFIFALGYEVSGLGRRIALFLVKFMGKRTLTLGYAIVIIDILLAPFTPSNTART
FT                   GGTVFPVIKNLPPLFKSFPNDPSARRIGGYLMWMMVISTSLSSSMFVTGAAPNVLGLEF
FT                   VSKIAGIQISWLQWFLCFLPVGVILLIIAPWLSYVLYKPEITHSEEVATWAGDELKTMG
FT                   ALTRREWTLIGLVLLSLGLWVFGSEVINATAVGLLAVSLMLALHVVPWKDITRYNSAWN
FT                   TLVNLATLVVMANGLTRSGFIDWFAGTMSTHLEGFSPNATVIVLVLVFYFAHYLFASLS
FT                   AHTATMLPVILAVGKGIPGVPMEQLCILLVLSIGIMGCLTPYATGPGVIIYGCGYVKSK
FT                   DYWRLGAIFGVIYISMLLLVGWPILAMWN"
FT   CDS_pept        complement(732588..733466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="ECO26_0688"
FT                   /product="triphosphoribosyl-dephospho-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24017"
FT                   /protein_id="BAI24017.1"
FT                   /translation="MSMPATSTKTTKLATSLIDEYALLGWRAMLTEVNLSPKPGLVDRI
FT                   NCGAHKDMALEDFHRSALAIQGWLPRFIEFGACSAEMAPEAVLHGLRPIGMACEGDMFR
FT                   ATAGVNTHKGSIFSLGLLCAAIGRLLQLNQPVTPTTVCSTAASFCRGLTDRELRTNNSQ
FT                   LTAGQRLYQQLGLTGARGEAEAGYPLVINHALPHYLTLLDQGLDPELALLDTLLLLMAI
FT                   NGDTNVASRGGEGGLRWLQREAQTLLQKGGIRTPADLDYLRQFDRECIERNLSPGGSAD
FT                   LLILTWFLAQI"
FT   CDS_pept        complement(733441..733992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citX"
FT                   /locus_tag="ECO26_0689"
FT                   /product="apo-citrate lyase phosphoribosyl-dephospho-CoA
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24018"
FT                   /protein_id="BAI24018.1"
FT                   /translation="MHLLPELASHHAVSIPELLVSRDERQARQHVWLKRHPVPLVSFTV
FT                   VAPGPIKDSEVTRRIFNHGVTALRALAAKQGWQIQEQAALVSASGPEGMLSIAAPARDL
FT                   KLATIELEHSHPLGRLWDIDVLTPEGEILSRRDYSLPPRRCLLCEQSAAVCARGKTHQL
FT                   TDLLNRMEALLNDVDACNVN"
FT   CDS_pept        complement(733996..735528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECO26_0690"
FT                   /product="citrate lyase citrate-ACP transferase subunit"
FT                   /note="alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24019"
FT                   /protein_id="BAI24019.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAMVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
FT   CDS_pept        complement(735539..736447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ECO26_0691"
FT                   /product="citrate lyase, citryl-ACP lyase subunit"
FT                   /note="beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24020"
FT                   /protein_id="BAI24020.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
FT   CDS_pept        complement(736444..736740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="ECO26_0692"
FT                   /product="citrate lyase acyl carrier subunit"
FT                   /note="gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24021"
FT                   /protein_id="BAI24021.1"
FT                   /translation="MKINQPAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGDAI
FT                   RTTILDVLARYNVRGVQLNVDDKGALDCILRARLEALLARASGIPALPWEDCQ"
FT   CDS_pept        complement(736755..737813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="ECO26_0693"
FT                   /product="citrate lyase synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24022"
FT                   /protein_id="BAI24022.1"
FT                   /translation="MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRD
FT                   EKLIACGGIAGNIIKCVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEAL
FT                   FRQCGFSTLTSVPGVMVLMENSATRLKRYAESLKKFRHPGNKIGCIVMNANPFTNGHRY
FT                   LIQQAAAQCDWLHLFLVKEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFP
FT                   CYFIKEQSVINHCYTEIDLKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLET
FT                   PTISAPPIELVEIERLRYQEMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHS
FT                   RQDAAARQKTPA"
FT   CDS_pept        738193..739851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="ECO26_0694"
FT                   /product="sensory histidine kinase CitA in two-component
FT                   regulatory system with CitB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24023"
FT                   /protein_id="BAI24023.1"
FT                   /translation="MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASF
FT                   EDYLTLHVRDMAMNQAKIIASNDSVISAVKTRDYKRLATIANKLQRDTDFDYVVIGDRH
FT                   SIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVV
FT                   SIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVR
FT                   QQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIAEVVRPADFFTE
FT                   QIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVE
FT                   SLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLL
FT                   FGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIV
FT                   ELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRC
FT                   GGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR"
FT   CDS_pept        739820..740500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB"
FT                   /locus_tag="ECO26_0695"
FT                   /product="DNA-binding response regulator CitB in
FT                   two-component regulatory system with CitA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24024"
FT                   /protein_id="BAI24024.1"
FT                   /translation="MTAPLTLLIVEDETPLAEMHAEYIRHIPGFSQILLAGNLAQARMM
FT                   IERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTAASDMETVSEAVRCGVFDY
FT                   LIKPIAYERLGQTLTRFRQRKHMLESIDSASQKQIDEMFNAYARGEPKDELPTGIDPLT
FT                   LNAVRKLFKEPGVQHTAETVAQALTISRTTARRYLEYCASRHLIIAEIVHGKVGRPQRI
FT                   YHSG"
FT   CDS_pept        complement(740541..741926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuC"
FT                   /locus_tag="ECO26_0696"
FT                   /product="anaerobic C4-dicarboxylate transport DcuC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24025"
FT                   /protein_id="BAI24025.1"
FT                   /translation="MLTFIELLIGVVVIVGVARYIIKGYSATGVLFVGGLLLLIISAIM
FT                   GHKVLPSSQASTGYSATDIVEYVKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVK
FT                   LASKPLQYINSPYLLMIAAYFVACLMSLAVSSATGLGVLLMATLFPVMVNVGISRGAAA
FT                   AICASPAAIILAPTSGDVVLAAQASEMSLIDFAFKTTLPISIAAIIGMAIAHFFWQRYL
FT                   DKKEHISHEMLDVSEITTTAPAFYAILPFTPIIGVLIFDGKWGPQLHIITILVICMLIA
FT                   SILEFLRSFNTQKVFSGLEVAYRGMADAFANVVMLLVAAGVFAQGLSTIGFIQSLISIA
FT                   TSFGSASIILMLVLVILTMLAAVTTGSGNAPFYAFVEMIPKLAHSSGINPAYLTIPMLQ
FT                   ASNLGRTLSPVSGVVVAVAGMAKISPFEVVKRTSVPVLVGLVIVIVATELMVPGTAAAV
FT                   TGK"
FT   CDS_pept        742515..743075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcA"
FT                   /locus_tag="ECO26_0697"
FT                   /product="palmitoyl transferase CrcA for Lipid A"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24026"
FT                   /protein_id="BAI24026.1"
FT                   /translation="MNVSKYVAIFSFVFIQLISVGKVFANADEWMTTFRENIAQTWQQP
FT                   EHYDLYIPAITWHARFAYDKEKTDRYNERPWGGGFGLSRWDEKGNWHGLYAMAFKDSWN
FT                   KWEPIAGYGWESTWRPLADENFHLGLGFTAGVTARDNWNYIPLPVLLPLASVGYGPVTF
FT                   QMTYIPGTYNNGNVYFAWMRFQF"
FT   CDS_pept        743250..743459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspE"
FT                   /locus_tag="ECO26_0698"
FT                   /product="DNA-binding transcriptional repressor CspE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24027"
FT                   /protein_id="BAI24027.1"
FT                   /translation="MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLA
FT                   EGQRVEFEITNGAKGPSAANVIAL"
FT   CDS_pept        complement(743514..743897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ECO26_0699"
FT                   /product="predicted inner membrane protein"
FT                   /note="associated with chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24028"
FT                   /protein_id="BAI24028.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGA
FT                   FIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
FT   CDS_pept        743990..744778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeM"
FT                   /locus_tag="ECO26_0700"
FT                   /product="predicted amidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24029"
FT                   /protein_id="BAI24029.1"
FT                   /translation="MLVAAGQFAVTSVWEKNAEICASLMAQAAENDVSLFVLPEALLAR
FT                   DDHDADLSVKSAQLLEGEFLGRLRRESKRNMMTTILTIHVPSTPGRAWNMLVALQAGNI
FT                   VARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFPELALAQALQG
FT                   AEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGECGNKNIGQSRIIDPFGVTI
FT                   AAASEMPALIMAEVTPERVRQVRAQLPVLNNRRFAPPQLL"
FT   CDS_pept        744907..745110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatE"
FT                   /locus_tag="ECO26_0701"
FT                   /product="TatABCE protein translocation system subunit
FT                   TatE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24030"
FT                   /protein_id="BAI24030.1"
FT                   /translation="MGEISITKLLVVAALVVLLFGTKKLRTLGGDLGAAIKGFKKAMND
FT                   DDAAAKKGADVDLQAEKLSHKE"
FT   CDS_pept        complement(745211..746176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="ECO26_0702"
FT                   /product="lipoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24031"
FT                   /protein_id="BAI24031.1"
FT                   /translation="MSKPIVMERGVKYRDADKMALIPVKNVATEREALLRKPEWMKIKL
FT                   PADSTRIQGIKAAMRKNGLHSVCEEASCPNLAECFNHGTATFMILGAICTRRCPFCDVA
FT                   HGRPVAPDANEPVKLAQTIADMALRYVVITSVDRDDLRDGGAQHFADCITAIREKSPQI
FT                   KIETLVPDFRGRMDRALDILTATPPDVFNHNLENVPRIYRQVRPGADYNWSLKLLERFK
FT                   EAHPEIPTKSGLMVGLGETNEEIIEVMRDLRRHGVTMLTLGQYLQPSRHHLPVQRYVSP
FT                   DEFDEMKAEALAMGFTHAACGPFVRSSYHADLQAKGMEVK"
FT   CDS_pept        complement(746385..747338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /locus_tag="ECO26_0703"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24032"
FT                   /protein_id="BAI24032.1"
FT                   /translation="MDSNNQIEPCLSRKSSEGKPQIFTTLRNIDLNLLTIFEAVYVHKG
FT                   IVNAAKVLNLTPSAISQSIQKLRVIFPDPLFIRKGQGVTPTAFAMHLHEYISQGLESIL
FT                   GALDIEGSYDKQRTITIATTPSVGALVLPVIYRAIKTHYPQLLLRNPPISDAENQLSQF
FT                   QTDLIIDNMFCTNRTVQHHVLFTDNMVLICREGNPLLSLEDDRETIDNAAHVLLLPEEQ
FT                   NFSGLRQRVQEMFPDRQINFTSYNILTIAALVANSDMLAIIPSRFYNLFSRCWPLEKLP
FT                   FPSLNEEQIDFSIHYNKFSLRDPILHGVIDVIRNAF"
FT   CDS_pept        complement(747597..748238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="ECO26_0704"
FT                   /product="lipoyl-protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24033"
FT                   /protein_id="BAI24033.1"
FT                   /translation="MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYP
FT                   VFTQGQAGKAEHILMPGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTL
FT                   LEQTVVNTLAELGIEAHPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPF
FT                   LRINPCGYAGMEMAKISQWKPEATTNNIAPRLLENILALLNNPDFEYITA"
FT   CDS_pept        complement(748339..748602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /locus_tag="ECO26_0705"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24034"
FT                   /protein_id="BAI24034.1"
FT                   /translation="MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTP
FT                   TVKPSSKGNYHSVSITINATHIEQVETLYEELGKIDIVRMVL"
FT   CDS_pept        complement(748713..749924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="ECO26_0706"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="penicillin-binding protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24035"
FT                   /protein_id="BAI24035.1"
FT                   /translation="MNTIFSARIMKRLALTTALCTAFISAAHADDLNIKTMIPGVPQID
FT                   AESYILIDYNSGKVLAEQNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGNDA
FT                   WATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMN
FT                   SYVNALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEKEFTFNGI
FT                   RQLNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFKGREAES
FT                   KKLLTWGFRFFETVNPLKVGKEFASEPVWFGDSDRASLGVDKDVYLTIPRGRMKDLKAS
FT                   YVLNSSELHAPLQKNQVVGTINFQLDGKTIEQRPLVVLQEIPEGNFFGKIIDYIKLMFH
FT                   HWFG"
FT   CDS_pept        complement(750064..751152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="ECO26_0707"
FT                   /product="minor lipoprotein RlpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24036"
FT                   /protein_id="BAI24036.1"
FT                   /translation="MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISG
FT                   ADPRFEPLNATANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPT
FT                   QLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTK
FT                   VRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAGASSVSGPQGDILPVSNS
FT                   TLKSEDPTGAPVTSSGFLGAPTTLAPGVLESSEPTPAPQPVVTAPSTTPATSPAMVTPQ
FT                   AASQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAE
FT                   ASTLQQRLQTEAQLQSFITTAQ"
FT   CDS_pept        complement(751163..752275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="ECO26_0708"
FT                   /product="cell wall shape-determining protein MrdB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24037"
FT                   /protein_id="BAI24037.1"
FT                   /translation="MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
FT   CDS_pept        complement(752278..754179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdA"
FT                   /locus_tag="ECO26_0709"
FT                   /product="transpeptidase MrdA"
FT                   /note="involved in peptidoglycan synthesis
FT                   (penicillin-binding protein 2)"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24038"
FT                   /protein_id="BAI24038.1"
FT                   /translation="MKLQNSFRDYTAESALFVRRALVAFLGILLLTGVLIANLYNLQIV
FT                   RFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIEMMPEKVDNVQQTLDA
FT                   LRSVVDLTDDDIAAFRKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKR
FT                   RYYPYGSALTHVIGYVSKINDKDVERLNNDGKLANYAATHDIGKLGIERYYEDVLHGQT
FT                   GYEEVEVNNRGRVIRQLKEVPPQAGHDIYLTLDLKLQQYIETLLAGSRAAVVVTDPRTG
FT                   GVLALVSTPSYDPNLFVDGISSKDYSALLNDPNTPLVNRATQGVYPPASTVKPYVAVSA
FT                   LSAGVITRNTTLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTRSLEESADTFFYQVAYDM
FT                   GIDRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYW
FT                   TATPIQMSKALMILINDGIVKVPHLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWELAKD
FT                   GMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNAHKIAERLRDHKLMTA
FT                   FAPYNNPQVAVAMILENGGAGPAVGTLMRQILDHIMLGDNNTDLPAENPAVAAAEDH"
FT   CDS_pept        complement(754210..754677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeA"
FT                   /locus_tag="ECO26_0710"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24039"
FT                   /protein_id="BAI24039.1"
FT                   /translation="MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGG
FT                   PEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYHRE"
FT   CDS_pept        complement(754681..754998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /locus_tag="ECO26_0711"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24040"
FT                   /protein_id="BAI24040.1"
FT                   /translation="MQGKALQDFVIDKIDDLKGQDIIALDVQGKSSITDCMIICTGTSS
FT                   RHVMSIADHVVQESRAAGLLPLGVEGENSADWIVVDLGDVIVHVMQEESRRLYELEKLW
FT                   S"
FT   CDS_pept        complement(755258..755869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobC"
FT                   /locus_tag="ECO26_0712"
FT                   /product="predicted alpha-ribazole-5'-P phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24041"
FT                   /protein_id="BAI24041.1"
FT                   /translation="MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLDDV
FT                   SFDLVLCSELERAQHTARRVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYS
FT                   AWCNDWQHAIPTNGEGFQAFSQRVERFIARLSEYQHYQNILIVSHQGVLSLLIARLIGM
FT                   PAESMWHFRVDQGCWSAIDINQKFATLRVLNSRAIGVENA"
FT   CDS_pept        complement(755893..756534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="ECO26_0713"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase, NAD(P)-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24042"
FT                   /protein_id="BAI24042.1"
FT                   /translation="MKSLQALFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPH
FT                   RPQPEANSVQRKHMLELAIADKPLFTLDERELKRNAPSYTAQTLKEWRQEQGPDVPLAF
FT                   IIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPLEMAQPQYQQWLEDHLTHNPEDLHL
FT                   QPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR"
FT   CDS_pept        complement(756536..757567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="ECO26_0714"
FT                   /product="DNA polymerase III, delta subunit HolA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24043"
FT                   /protein_id="BAI24043.1"
FT                   /translation="MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQ
FT                   GFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLL
FT                   HDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELD
FT                   DAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALL
FT                   MGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQN
FT                   RRGMMGEALNRLSQTQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVF
FT                   IDG"
FT   CDS_pept        complement(757567..758148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpB"
FT                   /locus_tag="ECO26_0715"
FT                   /product="minor lipoprotein RlpB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24044"
FT                   /protein_id="BAI24044.1"
FT                   /translation="MRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNG
FT                   PLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTV
FT                   NATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIR
FT                   AADIRSDEEQTSTTTDTPATPARVSTTLGN"
FT   CDS_pept        complement(758163..760745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="ECO26_0716"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24045"
FT                   /protein_id="BAI24045.1"
FT                   /translation="MQEQYRPEEIESKVQLHWDEKRTFEVTEDESKEKYYCLSMLPYPS
FT                   GRLHMGHVRNYTIGDVIARYQRMLGKNVLQPIGWDAFGLPAEGAAVKNNTAPAPWTYDN
FT                   IAYMKNQLKMLGFGYDWSRELATCTPEYYRWEQKFFTELYKKGLVYKKTSAVNWCPNDQ
FT                   TVLANEQVIDGCCWRCDTKVERKEIPQWFIKITAYADELLNDLDKLDHWPDTVKTMQRN
FT                   WIGRSEGVEITFNVNDYDNTLTVYTTRPDTFMGCTYLAVAAGHPLAQKAAENNPELAAF
FT                   IDECRNTKVAEAEMATMEKKGVDTGFKAVHPLTGEEIPVWAANFVLMEYGTGAVMAVPG
FT                   HDQRDYEFASKYGLNIKPVILAADGSEPDLSQQALTEKGVLFNSGEFNGLDHEAAFNAI
FT                   ADKLTAMGVGERKVNYRLRDWGVSRQRYWGAPIPMVTLEDGTVMPTPDDQLPVILPEDV
FT                   VMDGITSPIKADPEWAKTTVNGMPALRETDTFDTFMESSWYYARYTCPEYKEGMLDSEA
FT                   ANYWLPVDIYIGGIEHAIMHLLYFRFFHKLMRDAGMVNSDEPAKQLLCQGMVLADAFYY
FT                   VGENGERNWVSPVDAIVERDEKGRIVKAKDAAGHELVYTGMSKMSKSKNNGIDPQVMVE
FT                   RYGADTVRLFMMFASPADMTLEWQESGVEGANRFLKRVWKLVYEHTAKGDVAALNVDAL
FT                   TEDQKALRRDVHKTIAKVTDDIGRRQTFNTAIAAIMELMNKLAKAPTDGEQDRALMQEA
FT                   LLAVVRMLNPFTPHICFTLWQELKGEGDIDNAPWPVADEKAMVEDSTLVVVQVNGKVRA
FT                   KITVPVDATEEQVRERAGQEHLVAKYLDGVTVRKVIYVPGKLLNLVVG"
FT   CDS_pept        760980..761462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeL"
FT                   /locus_tag="ECO26_0717"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24046"
FT                   /protein_id="BAI24046.1"
FT                   /translation="MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTR
FT                   TEVDELTRAVRRDLEEFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREV
FT                   FQDLNHHGVYHSGEVVGLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP"
FT   CDS_pept        complement(761532..762509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeQ"
FT                   /locus_tag="ECO26_0718"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24047"
FT                   /protein_id="BAI24047.1"
FT                   /translation="MIFTSSCCDNLSIDEIIERAEKGDCEAQYIVGFYYNRDSAIDSPD
FT                   DEKAFYWLKLAAEQGHCEAQYSLGQKYTEDKSRHKDNEQAIFWLKKAALQGHTFASNAL
FT                   GWTLDRGEAPNYKEAVVWYQIAAESGMSYAQNNLGWMYRNGNGVAKDYALAFFWYKQAA
FT                   LQGHSDAQNNLADLYEDGKGVAQNKTLAAFWYLKSAQQGNRHAQFQIAWDYNAGEGVDQ
FT                   DYKQAMYWYLKAAAQESVGAYVNIGYMYKHGQGVEKDYQAAFEWFTKAAECNDATAWYN
FT                   LAIMYHYGEGRPVDLRQALDLYRKVQSSGTRDVSQEIRETEDLL"
FT   CDS_pept        762673..763380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECO26_0719"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24048"
FT                   /protein_id="BAI24048.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDARDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYRNWRQYFA
FT                   GYTFGRQYWQSPEDDHLQLLREFLARKEYDDSGNDMFYQLFASDDAYYPTLSWQPLAYY
FT                   SACPETLKDMSDL"
FT   CDS_pept        763377..763877
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0720"
FT                   /note="predicted DnaJ family chaperone DjlB, N-terminal
FT                   part"
FT   CDS_pept        763849..764805
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0721"
FT                   /note="predicted DnaJ family chaperone DjlB, C-terminal
FT                   part"
FT   CDS_pept        complement(764815..765369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeT"
FT                   /locus_tag="ECO26_0722"
FT                   /product="conserved predicted outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24049"
FT                   /protein_id="BAI24049.1"
FT                   /translation="MNKKLMYIFAIFIVAAITCISHPKKTTLRDKAMVNYAFDYLSSPG
FT                   SLPFTTAATELSAIHGHSTSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQENPRAQS
FT                   KLGWIYLKGLGVKPDTRKAILWYKEAAEQGYAHAQYTLGLIYRNGSGINVNHYESQKWL
FT                   KLAAKQHYKNAERLLAGLPAH"
FT   CDS_pept        765470..766177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeU"
FT                   /locus_tag="ECO26_0723"
FT                   /product="predicted tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24050"
FT                   /protein_id="BAI24050.1"
FT                   /translation="MNKEEQYLLFALSAPMEILNQGCKPAHDSPKMYTGIKEFDLSSSW
FT                   GINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQ
FT                   TAMCCGEGGIKAWDYVRMGFLSRVGVLNNWLTEEESLWLQSCVYVRAHHYYHSWMHYFS
FT                   AYSLGRLYWQSSQCEDNTSLREALTLYKYDSAGSRMFEELAAGSDRFYATLPWQPLTVQ
FT                   PECPVTLKDVSDL"
FT   CDS_pept        766174..767625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeV"
FT                   /locus_tag="ECO26_0724"
FT                   /product="Hsc56 co-chaperone of HscC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24051"
FT                   /protein_id="BAI24051.1"
FT                   /translation="MKTCWQILEIESTTQIDIIRQAYLARLPLCHPETDPQGFKALRQA
FT                   YEEALRLAVNPVEEADDEEKDAAAEHEILRAFRTLLDSESDRFQPSAWQKFIQQLNTWN
FT                   MEDVDQLRWPLCAIAIEARYLSLNCASLLAERLNWHSFNDSEGMDEEEREAFLEAIQAG
FT                   DCFDFLSLLEYPVALQNQTVEYYFALERCCRYHPDYVTAFLAMEGPWFIPDDAKLHRKL
FT                   LRWYSSVQTGMAELIPVAKQWQMEEPESEDARYYLCAQRLYCGEGESLLADLCAYRESY
FT                   PSTQADNLLLQWSKRHCPDYFALLVMVIEARSMVDAQGQPLKYVPGESARTRLLWAEIL
FT                   HSGKLSPLGQSFIESLFFKRKAWAWWKSRVGSETEEDSPLLDLYRVAEQVVLEAFPKQE
FT                   MLARLNTRLEGGDAHPLEAIITRMLLTKVKLEPEDEDVDEPTPENHEEKNDEGEKPQSI
FT                   TSIIKISLTVLVIGYALGKIAMLFS"
FT   CDS_pept        complement(767685..769355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscC"
FT                   /locus_tag="ECO26_0725"
FT                   /product="Hsp70 family chaperone Hsc62"
FT                   /note="binds to RpoD and inhibits transcription"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0725"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24052"
FT                   /protein_id="BAI24052.1"
FT                   /translation="MDNAELAIGIDLGTTNSLIAVWKDGAAQLIPNKFGEYLTPSIISM
FT                   DENNHILVGKPAVSRRTSHPDKTAALFKRAMGSNTNWRLGSDTFNAPELSSLVLRSLKE
FT                   DAEEFLQRPIKDVVISVPAYFSDEQRKHTRLAAELAGLNAVRLINEPTAAAMAYGLHTQ
FT                   QNTRSLVFDLGGGTFDVTVLEYATPVIEVHASAGDNFLGGEDFTHMLVDEVLKRADVAR
FT                   TTLNESELGALYACVEAAKCSNQSPLHIRWQYQDETRECEFYENELEDLWLPLLNRLRV
FT                   PIEQALRDARLKPSQIDSLVLVGGASQMPLVQRIAVRLFGKLPYQSYDPSTIVALGAAI
FT                   QAACRLRSEDIEEVILTDICPYSLGVEVNRQGVSGIFSPIIERNTTVPVSRVETYSTMH
FT                   PEQNSITVNVYQGENHKVKNNILVESFDVPLKKTGAYQSIDIRFSYDINGLLEVDVLLE
FT                   DGSVKSRVINHSPVTLSAQQIEESRTRLSALKIYPRDMLINRTFKAKLEELWARALGDE
FT                   REEIGRVITDFDAALQSNDMARVDEVRRRASVYLAIETS"
FT   CDS_pept        complement(769439..770374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rihA"
FT                   /locus_tag="ECO26_0726"
FT                   /product="ribonucleoside hydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0726"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24053"
FT                   /protein_id="BAI24053.1"
FT                   /translation="MALPILLDCDPGHDDAIAIVLALASPELDVKAITSSAGNQTPEKT
FT                   LRNVLRMLTLLNRTDIPVAGGAVKPLMRELIIADNVHGESGLDGPALPEPTFAPQNCTA
FT                   VELMAKTLRESAEPVTIVSTGPQTNVALLLNSHPELHSKIARIVIMGGAMGLGNWTPAA
FT                   EFNIYVDPEAAEIVFQSGIPVVMAGLDVTHKAQIHVEDTERFRAIGNPVSTIVAELLDF
FT                   FLEYHKDEKWGFVGAPLHDPCTIAWLLKPELFTTVERWVGVETQGKYSQGMTVVDYYYL
FT                   TGNKPNATVMVDVDRQGFVDLLADRLKFYA"
FT   CDS_pept        complement(770492..771217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL"
FT                   /locus_tag="ECO26_0727"
FT                   /product="ATP-binding protein GltL of glutamate/aspartate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0727"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24054"
FT                   /protein_id="BAI24054.1"
FT                   /translation="MITLKNVSKWYGHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIK
FT                   TVNGLEPVQQGEITVDGIVVNDKKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVK
FT                   VLKRDKAPAREKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEP
FT                   TSALDPEMINEVLDVMVELANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDA
FT                   FFDDPKSDRAKDFLAKILH"
FT   CDS_pept        complement(771217..771891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="ECO26_0728"
FT                   /product="glutamate/aspartate transport system permease
FT                   GltK"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0728"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24055"
FT                   /protein_id="BAI24055.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
FT   CDS_pept        complement(771891..772631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ"
FT                   /locus_tag="ECO26_0729"
FT                   /product="glutamate/aspartate transport system permease
FT                   GltJ"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0729"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24056"
FT                   /protein_id="BAI24056.1"
FT                   /translation="MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFL
FT                   VGSFFGILRTVPNRFLSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAEL
FT                   DPNIQFFLSSMLCLGLFTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPN
FT                   AYRVIVPPMTSEMMNLVKNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLI
FT                   NAVIMLVMTLVERKVRLPGNMGGK"
FT   ncRNA           complement(772643..772805)
FT                   /gene="sroC"
FT                   /locus_tag="ECO26_ncRNA05"
FT                   /note="sRNA, function unknown, identified by Rfam"
FT                   /inference="nucleotide motif:Rfam:RF00369"
FT                   /ncRNA_class="other"
FT   CDS_pept        complement(772801..773709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltI"
FT                   /locus_tag="ECO26_0730"
FT                   /product="periplasmic-binding component GltI"
FT                   /note="ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24057"
FT                   /protein_id="BAI24057.1"
FT                   /translation="MQLRKPATAILALALSAGLAQADDAAPVAGSTLDKIAKNGVIVVG
FT                   HRESSVPFSYYDNQQKVVGYSQDYSNAIVEAVKKKLNKPDLQVKLIPITSQNRIPLLQN
FT                   GTFDFECGSTTNNVERQKQAAFSDTIFVVGTRLLTKKGGDIKDFADLKGKAVVVTSGTT
FT                   SEVLLNKLNEEQKMNMRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDNW
FT                   DIVGKPQSQEAYGCMLRKDDPQFKKLMDDTIAQVQTSGEAEKWFDKWFKNPIPPKNLNM
FT                   NFELSDEMKALFKEPNDKALN"
FT   CDS_pept        774164..776041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0731"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0731"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24058"
FT                   /protein_id="BAI24058.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCIGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVAPLTLSGEPWRLLSSIFLHSSVSHLLMNMFAFLVVGGVAEQILGKWRLLITW
FT                   LFSGVFGGLISACYALRESEQIVISVGASGAILGIAGAAIATQFASGTGTYHKNQRRVF
FT                   PLLGMVALTLLYGARQTGIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSL
FT                   LLTGAIWLAQQQMDESVLQVRQSLREAFYPQEIEQERRQKKQQLAEERNALRETLSAPV
FT                   SREQASGDLLAEIADIHDMAISRDGNTLYAAIENTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSLALSPDEKLIYATSFEANALSVINVATGEIIQSITTGAHPDSF
FT                   ILSRDGTKAWVMNRTSNSVSAIDLVTYQHVADIPLEKYDGTGTSGKPGAWVMALSPDER
FT                   TLLVPGAGRGNIVRINTITHQKEDFPAGDARGTISAMRFRPENGEVIFADSQGISRISV
FT                   GDQQASIMTQWCSRSVYSVEGISPDGQYLALVSYGLQGYVILLNINAGQIIGVYPASYV
FT                   NHLRFSADGRKIFVMAKNGLIQMDRTRSLDPQAIIRHPQYGNVACIPEP"
FT   CDS_pept        complement(776119..777657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="ECO26_0732"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0732"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24059"
FT                   /protein_id="BAI24059.1"
FT                   /translation="MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIVSLMGLQ
FT                   ALTFNRRPLQSAAIGFCWGFGLFGTGINWVYVSIATFGGMPGPVNIFLVVLLAAYLSLY
FT                   TGLFAGVLSRLWPKTTWLRVAIAAPALWQVTEFLRGWVLTGFPWLQFGYSQIDGPLKGL
FT                   APIMGVEAINFLLMMVSGLLALALVKRNWRPLVVAVVLFALPFPLRYIQWFTPQPEKTI
FT                   QVSMVQGDIPQSLKWDGDQLLNTLKIYYNATAPLLGKSSLIIWPESAITDLEINQQPFL
FT                   KALDGELRDKGSSLVTGIVDARLNKQNRYDTYNTIITLGKGAPYSYESADRYNKNHLVP
FT                   FGEFVPLESILRPLAPFFDLPMSSFSRGPYIQPPLSVNGIELTAAICYEIILGEQVRDN
FT                   FRPDTDYLLTISNDAWFGKSIGPWQHFQMARMRALELARPLLRSTNNGITAVIGPQGEI
FT                   QAMIPQFTREVLTTNVTPTTGLTPYARTGNWPLWVLTALFGFAAVLMSLRARKR"
FT   CDS_pept        complement(777682..778560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeX"
FT                   /locus_tag="ECO26_0733"
FT                   /product="predicted ion transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0733"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24060"
FT                   /protein_id="BAI24060.1"
FT                   /translation="MSDDNSHSSDTISNKKGFFSLLLSQLFHGEPKNRDELLALIRDSG
FT                   QNDLIDEDTRDMLEGVMDIADQRVRDIMIPRSQMITLKRNQTLDECLDVIIESAHSRFP
FT                   VISEDKDHIEGILMAKDLLPFMRSDAEAFSMDKVLRQAVVVPESKRVDRMLKEFRSQRY
FT                   HMAIVIDEFGGVSGLVTIEDILELIVGEIEDEYDEEDDIDFRQLSRHTWTVRALASIED
FT                   FNEAFGTHFSDEEVDTIGGLVMQAFGHLPARGETIDIDGYQFKVAMADSRRIIQVHVKI
FT                   PDDSPQPKLDE"
FT   CDS_pept        complement(778650..779117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeY"
FT                   /locus_tag="ECO26_0734"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0734"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24061"
FT                   /protein_id="BAI24061.1"
FT                   /translation="MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRV
FT                   VDTAESHSLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLVICRQVVEKEAQEQGKPL
FT                   EAHWAHMVVHGSLHLLGYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE"
FT   CDS_pept        complement(779114..780193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeZ"
FT                   /locus_tag="ECO26_0735"
FT                   /product="conserved hypothetical protein"
FT                   /note="contains nucleoside triphosphate hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0735"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24062"
FT                   /protein_id="BAI24062.1"
FT                   /translation="MFSFRRHTDKRNGLNIDTREITLEPADNARLLSLCGPFDDNIKQL
FT                   ERRLGIEINRRDNHFKLTGRPICVTAAADILRSLYVDTAPMRGQIQDIEPEQIHLAIKE
FT                   ARVLEQSAESVPEYGKAVNIKTKRGVIKPRTPNQAQYIANILDHDITFGVGPAGTGKTY
FT                   LAVAAAVDALERQEIRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGF
FT                   EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSKAVIT
FT                   GDVTQIDLPRNTKSGLRHAIEVLADVEEISFNFFHSEDVVRHPVVARIVNAYEAWEEAE
FT                   QKRKAALAAERKREEQEQK"
FT   CDS_pept        complement(780307..781731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="ECO26_0736"
FT                   /product="isopentenyl-adenosine A37 tRNA methylthiolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0736"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24063"
FT                   /protein_id="BAI24063.1"
FT                   /translation="MTKKLHIKTWGCQMNEYDSSKMADLLDATHGYQLTDVAEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKLLKEKNPDLIIGVGGCVASQEGEHIRQRAHYVDIIFG
FT                   PQTLHRLPEMINSVRGDRSPVVDISFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTY
FT                   CVVPYTRGEEVSRPSDDILFEIAQLAAQGVREVNLLGQNVNAWRGENYDGTTGSFADLL
FT                   RLVAAIDGIDRIRFTTSHPIEFTDDIIEVYRDTPELVSFLHLPVQSGSDRILNLMGRTH
FT                   TALEYKAIIRKLRAARPDIQISSDFIVGFPGETTEDFEKTMKLIADVNFDMSYSFIFSA
FT                   RPGTPAADMVDDVPEEEKKQRLYILQERINQQAMAWSRRMLGTTQRILVEGTSRKSIME
FT                   LSGRTENNRVVNFEGTPDMIGKFVDVEITDVYPNSLRGKVVRTEDEMGLRVAETPESVI
FT                   ARTRKENDLGVGYYQP"
FT   CDS_pept        781877..783052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="ECO26_0737"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinoloxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0737"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24064"
FT                   /protein_id="BAI24064.1"
FT                   /translation="MTNQPTEIAIVGGGMVGGALALGLAQHGFSVTVIEHAEPAPFVAD
FT                   SQPDVRISAISAASVSLLKGLGVWDAVQAMRCHPYRRLETWEWETAHVMFDAAELKLPL
FT                   LGYMVENTVLQQALWQALEAHPKVTLRVPGSLIALHRDNDLQELELKGGEVIRAKLVIG
FT                   ADGANSQVRQMAGIGVHAWQYAQSCMLISVQCENDPGDSTWQQFTPDGPRAFLPLFDNW
FT                   ASLVWYDSPVRIRQLQNMNMAQLQAEIAKHFPSRLGYVTPLAAGAFPLTRRHALQYVQP
FT                   GLALVGDAAHTIHPLAGQGGNLGYRDVDALIDVLVNARSYGEAWASYPVLKRYQMRRMA
FT                   DNFIMQSGMDLFYAGFSNNLPPLRFVRNLGLMAAERAGVLKRQALKYALGL"
FT   tRNA            complement(783206..783280)
FT                   /gene="glnX"
FT                   /locus_tag="ECO26_tRNA007"
FT                   /product="tRNA-Gln (CUG)"
FT   tRNA            complement(783318..783392)
FT                   /gene="glnV"
FT                   /locus_tag="ECO26_tRNA008"
FT                   /product="tRNA-Gln (CUG)"
FT   tRNA            complement(783441..783517)
FT                   /gene="metU"
FT                   /locus_tag="ECO26_tRNA009"
FT                   /product="tRNA-Met (CAU)"
FT   tRNA            complement(783533..783607)
FT                   /gene="glnW"
FT                   /locus_tag="ECO26_tRNA010"
FT                   /product="tRNA-Gln (UUG)"
FT   tRNA            complement(783642..783716)
FT                   /gene="glnU"
FT                   /locus_tag="ECO26_tRNA011"
FT                   /product="tRNA-Gln (UUG)"
FT   tRNA            complement(783740..783824)
FT                   /gene="leuW"
FT                   /locus_tag="ECO26_tRNA012"
FT                   /product="tRNA-Leu (UAG)"
FT   tRNA            complement(783833..783909)
FT                   /gene="metL"
FT                   /locus_tag="ECO26_tRNA013"
FT                   /product="tRNA-Met (CAU)"
FT   CDS_pept        complement(784290..785954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="ECO26_0738"
FT                   /product="asparagine synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0738"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24065"
FT                   /protein_id="BAI24065.1"
FT                   /translation="MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAI
FT                   LAHERLSIVDVNAGAQPLYNQQKTHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVIL
FT                   ALYQEKGPEFLDDLQGMFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMK
FT                   ALVPVCRTIKEFPAGSYLWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKS
FT                   HLMSDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGLPGSPDL
FT                   KAAQEVANHLGTVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAM
FT                   GIKMVLSGEGSDEVFGGYLYFHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVE
FT                   ARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVG
FT                   YSWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPG
FT                   GPSVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK"
FT   CDS_pept        complement(786211..786963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagD"
FT                   /locus_tag="ECO26_0739"
FT                   /product="UMP phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0739"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24066"
FT                   /protein_id="BAI24066.1"
FT                   /translation="MTIKNVICDIDGVLMHDNVAVPGAAEFLHGIMDKGLPLVLLTNYP
FT                   SQTGQDLANRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVVGEGALIHELYKAGF
FT                   TITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNPDTHGRGFYPACGALCAGI
FT                   EKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDNLRTDILAGFQAGLETILVLS
FT                   GVSSLDDIDSMPFRPSWIYPSVAEIDVI"
FT   CDS_pept        complement(787011..788231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagC"
FT                   /locus_tag="ECO26_0740"
FT                   /product="DNA-binding transcriptional dual regulator NagC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24067"
FT                   /protein_id="BAI24067.1"
FT                   /translation="MTPGGQAQIGNVDLVKQLNSAAVYRLIDQYGPISRIQIAEQSQLA
FT                   PASVTKITRQLIERGLIKEVDQQASTGGRRAISIVTETRNFHAIGVRLGRHDATITLFD
FT                   LSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSG
FT                   KIHYMPHIQVENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHR
FT                   GTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNL
FT                   LKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVI
FT                   AGEITEADKVLLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKRAMLNGIL
FT                   LQHLLEN"
FT   CDS_pept        complement(788240..789388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="ECO26_0741"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0741"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24068"
FT                   /protein_id="BAI24068.1"
FT                   /translation="MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRS
FT                   LNGAILSPGFIDVQLNGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSD
FT                   ELMKQGVRVMREYLAKHPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENA
FT                   DVITKVTLAPEMVPAEVISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMP
FT                   YITGREPGLAGAILDEADIYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGAN
FT                   IEQFIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPA
FT                   RAIGVEKRLGTLAAGKVANLTAFTPDFKITKTIVNGNEVVTQ"
FT   CDS_pept        complement(789448..790248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="ECO26_0742"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0742"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24069"
FT                   /protein_id="BAI24069.1"
FT                   /translation="MRLIPLTTAEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTP
FT                   MTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENI
FT                   NLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLT
FT                   HDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNH
FT                   MWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL"
FT   CDS_pept        790581..792527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagE"
FT                   /locus_tag="ECO26_0743"
FT                   /product="fused N-acetyl glucosamine specific PTS enzyme:
FT                   IIC, IIB, and IIA components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0743"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24070"
FT                   /protein_id="BAI24070.1"
FT                   /translation="MNILGFFQRLGRALQLPIAVLPVAALLLRFGQPDLLNVAFIAQAG
FT                   GAIFDNLALIFAIGVASSWSKDSAGAAALAGAVGYFVLTKAMVTINPEINMGVLAGIIT
FT                   GLVGGAAYNRWSDIKLPDFLSFFGGKRFVPIATGFFCLVLAAIFGYVWPPVQHAIHAGG
FT                   EWIVSAGALGSGIFGFINRLLIPTGLHQVLNTIAWFQIGEFTNAAGTVFHGDINRFYAG
FT                   DGTAGMFMSGFFPIMMFGLPGAALAMYFAAPKERRPMVGGMLLSVAVTAFLTGVTEPLE
FT                   FLFMFLAPLLYLLHALLTGISLFVATLLGIHAGFSFSAGAIDYALMYNLPAASQNVWML
FT                   LVMGVVFFAIYFVVFSLVIRMFNLKTPGREDKEDEIVTEEANSNTEEGLNQLATNYIAA
FT                   VGGTDNLKAIDACITRLRLTVADSARVNDTMCKRLGASGVVKLNKQTIQVIVGAKAESI
FT                   GDAMKKVVARGPVAAASAEATPATAAPVAKPQAVPNAVSIAELVSPITGDVVALDQVPD
FT                   EAFASKAVGDGVAVKPTDKIVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVA
FT                   LEGKGFKRLVEEGAQVSAGQPILEMDLDYLNANARSMISPVVCSNIDDFSGLIIKAQGH
FT                   VVAGQTPLYEIKK"
FT   CDS_pept        792730..794394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="ECO26_0744"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0744"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24071"
FT                   /protein_id="BAI24071.1"
FT                   /translation="MSEAEARPTNFIRQIIDEDLASGKHTTVHTRFPPEPNGYLHIGHA
FT                   KSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYF
FT                   DQLHAYAIELINKGLAYVDELTPEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRA
FT                   GGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYPMYDFTHCISDAL
FT                   EGITHSLCTLEFQDNRRLYDWVLDNITIPVHPRQYEFSRLNLEYTVMSKRKLNLLVTDK
FT                   HVEGWDDPRMPTISGLRRRGYTAASIREFCKRIGVTKQDNTIEMASLESCIREDLNENA
FT                   PRAMAVIDPVKLVIENYQGEGEMVTMPNHPNKPEMGSRQVPFSGEIWIDRADFREEANK
FT                   QYKRLVLGKEVRLRNAYVIKAERVEKDAEGNITTIFCTYDADTLSKDPADGRKVKGVIH
FT                   WVSAAHALPVEIRLYDRLFSVPNPGAADDFLSVINPESLVIKQGFAEPSLKDAVAGKAF
FT                   QFEREGYFCLDSRHSTAEKPVFNRTVGLRDTWAKVGE"
FT   CDS_pept        794840..796246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /locus_tag="ECO26_0745"
FT                   /product="predicted outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0745"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24072"
FT                   /protein_id="BAI24072.1"
FT                   /translation="MRTFSGKRSTLALAIAGVTAMSGFMAMPEARAEGFIDDSTLTGGI
FT                   YYWQRERDRKDVTDGDKYKTNLSHSTWNANLDFQSGYAADMFGLDIAAFTAIEMAENGD
FT                   SSHPNEIAFSKSNKAYDEDWSGDKSGISLYKAAAKFKYGPVWARAGYIQPTGQTLLAPH
FT                   WSFMPGTYQGAEAGANFDYGDAGALSFSYMWTNEYKAPWHLEMDEFYQNDKTTKVDYLH
FT                   SIGAKYDFKNNFVLEAAFGQAEGYIDQYFAKASYKFDIAGSPLTTSYQFYGTRDKVDDR
FT                   SVNDLYDGTAWLQALTFGYRAADVVDLRLEGTWVKADGQQGYFLQRMTPTYASSNGRLD
FT                   IWWDNRSDFNANGEKAVFFGAMYDLKNWNLPGFAIGASYVYAWDAKPATWQSNPDAYYD
FT                   KNRTIEESAYSLDAVYTIQDGRAKGTMFKLHFTEYDNHSDIPSWGGGYGNIFQDERDVK
FT                   FMVIAPFTIF"
FT   CDS_pept        796296..796622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /locus_tag="ECO26_0746"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0746"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24073"
FT                   /protein_id="BAI24073.1"
FT                   /translation="MKKLILIAIMASGLVACAQSTAPQEDSRLKEAYSACINTAQGSPE
FT                   KIEACQSVLNVLKKEKQHQQFADQESVRVLDYQQCLRATQTGNDQAVKADCDKVWQEIR
FT                   SNNK"
FT   CDS_pept        complement(796706..797152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="ECO26_0747"
FT                   /product="DNA-binding transcriptional dual regulator Fur of
FT                   siderophore biosynthesis and transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0747"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24074"
FT                   /protein_id="BAI24074.1"
FT                   /translation="MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLID
FT                   MGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSD
FT                   DSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK"
FT   CDS_pept        complement(797145..797231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uof"
FT                   /locus_tag="ECO26_0748"
FT                   /product="ryhB-regulated fur leader peptide"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0748"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24075"
FT                   /protein_id="BAI24075.1"
FT                   /translation="MIRIISRANSVTSSNEVNRLVTGQIPHD"
FT   CDS_pept        complement(797441..797971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fldA"
FT                   /locus_tag="ECO26_0749"
FT                   /product="flavodoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0749"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24076"
FT                   /protein_id="BAI24076.1"
FT                   /translation="MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLE
FT                   AYDILLLGIPTWYYGEAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGT
FT                   IRDIIEPRGATIVGHWPTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQ
FT                   ISEELHLDEILNA"
FT   CDS_pept        complement(798111..798404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECO26_0750"
FT                   /product="LexA regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24077"
FT                   /protein_id="BAI24077.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
FT   CDS_pept        complement(798544..799308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /locus_tag="ECO26_0751"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0751"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24078"
FT                   /protein_id="BAI24078.1"
FT                   /translation="MKLNIRAQTAQNQHNNSPIVLVHGLFGSLDNLGVLARDLVNDHNI
FT                   IQVDMRNHGLSPRDPVMNYPAMAQDLVDTLDAQQIDKATFIGHSMGGKAVMALTALAPD
FT                   RIDKLVAIDIAPVDYHVRRHDEIFAAINAVSESDAQTRQQAAAIMRQHLNEEGVIQFLL
FT                   KSFVDGEWRFNVPVLWDQYPHIVGWEKIPAWDHPALFIPGGNSPYVSEQYRDDLLAQFP
FT                   QARAHVIAGAGHWVHAEKPDAVLRAIRRYLND"
FT   CDS_pept        799493..800038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="seqA"
FT                   /locus_tag="ECO26_0752"
FT                   /product="replication initiation regulatory protein SeqA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0752"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24079"
FT                   /protein_id="BAI24079.1"
FT                   /translation="MKTIEVDDELYSYIASHTKHIGESASDILRRMLKFSASSQPAAPV
FT                   TKEVRVASPAIVEAKPVKTIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQ
FT                   AFAEATESLHGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
FT                   MQSMQFPAELIEKVRGTI"
FT   CDS_pept        800064..801704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="ECO26_0753"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0753"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24080"
FT                   /protein_id="BAI24080.1"
FT                   /translation="MAIHNRAGQPAQQSDLINVAQLTAQYYVLKPEAGNAEHAVKFGTS
FT                   GHRGSAARHSFNEPHILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLAA
FT                   NGVDVIVQENNGFTPTPAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGG
FT                   PADTNVTKVVEDRANALMADGLKGVKRISLDEAMASGHVKEQDLVQPFVEGLADIVDMA
FT                   AIQKAGLTLGVDPLGGSGIEYWKRIGEYYNLNLTIVNDQVDQTFRFMHLDKDGTIRMDC
FT                   SSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWG
FT                   KDVAVGKTLVSSAMIDRVVNALGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLR
FT                   FDGTPWSTDKDGIIMCLLAAEITAVTGKNPQEHYNELAKRFGAPSYNRLQAAATSAQKA
FT                   ALSKLSPEMVSASTLAGDPITARLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKI
FT                   YCESFLGEEHRKQIEKEAVEIVSEVLKNA"
FT   CDS_pept        complement(801759..803078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="ECO26_0754"
FT                   /product="putrescine/proton symporter PotE"
FT                   /note="putrescine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0754"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24081"
FT                   /protein_id="BAI24081.1"
FT                   /translation="MSQAKSNKMGVVQLTILTMVNMMGSGIIMLPTKLAEVGTISIISW
FT                   LVTAVGSMALAWAFAKCGMFSRKSGGMGGYAEYAFGKSGNFMANYTYGVSLLIANVAIA
FT                   ISAVGYGTELLGASLSPVQIGLATIGVLWICTVANFGGARITGQISSITVWGVIIPVVG
FT                   LCIIGWFWFSPTLYVDSWNPHHAPFFSAVGSSIAMTLWAFLGLESACANTDVVENPERN
FT                   VPIAVLGGTLGAAVIYIVSTNVIAGIVPNMELANSTAPFGLAFAQMFTPEVGKVIMALM
FT                   VMSCCGSLLGWQFTIAQVFKSSSDEGYFPKIFSRVTKVDAPVQGMLTIVIIQSGLALMT
FT                   ISPSLNSQFNVLVNLAVVTNIIPYILSMAALVIIQKVANVPPSKAKVANFVAFVGAMYS
FT                   FYALYSSGEEAMLYGSIVTFLGWTLYGLVSPRFELKNKHG"
FT   CDS_pept        complement(803075..805273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speF"
FT                   /locus_tag="ECO26_0755"
FT                   /product="ornithine decarboxylase isozyme SpeF, inducible"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0755"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24082"
FT                   /protein_id="BAI24082.1"
FT                   /translation="MSELKIAVSRSCPDCFSTHRACVNIDESNYIDVAAIILSVSDVER
FT                   GKLDEIDATGYDIPVFIATENEERVPAEYLPRISGVFEHCESRKEFYGRQLETAASHYE
FT                   TQLRPPFFRALVDYVNQGNSAFDCPGHQGGEFFRRHPAGNQFVEYFGEMLFRSDLCNAD
FT                   VAMGDLLIHEGAPCIAQQHAAKVFNADKTYFVLNGTSSSNKVVLNALLTPGDLVLFDRN
FT                   NHKSNHHGALLQAGATPVYLETARNPYGFIGGIDAHCFEESYLRELIAEVAPQRAKEAR
FT                   PFRLAVIQLGTYDGTIYNARQVVDKIGHLCDYILFDSAWVGYEQFIPMMADCSPLLLDL
FT                   NENDPGILVTQSVHKQQAGFSQTSQIHKKDSHIKGQQRYVPHKRMNNAFMMHASTSPFY
FT                   PLFAALDINAKMHEGVSGRNMWMDCVVNGINARKLILDNCQHIRPFVPELVDGKPWQSY
FT                   ETAQIAVDLRFFQFVPGEHWHSFEGYAENQYFVDPCKLLLTTPGIDARNGEYEAFGVPA
FT                   TILANFLRENGVVPEKCDLNSILFLLTPAEDMAKLQQLVALLVRFEKLLESDAPLAEVL
FT                   PSIYKQHEERYAGYTLRQLCQEMHDLYARHNVKQLQKEMFRKEHFPRVSMNPQEANYAY
FT                   LRGEVELVRLPDAEGRIAAEGALPYPPGVLCVVPGEIWGGAVLRYFSALEEGINLLPGF
FT                   APELQGVYIEEHDGRKQVWCYVIKPRDAQSTLLKGEKL"
FT   CDS_pept        complement(805963..806640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="ECO26_0756"
FT                   /product="DNA-binding response regulator KdpE in
FT                   two-component regulatory system with KdpD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0756"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24083"
FT                   /protein_id="BAI24083.1"
FT                   /translation="MTNVLIVEDEQAIRRFLRTALEGDGMRVYEAETLQRGLLEAATRK
FT                   PDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFG
FT                   IGELQARLRVALRRHSATAAPDPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVL
FT                   LNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYR
FT                   FMP"
FT   CDS_pept        complement(806637..809321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ECO26_0757"
FT                   /product="fused sensory histidine kinase KdpD in
FT                   two-component regulatory system with KdpE: signal sensing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0757"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24084"
FT                   /protein_id="BAI24084.1"
FT                   /translation="MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPPKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLTDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASCRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDSRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANAFERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEDFHEDM"
FT   CDS_pept        complement(809314..809886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECO26_0758"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0758"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24085"
FT                   /protein_id="BAI24085.1"
FT                   /translation="MRGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFQGRPSATAEMPYNPQASGGSNLAVSNPELDKQIAARVAA
FT                   LRAANPDASTNVPVELVTASASGLDNNITPQAAVWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
FT   CDS_pept        complement(809895..811943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="ECO26_0759"
FT                   /product="potassium translocating ATPase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0759"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24086"
FT                   /protein_id="BAI24086.1"
FT                   /translation="MSRKQLALFEPTLVVQALKEAVKKLNPQAQWRNPVMFIVWIGSLL
FT                   TTCISIAMASGAMPGNALFSAAISGWLWVTVLFANFAEALAEGRSKAQANSLKGVKKTA
FT                   FARKLREPKYGAAADKVPADQLRKGDIVLVEAGDIIPCDGEVIEGGASVDESAITGESA
FT                   PVIRESGGDFASVTGGTRILSDWLVIECSVNPGETFLDRMIAMVEGAQRRKTPNEIALT
FT                   ILLIALTIVFLLATATLWPFSARGGNAVSVTVLVALLVCLIPTTIGGLLSAIGVAGMSR
FT                   MLGANVIATSGRAVEAAGDVDVLLLDKTGTITLGNRQASEFIPAQGVDEKTLADAAQLA
FT                   SLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVD
FT                   AIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRVLGVIALKDIVKGGIKERFA
FT                   QLRKMGIKTVMITGDNRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTG
FT                   DGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLT
FT                   TFSIANDVAKYFAIIPAAFAATYPQLNALNIMRLHSPDSAILSAVIFNALIIVFLIPLA
FT                   LKGVSYKPLTASAMLRRNLWIYGLGGLLVPFIGIKVIDLLLTVCGLV"
FT   CDS_pept        complement(811966..813639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="ECO26_0760"
FT                   /product="potassium translocating ATPase, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24087"
FT                   /protein_id="BAI24087.1"
FT                   /translation="MAAQGFLLIATFLLVLMVLARPLGSGLARLINDIPLPGTAGVERI
FT                   LFRLPGVSDHEMNWKQYLCAILGLNMLGLAVLFFMLLDQHYLPLNPQQLPGLSWDLALN
FT                   AAVSFVTNTNWQSYSGETTLSYFSQMAGLTVQNFLSAASGIAVIFALIRAFTRQSMSTL
FT                   GNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFQPYQAVNTVEGAQQLLPMGPVASQ
FT                   EAIKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVTGDRRQGR
FT                   MLLWAMSVIFVICVGVVMWAEVQGNPHLLALGADSSINMEGKESRFGVLVSSLFAVVTT
FT                   AASCGAVIAMHDSFTALGGMVPMWLMQIGEVVFGSVGSGLYGMMLFVLLAVFIAGLMIG
FT                   RTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMTDAGRSAMLNPGPHGFSEVLY
FT                   AVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQPASS
FT                   GTLPTHGPLFVGLLIGTVLLVGALTFIPALALGPVAEYLS"
FT   CDS_pept        complement(813639..813728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpF"
FT                   /locus_tag="ECO26_0761"
FT                   /product="potassium ion accessory transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0761"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24088"
FT                   /protein_id="BAI24088.1"
FT                   /translation="MSAGVITGVLLVFLLLGYLVYALINAEAF"
FT   CDS_pept        814041..814247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="ECO26_0762"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0762"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24089"
FT                   /protein_id="BAI24089.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
FT   CDS_pept        814490..818683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0763"
FT                   /product="RhsC core protein with extension"
FT                   /note="RhsC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0763"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24090"
FT                   /protein_id="BAI24090.1"
FT                   /translation="MSGKPAARQGDMTQYGGSIVQGSAGVRIGAPTGVACSVCPGGVTS
FT                   GHPVNPLLGAKVLPGETDIALPAPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRL
FT                   QLRDNTLILSDNGGRSLYFEHLFPGEDGYSRSESLWLVRGGVAKLDEGHRLAALWQALP
FT                   EELRLSPHRYLATNSPQGPWWVLGWCERVPEADEVLPAPLPPYRVLTGLVDRFGRTQTF
FT                   HHEAAGEFSGEITGVTDGAGRHFRLVLTTQAQRAEEARQQAISGGTEPSAFPDTLPGYT
FT                   EYGRDNGIRLSAVWLTHDPEYPENLPAAPLVRYGWTPRGELAAVYDRSNTQVRSFTYDD
FT                   KYRGRMVAHRHTSRPEIRYRYDSDGRVTEQLNPAGLSYTYQYEKDHITITDSLDRREVL
FT                   HTQGEAGLKRVVKKEHADGSVTQSQFDAVGRLRTQTDAAGRTTEYSPDVVTGLITRITT
FT                   PDGRASAFYYNHHSQLTSATGPDGLEIRREYDELGRLIQETAPDGDITRYRYDNPHSDL
FT                   PCATEDATGSRKTMTWSRYAQLLSFTDCSGYVTRYDHDRFGQMTAVHREEGLSQYHAYD
FT                   SRGQLIAVKDTQGHETRYEYNIAGDLTAVIAPDGSRNGTQYDAWGKAVRTTQGGLTRSM
FT                   EYDAAGRVIRLTSENGSHTTFRYDVLDRLIQETGFDGRTQRYHHDLTGKLIRSEDEGLV
FT                   THWHYDEADRLTHRTVKGETAERWRYDERGWLTDISHISEGHRVTVHYGYDEKGRLTGE
FT                   RQTVHHPQTEALLWQHETRHAYNAQGLANRCIPDSLPAVEWLTYGSGYLAGMKLGDTPL
FT                   VEYTRDRLHRETLRRFGRYELTTAYTPAGQLQRQHLNSLQYDRDYTWNDNGELIRISSP
FT                   RQTRSYSYSTTGRLTSVHTTAANLDIRIPYATDPAGNRLPDPELHPDSALSMWPDNRIA
FT                   RDAHYLYRYDRHGRLTEKTDLIPEGVIRTDDERTHRYHYDSQHRLVHYTRTQYAEPLVE
FT                   SRYLYDPLGRRVAKRVWRRERDLTGWMSLSRKPQVTWYGWDGDRLTTIQNDRSRIQTIY
FT                   QPGSFTPLIRVETATGELARTQRRSLADALQQSGGEDGGSVVFPPVLVQMLDRLESEIL
FT                   ADWVSEESRRWLASCGLTVEQMQNQMDPVYTPARKIHLYHCDHRGLPLALISKEGATEW
FT                   CAEYDEWGNLLNEENPHQLQQLIRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIGL
FT                   KGGWNFYQYPLNPISNIDPLGLETLKCIKPLHSMGGTGERSGPDIWGNPFYHQYLCVPD
FT                   GKGDYTCGGQDQRGESKGDGLWGPGKASNDTKEAAGRCDLVETDNSCVENCLKGKFKEV
FT                   RPRYSVLPDIFTPINLGLFKNCQDWSNDSLETCKMKCSGNNIGRFIRFVFTGVM"
FT   CDS_pept        818683..819009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0764"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0764"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24091"
FT                   /protein_id="BAI24091.1"
FT                   /translation="MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSY
FT                   GMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKR
FT                   IINK"
FT   CDS_pept        819127..820560
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0765"
FT                   /note="Rhs core protein with extension, C-terminal
FT                   fragment"
FT   CDS_pept        820557..821126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0766"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0766"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24092"
FT                   /protein_id="BAI24092.1"
FT                   /translation="MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPV
FT                   LNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQ
FT                   ELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPVQLLAVLDNSIMVKYFKDEKPTYARMT
FT                   AHLPNKNESYECLIKIQHELIRSEEK"
FT   mobile_element  821209..822120
FT                   /mobile_element_type="insertion sequence:IS677"
FT   CDS_pept        821427..822113
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0767"
FT                   /note="RhsC, IS677, putative H repeat-associated protein,
FT                   central part"
FT   CDS_pept        822261..822770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="ECO26_0768"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0768"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24093"
FT                   /protein_id="BAI24093.1"
FT                   /translation="MNQQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYYQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
FT   CDS_pept        822767..824185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="ECO26_0769"
FT                   /product="deoxyribodipyrimidine photolyase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0769"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24094"
FT                   /protein_id="BAI24094.1"
FT                   /translation="MTTHLVWFRQDLRLHDNLALAAACRNSSARVLALYIATPRQWATH
FT                   NMSPRQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNY
FT                   QYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVKTGNHEMYKVFTPFKNAWLKRLR
FT                   EGMPECVAAPKVRSSGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIAQLRQFCQNGAGE
FT                   YEQQRDFPAVEGTSRLSASLATGGLSPRQCLHRLLAEQPQALDGGAGSVWLSELIWREF
FT                   YRHLMTYYPSLCKHCPFIAWTDRVQWQSNPAHLQAWQEGKTGYPIVDAAMRQLNSTGWM
FT                   HNRLRMISASFLVKDLLIDWREGERYFMSQLIDGDLAANNGGWQWAASTGTDAAPYFRI
FT                   FNPTTQGEKFDREGEFIRRWLPELRDVPGKAVHEPWKWAQKAGVMLDYPQPIVDHKEAR
FT                   LRTLAAYEEARKGA"
FT   CDS_pept        complement(824227..825708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgH"
FT                   /locus_tag="ECO26_0770"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0770"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24095"
FT                   /protein_id="BAI24095.1"
FT                   /translation="MNKHASQPRAIYYVVALQIWEYFSFYGMRALLILYLTNQLKYNDT
FT                   HAYELFSAYCSLVYVTPILGGFLADKVLGNRMAVMLGALLMAIGHVVLGASEIHPSFLY
FT                   LSLAIIVCGYGLFKSNVSCLLGELYEPTDPRRDGGFSLMYAAGNVGSIIAPIACGYAQE
FT                   EYSWAMGFGLAAVGMIAGLVIFLCGNRHFTHTRGVNKKVLRATNFLLPNWGWLLVLLVA
FT                   TPALITVLFWKEWSVYALIVATIIGLGVLAKIYRKAENQKQRKELGLIVTLTFFSMLFW
FT                   AFAQQGGSSISLYIDRFVNRDMFGYTVPTAMFQSINAFAVMLCGVFLAWVVKESVAGNR
FT                   TVRIWGKFALGLGLMSAGFCILTLSARWSAMYGHSSLPLMVLGLAVMGFAELFIDPVAM
FT                   SQITRIEIPGVTGVLTGIYMLLSGAIANYLAGVIADQTSQASFDASGAINYSINAYIEV
FT                   FDQITWGALACVGLVLMIWLYQALKFRNRALALES"
FT   CDS_pept        825979..826722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="ECO26_0771"
FT                   /product="conserved predicted metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0771"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24096"
FT                   /protein_id="BAI24096.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAS
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
FT   CDS_pept        826745..827401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /locus_tag="ECO26_0772"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0772"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24097"
FT                   /protein_id="BAI24097.1"
FT                   /translation="MQRARCYLIGETAVVLELEPPVTLASQKRIWRLAQRLVDMPNVVE
FT                   AIPGMNNITVILRNPESLALDAIERLQRWWEESEALEPESRFIEIPVVYGGAGGPDLAV
FT                   VAAHCGLSEKQVVELHSSVEYVVWFLGFQPGFPYLGSLPEQLHTPRRAEPRLLVPAGSV
FT                   GIGGPQTGVYPLATPGGWQLIGHTSLSLFDPARDEPILLRPGDSVRFVPQKEGVC"
FT   CDS_pept        827395..828327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /locus_tag="ECO26_0773"
FT                   /product="predicted carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0773"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24098"
FT                   /protein_id="BAI24098.1"
FT                   /translation="MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVG
FT                   NDANAPALEITLGQLTVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKR
FT                   PQHGMRSYLAVAGGIDVPPVMGSCSTDLKVGSGGLEGRLLKDGDRLPIGKAKRDFMEAQ
FT                   GVKQLLWGNRIRALPGPEYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDR
FT                   ELLSHGLLPGVVQVPHNGQPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFV
FT                   QCSLEEALKARQDQQRYFEQLAWRLHNEN"
FT   CDS_pept        828317..829051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECO26_0774"
FT                   /product="predicted lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0774"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24099"
FT                   /protein_id="BAI24099.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEQQALAQTLEMVQHGRVKSITGEWATVAAQTVCLHGDGE
FT                   HALAFARRLRATFAKKGIVVAA"
FT   CDS_pept        829087..829878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nei"
FT                   /locus_tag="ECO26_0775"
FT                   /product="endonuclease VIII/
FT                   5-formyluracil/5-hydroxymethyluracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0775"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24100"
FT                   /protein_id="BAI24100.1"
FT                   /translation="MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKTYQSQLIGQHV
FT                   THVETRGKALLTHFSNELTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLY
FT                   SASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERVLSPRFRNRQFAGLLLEQAF
FT                   LAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAHALLEIPRFSYATRGQVDENKHH
FT                   GALFRFKVFHRDGEPCERCGSIIEKTTLSSRPFYWCPGCQH"
FT   CDS_pept        complement(829875..830921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="ECO26_0776"
FT                   /product="predicted regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0776"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24101"
FT                   /protein_id="BAI24101.1"
FT                   /translation="MPVLQWGMLCVLSLLLSIGFLAVHLPAALLLGPMIAGIIFSMRGI
FT                   TLQLPRSAFLAAQAILGCMIAQNLTGSILTTLAANWPIVLAILLVTLLSSAIVGWLLVR
FT                   YSSLPGNTGAWGSSPGGAAAMVAMAQDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLG
FT                   DNAEAVNQQIVWFPPVSINLLLTILLAVVAGTAGCMLRLPSGTMLIPMLAGAVLQSGQL
FT                   ITIELPEWLLAMAYMAIGWRIGLGFDKQILLRALRPLPQILLSIFALLAICAGMAWGLT
FT                   RFMHIDFMTAYLATSPGGLDTVAVIAAGSNADMALIMAMQTLRLFSILLTGPAIARFIS
FT                   TYAPKRSA"
FT   CDS_pept        complement(831073..832134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECO26_0777"
FT                   /product="predicted fimbrial-like adhesin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0777"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24102"
FT                   /protein_id="BAI24102.1"
FT                   /translation="MSAGKGVLLVICLLFLPLKSALALNCYFGSSGGSVEKSEAIQPFA
FT                   VPGNAKLGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNG
FT                   VDYDANQGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMR
FT                   LYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNF
FT                   SISPETQVIDFGKFNLLDIRRHTMSKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEE
FT                   DKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLVYEKTYTAELSSIAGTPIEAG
FT                   PFDTVVLFKINYN"
FT   CDS_pept        complement(832131..832862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgP"
FT                   /locus_tag="ECO26_0778"
FT                   /product="putative chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0778"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24103"
FT                   /protein_id="BAI24103.1"
FT                   /translation="MTFMKGLPLLLLVASLCSHAALQPDRTRIVFNANDKATSLRVDNR
FT                   SDKLPYLAYSWLENEKGEKSDDLLVALPPIQRLEPKATTQVRIVKQASTTKLPGDRETL
FT                   FFYNMREIPPAPEKNSDHAVLQVAIQSRIKVFWRPAALRKKAGEKVELQLQVSQQGNQL
FT                   TLKNPTAYYLTIAYLGRNEKGVLPGFKTVMVAPFSTVNTNIGNYSGSQFYLGYMDDYGA
FT                   LRMTTLNYSGQCHLQAVEAKK"
FT   CDS_pept        complement(832877..835327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="ECO26_0779"
FT                   /product="putative outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0779"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24104"
FT                   /protein_id="BAI24104.1"
FT                   /translation="MNIYRLSFVSCLVVAMPCALAVEFNLNVLDKSMRDRIDISLLKEK
FT                   GVIAPGEYFVSVAVNNNQISNGQKINWHKNDDKTIPCINDLLVDKFGLKPEVRQSLPLI
FT                   NQCVDFSSRPEMLFNFDQANQQLNITIPQAWLAWHSENWTPPSTWKEGVAGVLMDYNLF
FT                   ASSYRPQDGSSSTNLNAYGTAGINTGAWRLRSDYQLNQTDSDDNHEQSGEISRTYLFRP
FT                   LPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGQPRPSMSHQTENETFFSNDVSWGMLSNTSLYGGLLLSGDDYHSAAIGIGQ
FT                   NMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAG
FT                   FNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTTHR
FT                   MSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAANDYSSVSS
FT                   SWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSY
FT                   QPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPL
FT                   GADIRQDDSGISVGMVGEEGHAWLSGVAENQKFTVVWGDSQHCSLHLPEHMEDTANRLI
FT                   LPCH"
FT   CDS_pept        complement(835387..835953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECO26_0780"
FT                   /product="putative fimbrial-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24105"
FT                   /protein_id="BAI24105.1"
FT                   /translation="MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   QDDIDKEVELGQVTTSHINQSHHSDAVAVDLRLVNCDLENSSNGSGGKISKVAVTFDSS
FT                   AKTTGADPILNNTSTGEATGVGVRLMNKDQSNIVLGTATPDIDLAPTSSEQTLNFFAWM
FT                   EQIDQATPVTPGAVTANATYVLDYK"
FT   CDS_pept        complement(836344..837627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="ECO26_0781"
FT                   /product="citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0781"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24106"
FT                   /protein_id="BAI24106.1"
FT                   /translation="MADTKAKLTLNGDTAVELDVLKGTLGQDVIDIRTLGSKGVFTFDP
FT                   GFTSTASCESKITFIDGDEGILLHRGFPIDQLATDSNYLEVCYILLNGEKPTQEQYDEF
FT                   KTTVTRHTMIHEQITRLFHAFRRDSHPMAVMCGITGALAAFYHDSLDVNNPRHREIAAF
FT                   RLLSKMPTMAAMCYKYSIGQPFVYPRNDLSYAGNFLNMMFSTPCEPYEVNPILERAMDR
FT                   ILILHADHEQNASTSTVRTAGSSGANPFACIAAGIASLWGPAHGGANEAALKMLEEISS
FT                   VKHIPEFVRRAKDKNDSFRLMGFGHRVYKNYDPRATVMRETCHEVLKELGTKDDLLEVA
FT                   MELENIALNDPYFIEKKLYPNVDFYSGIILKAMGIPSSMFTVIFAMARTVGWIAHWSEM
FT                   HSDGMKIARPRQLYTGYEKRDFKSDIKR"
FT   CDS_pept        838336..838725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="ECO26_0782"
FT                   /product="succinate dehydrogenase cytochrome b556 large
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0782"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24107"
FT                   /protein_id="BAI24107.1"
FT                   /translation="MIRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFIAVGILL
FT                   WLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFE
FT                   AGKRSAKISFVITVVLSLLAGVLVW"
FT   CDS_pept        838719..839066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="ECO26_0783"
FT                   /product="succinate dehydrogenase cytochrome b556 small
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0783"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24108"
FT                   /protein_id="BAI24108.1"
FT                   /translation="MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTY
FT                   EVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVY
FT                   VIYGFVVVWGV"
FT   CDS_pept        839066..840832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="ECO26_0784"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0784"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24109"
FT                   /protein_id="BAI24109.1"
FT                   /translation="MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSH
FT                   TVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGL
FT                   PFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSE
FT                   WYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDG
FT                   VGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAK
FT                   DLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHV
FT                   DPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANR
FT                   LGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEVSLDRLNRWNNNRNGEDPVA
FT                   IRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELD
FT                   NLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPK
FT                   LRPAFPPKIRTY"
FT   CDS_pept        840848..841564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ECO26_0785"
FT                   /product="succinate dehydrogenase, FeS subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0785"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24110"
FT                   /protein_id="BAI24110.1"
FT                   /translation="MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEK
FT                   DPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLV
FT                   VDMGQFYAQYDKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFW
FT                   WNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNP
FT                   TRAIGHIKSMLLQRNA"
FT   CDS_pept        841865..844666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="ECO26_0786"
FT                   /product="2-oxoglutarate decarboxylase, thiamin-requiring"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0786"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24111"
FT                   /protein_id="BAI24111.1"
FT                   /translation="MQNSALKAWLDSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTF
FT                   QQLPGTGVKPDQFHSQTREYFRRLAKDASRYSSTISDPDTNVKQVKVLQLINAYRFRGH
FT                   QHANLDPLGLWQQDKVADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLEALKQT
FT                   YCGPIGAEYMHITSTEEKRWIQQRIESGRATFNSEEKKRFLSELTAAEGLERYLGAKFP
FT                   GAKRFSLEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDE
FT                   FAGKHKEHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDR
FT                   LDEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNP
FT                   LDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH
FT                   GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGD
FT                   CVVAEWRPMNMHSFTWSPYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAK
FT                   IYGDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQSN
FT                   GSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQ
FT                   VVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPST
FT                   PAQVYHMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAIGEIDELDPK
FT                   GVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVW
FT                   CQEEPLNQGAWYCSQHHFREVIPFGASLRYAGRPASASPAVGYMSVHQKQQQDLVNDAL
FT                   NVE"
FT   CDS_pept        844681..845898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="ECO26_0787"
FT                   /product="dihydrolipoyltranssuccinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0787"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24112"
FT                   /protein_id="BAI24112.1"
FT                   /translation="MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKV
FT                   VLEVPASADGILDAVLEDEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQA
FT                   SLEEQNNDALSPAIRRLLAEHNLDASAIKGTGVGGRLTREDVEKHLAKAPAKESAPAAA
FT                   APAAQPALAARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGE
FT                   AFEKRHGIRLGFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVT
FT                   PVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINP
FT                   PQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPT
FT                   RLLLDV"
FT   CDS_pept        845992..847158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="ECO26_0788"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0788"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24113"
FT                   /protein_id="BAI24113.1"
FT                   /translation="MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVV
FT                   KCQVHAGGRGKAGGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDI
FT                   AKELYLGAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGREL
FT                   AFKLGLEGKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNA
FT                   LFRQPDLREMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGG
FT                   EPANFLDVGGGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVG
FT                   VNVPVVVRLEGNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEGK"
FT   CDS_pept        847158..848027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="ECO26_0789"
FT                   /product="succinyl-CoA synthetase, NAD(P)-binding, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0789"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24114"
FT                   /protein_id="BAI24114.1"
FT                   /translation="MSILIDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGG
FT                   TTHLGLPVFNTVREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLD
FT                   MLTVKVKLDEAGVRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVK
FT                   QTTDYGFGQSTCVGIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYI
FT                   KEHVTKPVVGYIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIG
FT                   EALKTVLK"
FT   CDS_pept        complement(848131..848853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mngA"
FT                   /locus_tag="ECO26_0790"
FT                   /product="transcriptional regulator of succinylCoA
FT                   synthetase operon"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24115"
FT                   /protein_id="BAI24115.1"
FT                   /translation="MGHKPLYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVT
FT                   VRQALRQLVEQQILESIQGSGTYVKEERVNYDIFQLTSFDEKLSDRHVDTHSEVLIFEV
FT                   IPADDFLQQQLQITAQDRVWHVKRVRYRKQKPMALEETWMPLALFPDLTWQVMENSKYH
FT                   FIEEVKKMVIDRSEQEIIPLMPTEEMSRLLNISQTKPILEKVSRGYLVDGRVFEYSRNA
FT                   FNTDDYKFTLIAQRKSSR"
FT   CDS_pept        849025..850944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mngA"
FT                   /locus_tag="ECO26_0791"
FT                   /product="fused 2-O-a-mannosyl-D-glycerate specific PTS
FT                   enzymes: IIA component/IIB component/IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0791"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24116"
FT                   /protein_id="BAI24116.1"
FT                   /translation="MMNLTTLTHRDALCLNARFTSREEAIHALTQRLAALGKISSTEQF
FT                   LEEVYRRESLGPTALGEGLAVPHGKTAAVKEAAFAVATLSEPLQWEGVDGPEAVDLVVL
FT                   LAIPPNEAGTTHMQLLTALTTRLADDEIRARIQSATTPDELLSALDDKGGTQPSASFSN
FT                   APTIVCVTACPAGIAHTYMAAEYLEKAGRKLGVNVYVEKQGANGIEGRLTADQLNSATA
FT                   CIFAAEVAIKESERFNGIPALSVPVAEPIRHAEALIQQALTLKRSDETRTVQQDTQPVK
FT                   SVKTELKQALLSGISFAVPLIVAGGTVLAVAVLLSQIFGLQDLFNEENSWLWMYRKLGG
FT                   GLLGILMVPVLAAYTAYSLADKPALAPGFAAGLAANMIGSGFLGAVVGGLIAGYLMRWV
FT                   KNHLRLGSKFNGFLTFYLYPVLGTLGAGSLMLFVVGEPVAWINNSLTAWLNGLSGSNAL
FT                   LLGAILGFMCSFDLGGPVNKAAYAFCLGAMANGVYGPYAIFASVKMVSAFTVTASTMLA
FT                   PRLFKEFEIETGKSTWLLGLAGITEGAIPMAIEDPLRVIGSFVLGSMVTGAIVGAMNIG
FT                   LSTPGAGIFSLFLLHDNGAGGVMAAIGWFGAALVGAAISTAILLMWRRHAVKHGNYLTD
FT                   GVMP"
FT   CDS_pept        850962..853595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mngB"
FT                   /locus_tag="ECO26_0792"
FT                   /product="putative sugar hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0792"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24117"
FT                   /protein_id="BAI24117.1"
FT                   /translation="MKAVSRVHITPHMHWDREWYFTTEESRILLVNNMEEILCRLEQDN
FT                   EYKYYVLDGQTAILEDYFAVKPENKDRVKKQVEAGKLIIGPWYTQTDTTIVSAESIVRN
FT                   LMYGMRDCLAFGEPMKIGYLPDSFGMSGQLPHIYNGFGITRTMFWRGCSERHGTDKTEF
FT                   LWQSSDGSEVTAQVLPLGYAIGKYLPADEDGLRKRLDSYFDVLEKASVTKEILLPNGHD
FT                   QMPLQQNIFEVMDKLREIYPQRKFVMSRFEEVFEKIEAQRDNLATLKGEFIDGKYMRVH
FT                   RTIGSTRMDIKIAHARIENKIVNLLEPLATLAWTLGFEYHHGLLEKMWKEILKNHAHDS
FT                   IGCCCSDKVHREIVARFELAEDMADNLIRFYMRKIADNMPQSDADKLVLFNLMPWPREE
FT                   VINTTVRLRASQFNLRDDRGQPVPYFIRHAREIDPGLIDRQIVHYGNYDPFMEFDIQIN
FT                   QIVPSMGYRTLYIEANQPGNVIAAKSDAEGILENAFWQIALNEDGSLQLVDKDSGVRYD
FT                   RVLQIEESSDDGDEYDYSPAKEEWVITAANAKPQCDIIHEAWQSRAVIRYEMAVPRNLQ
FT                   ERSARQSTGRVGVEMVVTLSHNSRRIDVDINLDNQADDHRLRVLIPTPFNTDSVLADTQ
FT                   FGSLTRPVNDSAMNNWQQEGWKEAPVPVWNMLNYVALQEGRNGMAVFSEGLREFEVIGE
FT                   EKKTFAITLLRGVGLLGKEDLLLRPGRPSGIKMPVPDSQLRGLLSCRLSLLSYTGTPTA
FT                   AGVAQQARAWLTPVQCYNKIPWDAMKLNKAGFNVPESYSLLKMPPVGCLISALKKAEDR
FT                   QEVILRLFNPAESATCDATVAFSREVISCSETMMDEHITTEENQGSNLSGPFLPGQSRT
FT                   FSYRLA"
FT   CDS_pept        854442..856010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="ECO26_0793"
FT                   /product="cytochrome d terminal oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0793"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24118"
FT                   /protein_id="BAI24118.1"
FT                   /translation="MLDIVELSRLQFALTAMYHFLFVPLTLGMAFLLAIMETVYVLSGK
FT                   QIYKDMTKFWGKLFGINFALGVATGLTMEFQFGTNWSYYSHYVGDIFGAPLAIEGLMAF
FT                   FLESTFVGLFFFGWDRLGKVQHMCVTWLVALGSNLSALWILVANGWMQNPIASDFNFET
FT                   MRMEMVSFSELVLNPVAQVKFVHTVASGYVTGAMFILGISAWYMLKGRDFAFAKRSFAI
FT                   AASFGMAAVLSVIVLGDESGYEMGDVQKTKLAAIEAEWETQPAPAAFTLFGIPDQEEET
FT                   NKFAIQIPYALGIIATRSVDTPVIGLKELMVQHEERIRNGMKAYSLLEQLRSGSTDQAV
FT                   RDQFNSMKKDLGYGLLLKRYTPNVADATEAQIQQATKDSIPRVAPLYFAFRIMVACGFL
FT                   LLAIIALSFWSVIRNRIGEKKWLLRAALYGIPLPWIAVEAGWFVAEYGRQPWAIGEVLP
FT                   TAVANSSLTAGDLIFSMVLICGLYTLFLVAELFLMFKFARLGPSSLKTGRYHFEQSSTT
FT                   TQPAR"
FT   CDS_pept        856026..857165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="ECO26_0794"
FT                   /product="cytochrome d terminal oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0794"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24119"
FT                   /protein_id="BAI24119.1"
FT                   /translation="MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTE
FT                   RRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGF
FT                   DYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGNFFQ
FT                   LLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWV
FT                   MYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTIL
FT                   TARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVM
FT                   TWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY"
FT   CDS_pept        857180..857293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgT"
FT                   /locus_tag="ECO26_0795"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0795"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24120"
FT                   /protein_id="BAI24120.1"
FT                   /translation="MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI"
FT   CDS_pept        857293..857586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="ECO26_0796"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0796"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24121"
FT                   /protein_id="BAI24121.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF"
FT   CDS_pept        857736..858140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgC"
FT                   /locus_tag="ECO26_0797"
FT                   /product="acyl-CoA thioesterase"
FT                   /note="involved in phospholipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0797"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24122"
FT                   /protein_id="BAI24122.1"
FT                   /translation="MNTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHF
FT                   SQQALMAERVAFVVRKMTVEYYAPARLDDMLEIQTEITSMRGTSLVFTQRIVNAENTLL
FT                   NEAEVLVVCVDPLKMKPRALPKSIVAEFKQ"
FT   CDS_pept        858137..858829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="ECO26_0798"
FT                   /product="membrane spanning protein TolQ"
FT                   /note="in TolA-TolQ-TolR complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0798"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24123"
FT                   /protein_id="BAI24123.1"
FT                   /translation="MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAA
FT                   AREAEAFEDKFWSGIELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAV
FT                   VEGASRAMRISMNRELENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQAT
FT                   LQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQAF
FT                   TVSESNKG"
FT   CDS_pept        858833..859261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="ECO26_0799"
FT                   /product="membrane spanning protein TolR"
FT                   /note="in TolA-TolQ-TolR complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0799"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24124"
FT                   /protein_id="BAI24124.1"
FT                   /translation="MARARGRGRRELKSEINIVPLLDVLLVLLLIFMATAPIITQSVEV
FT                   DLPDATESQAVSSNDNPPVIVEVSGIGQYTVVVEKDRLERLPPEQVVAEVSSRFKANPK
FT                   TVFLIGGAKDVPYDEIIKALNLLHSAGVKSVGLMTQPI"
FT   CDS_pept        859326..860591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolA"
FT                   /locus_tag="ECO26_0800"
FT                   /product="membrane anchored protein TolA in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0800"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24125"
FT                   /protein_id="BAI24125.1"
FT                   /translation="MSKATEQNDKLKRAIIISAVLHVILFAALIWSSFDENIEASAGGG
FT                   GGSSIDAVMVDSGAVVEQYKRMQSQESSAKRSDEQRKMKEQQAAEELREKQAAEQERLK
FT                   QLEKERLAAQEQKKQAEEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAEEAAKKA
FT                   AADAKKKAEAEAAKAAAEAQKKAEAAAAALKKKAEAAEAAAAEARKKAATEAAEKAKAE
FT                   AEKKAAAEKAAADKKAAAEKAAADKKAAEKAAAEKAAADKKAAAEKAAADKKAAAAKAA
FT                   AEKAAAAKAAAEADDIFGELSSGKNAPKTGGGAKGNNASPAGSGNTKNNGASGADINNY
FT                   AGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPEGGDPALCQAALAAAKLAK
FT                   IPKPPSQAVYEVFKNAPLDFKP"
FT   CDS_pept        860724..862016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="ECO26_0801"
FT                   /product="periplasmic protein TolB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0801"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24126"
FT                   /protein_id="BAI24126.1"
FT                   /translation="MKQALRVAFGFLILWASVLHAEVRIVIDSGVDSGRPIGVVPFQWA
FT                   GPGAAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGSAQEVQPAAWSALGIDAVVVGQV
FT                   TPNPDGSYNVAYQLVDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTGIKGAF
FT                   RTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESG
FT                   RSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIR
FT                   QVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVS
FT                   SDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
FT                   VLNLVSTDGRFKARLPATDGQVKFPAWSPYL"
FT   CDS_pept        862051..862572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="ECO26_0802"
FT                   /product="peptidoglycan-associated outer membrane
FT                   lipoprotein Pal"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0802"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24127"
FT                   /protein_id="BAI24127.1"
FT                   /translation="MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDA
FT                   NGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVT
FT                   VEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAY
FT                   SKNRRAVLVY"
FT   CDS_pept        862582..863373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /locus_tag="ECO26_0803"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0803"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24128"
FT                   /protein_id="BAI24128.1"
FT                   /translation="MSSNFRHQLLSLSLLVGIAAPWAAFAQAPISSVGSGSVEDRVTQL
FT                   ERISNAHSQLLTQLQQQLSDNQSDIDSLRGQIQENQYQLNQVVERQKQILLQIDSLSSG
FT                   GAAAQSTSSDQSGAAASTTPTADAGTANAGAPVKSGDANTDYNAAIALVQDKSRQDDAM
FT                   VAFQNFIKNYPDSTYLPNANYWLGQLNYNKGKKDDAAYYFASVVKNYPKSPKAADAMFK
FT                   VGVIMQDKGDTAKAKAVYQQVISKYPGTDGAKQAQKRLNAM"
FT   tRNA            863538..863613
FT                   /gene="lysT"
FT                   /locus_tag="ECO26_tRNA014"
FT                   /product="tRNA-Lys (UUU)"
FT   tRNA            863749..863824
FT                   /gene="valT"
FT                   /locus_tag="ECO26_tRNA015"
FT                   /product="tRNA-Val (UAC)"
FT   tRNA            863827..863902
FT                   /gene="lysW"
FT                   /locus_tag="ECO26_tRNA016"
FT                   /product="tRNA-Lys (UUU)"
FT   tRNA            864052..864127
FT                   /gene="valZ"
FT                   /locus_tag="ECO26_tRNA017"
FT                   /product="tRNA-Val (UAC)"
FT   tRNA            864131..864206
FT                   /gene="lysY"
FT                   /locus_tag="ECO26_tRNA018"
FT                   /product="tRNA-Lys (UUU)"
FT   tRNA            864353..864428
FT                   /gene="lysZ"
FT                   /locus_tag="ECO26_tRNA019"
FT                   /product="tRNA-Lys (UUU)"
FT   tRNA            864462..864537
FT                   /gene="lysQ"
FT                   /locus_tag="ECO26_tRNA020"
FT                   /product="tRNA-Lys (UUU)"
FT   CDS_pept        864942..865985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="ECO26_0804"
FT                   /product="quinolinate synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0804"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24129"
FT                   /protein_id="BAI24129.1"
FT                   /translation="MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMV
FT                   AHYYTDPEIQQLAEETGGCISDSLEMARFGAKHPASTLLVAGVRFMGETAKILSPEKTI
FT                   LMPTLQAECSLDLGCPVEEFNAFCDAHPDRTVVVYANTSAAVKARADWVVTSSIAVELI
FT                   DHLDSLGEKIIWAPDKHLGRYVQKQTGGDILCWQGACIVHDEFKTQALTRLQEEYPDAA
FT                   ILVHPESPQAIVDMADAVGSTSQLIAAAKTLPHQRLIVATDRGIFYKMQQAVPDKELLE
FT                   APTAGEGATCRSCAHCPWMAMNGLQSIAEALEQEGSNHEVHVDERLRERALVPLNRMLD
FT                   FAATLRG"
FT   CDS_pept        866023..866742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnuC"
FT                   /locus_tag="ECO26_0805"
FT                   /product="predicted nicotinamide mononucleotide transporter
FT                   PnuC"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0805"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24130"
FT                   /protein_id="BAI24130.1"
FT                   /translation="MDFFSVQNILVHIPIGAGGYDLSWIEAVGTIAGLLCIGLASLEKI
FT                   SNYFFGLINVTLFGIIFFQIQLYASLLLQVFFFAANIYGWYAWSRQTSQNEAELKIRWL
FT                   PLPKALSWLAVCVVSIGLMTVFINPVFAFLTRLAVMIMQALGLQVVMPELQPDAFPFWD
FT                   SCMMVLSIVAMILMTRKYVENWLLWVIINVISVVIFALQGVYAMSLEYIILTFIALNGS
FT                   RMWINSARERGSRALSH"
FT   CDS_pept        complement(866739..867680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zitB"
FT                   /locus_tag="ECO26_0806"
FT                   /product="zinc efflux system protein ZitB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0806"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24131"
FT                   /protein_id="BAI24131.1"
FT                   /translation="MAHSHSHTSSHLPEDNNARRLLYAFGVTAGFMLVEVVGGFLSGSL
FT                   ALLADAGHMLTDTAALLFALLAVQFSRRPPTIRHTFGWLRLTTLAAFVNAIALVVITIL
FT                   IVWEAIERFRTPRPVEGGMMMAIAVAGLLANILSFWLLHHGSEEKNLNVRAAALHVLGD
FT                   LLGSVGAIIAALIIIWTGWTPADPILSILVSLLVLRSAWRLLKDSVNELLEGAPVSLDI
FT                   AELKRRMCREIPEVRNVHHVHVWMVGEKPVMTLHVQVIPPHDHDALLDQIQHYLMDHYQ
FT                   IEHATIQMEYQPCHGPDCHLNEGVSGHSHHHH"
FT   CDS_pept        complement(867794..868174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="ECO26_0807"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0807"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24132"
FT                   /protein_id="BAI24132.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
FT   CDS_pept        868490..869542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="ECO26_0808"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase, phenylalanine repressible"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0808"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24133"
FT                   /protein_id="BAI24133.1"
FT                   /translation="MNYQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHK
FT                   ILKGNDDRLLVVIGPCSIHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGW
FT                   KGLINDPHMDNSFQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIG
FT                   ARTTESQVHRELASGLSCPVGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVN
FT                   TSGNGDCHIILRGGKEPNYSAKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDV
FT                   CADVCQQIAGGETAIIGVMVESHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQ
FT                   LANAVKARRG"
FT   CDS_pept        complement(869701..870453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="ECO26_0809"
FT                   /product="phosphoglyceromutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0809"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24134"
FT                   /protein_id="BAI24134.1"
FT                   /translation="MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLL
FT                   KEEGYSFDFAYTSVLKRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETA
FT                   EKYGDEQVKQWRRGFAVTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIP
FT                   YWNETILPRMKSGERVIIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENF
FT                   KPLKRYYLGNADEIAAKAAAVANQGKAK"
FT   CDS_pept        complement(870656..871696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="ECO26_0810"
FT                   /product="galactose-1-epimerase"
FT                   /note="mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24135"
FT                   /protein_id="BAI24135.1"
FT                   /translation="MLNETPALAPDGQPYRLLTLRNNAGMVVTLMDWGATLLSARIPLS
FT                   DGSVREALLGCASPECYQDQAAFLGASIGRYANRIANSRYTFDGETVTLSPSQGVNQLH
FT                   GGPEGFDKRRWQIVNQNDRQVLFALSSDDGDQGFPGNLGATVQYRLTDDNRISITYRAT
FT                   VDKPCPVNMTNHVYFNLDGEQSDVRNHKLQILADEYLPVDEGGIPHDGLKSVAGTSFDF
FT                   RSAKIIASEFLADDDQRKVKGYDHAFLLQAKGDGKKVAAHVWSADEKLQLKVYTTAPAL
FT                   QFYSGNFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQPDCFLRPGEEYSSLTE
FT                   YQFIAE"
FT   CDS_pept        complement(871690..872838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="ECO26_0811"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0811"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24136"
FT                   /protein_id="BAI24136.1"
FT                   /translation="MSLKEKTQSLFANAFGYPATHTIQAPGRVNLIGEHTDYNDGFVLP
FT                   CAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLNAPIVAHENYQWANYVRGVVKHLQ
FT                   LRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVLQQLYYLPLDGAQIALNGQEAEN
FT                   QFVGCNCGIMDQLISALGKKDHALLIDCRSLGTKAVSMPKGVAVVIINSNFKRTLVGSE
FT                   YNTRREQCETGARFFQQPALRDVTIEEFNAVAHELDPIVAKRVRHILTENARTVEAASA
FT                   LEQGDLKRMGELMAESHASMRDDFEITVPQIDTLVEIVKAVIGDKGGVRMTGGGFGGCI
FT                   VALIPEELVPAVQQAVAEQYEAKTGIKETFYVCKPSQGAGQC"
FT   CDS_pept        complement(872842..873888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="ECO26_0812"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0812"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24137"
FT                   /protein_id="BAI24137.1"
FT                   /translation="MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVL
FT                   PAHDPDCFLCAGNVRVTGDKNPDYTRTYVFTNDFAALMSDTPDAPESNDPLMRCQSARG
FT                   TSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNP
FT                   HPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAV
FT                   VPYWAAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWH
FT                   GAPFNGEENQHWQLHAHFYPPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSD
FT                   IHFRESGV"
FT   CDS_pept        complement(873898..874914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="ECO26_0813"
FT                   /product="UDP-galactose-4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0813"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24138"
FT                   /protein_id="BAI24138.1"
FT                   /translation="MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIE
FT                   RLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGT
FT                   LRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDL
FT                   QKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDY
FT                   PTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACG
FT                   KPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD"
FT   CDS_pept        complement(875175..876647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modF"
FT                   /locus_tag="ECO26_0814"
FT                   /product="fused molybdate transporter subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0814"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24139"
FT                   /protein_id="BAI24139.1"
FT                   /translation="MSSLQILQGTFRLSDTKTLQLPQLTLNAGDSWAFVGSNGSGKSAL
FT                   ARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRNNTDMLGPGEDDTGRTTAE
FT                   IIQDEVKDAPRCMQLAQQFGITALLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPF
FT                   DGLDVASRQQLAERLASLHQSGITLVLVLNRFDEIPEFVQFAGVLADCTLAETGAKEEL
FT                   LQQALVAQLAHSEQLEGVQLPEPDEPSARHALPANEPRIVLNNGVVSYNDRPILNNLSW
FT                   QVNPGEHWQIVGPNGAGKSTLLSLVTGDHPQGYSNDLTLFGRRRGSGETIWDIKKHIGY
FT                   VSSSLHLDYRVSTTVRNVILSGYFDSIGIYQAVSDRQQKLVQQWLDILGIDKRTADAPF
FT                   HSLSWGQQRLALIVRALVKHPTLLILDEPLQGLDPLNRQLIRRFVDVLISEGETQLLFV
FT                   SHHAEDAPACITHRLEFVPDGGLYRYVLTKIY"
FT   CDS_pept        complement(876715..877503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modE"
FT                   /locus_tag="ECO26_0815"
FT                   /product="DNA-binding transcriptional dual regulator ModE"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0815"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24140"
FT                   /protein_id="BAI24140.1"
FT                   /translation="MQAEILLTLKLQQKLFADPRRISLLKHIALSGSISQGAKDAGISY
FT                   KSAWDAINEMNQLSEHILVERATGGKGGGGAVLTRYGQRLIQLYDLLAQIQQKAFDVLS
FT                   DDDALPLNSLLAAISRFSLQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAIT
FT                   AQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMA
FT                   LPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATLC"
FT   CDS_pept        877632..877781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhT"
FT                   /locus_tag="ECO26_0816"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0816"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24141"
FT                   /protein_id="BAI24141.1"
FT                   /translation="MLELLKSLVFAVIMVPVVMAIILGLIYGLGEVFNIFSGVGKKDQP
FT                   GQNH"
FT   CDS_pept        877947..878720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="ECO26_0817"
FT                   /product="molybdate-binding periplasmic protein ModA"
FT                   /note="permease; periplasmic-binding component of ABC
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0817"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24142"
FT                   /protein_id="BAI24142.1"
FT                   /translation="MARKWLNLFAGAALSFAVAGNTLADEGKITVFAAASLTNAMQDIA
FT                   TQYKKEKGVDVVSSFASSSTLARQIEAGAPADLFISADQKWMDYAVDKKAIDTASRQTL
FT                   LGNSLVVVAPKASEQKDFTIDSKTNWTSLLNGGRLAVGDPEHVPAGIYAKEALQKLGAW
FT                   DTLSPKLAPAEDVRGALALVERNEAPLGIVYGSDAVASKGVKVVATFPEDSHKKVEYPV
FT                   AVVEEHNNATVKAFYDYLKGPQAAEIFKRYGFTTK"
FT   CDS_pept        878720..879409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="ECO26_0818"
FT                   /product="molybdate transport permease protein ModB"
FT                   /note="membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0818"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24143"
FT                   /protein_id="BAI24143.1"
FT                   /translation="MILTDPEWQAVLLSLKVSSLAVLFSLPFGIFFAWLLVRCTFPGKA
FT                   LLDSVLHLPLVLPPVVVGYLLLVSMGRRGFIGERLYDWFGITFAFSWRGAVLAAAVMSF
FT                   PLMVRAIRLALEGVDVKLEQAARTLGAGRWRVFFTITLPLTLPGIIVGTVLAFARSLGE
FT                   FGATITFVSNIPGETRTIPSAMYTLIQTPGGESGAARLCIISIALAMISLLISEWLARI
FT                   SRERAGR"
FT   CDS_pept        879412..880470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="ECO26_0819"
FT                   /product="ATP-binding component of molybdate transport"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0819"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24144"
FT                   /protein_id="BAI24144.1"
FT                   /translation="MLELNFSQTLGNHCLTINETLPANGITAIFGVSGAGKTSLINAIS
FT                   GLTRPQKGRIVLNGRVLNDAEKGICLTPEKRRVGYVFQDARLFPHYKVRGNLRYGMAKS
FT                   MVDQFDKLVALLGIEPLLDRLPGSLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPR
FT                   KRELLPYLQRLTREINIPMLYVSHSLDEILHLADRVMVLENGQVKAFGALEEVWGSSVM
FT                   NPWLPKEQQSSILKVTVLEHHPHYAMTALALGDQHLWVNKLDEPLQAALRIRIQASDVS
FT                   LVLQPPQQTSIRNVLRAKVVNSYDDNGQVEVELEVGGKTLWARISPWARDELVIKPGLW
FT                   LYAQIKSVSITA"
FT   CDS_pept        complement(880471..881289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhA"
FT                   /locus_tag="ECO26_0820"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0820"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24145"
FT                   /protein_id="BAI24145.1"
FT                   /translation="MTTRVIALDLDGTLLTPKKTLLPSSIEALARAREAGYQLIIVTGR
FT                   HHVAIHPFYQALALDTPAICCNGTYLYDYHAKTVLEADPMPVNKALQLIEMLNEHHIHG
FT                   LMYVDDAMVYEHPTGHVIRTSNWAQTLPPEQRPTFTQVASLAETAQQVNAVWKFALTHD
FT                   DLPQLQHFGKHVEHELGLECEWSWHDQVDIARGGNSKGKRLTKWVEAQGWSMENVVAFG
FT                   DNFNDISMLEAAGTGVAMGNADDAVKARANIVIGDNTTDSIAQFIYSHLI"
FT   CDS_pept        881444..882439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhE"
FT                   /locus_tag="ECO26_0821"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0821"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24146"
FT                   /protein_id="BAI24146.1"
FT                   /translation="MKQTVYIASPESQQIHVWNLNHEGALTLTQVVDVPGQVQPMVVSP
FT                   DKRYLYVGVRPEFRVLAYSIAPDDGALTFAAESALPGSPTHISTDHQGQFVFVGSYNAG
FT                   NVSVTRLEDGLPVGVVDVVEGLDGCHSANISPDNRTLWVPALKQDRICLFTVSDDGHLV
FT                   AQDPAEVTTVEGAGPRHMVFHPNEQYAYCVNELNSSVDVWELKDPHGNIECVQTLDMMP
FT                   ENFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSKEGFQPTETQPRGFN
FT                   VDHSGKYLIAAGQKSHHISVYEIVGEQGLLHEKGRYAVGQGPMWVVVNAH"
FT   CDS_pept        complement(882480..883433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhD"
FT                   /locus_tag="ECO26_0822"
FT                   /product="predicted DNA-binding transcriptional regulator,
FT                   LYSR-type"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0822"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24147"
FT                   /protein_id="BAI24147.1"
FT                   /translation="MKHELSSMKAFVILAESSSFNNAAKLLNITQPALTRRIKKMEEDL
FT                   HIQLFERTTRKVTLTKAGKRLLPEARELIKKFDETLFNIRDMNAYHRGMVTLACIPTAV
FT                   FYFLPLAIGKFNELYPNIKVRILEQGTNNCMESVLCNESDFGINMNNVTNSSIDFTPLV
FT                   NEPFVLACRRDHPLAKKQLVEWQELVGYKMIGVRSSSGNRLLIEQQLADKPWKLDWFYE
FT                   VRHLSTSLGLVEAGLGISALPGLAMPHAPYSSIIGIPLVEPVIRRTLGIIRRKDAVLSP
FT                   AAERFFALLINLWTDDKDNLWTNIVERQRHALQEIG"
FT   CDS_pept        883617..884669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhH"
FT                   /locus_tag="ECO26_0823"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0823"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24148"
FT                   /protein_id="BAI24148.1"
FT                   /translation="MKKIPCVMMRGGTSRGAFLLAEHLPEDQTQRDKILMAIMGSGNDL
FT                   EIDGIGGGNPLTSKVAIISRSSDPRADVDYLFAQVIVHEQRVDTTPNCGNMLSGVGAFA
FT                   IENGLIAATSPVTRVRIRNVNTGTFIEADVQTPNGVVEYEGSARIDGVPGTAAPVALTF
FT                   LNAAGTKTGKVFPTDNQIDYFDDVPVTCIDMAMPVVIIPAEYLGKTGYELPAELDADKA
FT                   LLARIESIRLQAGKAMGLGDVSNMVIPKPVLISPAQKGGAINVRYFMPHSCHRALAITG
FT                   AIAISSSCALEGTVTRQIVPSVGYGNINIEHPSGALDVHLSNEGQDATTLRASVIRTTR
FT                   KIFSGEVYLP"
FT   CDS_pept        884745..886178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhI"
FT                   /locus_tag="ECO26_0824"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0824"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24149"
FT                   /protein_id="BAI24149.1"
FT                   /translation="MNKKSLWKLILILAIPCIIGFMPAPAGLSELAWVLFGIYLAAIVG
FT                   LVIKPFPEPVVLLIAVAASMVVVGNLSDGAFKTTAVLSGYSSGTTWLVFSAFTLSAAFV
FT                   TTGLGKRIAYLLIGKIGNTTLGLGYVTVFLDLVLAPATPSNTARAGGIVLPIINSVAVA
FT                   LGSEPEKSPRRVGHYLMMSIYMVTKTTSYMFFTAMAGNILALKMINDILHLQISWGGWA
FT                   LAAGLPGIIMLLVTPLVIYTMYPPEIKKVDNKTIAKAGLAELGPMKIREKMLLGVFVLA
FT                   LLGWIFSKFLGVDESTVAIVVMATMLLLGIVTWEDVVKNKGGWNTLIWYGGIIGLSSLL
FT                   SKVKFFEWLAEVFKNNLAFDGHGNVAFFVIIFLSIIVRYFFASGSAYIVAMLPVFAMLA
FT                   NVSGAPLMLTALALLFSNSYGGMVTHYGGAAGPVIFGVGYNDIKSWWLVGAVLTILTFL
FT                   VHITLGVWWWNMLIGWNML"
FT   CDS_pept        886361..888622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhJ"
FT                   /locus_tag="ECO26_0825"
FT                   /product="predicted hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0825"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24150"
FT                   /protein_id="BAI24150.1"
FT                   /translation="MIKLSEKGVFLASNNEIIAEEHFTGEIKKEEAKKGTIAWSILSSH
FT                   NTSGNMDKLKIKFDSLASHDITFVGIVQTAKASGMERFPLPYVLTNCHNSLCAVGGTIN
FT                   GDDHVFGLSAAQRYGGIFVPPHIAVIHQYMREMMAGGGKMILGSDSHTRYGALGTMAVG
FT                   EGGGELVKQLLNDTWDIDYPGVVAVHLTGKPAPYVGPQDVALAIIGAVFKNGYVKNKVM
FT                   EFVGPGVSALSTDFRNSVDVMTTETTCLSSVWQTDEEVHNWLALHGRGQDYCQLNPQPM
FT                   AYYDGCISVDLSAIKPMIALPFHPSNVYEIDTLNQNLTDILREIEIESERVAHGKAKLS
FT                   LLDKVENGRLKVQQGIIAGCSGGNYENVIAAANALRGQSCGNDTFSLAVYPSSQPVFMD
FT                   LAKKGVVADLIGAGAIIRTAFCGPCFGAGDTPINNGLSIRHTTRNFPNREGSKPANGQM
FT                   SAVALMDARSIAATAANGGYLTSASELDCWDNVPEYAFDVTPYKNRVYQGFVKGATQQP
FT                   LIYGPNIKDWPELGALTDNIVLKVCSKILDEVTTTDELIPSGETSSYRSNPIGLAEFTL
FT                   SRRDPGYVGRSKATAELENQRLAGNVSELTEVFARIKQIAGQEHIDPLQTEIGSMVYAV
FT                   KPGDGSAREQAASCQRVIGGLANIAEEYATKRYRSNVINWGMLPLQMAEVPTFEVGDYI
FT                   YIPGIKAALDNPGTTFKGYVIHEDAPVTEITLYMESLTAEEREIIKAGSLINFNKNRQM
FT                   "
FT   CDS_pept        complement(888856..890139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhC"
FT                   /locus_tag="ECO26_0826"
FT                   /product="predicted pectinesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0826"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24151"
FT                   /protein_id="BAI24151.1"
FT                   /translation="MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPIL
FT                   SAKEAQNFDAQHYFASLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAA
FT                   IIKRTNKRQYIAVMPGEYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWR
FT                   HDVNPRGKYMPGKPAWYMYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDS
FT                   VDAGNHPAVALRTDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIE
FT                   GDVDIVSGRGAVVFDNTEFRVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGV
FT                   AQLGRSLDVDANTNGQVVIRDSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEIQR
FT                   NLNDTNYNRMWEYNNRGVGSKVVAEAKK"
FT   misc_feature    890186..942733
FT                   /note="Prophage ECO26_P02, lambda-like phage"
FT   CDS_pept        complement(890274..891344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0827"
FT                   /product="putative integrase"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0827"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24152"
FT                   /protein_id="BAI24152.1"
FT                   /translation="MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAI
FT                   TEAIQANIELFSGHKHKPLTARINSDNSVTLHSWLDRYEKILASRGIKQKTLINYMSKI
FT                   KAIRRGLPDAPLEDITTKEIAAMLSGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTN
FT                   PVAATRAAKSEVRRSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWS
FT                   DIVDGYLYVEQSKTGVKIAIPTTLHVDALGISMKETLDKCKEILGGETIIASTHREPLS
FT                   SGTVSRYFMRARKASGLSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHKSDTMAS
FT                   QYRDDRGREWDKIEIK"
FT   CDS_pept        complement(891322..891540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0828"
FT                   /product="putative excisionase"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0828"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24153"
FT                   /protein_id="BAI24153.1"
FT                   /translation="MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHE
FT                   SAVKVDLNRPVTGSLLKRIRNGKKAKS"
FT   CDS_pept        complement(891647..891991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0829"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0829"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24154"
FT                   /protein_id="BAI24154.1"
FT                   /translation="MSDLSMKVLKWQSTGDVGISSATLASIACGLKKNIYGHHFGAPHD
FT                   AADFRRCVALVEKIPEIRDSFDKVAKRVPAFKGILNEWDSLVALLKSEMKIHGNKAPET
FT                   YRRISELRKD"
FT   CDS_pept        complement(892020..892187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0830"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24155"
FT                   /protein_id="BAI24155.1"
FT                   /translation="MHFRVTGEWNGEPFNRVIEAENINDCYDHWMIWAQIAHADVTNIR
FT                   IEELKEHQAA"
FT   CDS_pept        complement(892260..892544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0831"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0831"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24156"
FT                   /protein_id="BAI24156.1"
FT                   /translation="MANLQLAVKGEYFDAMIRGEKTEEYRLCNDYWNKRIMFREYDRLI
FT                   ITKGYPKRDDSSRRIDVPYDGYEIKTITHPHFGDKPVKVFAIKVNIGNE"
FT   CDS_pept        complement(892537..892839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0832"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0832"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24157"
FT                   /protein_id="BAI24157.1"
FT                   /translation="MNLYRCPFCGSTVLNIGYSFSIRGKMRYVSCKCGAQGPEKRTRSE
FT                   AISSWNSRMKVWVYDPETILNVEERRRTEVYIHNLNEDGFAPVLVKATPQEVNRG"
FT   CDS_pept        complement(892836..893453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0833"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0833"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24158"
FT                   /protein_id="BAI24158.1"
FT                   /translation="MSTITKERIELFIKSPLDNGLTSGEQMELARIALASLEAKPIGAF
FT                   HIAEQQVDGTSDYLKDGEWPIDNGIIEVYAAPPVPVVPAALPENDDEDGHDIDYLDPSE
FT                   VYALGRTAGWNACRAAMLQGKSEQPQNAQQNIPENIPGGNSPVTPDGWVMVPKELTPEM
FT                   MRAVQIRSELGGYATSNLSGAYNMFSEFWNVAVSAAPKVDDL"
FT   CDS_pept        complement(893455..894012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0834"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0834"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24159"
FT                   /protein_id="BAI24159.1"
FT                   /translation="MSKIDYQALREAAERAIPAMERLLMLPVDDDLLTEQELKDYGVDI
FT                   DALNAFKFLTGPETVLALLDERERNQQYIKRRDQKNEDIALTVGKLRVELEAVQKTSAA
FT                   RIEAIDRTHKMFQREKDRADAAEKCIAELSASHSKLRDTMAGIHNTIRMDGGYTPLAAI
FT                   LNAAKRAYEESASAAGIRIKGE"
FT   CDS_pept        complement(894009..894566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0835"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0835"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24160"
FT                   /protein_id="BAI24160.1"
FT                   /translation="MKQMTLIEMDGFLKGKCIPSDLKVDETNDEYLVRKFGELESKLET
FT                   ALRECRSAGITIDNLEAKCAKMAAENSSLKQSEKEFNDFCREEFSEWEDDITETPATDA
FT                   FLAEVKTEARKEGAYFVANRMLAAWEAGFIDDTAKNAADIARMILTSTEFMANAPEGDF
FT                   DRSFSDGVLEDIAEQLRKGVIQ"
FT   CDS_pept        complement(894738..895031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0836"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0836"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24161"
FT                   /protein_id="BAI24161.1"
FT                   /translation="MPAPLYGADDARRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKE
FT                   FRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEIDPRLRNYRSRYGAISND"
FT   CDS_pept        complement(895055..895438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0837"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0837"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24162"
FT                   /protein_id="BAI24162.1"
FT                   /translation="MAHSITVRLNKPAREFQTGENIGFNIRAGVQYYDRQTKKKEWTNY
FT                   SAVVFAKPGAQADYYRSVLVEGGIVEITGENIRVDVYQGQNGQSITLELLNAKIGFAAS
FT                   GNGPQQQSSNQQNTPVYDDSIPF"
FT   CDS_pept        complement(895438..896043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0838"
FT                   /product="putative essential recombination function
FT                   protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0838"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24163"
FT                   /protein_id="BAI24163.1"
FT                   /translation="MSKEFYARLAAIQENLNAPKNQYNSFGKYKYRSCEDILEGVKPLL
FT                   NGLFLSISDEVVLIGDRYYVKATATITDGENSHTATALAREEESKKGMDSAQVTGATSS
FT                   YARKYCLNGLFGIDDAKDADTDEHKHQQNAAAKQSKPSPTPEQVLKAFTDAAMQKNTVE
FT                   ELKQAFAKAWKMLEGTPEQHKAQDVYNIRRDELEGAAA"
FT   mobile_element  896169..897432
FT                   /mobile_element_type="insertion sequence:IS600"
FT   CDS_pept        896233..896535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0839"
FT                   /product="predicted IS600 transposase OrfA"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0839"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24164"
FT                   /protein_id="BAI24164.1"
FT                   /translation="MSRKTQRYSKEFKAEAVRTVLENQLSISEGASRLSLPEGTLGQWV
FT                   TAARKGLGTPGSRTVAELESEILQLRKALNEARLERDILKKATAYFAQESLKNTR"
FT   CDS_pept        896571..897389
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0840"
FT                   /note="Prophage ECO26_P02; predicted transposase OrfB
FT                   protein of insertion sequence IS600, C-terminal fragment"
FT   CDS_pept        complement(897704..897835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0841"
FT                   /product="predicted regulatory protein CIII"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0841"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24165"
FT                   /protein_id="BAI24165.1"
FT                   /translation="MIYAIAGGARMGAFQLNESLLERITRKLRDGWKRVEVLLCAMK"
FT   CDS_pept        complement(897860..898720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0842"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0842"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24166"
FT                   /protein_id="BAI24166.1"
FT                   /translation="MSFVPDITTAKGRKEIAYLAYKVAQTKTYLDGLGKDLVAELKEIP
FT                   KLIDANRKTVRDRLDELKAKARQPLTDYEEEQARIKAEEEAKAAAEALAKQIESDHEIA
FT                   ILMDREFDRQREEARLKAEQEKREHEERLKREAEEKARAEAEAKAKAEIEAAARREAEA
FT                   KAAEERAERERIEAEQRAQREAKEAAERAEREKHAAIEAERRKAQEEAERILREAEAKE
FT                   QARIAEEKRIKDEEERRAKDKAHRKEVNNKILADLIKVGASEDVAKNIITAIVKGELFA
FT                   TKITY"
FT   CDS_pept        899084..899308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0843"
FT                   /product="predicted superinfection exclusion protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0843"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24167"
FT                   /protein_id="BAI24167.1"
FT                   /translation="MSNWWQELLRFFLRGLTLQQLIHMLIILIALIIITPASIKEWVDI
FT                   RNPEILPDHWMYYAMLLCISYVLNRGMEC"
FT   CDS_pept        899370..899564
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0844"
FT                   /note="Prophage ECO26_P02; regulatory protein CII,
FT                   C-terminal part"
FT   CDS_pept        899597..900154
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0845"
FT                   /note="Prophage ECO26_P02; predicted replication protein,
FT                   N-terminal fragment"
FT   CDS_pept        900094..900468
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0846"
FT                   /note="Prophage ECO26_P02; predicted replication protein,
FT                   C-terminal fragment"
FT   CDS_pept        900465..901166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0847"
FT                   /product="putative replication protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0847"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24168"
FT                   /protein_id="BAI24168.1"
FT                   /translation="MKNIAAQMVNFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFS
FT                   QLLATFPASLANRDQNELNEIRRQWVLAFRENGITTMEQVNAGMRVARRQNRPFLPSPG
FT                   QFVAWCREEASVIAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQN
FT                   MRANALTDAELRRKAADELVHMTARINRGEALPEPVKQLPVMGGRPLNRAQALAKIAEL
FT                   KAKFGLKGASV"
FT   CDS_pept        901163..901453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0848"
FT                   /product="putative exclusion protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0848"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24169"
FT                   /protein_id="BAI24169.1"
FT                   /translation="MTGKEAIIHYLGTHNSFCAPDVAALTGATVTSINQAAAKMARAGL
FT                   LVIEGKVWRTVYYRFATKEEREGKMSTNLIFKECRQSAAMKRVLAVYGVKR"
FT   CDS_pept        901619..901732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0849"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0849"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24170"
FT                   /protein_id="BAI24170.1"
FT                   /translation="MNDGKDPWYTLFGAAFVWVIIGVAPVAVAKMAWRFVS"
FT   CDS_pept        901861..902106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0850"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24171"
FT                   /protein_id="BAI24171.1"
FT                   /translation="MDIRHSLNEWWTLWQASRAAIELDIDWPESNDDFWKDGEEGAYAM
FT                   GYEDGRDKTVIAVMKAIRAAGIKEKNFDEANNIPPN"
FT   CDS_pept        902078..902488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0851"
FT                   /product="putative recombination protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0851"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24172"
FT                   /protein_id="BAI24172.1"
FT                   /translation="MKQTIFLRTKQQQQAAINAILATPLDKDKPVTIRITDYKRNLDQN
FT                   AKFHAMLADIARQVQWCDKWLKPEQWKVLLISGHAVATKQEADVLPGLEGEYVNIRESS
FT                   AQMSVKRMASLIEYTTAWAIGQGVRFTDRRYE"
FT   mobile_element  complement(902862..904171)
FT                   /mobile_element_type="insertion sequence:IS629"
FT   CDS_pept        complement(902904..903794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0852"
FT                   /product="putative IS629 transposase OrfB"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0852"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24173"
FT                   /protein_id="BAI24173.1"
FT                   /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
FT                   QHDDWLKKEIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKK
FT                   VRTTVSRKAVAACDRVNRQFVAERPDQLWVADFTWVSTWQGFVYVAFIIDVFAGYIVGW
FT                   QVSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTQRLKEAGLLASTGSTG
FT                   DSYDNAMAESINGLYKAEVIHRNSWKNRTEVELATLTWVDWYNNRRLLERLGHIPPAEA
FT                   EKAYYASIGNNDLAA"
FT   CDS_pept        complement(903791..904117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0853"
FT                   /product="putative IS629 transposase OrfA"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0853"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24174"
FT                   /protein_id="BAI24174.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
FT   CDS_pept        904540..905262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0854"
FT                   /product="putative DNA-binding protein Roi"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0854"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24175"
FT                   /protein_id="BAI24175.1"
FT                   /translation="MNELINGNAIKMTSIEIAELVGKRHDNVKRTIETLAKNGVIRLPQ
FT                   IEVSERINNLGFNVQYEHYVFEGEQGKRDSIVVVAQLSPEFTARLVDRWRELEETAVNI
FT                   PKTLPEALRLAADLAEQKMQLENQLAIAAPKVEFADRVGEASGILIGNFAKVVGIGPNK
FT                   LFAWMRDHKILIASGSRRNVPMQEYMDRGYFTVKETAVNTNHGIQISFTTKITGRGQQW
FT                   LTRKLLDNGMLKVTGEAA"
FT   CDS_pept        905549..905911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0855"
FT                   /product="putative Holliday-junction resolvase"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0855"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24176"
FT                   /protein_id="BAI24176.1"
FT                   /translation="MNEYQFVLPYPPSVNTYWRRRGSQYYISDKGQKYRKDVQQIIHQL
FT                   KLDIFTKSRLRIKVIADVPDSRRRDLDNILKGLLDSLIHAGFAEDDEQFDDIRVIRGVK
FT                   VPGGRLGIKITELENA"
FT   CDS_pept        complement(906308..907267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0856"
FT                   /product="putative systemic factor protein A"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0856"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24177"
FT                   /protein_id="BAI24177.1"
FT                   /translation="MKKSVIAGVFIALSFTTCSAIANSLALSLANDDAGKFQPILNDIY
FT                   GNKHENRDDYSQGLFLGYSHDISDSSQLSLHIAQDIYSPSGSNKRHNTAVTGDRAFSAY
FT                   THTGIEWNSLANDWIRYRLGTDIGVVGPDAGGQKVQNKAHEIIGAEKYHAWDDQIENRY
FT                   GYTVKGMLSMTPSMDILGANVGLYPEVSAVTGNLFQYVAYGATIAIGNDKTFNSDNGFG
FT                   LLAPRGLMHMSDTSGFKYKIFAGMERRDVNRNYTLEGKTIQTKQTTVSLNKTVDEYQVG
FT                   ATIGYAPVAFTLAFNKVTSEFKTGDDYSFINGAITFFF"
FT   CDS_pept        907743..908432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0857"
FT                   /product="putative late gene regulator"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0857"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24178"
FT                   /protein_id="BAI24178.1"
FT                   /translation="MNTQYLQYVREQLMAATADLNGATKGQLEAWQEHAQFDTGTYKRK
FT                   KPRILDVVTGKMITLDNTPTSGKQSYAKGSSIALVSPVEFSTSSWRRAVLSLDEHQKAW
FT                   LLWCYSESVRWGHQVTITQWAWSEFKDLLSNRKIAGKTLDRLKTLIWLAAQDVKSELAG
FT                   REAYEYQTLASLVGVTTKNWSETFTERWVAMKHIFLQLDSDALLLVTRTRSKQKAAFLQ
FT                   QNIAKLD"
FT   CDS_pept        908602..909360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0858"
FT                   /product="predicted membrane protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0858"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24179"
FT                   /protein_id="BAI24179.1"
FT                   /translation="MSCKPMLSSCIGVVMKDGALLRSSSLFIAYMGCLGWGSAYFYGWG
FT                   TSFYYGFPWWIVGAGVDDVARSLFFAVIVIAIFLIGWGIGVVFFFAVKRKHSMQELNVF
FT                   RLYFAVELLFVPAIIEFSILRQKIQVPLLLLSAAIALAVTISIRSYGRFLSVSCFYDKP
FT                   FIKKHFFEIVMIAFVAYFWLFSFLTGYYKPQFKKEYEMINYNDGWYYVLARYDNCLVLS
FT                   TSFNAGSKRFVIYQSAQDKNLQVDIVRTRI"
FT   CDS_pept        909709..909849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0859"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0859"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24180"
FT                   /protein_id="BAI24180.1"
FT                   /translation="MIIAELSGRRHAYITSVIPFIIFLVSSGCALRSLFFMTCHWQMVI
FT                   L"
FT   CDS_pept        909903..910229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0860"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24181"
FT                   /protein_id="BAI24181.1"
FT                   /translation="MSIKHYDVVRAASPSDLAEKLTHKLKEGWQPYGGPVAITPYTLMQ
FT                   AVAIEGEPQVGPSSEPDWYYVIVLAGQSNAMAYGEGLTVKGFRCRIHTMLRIRALNSWR
FT                   AAVQ"
FT   CDS_pept        910226..911767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0861"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0861"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24182"
FT                   /protein_id="BAI24182.1"
FT                   /translation="MTPGGAACRYNDIIPADHCLHDVQDMSTLNHPRADLSKGQYGCVG
FT                   QGLHIAKKLLPYIPNNAGILLVPCCRGGSAFTQGAEGTFSESTGASQDSARWGVGKPLY
FT                   QDLISRTKAALQKNPKNVLLAVCWMQGEFDMSAATHVQQPALFTAMLTQFRADLSVFNA
FT                   QCHGGSAADVPWVCGDTTYYWKNTYATQYDTVYGGYKNRESEGVYFVPFMTDGNGVNTA
FT                   TNAPAEDPDIPASGYYGAASRTNGNQVSSNRPTHFSSWARRSIIPDRLATAILNAAGRT
FT                   SAFISGKAPEIKPSPGGNTPSGPFADTSVRTISLLPAAGEAAAQGWSIKDGGIQLSDGV
FT                   FKITKQSNKTWSLTHPVDDAITLLTQGGRLTCKFRLSGALTNNQFGLGIYLYTDAPVPD
FT                   GVAMTGTGNPFLMSYFTQTTDGRVNLMHHRKAGNTKLGEFGDYGNDWQTLELVFTAGSA
FT                   TVTPKLNGVAGPAFQVIKDSLTLGLNALTLTDVTKNAAYGVEIESLMLEINAPAA"
FT   CDS_pept        912215..912421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0862"
FT                   /product="putative holin protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0862"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24183"
FT                   /protein_id="BAI24183.1"
FT                   /translation="MEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLLFG
FT                   LLTYLTNLYFKIKEDKRKAARGE"
FT   CDS_pept        912421..912918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0863"
FT                   /product="putative endolysin"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0863"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24184"
FT                   /protein_id="BAI24184.1"
FT                   /translation="MSPSLRKAVAAAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDI
FT                   VGVWTVCHGHTGKDIMPGKTYTEAECKALLNKDLATVARQINPYINVDIPETTRGALYS
FT                   FVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWG
FT                   QQ"
FT   CDS_pept        912915..913352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0864"
FT                   /product="putative endopeptidase"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0864"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24185"
FT                   /protein_id="BAI24185.1"
FT                   /translation="MSRVTVIISALVICIIACQSWAVNHYRDNAMTYKEQRDKATSIIA
FT                   DMQKRQRDVAELDARYTKELADANATIESLRADVSAGRKRLQVSATCAKSTTGASSMGD
FT                   GESPGLTSDAELNYYRLRGGIDKITAQVNYLQEYIRTQCLK"
FT   CDS_pept        913114..913299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0865"
FT                   /product="putative lipoprotein Rz1 precursor"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0865"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24186"
FT                   /protein_id="BAI24186.1"
FT                   /translation="MLMRLSKVSVLMFLLGVSACKSPPPVQSQRPEPAAWAMEKAQDLH
FT                   QMLNSIITVSEVESTR"
FT   CDS_pept        913502..914119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0866"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0866"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24187"
FT                   /protein_id="BAI24187.1"
FT                   /translation="MLASLGGLVSCAAKVHFKEAGNAMNELIANHDFDFRQLVTAAEGQ
FT                   PVTDTFQIARAFGKRHQHVIRAIKCLRCSEEFSTTHFWAVEKINDLGIFDKKQIYYRMD
FT                   FSGFVMLVMGFNGAKADAVKEAYINAFNWMSAELRKYSESYEAERNAVMLEYMKEKDVA
FT                   SMSGRLLNRWGRTKKPQLLAKLERLERQGQFLLPGFDKGIQA"
FT   CDS_pept        914377..914529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0867"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0867"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24188"
FT                   /protein_id="BAI24188.1"
FT                   /translation="MTQAEKFPDPFCSRAMLICSIIWLGKRMLRVVVLRVLFFVDMRLP
FT                   CIQCR"
FT   CDS_pept        914897..915406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0868"
FT                   /product="putative terminase small subunit"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0868"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24189"
FT                   /protein_id="BAI24189.1"
FT                   /translation="MATQTEVARHLSLTDRQLRRLQKLPGAPVSNKRGQLDLDAWRDFY
FT                   ISYLRRSKNDVPDGDSEEDYEEKLLIARWELTAEQAVTQQLKNEVSKGKLIDTGFCIFA
FT                   LSKLAMALSSTLDSIPLSMQRQFPDLTPRHLDHLKTLIAKGANQCARAGDKLPDLLDEY
FT                   IRATTE"
FT   CDS_pept        915378..917306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0869"
FT                   /product="putative terminase large subunit"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0869"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24190"
FT                   /protein_id="BAI24190.1"
FT                   /translation="MNISEQQLNNMMSAVTTALQPLIRALPVTPVEWADQNYYLPKESS
FT                   YGEGEWKTLPFQIAIMNCMGNDQIRTVNLIKSARVGYTKMLLGVVGYFIEHKSRNSLLF
FT                   QPTDSAAEDFMKSHVEATIRNVPCLKDLSPWLGRKHRDNTLTLKRFSSGVGFWCLGGAA
FT                   AKNYREKSVDVVCYDELSSFEPDVEKEGSPTLLGDKRIEGSVWPKSIRGSTPKIKGTCQ
FT                   IEKAANESAHFMRFYVPCPHCGEEQYLKFGDESTPFGLKWEKDSPESVFYLCEHHGCVI
FT                   HQSELDQSNGRWICENTGMWTRDGLTFFSARGDEIPPPRSITFHIWTAYSPFTTWVQIV
FT                   YDWLDALKDPNGLKTFVNTTLGETWEEAVGEKLDHQVLMDKVVRYTAAVPSRVVYLTAG
FT                   IDSQRNRFEMYVWGWAPGEEAFLVDKIIIMGRPDEEGTLLRVDAAINKKYRHADGTEMT
FT                   ISRVCWDTGGIDGEIVYQRSKKHGVFRVLPVKGASVYGKPVITMPKTRNQRGVYLCEVG
FT                   TDTAKEILYARMKADPTPADEATSYAIRFPDDPEIFSQTEAQQLVAEELVEKWEKGKMR
FT                   LLWDNKKRRNEALDCLVYAYAALRVSVQRWQLDLAVLAKSREEETTRPTLKELAAKLSG
FT                   GVNGYSR"
FT   CDS_pept        917290..917496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0870"
FT                   /product="head-tail joining protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24191"
FT                   /protein_id="BAI24191.1"
FT                   /translation="MVTVAELQALRQARLDLLTGKRVVSVQKDGRRIEYTAASLDELNR
FT                   AINDAESVLGTTRRRRRPLGVRL"
FT   CDS_pept        917493..919085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0871"
FT                   /product="putative portal protein"
FT                   /note="Prophage ECO26_P02"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0871"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24192"
FT                   /protein_id="BAI24192.1"
FT                   /translation="MKRTPVLIDVNGVPLRESLSYNGGGAGFGGQMAEWLPPAQSADAA
FT                   LLPALRLGNARADDLVRNNGIAANAVALHKDHIVGHMFLISYRPNWRWLGMRETAAKSF
FT                   VDEVEAAWSEYAEGMSGEIDVEGKRTFTEFIREGVGVHAFNGEIFVQPVWDTETTQLFR
FT                   TRFKAVSPKRVDTPGHGMGNRFLRAGVEVDRYGRAVAYHICEDDFPFSGSGRWERIPRE
FT                   LPTGRPAMLHIFEPVEDGQTRGANQFYSVMERLKMLDSLQATQLQSAIVKAMYAATIES
FT                   ELDTEKAFEYIAGAPQGQKDNPLINILDKFSTWYDTNNVTLGGVKIPHLFPGDDLKLQT
FT                   AQDSDNGFSALEQALLRYIAAGLGVSYEQLSRDYSKVSYSSARASANESWRYFMGRRKF
FT                   IASRLATQMFSCWLEEALLRGIIRPPRARFDFYQARSAWSRAEWIGAGRMAIDGLKEVQ
FT                   ESVMRIEAGLSTYEKELALMGEDYQDIFRQQVRESAERQKAGLSRPVWIAQAYEQQIAE
FT                   SRRPEEETTPRET"
FT   CDS_pept        919075..919251
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0872"
FT                   /note="Prophage ECO26_P02; predicted head protein/prohead
FT                   protease, N-terminal fragment"
FT   mobile_element  919248..921701
FT                   /mobile_element_type="insertion sequence:ISEc22"
FT   CDS_pept        919329..919733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0873"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /note="predicted protein Orf1 in insertion sequence ISEc22"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0873"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24193"
FT                   /protein_id="BAI24193.1"
FT                   /translation="MKSLTAVRKKSPNYPVEFKIKMVELSHRPEISVAQLAREHGINDN
FT                   LLFKWRQYWREGKLRPPSTTENNVPELLPITLDAEDVVPTTSPRSQPVAAATPESLNIS
FT                   CEVTFRHGSLRLNGAISENILNLLIRELKR"
FT   CDS_pept        919784..920077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0874"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /note="predicted protein Orf2 in insertion sequence ISEc22"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0874"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24194"
FT                   /protein_id="BAI24194.1"
FT                   /translation="MRNGFNGLAAKVQTTLKDDPMSGHVFIFRGRNGSQVKLLWSTGDG
FT                   LCLLTKRLERGRFAWPSARDGKAFLTPAQLAMLLEGIDWRQPKRLLTSLTML"
FT   CDS_pept        920126..921664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO26_0875"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO26_P02"
FT                   /note="predicted protein Orf3 in insertion sequence ISEc22"
FT                   /db_xref="EnsemblGenomes-Gn:ECO26_0875"
FT                   /db_xref="EnsemblGenomes-Tr:BAI24195"
FT                   /protein_id="BAI24195.1"
FT                   /translation="MSSSLPDDINALKRLLAEQEAL