(data stored in SCRATCH3701 zone)

EMBL: AP011112

ID   AP011112; SV 1; circular; genomic DNA; STD; PRO; 1743135 BP.
XX
AC   AP011112;
XX
PR   Project:PRJDA34131;
XX
DT   13-FEB-2010 (Rel. 103, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 4)
XX
DE   Hydrogenobacter thermophilus TK-6 DNA, complete genome.
XX
KW   .
XX
OS   Hydrogenobacter thermophilus TK-6
OC   Bacteria; Aquificae; Aquificales; Aquificaceae; Hydrogenobacter.
XX
RN   [1]
RP   1-1743135
RA   Arai H.;
RT   ;
RL   Submitted (25-MAR-2009) to the INSDC.
RL   Contact:Hiroyuki Arai The University of Tokyo, Department of Biotechnology;
RL   Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan
XX
RN   [2]
RX   DOI; 10.1128/JB.00158-10.
RX   PUBMED; 20348262.
RA   Arai H., Kanbe H., Ishii M., Igarashi Y.;
RT   "Complete genome sequence of the thermophilic, obligately
RT   chemolithoautotrophic hydrogen-oxidizing bacterium Hydrogenobacter
RT   thermophilus TK-6";
RL   J. Bacteriol. 192(10):2651-2652(2010).
XX
DR   MD5; ada6627a9afb67ef682b5c075a181fe2.
DR   BioSample; SAMD00060961.
DR   EnsemblGenomes-Gn; EBG00001092839.
DR   EnsemblGenomes-Gn; EBG00001092840.
DR   EnsemblGenomes-Gn; EBG00001092841.
DR   EnsemblGenomes-Gn; EBG00001092842.
DR   EnsemblGenomes-Gn; EBG00001092843.
DR   EnsemblGenomes-Gn; EBG00001092844.
DR   EnsemblGenomes-Gn; EBG00001092845.
DR   EnsemblGenomes-Gn; EBG00001092846.
DR   EnsemblGenomes-Gn; EBG00001092847.
DR   EnsemblGenomes-Gn; EBG00001092848.
DR   EnsemblGenomes-Gn; EBG00001092849.
DR   EnsemblGenomes-Gn; EBG00001092850.
DR   EnsemblGenomes-Gn; EBG00001092851.
DR   EnsemblGenomes-Gn; EBG00001092852.
DR   EnsemblGenomes-Gn; EBG00001092853.
DR   EnsemblGenomes-Gn; EBG00001092854.
DR   EnsemblGenomes-Gn; EBG00001092855.
DR   EnsemblGenomes-Gn; EBG00001092856.
DR   EnsemblGenomes-Gn; EBG00001092857.
DR   EnsemblGenomes-Gn; EBG00001092858.
DR   EnsemblGenomes-Gn; EBG00001092859.
DR   EnsemblGenomes-Gn; EBG00001092860.
DR   EnsemblGenomes-Gn; EBG00001092861.
DR   EnsemblGenomes-Gn; EBG00001092862.
DR   EnsemblGenomes-Gn; EBG00001092863.
DR   EnsemblGenomes-Gn; EBG00001092864.
DR   EnsemblGenomes-Gn; EBG00001092865.
DR   EnsemblGenomes-Gn; EBG00001092866.
DR   EnsemblGenomes-Gn; EBG00001092867.
DR   EnsemblGenomes-Gn; EBG00001092868.
DR   EnsemblGenomes-Gn; EBG00001092869.
DR   EnsemblGenomes-Gn; EBG00001092870.
DR   EnsemblGenomes-Gn; EBG00001092871.
DR   EnsemblGenomes-Gn; EBG00001092872.
DR   EnsemblGenomes-Gn; EBG00001092873.
DR   EnsemblGenomes-Gn; EBG00001092874.
DR   EnsemblGenomes-Gn; EBG00001092875.
DR   EnsemblGenomes-Gn; EBG00001092876.
DR   EnsemblGenomes-Gn; EBG00001092877.
DR   EnsemblGenomes-Gn; EBG00001092878.
DR   EnsemblGenomes-Gn; EBG00001092879.
DR   EnsemblGenomes-Gn; EBG00001092880.
DR   EnsemblGenomes-Gn; EBG00001092881.
DR   EnsemblGenomes-Gn; EBG00001092882.
DR   EnsemblGenomes-Gn; EBG00001092884.
DR   EnsemblGenomes-Gn; EBG00001092885.
DR   EnsemblGenomes-Gn; EBG00001092886.
DR   EnsemblGenomes-Gn; EBG00001092887.
DR   EnsemblGenomes-Gn; EBG00001092888.
DR   EnsemblGenomes-Gn; EBG00001092889.
DR   EnsemblGenomes-Gn; EBG00001092890.
DR   EnsemblGenomes-Gn; EBG00001092891.
DR   EnsemblGenomes-Gn; HTH_r01.
DR   EnsemblGenomes-Gn; HTH_r02.
DR   EnsemblGenomes-Gn; HTH_r03.
DR   EnsemblGenomes-Gn; HTH_s01.
DR   EnsemblGenomes-Gn; HTH_t01.
DR   EnsemblGenomes-Gn; HTH_t02.
DR   EnsemblGenomes-Gn; HTH_t03.
DR   EnsemblGenomes-Gn; HTH_t04.
DR   EnsemblGenomes-Gn; HTH_t05.
DR   EnsemblGenomes-Gn; HTH_t06.
DR   EnsemblGenomes-Gn; HTH_t07.
DR   EnsemblGenomes-Gn; HTH_t08.
DR   EnsemblGenomes-Gn; HTH_t09.
DR   EnsemblGenomes-Gn; HTH_t10.
DR   EnsemblGenomes-Gn; HTH_t11.
DR   EnsemblGenomes-Gn; HTH_t12.
DR   EnsemblGenomes-Gn; HTH_t13.
DR   EnsemblGenomes-Gn; HTH_t14.
DR   EnsemblGenomes-Gn; HTH_t15.
DR   EnsemblGenomes-Gn; HTH_t16.
DR   EnsemblGenomes-Gn; HTH_t17.
DR   EnsemblGenomes-Gn; HTH_t18.
DR   EnsemblGenomes-Gn; HTH_t19.
DR   EnsemblGenomes-Gn; HTH_t20.
DR   EnsemblGenomes-Gn; HTH_t21.
DR   EnsemblGenomes-Gn; HTH_t22.
DR   EnsemblGenomes-Gn; HTH_t23.
DR   EnsemblGenomes-Gn; HTH_t24.
DR   EnsemblGenomes-Gn; HTH_t25.
DR   EnsemblGenomes-Gn; HTH_t26.
DR   EnsemblGenomes-Gn; HTH_t27.
DR   EnsemblGenomes-Gn; HTH_t28.
DR   EnsemblGenomes-Gn; HTH_t29.
DR   EnsemblGenomes-Gn; HTH_t30.
DR   EnsemblGenomes-Gn; HTH_t31.
DR   EnsemblGenomes-Gn; HTH_t32.
DR   EnsemblGenomes-Gn; HTH_t33.
DR   EnsemblGenomes-Gn; HTH_t34.
DR   EnsemblGenomes-Gn; HTH_t35.
DR   EnsemblGenomes-Gn; HTH_t36.
DR   EnsemblGenomes-Gn; HTH_t37.
DR   EnsemblGenomes-Gn; HTH_t38.
DR   EnsemblGenomes-Gn; HTH_t39.
DR   EnsemblGenomes-Gn; HTH_t40.
DR   EnsemblGenomes-Gn; HTH_t41.
DR   EnsemblGenomes-Gn; HTH_t42.
DR   EnsemblGenomes-Gn; HTH_t43.
DR   EnsemblGenomes-Gn; HTH_t44.
DR   EnsemblGenomes-Tr; EBT00001547092.
DR   EnsemblGenomes-Tr; EBT00001547094.
DR   EnsemblGenomes-Tr; EBT00001547096.
DR   EnsemblGenomes-Tr; EBT00001547097.
DR   EnsemblGenomes-Tr; EBT00001547098.
DR   EnsemblGenomes-Tr; EBT00001547099.
DR   EnsemblGenomes-Tr; EBT00001547102.
DR   EnsemblGenomes-Tr; EBT00001547104.
DR   EnsemblGenomes-Tr; EBT00001547107.
DR   EnsemblGenomes-Tr; EBT00001547109.
DR   EnsemblGenomes-Tr; EBT00001547112.
DR   EnsemblGenomes-Tr; EBT00001547115.
DR   EnsemblGenomes-Tr; EBT00001547117.
DR   EnsemblGenomes-Tr; EBT00001547119.
DR   EnsemblGenomes-Tr; EBT00001547121.
DR   EnsemblGenomes-Tr; EBT00001547123.
DR   EnsemblGenomes-Tr; EBT00001547125.
DR   EnsemblGenomes-Tr; EBT00001547128.
DR   EnsemblGenomes-Tr; EBT00001547130.
DR   EnsemblGenomes-Tr; EBT00001547133.
DR   EnsemblGenomes-Tr; EBT00001547135.
DR   EnsemblGenomes-Tr; EBT00001547136.
DR   EnsemblGenomes-Tr; EBT00001547137.
DR   EnsemblGenomes-Tr; EBT00001547139.
DR   EnsemblGenomes-Tr; EBT00001547141.
DR   EnsemblGenomes-Tr; EBT00001547143.
DR   EnsemblGenomes-Tr; EBT00001547145.
DR   EnsemblGenomes-Tr; EBT00001547146.
DR   EnsemblGenomes-Tr; EBT00001547148.
DR   EnsemblGenomes-Tr; EBT00001547151.
DR   EnsemblGenomes-Tr; EBT00001547153.
DR   EnsemblGenomes-Tr; EBT00001547156.
DR   EnsemblGenomes-Tr; EBT00001547159.
DR   EnsemblGenomes-Tr; EBT00001547162.
DR   EnsemblGenomes-Tr; EBT00001547164.
DR   EnsemblGenomes-Tr; EBT00001547166.
DR   EnsemblGenomes-Tr; EBT00001547167.
DR   EnsemblGenomes-Tr; EBT00001547169.
DR   EnsemblGenomes-Tr; EBT00001547172.
DR   EnsemblGenomes-Tr; EBT00001547175.
DR   EnsemblGenomes-Tr; EBT00001547177.
DR   EnsemblGenomes-Tr; EBT00001547179.
DR   EnsemblGenomes-Tr; EBT00001547182.
DR   EnsemblGenomes-Tr; EBT00001547184.
DR   EnsemblGenomes-Tr; EBT00001547186.
DR   EnsemblGenomes-Tr; EBT00001547189.
DR   EnsemblGenomes-Tr; EBT00001547191.
DR   EnsemblGenomes-Tr; EBT00001547193.
DR   EnsemblGenomes-Tr; EBT00001547195.
DR   EnsemblGenomes-Tr; EBT00001547197.
DR   EnsemblGenomes-Tr; EBT00001547200.
DR   EnsemblGenomes-Tr; EBT00001547202.
DR   EnsemblGenomes-Tr; HTH_r01-1.
DR   EnsemblGenomes-Tr; HTH_r02-1.
DR   EnsemblGenomes-Tr; HTH_r03-1.
DR   EnsemblGenomes-Tr; HTH_s01-1.
DR   EnsemblGenomes-Tr; HTH_t01-1.
DR   EnsemblGenomes-Tr; HTH_t02-1.
DR   EnsemblGenomes-Tr; HTH_t03-1.
DR   EnsemblGenomes-Tr; HTH_t04-1.
DR   EnsemblGenomes-Tr; HTH_t05-1.
DR   EnsemblGenomes-Tr; HTH_t06-1.
DR   EnsemblGenomes-Tr; HTH_t07-1.
DR   EnsemblGenomes-Tr; HTH_t08-1.
DR   EnsemblGenomes-Tr; HTH_t09-1.
DR   EnsemblGenomes-Tr; HTH_t10-1.
DR   EnsemblGenomes-Tr; HTH_t11-1.
DR   EnsemblGenomes-Tr; HTH_t12-1.
DR   EnsemblGenomes-Tr; HTH_t13-1.
DR   EnsemblGenomes-Tr; HTH_t14-1.
DR   EnsemblGenomes-Tr; HTH_t15-1.
DR   EnsemblGenomes-Tr; HTH_t16-1.
DR   EnsemblGenomes-Tr; HTH_t17-1.
DR   EnsemblGenomes-Tr; HTH_t18-1.
DR   EnsemblGenomes-Tr; HTH_t19-1.
DR   EnsemblGenomes-Tr; HTH_t20-1.
DR   EnsemblGenomes-Tr; HTH_t21-1.
DR   EnsemblGenomes-Tr; HTH_t22-1.
DR   EnsemblGenomes-Tr; HTH_t23-1.
DR   EnsemblGenomes-Tr; HTH_t24-1.
DR   EnsemblGenomes-Tr; HTH_t25-1.
DR   EnsemblGenomes-Tr; HTH_t26-1.
DR   EnsemblGenomes-Tr; HTH_t27-1.
DR   EnsemblGenomes-Tr; HTH_t28-1.
DR   EnsemblGenomes-Tr; HTH_t29-1.
DR   EnsemblGenomes-Tr; HTH_t30-1.
DR   EnsemblGenomes-Tr; HTH_t31-1.
DR   EnsemblGenomes-Tr; HTH_t32-1.
DR   EnsemblGenomes-Tr; HTH_t33-1.
DR   EnsemblGenomes-Tr; HTH_t34-1.
DR   EnsemblGenomes-Tr; HTH_t35-1.
DR   EnsemblGenomes-Tr; HTH_t36-1.
DR   EnsemblGenomes-Tr; HTH_t37-1.
DR   EnsemblGenomes-Tr; HTH_t38-1.
DR   EnsemblGenomes-Tr; HTH_t39-1.
DR   EnsemblGenomes-Tr; HTH_t40-1.
DR   EnsemblGenomes-Tr; HTH_t41-1.
DR   EnsemblGenomes-Tr; HTH_t42-1.
DR   EnsemblGenomes-Tr; HTH_t43-1.
DR   EnsemblGenomes-Tr; HTH_t44-1.
DR   EuropePMC; PMC2863560; 20348262.
DR   EuropePMC; PMC4751853; 26637598.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; AP011112.
DR   SILVA-SSU; AP011112.
DR   StrainInfo; 160150; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1743135
FT                   /organism="Hydrogenobacter thermophilus TK-6"
FT                   /strain="TK-6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:608538"
FT   CDS_pept        100..1299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HTH_0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68468"
FT                   /db_xref="GOA:D3DF66"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF66"
FT                   /protein_id="BAI68468.1"
FT                   /translation="MERQDFLSFIEQADKFAVGIFRQFKIEERDNSVILIAPTEAYKRW
FT                   AMEYIKSRVFNYGKRIEVRSAGEREKNEAYPSNLIEKYSFDNFVVGKANELVYKVCIEV
FT                   AEYPGSSFNPLFIYGKVGLGKTHLLHAIGNRARDGGYKVIYSPITDFSDEMIAYLKKGQ
FT                   IEAFRNKYSSVDVLLLDDVQFLSGKERTQIELFRVFESIYSKDKQMVLVSDRHPKDLKD
FT                   ISDRLISRFESGLVIEIGLDDETKLSIIKQKLILYGMPLDQKVIDHIFENTGYNVREIE
FT                   GAIKTLKVVGIKETPKKKSVKDINFVVEFTARHFKLKPEDLKKEGKERKIINARHIAMY
FT                   LCKMVLGTSYAEISRYFGKKDHTSAIYSIRKVEEKIRQDRKFKYMMTFLERHLRKELEL
FT                   "
FT   CDS_pept        1321..2289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68469"
FT                   /db_xref="GOA:D3DF67"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF67"
FT                   /protein_id="BAI68469.1"
FT                   /translation="MKRLIILLGAGCTFAQPLIKPQLADRLFPYITYSSVWSGTPAALK
FT                   DVAVPNILIVYGEKEDPQVVAQAGKIAYYLGQWTDDIGFGAQEVKMSKIPELLITDKQL
FT                   KSIDYKNIVVVGTNNHVVRELGLSFDRPTIEVIQKDGKNIMVVGGKDSQEVIQAAKYLA
FT                   DVRLNFKAGAYRTFFSFVALRGYIERGEFDAAYRLVKNPAGLSACGKNMSLAAPMVANW
FT                   SDDVKNVVKVRNAILYTELPKALEEKNKEKAVELWQKAMFTCYQCHQGIGIPQMRKFKP
FT                   LEEIHSKHQRIAESFGLVKVVGDQKSCIACHRGDTQIRGYK"
FT   CDS_pept        2291..2920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68470"
FT                   /db_xref="GOA:D3DF68"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF68"
FT                   /protein_id="BAI68470.1"
FT                   /translation="MVKRAVIILLFPFVLVLFCVRLAFTEFFVEWEYSKKNFPEDRWGL
FT                   SKDVRLHIAKLGLRAVLSDEGMREFKASGFFSSREIKHMEDVKRFLSIIFPAFYLLSAI
FT                   LFALLISLGSLKETGRMLMLGGLLVDVIAFVFFSLSLIDYNWLFVNFHNLVFDPYSWRF
FT                   RDYDMLLRVYPMKFWFDATVSVIVLTLILAAILQAVGFLLVKINRN"
FT   CDS_pept        complement(2897..3568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0004"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68471"
FT                   /db_xref="GOA:D3DF69"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF69"
FT                   /protein_id="BAI68471.1"
FT                   /translation="MNVVITGGSRGIGKATVIRFIKEGHQVCTCSRNEEALKFLWEELG
FT                   KPENLFIKACDVSERQSAKEFVKFCAKLMGKFDVLINNASVLGLRESIEHYPEDVWEEV
FT                   IRVNINGVFYITKYAIPFMKDGGIIINLSSGAGKRPAPYWGAYAVSKFGIEGFSLLLAE
FT                   ELKSRNIKVYAFNPGATRTQMRALAYPQEDPSTLKPPEKVADFLIKLVNLRPNLVSIDF
FT                   Y"
FT   tRNA            complement(3575..3647)
FT                   /locus_tag="HTH_t01"
FT                   /product="tRNA-Val"
FT   tRNA            3705..3787
FT                   /locus_tag="HTH_t02"
FT                   /product="tRNA-Leu"
FT   CDS_pept        3799..4602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0005"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68472"
FT                   /db_xref="GOA:D3DF70"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF70"
FT                   /protein_id="BAI68472.1"
FT                   /translation="MRLFVAGDIIGKPGRRALRYMLKQYRQVVDLVIVNVENAAGGFGI
FT                   TKKVYEELKSMGVDLMTSGNHIWDNKEVFGFIDEVDDLLRPANYPDGVPGRGYGIFEKS
FT                   GVKFVLINLMGRSLLDSNLDNPFKTFDRIYQEVSKETNIILVDFHAETTSEKWAFGIYA
FT                   DGRASLVYGTHTHVPTADQIVLKHGTGYITDVGMSGCWYSAIGMKPKEAIERFLTGIPQ
FT                   KYQVEEQEDVVFNGILVEIDPFTGKTTAIERLQRYIKREELLGVL"
FT   CDS_pept        4602..5171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0006"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68473"
FT                   /db_xref="GOA:D3DF71"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF71"
FT                   /protein_id="BAI68473.1"
FT                   /translation="MKEDILLCITGASGSIYGYRLLEVLYESFHVHLVISPSGSLVMKE
FT                   ELGLGREDLLKRFPRLHLIPHSKVDSEVASGSRLINYRGVIVAPCSMSTLACIANGINQ
FT                   NLIHRSCEVALKERVPLVLLLREMPYSIIHIENMLKVAKAGAVVMSASPGFYHKPKSLQ
FT                   ELVDFVVGKVLDSLGIDHHLYQRWKA"
FT   CDS_pept        complement(5168..6547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0007"
FT                   /product="sodium/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68474"
FT                   /db_xref="GOA:D3DF72"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF72"
FT                   /protein_id="BAI68474.1"
FT                   /translation="MLILFVILYMLITIGIGLVASRFVKSTKDFLLAGRSLPLYISAAA
FT                   LFATWFGSETVLGASSKIAKDGLYGVIEDHFGAALCLFLVGLFFAKPLYRMNLLTFGDF
FT                   YRVLYGRKVEVVASIMLSLSYLGWIAAQMVAIGIILQVTLSIPKEVGILVGFGVVLFYT
FT                   FLGGMWSVSLTDFIQTVMIVVGLVFVLHEVSHGFSQLIPVLESQPPGFYKFFPDNNIKD
FT                   ILSYIAAWITIGLGSIPQQDVFQRIMSSRSERVAVLSCFVAGFMYLTVAMIPLILALFA
FT                   KAYYPELLQLDAQLLLPRMVMDHTSLLTQVLFLGALLSAIMSTASGALLAPSAVLSENL
FT                   IKPLFRQLSDRAFLWVTRVCILFVALLSLLFAFMGESIYELVAASSALSLVSLFVPLVA
FT                   GLYFKSSNSVSAISSILLGFVSWLTVYPLSAEYSLLVGLLFSTVGYLLPLVVKRAYAKA
FT                   F"
FT   CDS_pept        complement(6549..7730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amnT1"
FT                   /locus_tag="HTH_0008"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68475"
FT                   /db_xref="GOA:D2Z0H8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2Z0H8"
FT                   /protein_id="BAI68475.1"
FT                   /translation="MNLSKRVSHIKPAPTLQISAKINELKAKGVDLVGFGAGEPDFDTP
FT                   DFVKEACIRALKDGKTKYTPSAGILELREALSEKLQRENSVQYSPSEIVVTAGAKMALY
FT                   LIFMTVLEEGDEVLLPSPYWVTYPEQIMLCGGIPVVVPLKEEKGFVLSVDDIKPHVSKR
FT                   TKMLVLNSPCNPTGAVVPEEELRKVVEFCIENNILIISDECYEAFLYDGKRFVSPASFS
FT                   KEAREITFTVNAFSKTYSMTGWRVGYVAAPAKYAKVMADINSQTISNATSFAQYGALEA
FT                   LKNPKAKEFVKEMKWTFERRRNLAYQLLLEIPNISLVKPEGAFYIFPNLSAYLGKLGSD
FT                   IKLVEYLIEKGRAACVPGSAFGAEGYVRLSYCVSEDTIREGIRRIKQALEELS"
FT   CDS_pept        complement(7727..8542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="HTH_0009"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68476"
FT                   /db_xref="GOA:D3DF74"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF74"
FT                   /protein_id="BAI68476.1"
FT                   /translation="MGILEGKRALITGIANEKSIAYGIAKAFHREGAELAFTYANEKLK
FT                   SRVEEIAHEFGSHLTFECDVSKDEHIKAIGSALRSAWGSLDILVHSIAFAPREEFKGGV
FT                   IDTTREGFKIAMDISVYSLIALTRELLPLMRSGGAILTLTYYGAEKVVPHYNVMGIAKA
FT                   ALESTVRYLAYDIAKYELRINAISAGPVKTLAAYSITGFHLLMEHTTKVNPFGRAITIE
FT                   EVGDTAVFLCSELSRAITGEVLHVDNGYHIMGVFGREEEIKREVFGESS"
FT   CDS_pept        complement(8555..9352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0010"
FT                   /product="putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68477"
FT                   /db_xref="GOA:D3DF75"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF75"
FT                   /protein_id="BAI68477.1"
FT                   /translation="MTSVGKAVRLERIIDRNTGNTIIVPMDHGVSSGPIEGIVDIRSAV
FT                   NDVAEGGANAVVLHKGMVKAGHRGRGKDIGLIVHLSASTDLSPTKNDKVLVCTVEEAIK
FT                   LGADGVSVHVNIGADMEREMLRDLGYVSRVCEEWGMPLLAMVYGRGKDINQYDPKVIAH
FT                   CARIGAELGADIVKVPYSGDPESFRRVVEGSPVPVVIAGGPKMKTDREVLEMVKGAMQA
FT                   GARGLSVGRNIFQAKDRVKMVRALAHIVHKGGTLEEAMAILNQ"
FT   CDS_pept        complement(9356..10063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68478"
FT                   /db_xref="GOA:D3DF76"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF76"
FT                   /protein_id="BAI68478.1"
FT                   /translation="MEDRMHFEDLFYWLISTFVNLVLFTFLSYLLLLKINIKEEMPPLN
FT                   VSLETPKEVLQEVKFSKGRHMYIKPKEGKHTLAKGKGSASLTPMVMERKEGDAALPSGK
FT                   ETQEDVSILSSVEEKVKGRKETQEEGVPAKEVGEVSAVISKGSVGFGGGAGRGILYVPP
FT                   LPKLVSEELPSTLRIRVWVEPSGEVSRVQILQRSGVPDIDERLAQFVRRIKFEPIKENV
FT                   VQTGILTFRFKGG"
FT   CDS_pept        complement(10073..10483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="HTH_0012"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68479"
FT                   /db_xref="GOA:D3DF77"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF77"
FT                   /protein_id="BAI68479.1"
FT                   /translation="MPKIVGVVGYHNTGKTTLIEKLSKELSLRGYKVGYIKHDPKGHGI
FT                   TDKEGSDTYRLFKVLDKVALLTEGKLTLWERVEDDPLHIVERYFSDFDVVILEGWKSLK
FT                   GVKKIVLGDLPIEGFHMDESTSLEEVISYVML"
FT   CDS_pept        complement(10486..11868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="HTH_0013"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68480"
FT                   /db_xref="GOA:D3DF78"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF78"
FT                   /protein_id="BAI68480.1"
FT                   /translation="MQVKFGTDGWRAVIGEDFTFENVKRVAFAHAKVLSEQGKKKVIVG
FT                   YDHRFMSEMFAQEVCRVFKAMGFEAYITNRSCTTPMVSFAIKYMGFDGGVMITASHNPP
FT                   EYNGYKIKDSFGGSATEGLVKRVEQELSSAEIVDTRGIKVESINVWGEYIRKVKDFINT
FT                   ELFYEKEVLIVHDAMYGSSVNTYSQVLAGTKISTIPIRSYRDPLFGGHAPEPVEKHLLP
FT                   LMEKVRSVGAFLGIANDGDGDRIALVDERGKFVNAQLVYVLLLYHLLKNKGIKDGIVVK
FT                   TVSTTYLADRICQREGVELKEVAVGFKNINELILQEKVIFGGEESGGYGIVHFLPERDG
FT                   LFSGLNILELLLLKDKNLSQIIEEIFKNYGSAYYRRYDMRAEEDKKKKLAELKSHPPER
FT                   LAVHKVKKINTSDGLKLVFENDGWILFRASGTEPLIRVYVEMPTEEEVERVLQEGIKLF
FT                   EG"
FT   tmRNA           11915..12258
FT                   /locus_tag="HTH_s01"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 120.18"
FT   CDS_pept        complement(12264..12929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0014"
FT                   /product="putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68481"
FT                   /db_xref="GOA:D3DF79"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF79"
FT                   /protein_id="BAI68481.1"
FT                   /translation="MEIDKIIRSKRKTITLQITDNATLIVKAPFEVSEETIRKFVIKHS
FT                   KWIEEKKKEILSRDPKFAKKEFVSGEGFLYLGKSYKLYIVNQQDTPLKFDNGFFLLRDY
FT                   QPLAKGLFIKWYKERAYEKISERVQLYAQKRGFIYNKVSITKAEKRWGSCSSSGNLNFS
FT                   WRLIMAPLPVIDYVVVHELVHLIEKSHGKAFWDKVKVLMPDYEKHREWLKNNGHLLRL"
FT   CDS_pept        complement(12919..16086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="HTH_0015"
FT                   /product="type I restriction-modification system R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68482"
FT                   /db_xref="GOA:D3DF80"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF80"
FT                   /protein_id="BAI68482.1"
FT                   /translation="MYAKLDEEYYVENPFLAQLQKIGWKIYRQNKNNPEDVKEIISFDS
FT                   NGEPIYGNSVKFRESFREVILEDELKKSIKRINPWIEDDQINEVVRRITTPQANSLIEA
FT                   NREIHDLLIENTSVSENRKTGEKSPTVRYIDFKNPDNNSFIAISQFKVNIPGTGKHIIP
FT                   DIVLFVNGLPLVVVECKSPAITDPITEAITQLMRYSNRRGAKEGNEKLFWYNLFMIATS
FT                   KQVAKLGTITSGYEHFNEWKDPYPYTLLDINKNGTITSQDVLIQGTLTKNNLLDILRIF
FT                   TLFVEDSKGPGVIKIVPRYHQFRAVKKIVKRIKEGQTPEEKGGIVWHTQGSGKSLTMML
FT                   TVRAINKDPELSKFKIVFITDREQLEKQLRATSKSVGYTVNHADSIEKLKELLRTDTPD
FT                   LVMAMIHKFQERDLSAKFPTLNESPNILVLIDEAHRTQYNILGANLRKALPNSVKIAFT
FT                   GTPIEKTEQTFGDYIDKYTIKQAVEDGVTVEIVYEGRAHLAEISDEEAANAKFESVFYA
FT                   FDNEEKQLILGKYTWKSYLENENVIKEKAKDIIEHYITHIFPNGFKAQVIAVSRLAAVR
FT                   YKEKLEEALKEKIAELEKNNPNNIDIDTLKRLKVAVIISGTPNDDPQIYKKEYTDVNEH
FT                   DKNIKSFKMPFNKSDEKIGINGDVGIIVVNEMLVTGFDAPIEQALYLDNVLKGHRLLQA
FT                   IARVNRVYKNKYCGYVVDYVGVFNHLKEALAVYSDSDIEEISQTVVNKSKIKDELKYIH
FT                   NQIEDFFKKFKISNWRENIDECIDLLEDEEIREEFITLVRKFNSTLDKLLPDPEALKYT
FT                   KDLKVINFIKEAARQRYRDDKLSIKDVSNKIREIVEQYLVSKGIDPKIPPIPLLSDEFT
FT                   IKLKQKPPKAKAVELEYAIKEHIEKHFEEDPELYERFSDKLKKILEEYKENWDLLAEKL
FT                   ENLRIEIKKGREEENTYELDPKKEMPFLGLLKDMILGKEPLEKYSPDQVEFLVKLTKDI
FT                   LKIIKGKIKIVDFWENYTKQKELIGEIISHLLKQGRDNNIFNKRNEIAQRLLELAYHIY
FT                   GGKTDGN"
FT   CDS_pept        complement(16088..16213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68483"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF81"
FT                   /protein_id="BAI68483.1"
FT                   /translation="MSKKRTLKIILQDIIEEIEKIKKFKLPELEKAVNFLLEKES"
FT   CDS_pept        complement(16206..16496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0017"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68484"
FT                   /db_xref="GOA:D3DF82"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF82"
FT                   /protein_id="BAI68484.1"
FT                   /translation="MKNKIHQILQEHKSYLAEKFGVKEIAIFGSYARGEESSESDVDIL
FT                   VDFKEGYKTFDNYMDLKFYLEELLGKRVDLVIKSAVKPRLKTSIFEEAVYV"
FT   CDS_pept        complement(16493..17773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="HTH_0018"
FT                   /product="restriction endonuclease S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68485"
FT                   /db_xref="GOA:D3DF83"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF83"
FT                   /protein_id="BAI68485.1"
FT                   /translation="MGEDVKLPEGWKKVKLGEVIEKLRNGYVYSFSEIRKEGLPITRIE
FT                   TISEGKIDKSKLGYITEELRYKVNKYQMQRGDILFSHINSIEHIGKCAIYDGSIPTLIH
FT                   GMNLLLLRTKKHILDPFFLINFLKKEDIRSRLRNLSGQAVNQVSIKPSELAKFAIPLPP
FT                   LPEQQKIAEILETVDRAIEKTDKIIEKYKRIKQGLMQDLLTKGIDENGKIRSEKTHKFK
FT                   DSPIGRIPEEWEVVRLGEVCFIIMGQSPSSVLINKKEKGIPFLQGNAEFTSKYPNPINW
FT                   IEKPLKIAKKESILLSVRAPVGALNIANREYCIGRGLCSIVTNKSITHNLFIWYYLQFS
FT                   INNLINLSQGSTFEAISSRELKNYSIPLPPLTEQQRIAEILSQIDNVIEKEQAYRQKLE
FT                   RIKKGLMEDLLTGKVRVNKLIKEEDKK"
FT   CDS_pept        complement(17766..20207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="HTH_0019"
FT                   /product="type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68486"
FT                   /db_xref="GOA:D3DF84"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF84"
FT                   /protein_id="BAI68486.1"
FT                   /translation="MEKKKITLRELETHLFKAADILRGKMDASEYKEYIFGMLFLKRMS
FT                   DVFDEEREKLFKEYKNLGYSDEEIKEILEDPNIYSETFFVPEKARWEYILTLKEDVGNQ
FT                   LNKALAALEEANPELEGVLKHIDFNAVKGKTRLKDQQLIDLIHHFNKYRLRNEDFEFPD
FT                   LLGAAYEYLLKEFADSAGKKGGEFYTPPSVKTLMVRLVKPKEGMRIYDPTVGSGGFLIE
FT                   ARQYVEEKGQNPKNLALYGQENNGVTWSICKMNMILHGIPDAQIENEDTLTNPKFVENG
FT                   YIKQFDIVLANPPFSQNYTRANMHFPERFKYGFTPETGKKADLMFLQHMIASLKPDGIM
FT                   ATVMPHGVLFRGGQEKVIREGIVKDDLIQAIIGLPPKLFYNTGIPACIIVINKRKPDHL
FT                   KNKILFINADREYGEGRNQNYLRPEDIEKIVTVFDNNLEIPKYSRLVDIKEIEENDFNL
FT                   NIRRYVDNSPEPEIENVHYHINGYIPKQELELYKPQMKKFNISLDNLFIEIDKDSLDFI
FT                   PYINEKSKIKEVIENYEGVKQTYDIHFQKLNEWWENVEKDIEAFAKNNNLWSFREKALE
FT                   DLKESLLPLGVLDEFKIAGVFVNWWENLRYDFKTIVSSGWSKTLIDDEMIERKFFAKEL
FT                   EEIEEIESNIAQVEGELNEILEEVEDWDEEDLGEKTTKKMKEFIKQTINDLLSNGNEAA
FT                   VKEAQKWKDLAEKINEKEKELKNLNKELKQKQQELAKIIREKRETLTEEEAKGLVLEKF
FT                   KESIKQELEKYINAEKKEVIKIFEKLWDKYKISLNQLITERDEEVKKLNEFLKQLGYIN
FT                   G"
FT   CDS_pept        complement(20210..21112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0020"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68487"
FT                   /db_xref="GOA:D3DF85"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF85"
FT                   /protein_id="BAI68487.1"
FT                   /translation="MDVQKIVQDVSSVLKGKEEVITYSLVCFLSGGHLILEDVPGVGKT
FT                   TLALAISKVLGLSFARVQFTSDLLPSDITGVSVYDQSKKTFVFKQGPIFHNIVLADEIN
FT                   RATPKTQSALLEAMAEGKVSVDGITYELPFPFFVIATQNPVEQYGTYPLPESQLDRFSM
FT                   RLSLGYPDPDTEVQIIMGENPIEKVSRLNPAVKPQELISAIQQIKRFYVSPDVGKFVVE
FT                   IVNQTRNHPDVLLGVSTRGAIHLVSCARALAYVKGRDFIVPEDVIELAPLVLPHRIITR
FT                   TDSDPKAIIEEILTKVEVP"
FT   CDS_pept        21144..21617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68488"
FT                   /db_xref="GOA:D3DF86"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF86"
FT                   /protein_id="BAI68488.1"
FT                   /translation="MQINEKSIVEKVRQLAEPIIKNLGFKLFDVEFKPERGWVLRVILD
FT                   KDGGITVNDCEEVSKRLSALLDVEDIIPTSYILEVSSPGLTRELTKPEHYEFFKGRLIR
FT                   LVLREALEGKRELKGYIVDVKEGILQLREKDSGKMFHTPLSIVARAHLEIEGW"
FT   CDS_pept        21611..22594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="HTH_0022"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68489"
FT                   /db_xref="GOA:D3DF87"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF87"
FT                   /protein_id="BAI68489.1"
FT                   /translation="MVKNLKKLIEQVAKEKNLPEWIVEGALKNAIALAVKKDRKLKEHL
FT                   QVELLEEGIKVYIVKRNNSETVRFPLEISTEDVNRIAAYAAKEEFLKELEKAEEERGYL
FT                   EFVEQEGEITVGIVRRVLENGDVLVDLGRVMGVLPKREQIPKESYRQGERIKALVLEVR
FT                   KHRGRYEIILSRTHPKFLRKLLEAEVPEIKSGEIEIKAITREPGERAKVLVHAKDMKMD
FT                   PVGVIVGLRGSRINPVSKELSGEKIDVIRWTENVEELIKKSLSPAPVTKVRLIPKDKRA
FT                   EVAVPKEKLSLAIGKHGVNVKLANRITGWYIDVLSEEDFEKLSALR"
FT   CDS_pept        22591..23853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmA"
FT                   /locus_tag="HTH_0023"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68490"
FT                   /db_xref="GOA:D3DF88"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF88"
FT                   /protein_id="BAI68490.1"
FT                   /translation="MKVLPELSIKKIVYGGYGLAEYKGKKVFVRYAAPMELLSAQVIKE
FT                   KGDHIEATAKEVIISSPSRKDPPCRYYYYCGGCQLQHIDTDQQVRIKEDILIESLRRIG
FT                   NLEISALGESIRSKQDFGYRTRVQFKVSNGSLGFFAWGTHELVKIDQCLLVHPAMNDLI
FT                   PSLQELSKKIPHLQELHVLYSPSEDEFLLKVITPTIYDAEKLRKLKENVLPKKVVGIGN
FT                   YSKLGDHLLKRYHIGRSFTFMQVKNYRYRVSNDSFFQINFTLWEDLLNSVVVRDKRRVI
FT                   ELHCGAGFFSIPLSEGNHFVISSDTNATAIKDAQYNAKLNSRDNIVFFHESAHQTLKKH
FT                   AGETIDLLFLDPPRGGLTTDELSLVLQNKPKEIVYVSCNPTTLARDLGKMVRGGYSLKS
FT                   VRLIDNFPQTYHIESVAYLEL"
FT   CDS_pept        24076..26379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="HTH_0024"
FT                   /product="ribonucleotide reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68491"
FT                   /db_xref="GOA:D3DF89"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF89"
FT                   /protein_id="BAI68491.1"
FT                   /translation="MYVTKRSGVGEPMDISKIRIVIDFACRGLRVDPLELEADAQIQFR
FT                   EGISTKEIQQLLIRTAAEKVSPENPDWQYVAARLLLYDLYKDVGHIRGYKVKDKINGRY
FT                   KPYNPESFYNLVKNYAEKGIYGEYLLREYSKEDFQALASYIKPDRDLLFNYTGIKVLYD
FT                   RYLVRDEEGNVIELPQEMYMLISMSLALPEKKEERIKWVKTFYDLMSKHEVSLATPTLM
FT                   NARRPHTQLSSCFVLTVDDDLYDIFDNVQKAGQISKFAGGLGIYLGKVRATGSPIRKFK
FT                   GASSGVLPVVKILNDVMVYVDQLGMRKGSASITLDIWHKDVMDFLEVKTNVGDERKKAH
FT                   DIHPAISIPDIFMKRLKNREKWTLLDPYYCKNVKDGKNLEDFYGEEFEELYQRLERELP
FT                   PNAKKEVDAFELWKRLLTVVFETGEPYIFFRDTANRLNPNKHCGVVYSSNLCHEIVQNM
FT                   SASQHIEDSLDPQTGEIVHRKKSGDVVVCNLGSINLGKVYTKEDMERVVPLLVRMLDNV
FT                   ISINYYAIKEAEYTNRRYRAIGIGVSNYHYCLVKNAIQWESEEHLKFANALFERIAYYA
FT                   IKGSMELAKERGRYPLFEGSDWSKGVFFGRDAEENQRMSEKNGNNLNWIELAEEVKTYG
FT                   LRNAYLLALMPTGSTSLIIGATPSVDPIFAKFYKEENMSGILPQVPPEIDRYFWHYKSA
FT                   YSIDQEWIIRAASERQKWIDQAQSLNLFIDPEHVDGPTLSKLYELSWELGLKTVYYCRS
FT                   KSLTEIEECESCSS"
FT   CDS_pept        26392..27420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="HTH_0025"
FT                   /product="ribonucleotide reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68492"
FT                   /db_xref="GOA:D3DF90"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF90"
FT                   /protein_id="BAI68492.1"
FT                   /translation="MDRTIIFNPQGDRETSKRKVIFGNPTNIMELNNVKYQWAFDLYKT
FT                   MGFTNFWVPEEIPMHEDKKQYEKDLSPYEKRAYEMVLSFLIALDSYQVNMLKEFARYIT
FT                   APELVMALTSQEFQEALHSYSYQFILESVVEPQVADEIYNYWRQDTVLMERNQVIAQLY
FT                   NEFIRHPTEENFIKATFGNYVLESLYFYSGFAFFYTLGRQGKMRNTVQQIKYINRDELT
FT                   HVTLFRNIIQTIKQENPELFTPELEKWVYEFFKYATDAEIKWGQYVTQNQILGINNTLI
FT                   DRYIKYLANLRLTQLGYKPLYPEITENPMKWIDQFRTINDTKTDFFQAKPQTYAKRSEL
FT                   KW"
FT   CDS_pept        complement(27544..29034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0026"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68493"
FT                   /db_xref="GOA:D3DF91"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF91"
FT                   /protein_id="BAI68493.1"
FT                   /translation="MVWFYTFLVVLGTFLAVLGITSTNVAIPKMIAPLQTDIYGIEWVA
FT                   ISYIVATAITIIVFNFASARLGLKNTYILGLALFSLGSALSGQASSLEEMIAFRFLQGV
FT                   GEGFLIPSSQSILFNLFPPEKRGTAMGFYAMAVAFAPGLGPTVGGYMVEFLSWRWIFYM
FT                   NLPVVVLLLPVAYLMLPDLGERRKLPFNFFSFLFLSLASIAFIVFLSKGESWGWFYSMK
FT                   TFTAFCVFVASLLLFALSELTSRHTLIDYSVFKEPNYLYALITFVVVYGLVFFQVIYLL
FT                   PIYLESLKGVPTFQTGTTFLGFAILLGTFALIGGRLSDRTEPKLLLLISQSVLFLTLFF
FT                   FLSHVDYYTPRWKIALYMCFMGVAMGFFFAPLTALAFKSLKPHQIPIGTALYNYARLIG
FT                   ASIATSLATYTLETHRALHFDQINELRSALSSPAFVSYMQKLSGLEAFRYMVALGQFQN
FT                   LLAGTYAVQDAFKLASYMSILSIIITITFLLRYRKTRF"
FT   CDS_pept        complement(29010..30557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0027"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68494"
FT                   /db_xref="GOA:D3DF92"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF92"
FT                   /protein_id="BAI68494.1"
FT                   /translation="MQERPLYELVSPFERVMLTFSLMMGVFMAILDTTIVDIVVPKMMA
FT                   PLSTDLYGVQWVITSYMMAAASGILLVESLERYVGLRNVFISGLFLFTVASFLSGQAPS
FT                   LDWMIASRSLQGFGEALIVVSAEALLFSAYPPEKRGLAMGIYGLGVSFAPALGPTLGGY
FT                   ITEYINWRWVFYINLPVGIINLVLALSFLPDYKPQNAHGRLNLVSFLFLSSATVFLLIT
FT                   LSKGQQQGWWNSDFILYTSLISLFSFLLFFLSELASKESLIDYSIFSIKEFVVAILVYC
FT                   FLLGFSMYQVFYLIPLYYENLKGIGTLMTGIHILPLALAIGFSSPIAGVLGDKKGEILP
FT                   LGIAVLTYLYAVLFVMPQFNYFTPAWESSLKMILLGIGMGFFFAPITNLALKKLGEKTT
FT                   LGVSLMHYIRFVGGSFGTAIATNDLQKYMWESFQKTSEVQSYSAVSQYLLSLFHLGEER
FT                   AKAFFYGIEQLYAYSNAFESTFFSAGLWGLLGSLPIFYLLWTYLIRRARIWSGSTPS"
FT   CDS_pept        complement(30557..31684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0028"
FT                   /product="multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68495"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF93"
FT                   /protein_id="BAI68495.1"
FT                   /translation="MKRKVGLTIVISLMMVFSVIAFRWIKHRMEYAVTDAVFVKADQLS
FT                   NVGFQKVSGRVIKLYKDLGDEVKKSEVIAEIDPTDYQLNLQNIRAKIESLEAQKEQLLT
FT                   QLTRVSQELSVNYSMSDISAKEVKKREQALEKQLSQVQAQLELAQKDRERYKNLLERGV
FT                   IPRRTFEEADTRYKVLKDQEESLLKSLEELRLSYKKSLENVSLSRIAFLKQKELKAQVE
FT                   ALEKEIESLKKQEELAQNYLSNTKLTAPFDGVVAKRYVSVGDVVSPGSPVYAIVKPDSM
FT                   YVEVLLEESKLRGVQKGCKAYVRLDAYPNKVFEGVVEEISPASAATFALVPRDISAGEF
FT                   TKVVQRIPVKIRIIKGDASLLRVGMGGEVEIKRVR"
FT   CDS_pept        complement(31681..32952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0029"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68496"
FT                   /db_xref="GOA:D3DF94"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF94"
FT                   /protein_id="BAI68496.1"
FT                   /translation="MKLIVFFLTFSFAFSLTMEEAIQSAIEKNPEIRSQRHAVSSAFYS
FT                   YRADTNLYLPNFFASASFSRLSQKQSLHIPPFGPFPPLSVESAKQNYRAFSIGLREVLY
FT                   DGGAREGRVNISSSEVRLQQDLYGEKLEDIKLQVIKAYLDVLSSQEIVDVYRKQLEAID
FT                   SQYRRAEAFYKEGLVAITDMLQAKVRLAEVQRDLRKAEGDYSVALANLSKLTGIPQEKL
FT                   KDLQLPQIADYQVPDLESLYLKALERRLILRAYSERVYQAKKLQDIERSKYLPKVFAQA
FT                   EYTYSDQNPVISPKGVYTLSLGLSLEFQTLEPYYRVLSRLEEEKRARWELENLKEAIKL
FT                   EIKKAYEDVLTAKDNLRVAEDALRYAEEFYKLSQEQYKNQIISSTDLLLAEASLTQARK
FT                   NKVLSYYEYLKAYYELMRAVGGEI"
FT   CDS_pept        complement(32949..33521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0030"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68497"
FT                   /db_xref="GOA:D3DF95"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF95"
FT                   /protein_id="BAI68497.1"
FT                   /translation="MDTKEKLLNSAKKLFSKKGYYETRVSDIVADAGLSQGAFYLYFKS
FT                   KEDIFIELVKSMSNKVVKLLKDYASMEMDPEEVIKNSTFDFFRVMYEERPIAYIFLFQL
FT                   VGTNEKFRKLYMDKNKKVRELLHIIVEKGVKSGVFSYKNTENIVNILMGYVRIVYLEYL
FT                   LKDNIPLEDILSLVSEGIDVILKGVKG"
FT   CDS_pept        complement(33521..34756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0031"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68498"
FT                   /db_xref="GOA:D3DF96"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF96"
FT                   /protein_id="BAI68498.1"
FT                   /translation="MRCFMVILLLVLSVSWSMTLEEAINVALKNNTQVKLSELDLKRVE
FT                   EDIRKARAGILPQVSLSYSYTKLDKSLAFGFTPTERQSYVFEVNQSIFDKAVFDAIKLS
FT                   KLAKDLQAYILEDIKRTVENQTKQLFYALLYKKEVVKLYQDNLSYWEENYKLTKVQYEA
FT                   GVVPMVNLLRSKAQLQTAEAQYQQALADYKKSLEDFKAYLRWEGDIQPEGSLEFKPFQE
FT                   DYPTLRKLLLERNSTLLVAKKSVEVYEKRIDVAKDAYYPTISGFVTYQGNTGRRSLSGG
FT                   TEWIRGYTFGFQLNYHLFDGFQREANIAQANIDYLKQKEVYIDTLYTQDAQMKKTLEDI
FT                   NSLKAQIRALESSLEAAKEALRLSTERYRYGVTNQLEVLESRANYNQTLQNYYLLLYQY
FT                   MSDLANIERLTK"
FT   CDS_pept        complement(34753..35802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0032"
FT                   /product="efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68499"
FT                   /db_xref="GOA:D3DF97"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF97"
FT                   /protein_id="BAI68499.1"
FT                   /translation="MSMIRCLALISLLVLLSCQKKESPPPAPQAVQISVYTVKPESVEV
FT                   FYTANGYFEAIKDVVLRPEVSGRVLELLTDEGQLVRQGQPLLKIDPSDYQNTLRQLEAN
FT                   LMQARANYENQRAIYERRKFLYEQNLIAREDFENAKTQLKVYQDQVSAIEAQLRNARLQ
FT                   LSRTTLRAPFSGYIAQKFVNVGDYITPQSQTFRLVTLDPIKVVFEAPQELQPKLKLGSL
FT                   VYLQVEGAGNYEGRINFVSPTANASRMLTIKALVKNPKGELKPNMYAQVHVPISSTEAF
FT                   KIPETALVLIGNQKAVWKVVGDKVFPVKVDIVKQGDGYVYAKADLKEGDAIAVENAYLL
FT                   NQTSRVKVR"
FT   CDS_pept        35845..38853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0033"
FT                   /product="cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68500"
FT                   /db_xref="GOA:D3DF98"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF98"
FT                   /protein_id="BAI68500.1"
FT                   /translation="MYKFFIHRPVTTIMFMLSFVLLGLYTYTKMPVDRLPNVDFPIVTV
FT                   NTTYTGANPDVVDTNVTRYIEDEVSTISGIDAIVSQSYAGLSRVTIVFTLDKNIDVGTQ
FT                   EVRDAVQRAYRRMPVGVDPPVVRKVDTGSFPILAVHLHSKSVDYQTLAYYADKVIKREF
FT                   QKVNGVGDVGLGGFRDNVLWVRLYPERLYSYGITPVDVLSAVSKNHLEVPTGTIYGKDK
FT                   EYIIRLYGKVKDPKELENTYLKGNLRLRDVGFVEFTEDEKRGIARFKGEQSVALIVYKQ
FT                   SGFNTVEVADAVKARMAELNRELPPGMRMDITFDASVFPKEGAHAAVEEIIIGSLLTAL
FT                   VVFVFLGSLRLTLIPVFAIPVTLLSAIIFLYYTGNSLNTFTLLALAVAVGIVIDDAIVV
FT                   IESIYRRREMGLAPLEAAEVGTRIVVFALLASTTSLVIVFLPIIFLKGVIGSFFGSFAL
FT                   TLAVAIGVSYIVAISFTPMAGARLITQTQENVFMRAYEKFELFFDRVLRWSLDHKLVVL
FT                   LFSIATVYIGFLFLKATNKEFFPLTDEGAFIVRFETPIGSSFEYTDQKAKEVEAVLSRN
FT                   PYIDRFGIAIGQGVAGRPDVNGGQAFIFLKDRSVRPHQKVIMDQLRKELAKIKGITVSV
FT                   EAFPIVAGAGRQTDITYAIRGSSLEELQKIANKMVAEFRQKPGYKDVDTDLRLNEPQIQ
FT                   IKVNREKLGDLGISVEDVGTTLNILFGKYKFGTYEVGGESYDAYIKAQPEFVKNWENLK
FT                   KVYLRAKDGSLVPLTDVVSLTIAPGYHVINRYDRQYSFTFFANLSGKALGDATAEIESW
FT                   LRSNLPPGYSFEPTGQTREFARAFKGLAFALTVALVGIYMVLASLFESYRHPFTVLLTV
FT                   PLSLSGTFGLLYLTGTSLSVPSYFGIILLIGIVVRDAVLFIERIIQLRKEGYQTRQAIL
FT                   QARRERLRPILMTTLTVVFALLPVSLGLTAGSELRKPLAIAVIGGIATALPLSLLVLPI
FT                   VYELFDGLKLKRR"
FT   CDS_pept        38910..39560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0034"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68501"
FT                   /db_xref="GOA:D3DF99"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D3DF99"
FT                   /protein_id="BAI68501.1"
FT                   /translation="MRKEDVEKVIDILRREFPRWNAPVVSLIAQKTGDPFRVLVCALIS
FT                   TRTKDETTAMVCKRLFERIKNVDDLYNIDEEELSRLLYPVGFYKNKAKFLKSIAEEIKK
FT                   NYSSQVPNKLEDLLKLKGVGRKVANLVLSEGYGIPAICVDTHVHRITNRWCLIKSKDPE
FT                   ETERKLTEILPEKYWIEFNKLLVAFGQTLCKPVKPLCGVCPIREYCEYEFKTL"
FT   CDS_pept        39579..40436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0035"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68502"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA0"
FT                   /protein_id="BAI68502.1"
FT                   /translation="MADIKKRLPCNVPGDFFVDASCIDCDICTEIAPAIFGKGKDSACV
FT                   IKQPKAKEEEEKALMALLSCPVGAIGTRSKEGVREVIKKFPAKIEDGVYRCGLSSKKSY
FT                   GAMSYFILHPDGNWMIDSPRENAHLLKNIASLGGLKYIFLTHEDDVADAEFYAKAFNAQ
FT                   VIIHERDAHAYPKADIKVSGDDPTNMGDFTIIPTPGHTAGHMVLLYKNFLFTGDHLWYS
FT                   PERKRLWASEEYCWYSWSHQLKSIKRLLDFRFEWVLPGHGRSIKMSHKEIKRQIKELLL
FT                   MYNF"
FT   CDS_pept        40445..41476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0036"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68503"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA1"
FT                   /protein_id="BAI68503.1"
FT                   /translation="MAKKVLAVFTDSEQTAKMLSEIAERYSLKCKVISSVALLSADNEE
FT                   DILELLLDADREMVKGFRYLLLSSEKPIEVSTDFLLREVPHTLNLEELLDKLIYGVIGD
FT                   VFYNVKIAFHPILDLKNGKVFACEALCRPPIKITDLLEVGRSTSTYTEEFCRSKAIKEA
FT                   GEKLNGEIKLFINFHPRFLTDPFRTFGDFISMAVSYNFKPSRIVIELTEHEKLELSSVR
FT                   GFINFLKEEGVKVALDDVGSGYSGLFYLSELQPDYIKIDMELIRDIHRNNFKKVIVGHL
FT                   IKMAHSEGIKVVCEGIEKKEELDWVKYAGADYGQGYLFTKPTDKPDIAAVEGMAKELLA
FT                   LDA"
FT   CDS_pept        41504..42829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="HTH_0037"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68504"
FT                   /db_xref="GOA:D3DFA2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA2"
FT                   /protein_id="BAI68504.1"
FT                   /translation="MSIEVKSYAEEKVERVRRVLRELVALKTEVKNRALLTAAELINGK
FT                   RSFIKEENAKDVEYAKSIGLSSAVIDRLVLNDKRIDGIIKVLKDVASLPDPVGEITRMW
FT                   TLPNGLKVGRMRVPLGVIFIIYEARPNVTVEAASLCMKSSNAVILRGGKEAINSNRALV
FT                   SILKEASREVGFPEDAIEFIDRPEREIVWELLQMEGKIDVAIPRGGESLIRAVAEKAKV
FT                   PVIKHYKGVCNIYVDEEADLSKAYHIVYNAKVQRPSVCNAVENLIIHRRILRDFFPRMA
FT                   YILGKAGVELRCDEESLSLIKSDPRLSFVKATPAREEDYYEEFLDLILAVKVVGSLEEA
FT                   IEFIEKYGSKHSDAIITENYTKAMKFLNEVDSAAVYVNASTRFTDGNEFGLGAEMGIST
FT                   DKVHARGPMALEELTIQKFIIFGNGQLRDNVGVPEEIMKELL"
FT   CDS_pept        complement(42810..44717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="HTH_0038"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68505"
FT                   /db_xref="GOA:D3DFA3"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA3"
FT                   /protein_id="BAI68505.1"
FT                   /translation="MPVYFIFFYMNLSMITDYDIYLFKEGSHCRLYEKLGAHPLEGGVY
FT                   FAVWAPNARYVSVVGSFNSWDRGANPLKLREDGSGIWEGFVEKARVGDLYKYFIVSKSG
FT                   YEAEKADPFGFFFEVSPKTASIVWDLSYQWKDQEWMKERHKKNALDSPWLIYEVHLGSW
FT                   KKKGWESLSYRELAEELVEYIKEMGFTHVEFLPVMEHPFYGSWGYQITGYFAPTSRYGT
FT                   PQDFMYLIDRLHQEGIGVILDWVPSHFPTDGHALAYFDGTHLYEYEDFRKRYHPDWNSY
FT                   IFDYSKPEVRSFLLSSAHFWLGIYHADGIRVDAVASMLYLDYSRKPGEWVPNIYGGKEN
FT                   LEAIEFIRKLNECLYRDFPGIQTIAEESTAWPMVTKPTYLGGLGFGMKWNMGWMHDTLF
FT                   YFSKDPIHRKYHQDKLAFSLWYAFSENFVLVLSHDEVVYGKGSLINKMPKDWWQKFANL
FT                   RLLLTYMYAHPGKKLLFMGGEFGQWDEWNHDRGLDWFLLEHSTHRGVQKLVRDLNRVVK
FT                   ENPALYELDFSHEGFEWIDFSDTDQSVISFLRKDRSGKNIFLSVFNFTPVPRYNYRIGV
FT                   PYRGFWKKIINSDALEYGGSGHGDTEAVHTEDVPFHGRPYSICLTLPSLAGLYFTIALS
FT                   "
FT   CDS_pept        44719..45276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68506"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA4"
FT                   /protein_id="BAI68506.1"
FT                   /translation="MEELQTEREDRLEAIIEDIYRSTGHFDIGCSELGCFLCAKGGKKS
FT                   AECQRLQEAVVLLPTENRVIKKLNSACFPEISVNGFSIGFLAPEQDCPFNMDGFCGIHG
FT                   KHPIDCRSFPIVPSVNERGDLIISISLKCPTVPPWDFVKTWVENWKKLWELLPREWFRF
FT                   YSEVPTNPLKPIAIFRLKEKHL"
FT   CDS_pept        complement(45257..47824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="HTH_0040"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68507"
FT                   /db_xref="GOA:D3DFA5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA5"
FT                   /protein_id="BAI68507.1"
FT                   /translation="MWNTPSEGELTPMLSQYHHFKRLHPDCLLFFRLGDFYELFYEDAH
FT                   IGSKELGLVLTSRPSGKGKERIPMCGVPYHSSTNYITKLVSKGYKVAICEQMEDATQAK
FT                   GLVRREVIRVITPGTYFEKDLSGLACVYVKGKRYFCAYLNPSTGEFVAGSFSQEQVYEF
FT                   LCKFSPREVLLQRGTHLEPEKYIRTYKTELDEEYFSRGLEELIRDFNLHSYRSLGFETQ
FT                   EELIPCGCAYLYLKSTQRGFTPFVSKPKPYSDEGYVRIDYRARRGLELLESYEGREDIS
FT                   LFSVIDRTLTGMGRRRLKFHLLHPFRSRERILQVQSAVEELTEKRQALKEIREYLKDMP
FT                   DIERLISRISGNVATPRDFVLLKKALFLASRLKEGFSGAEFSSSLLKSLFEDMQDLREL
FT                   AQDIDNTLVDDPPLHVKEGGLIKDGVSHELDRLRYICQNSESLLREYEEKLRKETGVQS
FT                   LKIGYNRVMGYYIEVTKPNLKYVPSYFKRRQTLSNAERFITEELSSLEEKILSAQARIK
FT                   DMEYEIFASLRERVLSKVEAIARSAQKVGFLDYLQSLAYVALEKGWKKPQITDEKVIKI
FT                   KEGRHPLIEAFVKDYVPNDTSIDERENIMIITGPNMAGKSSYIRQVAVLTLLAHMGSFI
FT                   PCQEAEIGTVSSIHARIGSGDILALGVSTFMNEMLDVASILNSADERSLIVLDEVGRGT
FT                   STYDGISLTKALVEYIAKRVKARTLLATHYLEITKLEEEINGIRNYHMAVSREGERVNF
FT                   LYRLKRGSAEGSFGIEVAKMAGLPQELINRAKEILSEYESMLQLPFLERVYAESVRIAN
FT                   EKSWQEFLDYIESIDIANTTPLQALLVLSQLKERLKMLKDASP"
FT   CDS_pept        complement(47805..49541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0041"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68508"
FT                   /db_xref="GOA:D3DFA6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA6"
FT                   /protein_id="BAI68508.1"
FT                   /translation="MSIEVLLMVLLVASVFSGLVGFFLSKLLRKEESQRVPQVDLEKVE
FT                   LEAKHILQRAQAQAEKIRQDAKEETERLIGITKEEAERYRKLAKEEAESLLLRAKEEAH
FT                   RIKEEAEKRRRETEDFIAEKRAELQKLEQSLIQKEHQLERRLEVLERREEELYRREKDT
FT                   RETERQLERLQRELEERLNGILQKEKEVESLRQKEILELQRIASMSMEEARAEVLKRAE
FT                   EEARIDAIRVMKRIEEEAKEKAEFEAKRIITTAIQRLSPEIAINYTTTTVELPSNEFKG
FT                   RIIGREGRNIRTFELLTGVDLIIDDTPDVVTISSFDPLRREIAKEALQILIDDGRIHPA
FT                   RIEEVVNQVKKEMDEKIRKMGEETCTELGLYDINPGLYYYIGKLYFRTSYSQNVLLHSK
FT                   EVAYIAGLMAGELGLDAKMARRAGLLHDIGKSISHELGGSHTDIGIELCKKYGEPDPVL
FT                   NAIKAHHNEEPVRYPEVALVCAADALSAARPGARRESLETYLKRLEKLENIVKSFKGVA
FT                   NAYAVQAGREVRIIVNPEELSDEEAYVLSKEVARKIEEEMEYPGQIKVVVIRETRHVEY
FT                   AK"
FT   CDS_pept        complement(49531..50106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0042"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68509"
FT                   /db_xref="GOA:D3DFA7"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA7"
FT                   /protein_id="BAI68509.1"
FT                   /translation="MKVLKKSELRRAYLNRREAMGEEEVFLYSERIKRGVKSLPDFKGA
FT                   KKILFYCPIKNEPDLTSLIWESISLGKEALLPKVDGDRLRIYKVEHSNQLKPGSFCILE
FT                   PEDGTQVEPEEVGLALVPGIVFDTKGYRIGFGKGFYDRLLKRVKGVKVGVAYSFQVLEE
FT                   IPVDSWDEPVDLLITETYILKGGKKYEY"
FT   CDS_pept        complement(50299..52614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="HTH_0043"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68510"
FT                   /db_xref="GOA:D3DFA8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA8"
FT                   /protein_id="BAI68510.1"
FT                   /translation="MKVPYTWLIELVDVQDISPEDIARELTLKSVETSVQKFDADLDGV
FT                   VFGKVVEMREHPTKKNLLVCRLDVGGGYHPTVITGDRSLKLGDGVFLALPGAKVGELCI
FT                   TKREFDGVVSEGMLLSAQELGLEPHSEGVLKIWEEIKPGTSAYDLLGFGEYLLELEITP
FT                   NRGDLLSVRGVAREVCAIFRRNLKKDKEVSFEEFGELDIQIIDRDCKRYRGALIEGVSV
FT                   KDSPLWLRRRLWQCGVRSINNVVDITNYIMLRDGQPLHAFDADKLSGGIRVRSAKKGER
FT                   IALLTGAEKTLTEDNLVIADEEKPLAVAGVVGGQESGVNHSSRRILLESAYFEPYRVRR
FT                   SSKAISTQTDSSYRFERNVDIEGVKRYQDLAIELILEVAGGTLTALRDAYPSPYQPKTI
FT                   FLSLEKYRRYAGETLNREEASEILTKLGIPNSPMRCGVEVYVPSHRSYDMQRDVDIIEE
FT                   ILRIKGYNSLPSEVLSLPSLPFEHKSITDKVRELLKSRGLLEIISFSFEDLSLYELLDI
FT                   EKPTISITNPLVKNQAYMRTSLIPSLLRTCLYNQRQHNYDMALFEVGRVYTHQGEEERV
FT                   GILLTGVRRLYPQEVYTAYDALSLLIDVGRILGLKMESQSSSYGFLHPYVQTDLVLENE
FT                   KVGFVGQLSPRIVNTLELKGKVFIGELRLLHIQQKTKLYKPFSKYPPVIRDLSVVVDKG
FT                   VAVDKLISHTQNLLKEKLEEVKVFSIYTGSELGEGKKSVSFRLVFRSFEGSMSDGEVNG
FT                   LVNKLISSLEDSFGARLR"
FT   CDS_pept        52635..53627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0044"
FT                   /product="ABC-type multidrug transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68511"
FT                   /db_xref="GOA:D3DFA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFA9"
FT                   /protein_id="BAI68511.1"
FT                   /translation="MLLHAIEVKNLVKVYDGKVRALDGVSLTVQTGQAFALLGPNGAGK
FT                   TTLMRILTTQIKPTHGDAYIYGYSVERQSSQVRKLISYVPQEMSVWTDITVYENLLIYA
FT                   KLFGLSGKDRNRAIERALEDMELREVRDDLVNTLSGGMIRRLEIACAMLIEPKVMFLDE
FT                   PTIGLDPVARKRVWEKLKQFRDNSGVTIFFNTHYMDEVDMYADRVAIINKGRIVVSGTC
FT                   EELKRSVAAEAVLVQTENPHANYNLLKHVPAVREVHTEGDEIKILVDDAEAFLPVLLDI
FT                   LRKAGVRIRRVSVSKPTLDDVFLKYAGTKFESADRISDVRQTRKMLSRM"
FT   CDS_pept        53630..54391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0045"
FT                   /product="ABC-type multidrug transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68512"
FT                   /db_xref="GOA:D3DFB0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB0"
FT                   /protein_id="BAI68512.1"
FT                   /translation="MNAIKSILVMMELELRRLKHDRTEIYFRAIQPMLWLVIYGPVMGS
FT                   VKAIPTNGVPYTDYITPGVLIQSTTFVSIFYGLMMVWERDVGILKRLLVTPAPRYSVVV
FT                   GRSMASGLRSLLQVFIILPVAYIIGVRFLPNPLYFVLALGVIFLSSGGFASVSILVASF
FT                   MKTRERFMGIGQAIIMPLFFASNALYPVNLMPPILRELSIINPLTYAVDAVRGLLITGD
FT                   ISKLYLDLGVLITFDILMFTLSSLSFRRIIE"
FT   CDS_pept        54412..55242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0046"
FT                   /product="ABC-type metal ion transport system periplasmic
FT                   component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68513"
FT                   /db_xref="GOA:D3DFB1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB1"
FT                   /protein_id="BAI68513.1"
FT                   /translation="MLQLIFLMLSVLSLSFCGEIVATTYPVYYPLKYLVGEKHRLEVLV
FT                   RSQADPHHYELTPKDAERLLGANLVMTLGLESWEWRLLKNLPKGKVVTLSEGINLLKRG
FT                   SFPDPHVWLSPKEYRVVVRNIKDALVRWDPSQRAYYQERYSQYLQRLNSLDRKLESTLK
FT                   TCSYRTLVSTHRAWDYLSRDYGIKTLSLSGVHAEEEPKPSEIKAIVQTVKREGLKYIFA
FT                   EVGQDRKVADFIASQTGTRVLMLNSSLFPQLNSDDYFSIMERNLRALREGLGCR"
FT   CDS_pept        55233..55910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0047"
FT                   /product="ABC-type metal ion transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68514"
FT                   /db_xref="GOA:D3DFB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB2"
FT                   /protein_id="BAI68514.1"
FT                   /translation="MQVKEALKVKNLSFRYRRDEPLIDDLSFSVLEGEFFGILGPNGSG
FT                   KTTLLRLILGFLKPLSGSIELFGEDVRTFKRWNKVGYVPQRFHVEKAFTGTVGELFRAL
FT                   APKEKVGWIIAYLHLEDLLKKQFTKLSGGQQQKVLLALALTTNPDMILLDEPLTGLDIH
FT                   AQEHIESILKEISRKRTVIVVSHDVGFVLRNADRILCLGMQECRLIKAQELEGMLKELY
FT                   RLH"
FT   CDS_pept        55912..56739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0048"
FT                   /product="ABC-type metal ion transport system permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68515"
FT                   /db_xref="GOA:D3DFB3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB3"
FT                   /protein_id="BAI68515.1"
FT                   /translation="MLLLEYAFLWKGLVGGLLISASSSLVGVFLLMKRLSLLGAGLSHA
FT                   AFGGIALAILFNADPTLFTLLYTVLSGLLLQFLIEKRGLPADTVISLFFSLGVALAILV
FT                   LSITQNLGSNVYSYLFGSVLTVSDRELYSALATSLLTFLFVLAYYRKLLLISFNEELAT
FT                   LRGVKVSLLNYLLISIASANIVFAIKAVGLILASSFIAIPPMSALLVAGSFFSTLALSL
FT                   FLSLSATLLGMLLSLELDAPPSATIILCMVFIFLILTLWKGITLLKRRLSQTS"
FT   CDS_pept        complement(56702..57481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhC"
FT                   /locus_tag="HTH_0049"
FT                   /product="ribonuclease HIII"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68516"
FT                   /db_xref="GOA:D3DFB4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004641"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB4"
FT                   /protein_id="BAI68516.1"
FT                   /translation="MNISLRLPEEYYDKVRAFLKDRGFEERKIEYAIWSLCREGTCATL
FT                   YRSGSLLLQGNGALFLKEEILSLMEEPSGVQIGCDESGKGDVFGPLVLCCVIIPPSHYK
FT                   RVLSLAPKDCKLLKDEVLLKKVEALSPLVEAKCLVYEPEQLNELYSEVRNLNRIMDRAY
FT                   RTLIEDVRKHYHVEITIDAYSSQSPFGKGVVFKKKGERDVAVSVASMFARARFLLWIRE
FT                   HNLPKGAGKDAITKARIMLKDEPHKAKKFVKVFFLEG"
FT   CDS_pept        complement(57557..57757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0050"
FT                   /product="hypothitical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68517"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB5"
FT                   /protein_id="BAI68517.1"
FT                   /translation="MTMDRALRLTSGVFLLIVFLFGIRGSDVHWFWKLFLLFMSLNQIQ
FT                   SAFTNWCPVMSLYRKLGIKEC"
FT   CDS_pept        57863..59380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0051"
FT                   /product="transcriptional regulator, NtrC family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68518"
FT                   /db_xref="GOA:D3DFB6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB6"
FT                   /protein_id="BAI68518.1"
FT                   /translation="METKRQLSTREVTIINEVAKILSKGMNFLESAGEVLKILYSFWDV
FT                   KYSYVALYRKDLKLLKIVKAFGLKEEEVERGLFKRGEGIIGKVYKSGVPVVLSDLSTNS
FT                   YLNRTGLKERLEGSESFIAVPIRIGGEIIGVLALFKSFDKKESVEKAVELLIILGTMIG
FT                   MLYKLEERINMERQEWEEEKKALTQALGKKYSLEGIIGRSVAIKNLIDLVERVSQTDIT
FT                   LLLTGESGTGKSLIAKAIHFLSHRKEKPFVTINCSAIPEALLEAELFGYEKGAFTGAYT
FT                   SKKGKFEIANGGTVFLDEIGDMPLSLQPKILRVLQEKEIEKLGSERSIKVDVRIISATN
FT                   KDLRQLVQKGDFREDLYYRLSVLPIHIPPLRERKEDIPLLVDHFLNTFNQKYSKNVKID
FT                   AKALELMMEYPWYGNVRELENTIERLVILKDGIVKESDLPSYFFVELSRDEPRNLPSVI
FT                   ELTEREEIIKALERTGYVKSRAAKLLGYTLRQLDYRIRKYGISLKKF"
FT   CDS_pept        complement(59450..60640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68519"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB7"
FT                   /protein_id="BAI68519.1"
FT                   /translation="MGKLREVILLSALVALPSVSSAVDIKVSEDVTLSLGAWLKVWGGY
FT                   LDKGITPDLRLDPTNTQRSYNVNLVYPAWWFMGKAYDKVDFALIWIAPGLVDNKNNALG
FT                   KEMRLIDGFINFNLADEFKITAGQFRAPYTRLHITNEATYVTETGPIYRGFAQGIAVSP
FT                   VYRDKGVALWGNIAGGMFQYRLGLFDGLYNKGDVVNGQNIVKDNLAYTVRVQFSPTMLG
FT                   FSPETDYVLSETYLGKKDVLTVGAGYTAQKWETATNSKTAKMWTVDFQFEKKFGDIVPN
FT                   LGAGYVETKDFLPASSVPADRTDCSQYQKCKLAYAEGQILYDQKVGAGKPGLGLRWEYQ
FT                   KPEGNPGSGIKLNRYQVWLNYYLNGHAAKVMVGADVVDPSQGSTRTNATIAAQVIF"
FT   CDS_pept        60753..61247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="HTH_0053"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68520"
FT                   /db_xref="GOA:D3DFB8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB8"
FT                   /protein_id="BAI68520.1"
FT                   /translation="MNPKVAIIMGSLSDWEYLKEAHNLLKEFGVECDVRVVSAHRTPEV
FT                   MYEFAKSAKDNGIEVIIAGAGGAAHLPGMTASLTTLPVIGVPVPSKHLSGVDSLYSIVQ
FT                   MPAGVPVATVGIGNGVNAGLLALRILSIKYPHIAQKLEDYRKSLQEKVERMNQELKNQT
FT                   T"
FT   CDS_pept        complement(61235..62806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0054"
FT                   /product="diguanylate cyclase (GGDEF motif) with PAS/PAC
FT                   sensor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68521"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFB9"
FT                   /protein_id="BAI68521.1"
FT                   /translation="MDYSAFDFIPLPVLVIDENYQVIFLNRKAKETYGDREGKCYEITH
FT                   SFSQPCYTMENCPCPVKSIEEKGLESYHAVHVHRMAGREAYFYVVAGCIPESKTYIELH
FT                   IDLSHLLTALEGSRLSSQLLVSEGPIVFFFWDNSPGWPVKLVSPNVKDLTGYTVEEFLR
FT                   GDITYADMVHRDDLERVAREVKTYTEGGAPSWTHEDYRIVTKDGKVKWVLDHTTVVKND
FT                   QGEVIGYYGYVMDITEKHEKEEIIRNLSDASPVGIFLRQGKKLLYVNQALAEITGYSSE
FT                   ELIELDDVLNIIHPKDRKMVRNVMLKRDAGIKGVERYEVRIKRKDGKIRWVQISSETIF
FT                   YKGSPAGIGVMVDITERKIAEKKLRRLIMYDGLTQIYNRYALEEFLSRELVKAERYKLP
FT                   FGIVFFDIDDFKRINDTYGHKMGDMVLKRLARLVKGNIRKADIFGRWGGEEFLIILPQL
FT                   EDPAAFAEKIRKMVESTVFDKGIKVTISLGVTTYREGDTVDTILRRVDAGLYRAKREGK
FT                   NRYYVV"
FT   CDS_pept        complement(62787..63173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0055"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68522"
FT                   /db_xref="GOA:D3DFC0"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC0"
FT                   /protein_id="BAI68522.1"
FT                   /translation="MLGIDIVKNERIKTAVERFGDRFLSRVYTQKELEYCKAQKCFFEC
FT                   LSARWACKEAVLKAFYQRFGIVLKLSQIEVLGDRGKPAKVNILGDDLKGMLESVSIWVS
FT                   ISHERDYSVAVALIEAHSYGLLSL"
FT   CDS_pept        complement(63213..63656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0056"
FT                   /product="cyanoglobin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68523"
FT                   /db_xref="GOA:D3DFC1"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC1"
FT                   /protein_id="BAI68523.1"
FT                   /translation="MRKTALSLMLVFGLFGVGSAEMMHKEKTLYRRLGGYDAISAVVND
FT                   LAVRLVTDKQLGVYFKGLSNDSKRRLIAHLTDFVCSATGGPCIYTGRDMKTVHEGLGIS
FT                   DSDWNRFVELTKETLNKFKVPPKEQQEFLQAVAPLKGVIVEKK"
FT   CDS_pept        complement(63671..64195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0057"
FT                   /product="cyanoglobin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68524"
FT                   /db_xref="GOA:D3DFC2"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC2"
FT                   /protein_id="BAI68524.1"
FT                   /translation="MRRYILGTLALLASAGFMLSSCGGSSSAQSPFERLGGEAGIRKVV
FT                   DDAVPCLATDPNIGIFFRGLSADSLERIKVCLTKQLCAAAGGPCTFPTTITYTSPVDGV
FT                   QRTFTCRPMRAAHQGMVGPDGKGIANDDVDSFKACVQKSMQKNGVPDDLQQAVLNILES
FT                   QRNDVVDDRNK"
FT   CDS_pept        64292..64591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68525"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC3"
FT                   /protein_id="BAI68525.1"
FT                   /translation="MGDFTKAGLDKGDIEKELEHTLTSARMLYRTYLLTIEDYSSEELL
FT                   ADLKEYTHQLETSILPLVRRAEATKVPKLVDMAYEIRYTYEKIIEVIREQLDRT"
FT   CDS_pept        64664..66310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0059"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68526"
FT                   /db_xref="InterPro:IPR010094"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC4"
FT                   /protein_id="BAI68526.1"
FT                   /translation="MITLHCKLTFENNKDKEALMDIMRKFSSCFRYAYNKLLEGHSRKD
FT                   LKKHLQKIFNINSRYVDDAIFKAQSLINSCIATYQSPSKVIFGGRRLFELLKNKHINGE
FT                   RRNKLKQKWEERRKHCLYSRGDKTKKGNLNIRIELEKDKLTLRINTGDRNWIKANIKRT
FT                   ANRQNDKWINFIADLIRAEETKEYFPYSVEVRKIDNDFYAFISYQDVKIEEPTITKDNG
FT                   VIGIDINASPFHIAMASVKTDGNLEKIRRISLHHLLGKTKNQREYLSWQITHQITDMAK
FT                   EENKAIAIEKLSNIPKGERGDGNGKLRKRLQQWIYKGLLEKIKTLAKRKRIQVIEVNPA
FT                   YTSVIGALKYAPQYSLDKDTAGAFVIGRKALGFREEIPKNYEKLITEKEYLKFAEERIR
FT                   QEKERTQESLKEEKNQYKRKPIQKKLKELNKNLKIIQSLYSEPQAQEPVNRWKQQVRGL
FT                   SWTSYKLWQIVKVALAIPVLGKSLSRDLSPLKGIIVSGAWDRVARRLAPVSWDRGYGMD
FT                   KYRQLGTCPYLKEAGYKYPSPKCGVLYPRFG"
FT   CDS_pept        66322..66870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0060"
FT                   /product="putative intracellular protease/amidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68527"
FT                   /db_xref="GOA:D3DFC5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006287"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC5"
FT                   /protein_id="BAI68527.1"
FT                   /translation="MPKVAIILVDGFEEVEAVAPIDVLRRAGVEVLIVGLSREPVASAR
FT                   GIKILPELSIDEVNLEEIDMVVLPGGAEGVENLKKDKRVEALVKALKDKDKYVSAICAA
FT                   PTALASFGVLEGKKATVYPSLKEEIKPAVFVDDKVVEDGRVITSQGPGTALLFALKLAE
FT                   KLAGKDKAREVAQRMLIDW"
FT   CDS_pept        66870..68045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0061"
FT                   /product="SAM dependent methyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68528"
FT                   /db_xref="GOA:D3DFC6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC6"
FT                   /protein_id="BAI68528.1"
FT                   /translation="MLQVRVKPGVEEKLKSYFPWVYKPEITSYSKKPQKGDHVVVRDAG
FT                   GHFLGYGYINPQANISIRLLSFEKEKKISYELIKERVEQAYNYRKSLSLNTDAFRLIHS
FT                   EGDFLPGLVMDVYGDYAVVEFTTFGMNAMREWVISAILEVLKPKGIYEKRNEYAQKAEG
FT                   FKTEEGVIYGKVPPEITIYEGDLKYYVNIPQGQKTGFYLDQRKARSMIRQLVKPGYRCL
FT                   DLFCHTGGFALNMRKAGAGEVLAVDISAQALEVAKRNAELNSLDNIVWMEENAFDFMRK
FT                   LHKEGQVFDLVLMDPPSFAKNRASVPNALRGYKELCVRGLHVVKRGGYLVIYSCSFHIT
FT                   MDHLLKVLLDAAKDTRRHLRIVGVSFQDLDHPWVLQMPNTLYLKGIYAEVL"
FT   CDS_pept        68045..68812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="HTH_0062"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68529"
FT                   /db_xref="GOA:D3DFC7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC7"
FT                   /protein_id="BAI68529.1"
FT                   /translation="MNIHQAIILGIVEGLTEFLPVSSTGHLILTAHLMGLENDNFTKSF
FT                   EISIQMGAILAVLFLYTKRFLRDYQVWKRILVAFFPTGLLGFLLYKFIKNYLVGNDKVV
FT                   VASLFLGGVFLLFADRVCERFCYMEDASKLSLRKAFMIGIFQSLAMIPGVSRSASTIIG
FT                   GMLMGLNRKASAEFSFLLAVPTMLIATSYDVYKSHTTFTNAQWYLLFVGFLSAFLTALI
FT                   TVKVFIGFISRHSFLPFGIYRILISFAYGFYFL"
FT   CDS_pept        68814..69899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="HTH_0063"
FT                   /product="bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68530"
FT                   /db_xref="GOA:D3DFC8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC8"
FT                   /protein_id="BAI68530.1"
FT                   /translation="MDRWILYAVVLLFFMGQTAIVSSNTVPYIFERYADFSIYKKPLYQ
FT                   LFTFLAGLFIVNWLFSRLDYRVLKKKKVVYTLVLLSTASLLAVLIKKFVAHKQVDRWLV
FT                   GTSLQPLEFAKITLIIFIAYYIVEKGSVRQWKYIFWASFIVFLNAFLVSLQPDKGGAIF
FT                   LLVLCGLMLYVGGIPKKVYLPIIGVFFLFIAYLLTSKSGYVAERFSAWKDPFADPEESG
FT                   YQIIQSLFGFAHGGMWGVGIGKGIQKMGALPAADTDYAVSLLAEELGFVGMLVLFSLYL
FT                   LLVGRLFYFTYRVKEPFGKLLLFGIALNFALSFLWNVGMAVNLLPPKGIALPFISYGTS
FT                   NLLFSMISIGLAQSVIRRGLF"
FT   CDS_pept        69913..70665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccmC"
FT                   /locus_tag="HTH_0064"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68531"
FT                   /db_xref="GOA:D3DFC9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFC9"
FT                   /protein_id="BAI68531.1"
FT                   /translation="MLTLSLILYLLSFFVAILSYYGKIAQKAVLPPLMFAIVSYFIYIL
FT                   HISLKLGSFPFANPYGFSSILGNTMVLTLTIFSLKNSQFLRFSAIFSFIGILSALLALP
FT                   SEPSPYRNPLYSLHILSALFAYVSAFFGGLSSLLRLLLERRLKQKDLPAFSLSINLLRT
FT                   SERIAVNLSFVLLTLTLIFGSFWTRVHFGKHWVNDPKLLFTFILWMYYAFVVHLNLVRG
FT                   LKPKQLSVLILLGSLFSLLNLLFVRHEV"
FT   CDS_pept        70655..71164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="HTH_0065"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68532"
FT                   /db_xref="GOA:D3DFD0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD0"
FT                   /protein_id="BAI68532.1"
FT                   /translation="MKFKRVFLIGFMCSGKSTIGKELAKSLSWKFCDLDEEVQKEEGMS
FT                   IKEIFELKGEDYFRKRELEVLKLLVLEDNAVISTGGGLGANKEALELMKRHGLVVWLDV
FT                   SFDAFLQRCKDVQERPLLKKSLGELKKLYQERKKIYSQAHAHIDTTDEPNKIAQRIIQI
FT                   LQDERR"
FT   CDS_pept        complement(71133..71558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="HTH_0066"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68533"
FT                   /db_xref="GOA:D3DFD1"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD1"
FT                   /protein_id="BAI68533.1"
FT                   /translation="MERTLIIIKPDAFQKGATGKIIDRFLSEGFKLRAMKLFRFTKEQA
FT                   QQFYIVHKERPFYAELVEFMTSGPVVACILEGEDAIRRVREIIGPTDSEEARKVAPNSI
FT                   RALFGTDKGKNAIHASDSKESADYEIPFIFSRLEVFE"
FT   CDS_pept        complement(71527..72318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0067"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68534"
FT                   /db_xref="GOA:D3DFD2"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD2"
FT                   /protein_id="BAI68534.1"
FT                   /translation="MFDILSKEQISQDFILLKIHAPHIRHAKAGQFVLLQLKEHSERIP
FT                   VCVFETFDNGFSCLVQVVGRSTLEIKEEGDAFYYIAGPLGKPFPVGNYGKVVIYSKGWG
FT                   IAPAISVGRALKDLGNYVKMVCLDESLSHLLKREGFDEVVYQENIVAYSGFDLVVSVGS
FT                   NMLSKILSQIYDSTPHITMPVVHMLCAAGLCLTCRVKSGLACTDGPWFEAKEINWEDLL
FT                   KRESLYKEQEKLALEEYKKSLLRKQLREEVEYGKDAHHYQT"
FT   CDS_pept        complement(72328..73395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcpE"
FT                   /locus_tag="HTH_0068"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68535"
FT                   /db_xref="GOA:D3DFD3"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD3"
FT                   /protein_id="BAI68535.1"
FT                   /translation="MSPKRRKTRQISVGWVKIGGDAPIVVQSMTSTKTHQVEETLQQIE
FT                   RLHSAGCELIRVAVPHEEDLEALPDIVKNSPIPVIADIHFAPSYAFRSMEKGVHGIRIN
FT                   PGNIGKEEIVREIVQEAKKKGVAIRIGVNSGSLEKDLLEKYGYPCAEALFESAMRWSEK
FT                   LEKWGFDNFKVSIKGSDVLENIKSNLLFAERTNIPLHIGITEAGMGQSGIVKSSVGIGI
FT                   LLYLGIGDTVRVSLTDDPEVEVKVAYDILRSLGIRRQGVEIVACPTCGRIEVDLPKVVM
FT                   QVKEKLKDIKEPLKIAIMGCVVNAIGEAREADLGLACGRGFAWLFKRGKPIRKVSEGEM
FT                   AQALLEEVLKYKSEL"
FT   CDS_pept        complement(73392..74360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="HTH_0069"
FT                   /product="quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68536"
FT                   /db_xref="GOA:D3DFD4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD4"
FT                   /protein_id="BAI68536.1"
FT                   /translation="MFALEVKKEEVLGKEELKALQEEVRKLAKEKNAVILAHYYQRPEV
FT                   QDVADFIGDSLELSRKASQTDADIIVFCGVRFMCETAKIVNPTKKVLHPNPESGCPMAD
FT                   MITAKDVLRLKEEHPDGEVVAYVNTNAEVKAVSDVCVTSANAIRIVQKLQSKKIIFIPD
FT                   QALGSWVKRHVPDKEFVIWQGFCPPHFEFTAREVQKLKEMYPDAKVAVHPECHPKVIDM
FT                   ADFVGSTSQIINYATTCDTNRVIVITEVGLKYTLMRKNPNKEYIFPEAMNYCGSVYCCT
FT                   MKAITLPKVYETLKYELNQVILPEEIIEKAKRPILRMLELS"
FT   CDS_pept        complement(74406..74849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0070"
FT                   /product="putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68537"
FT                   /db_xref="GOA:D3DFD5"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD5"
FT                   /protein_id="BAI68537.1"
FT                   /translation="MRNLKGQRRNRIQIRLHKRSIKKAQIEQISERIAELLGLERAEIS
FT                   IYITDDETIRHLNRDYRGKDEPTDVLSFPICEKVGNWLILGDIVISFDTAKKQASQMGH
FT                   SLEEEIKRLLAHGFVHLLGYDHELGGEEERKFFELESYVLKNL"
FT   CDS_pept        complement(74770..75795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="HTH_0071"
FT                   /product="phosphate starvation-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68538"
FT                   /db_xref="GOA:D3DFD6"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD6"
FT                   /protein_id="BAI68538.1"
FT                   /translation="MSSTEKLEERVDLGSFDESFYAIVGRGDENLKYFSQVFGVKVFAR
FT                   GTEIMIRGEEEKVKQAYDFIKGIIKELKSHPMTAQDVRERAKEYVSKREAKELEDKENI
FT                   IFLTHRRKAILPKTHTQKIYVDAIKNNDIVFGIGPAGTGKTYLAMAMALAHLKENKVNK
FT                   IILTRPAVEAGEKLGFLPGGIAEKVDPYLRPLYDALYDMVDYDKASYMLERNIIEIAPL
FT                   AFMRGRTLNDAFIILDEAQNSTKEQMKMFLTRIGFGSKVVITGDITQIDLPKREHSGLV
FT                   EAIKVLQNIEGISFVWFTQEDVVRHPIVARIIKAYEEFERAKEEQDTDKTSQEEYKESS
FT                   D"
FT   CDS_pept        75859..76728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="HTH_0072"
FT                   /product="putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68539"
FT                   /db_xref="GOA:D3DFD7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD7"
FT                   /protein_id="BAI68539.1"
FT                   /translation="MGYMLRTVILLGALTGLFLFVGHLIGGKTGMTIALILAGIMNFIA
FT                   YWFSDKIVLSMYGAREIPYEEAPWLHQIVEELASRAGIPKPPIYLVPMEQPNAFATGRG
FT                   PGHAAVAVTSGILHLLDRDELRGVLAHELGHIKNRDVLVATMAATIAGAISYLVNMFQW
FT                   MLIFGGGRDEENRGGWAGLVGSLMLIILTPIIAMIIQMAISRSREYLADETGAKISGDP
FT                   LALARALEKIHNYVYQIPAEVNQGTAHLFIENPLSGEGIWELFSTHPSTEKRIERLKEL
FT                   ARKMGVYA"
FT   CDS_pept        76725..77252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0073"
FT                   /product="intracellular protease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68540"
FT                   /db_xref="GOA:D3DFD8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD8"
FT                   /protein_id="BAI68540.1"
FT                   /translation="MKSVCVFLEELVEDVEFIYPYLRFKEEGFEVISAAPEKKDYRGKK
FT                   GMTFTPDATLSEVSGRLFDCLFIPGGYAPDRLRRYPQVLSMVKKHLEEDRLVAAVCHGP
FT                   WVLISAKVVKDRKVTGFYAIKDDLENAGAIYTGKSVEEDGNLITATDPSSMLQMIKLIL
FT                   EKFSQTGSKLAH"
FT   CDS_pept        complement(77206..78474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="HTH_0074"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68541"
FT                   /db_xref="GOA:D3DFD9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFD9"
FT                   /protein_id="BAI68541.1"
FT                   /translation="MDRVLVWGLGISGKSAIKLLKAKGYEVYAGDDKDGTDFREYLDLV
FT                   DTVVLSPGIPPRHPLWIEAQKRGLEVIGEMELAYRFFKGRVVAITGTDGKSTVTRMTYL
FT                   ILREHFGNVLEGGNTGTAFSEIVLRDPFSLAVLEVSSFQGKTLKTFRPCCGAFLNFARD
FT                   HLDWHISLEDYLHSKYNIFKHQQEEDFVVLYSRQEEVVNTPTRAKKYFFSSKDAHGFLR
FT                   EGRAYFMGEELFEVSKLKIYGHHNYRNALASAMIAKLMGVPSETIRKVLYEFSGLPFRL
FT                   ELLGEWEGVKVFNDSKATTVNALESALKSMPDKSVILIAGGRDKGGDFESLYDLILQKV
FT                   RLALLIGEAKDKIFQAWRGATILEKVESLEEALKVAKAYSQRGDIILFSPACASFDMFK
FT                   DYIERGQRFNELVYSLFGRTSQV"
FT   CDS_pept        78493..78825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="HTH_0075"
FT                   /product="periplasmic divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68542"
FT                   /db_xref="GOA:D3DFE0"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE0"
FT                   /protein_id="BAI68542.1"
FT                   /translation="MHRYFVVFITTSVDRAEDMAQHIIKEKLGACVNIVREVNSIYWWK
FT                   GNIERGKESLLVVKTAKEKLRDLVDGVKSIHPYTVPEIIAIPIEAGNEDYLKWIDESLG
FT                   ISQESS"
FT   CDS_pept        complement(78779..79369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0076"
FT                   /product="anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68543"
FT                   /db_xref="GOA:D3DFE1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE1"
FT                   /protein_id="BAI68543.1"
FT                   /translation="MELLVIDNYDSFTYNLVQYFQMLGCHVAVRRNDEITLMDIEKAKP
FT                   DAIVISPGPCSPKEAGISVDVIKRFYRDIPILGVCLGHQAIAYAFGAKIVRAKNLMHGK
FT                   TSLIYHTQEGIFRGIKNPFVAVRYHSLVVERESLPPVLKITAESDDGEIMGLEHRDYPL
FT                   FGVQFHPESVLSESGMDILKNFLEISQEIRLST"
FT   CDS_pept        79637..81532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acs"
FT                   /locus_tag="HTH_0077"
FT                   /product="acyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68544"
FT                   /db_xref="GOA:D3DFE2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE2"
FT                   /protein_id="BAI68544.1"
FT                   /translation="MVEDRSETLLKVEEKYMPPPSIVESAWVRDYETLYQESIKDREAF
FT                   WAKVAEDLHWFKKWDKVLEWNYPYAKWFVGGKTNITYNCLDRHVKNGKRNKVAYIALDE
FT                   DSREKKITYGELLELVNRIANGLKSLGVKKGDRVSIYMPNTVEAVACMLACARIGAIHS
FT                   LVFAGFSEGALRLRIEDAKAKVVITASYTKRRGKKIDLLATAQRAIDGLDFVEKVIVWD
FT                   RDGDVLNGEDKFFVSLDELISTSSPKCEPEVMDAEDPLYILYTSGTTGKPKGVLHTTGG
FT                   YMVGTYYTTKVVFDLKEDDIYWCTADIGWVTGHSYIVYGPLAVGATSLIVEGAPDYPDP
FT                   GRWWSYVEKYRVNIFYTAPTAVRMFMKYGEQWPAKYDLSSLRILGSVGEPINPEAWHWY
FT                   FKNIGREKCVIVDTWWQTETGMHMITTIPSYPAKPGKAGKPFFGIEALVVDRHGNVLPP
FT                   NTIGNLVIKTPWPSMLRTCWGEPERYEKYWNTIPGYYLTGDLASYDEEGYIMILGRADD
FT                   VLNVAGHRIGTMEVESAIVDYPAVAEAAVIGKPHEVKGESIKAFVILKKGYEPSEKLVE
FT                   EIKYHVKQVLGPIAVPDEIEFVEKLPKTRSGKIMRRVLKAQELGLPVGDISTLED"
FT   CDS_pept        complement(81484..81966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68545"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE3"
FT                   /protein_id="BAI68545.1"
FT                   /translation="MVSPFQTLQRRVSPFCYILLTMFGKKEEARVSNQEIRTLIGIGCL
FT                   FDGNLTIPEGLTRIDGEIRGNISGKGGLILGERGSVRGDIDLERVVVYGRVQGNIKAQS
FT                   LEIKAGGRVDGNVQVKELIIEKGAVYNGECKMEGGEAPTELQSSRVDMSPTGSPSS"
FT   CDS_pept        complement(81976..84003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0079"
FT                   /product="TonB dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68546"
FT                   /db_xref="GOA:D3DFE4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE4"
FT                   /protein_id="BAI68546.1"
FT                   /translation="MRGILLITATLSVGYAQELLLKEIEVKAKREPFEESLEIREVRES
FT                   SAKDVGEALTKLGGIWKIRKGGIANDIVLRGFYRDNINVLIDGERVYGACPNRMDPPAF
FT                   HVDFSEVEKIEVIKGPFDVKHQGSMAGLVNIITRKPEKGFHLKLNAGVGSFSFINLSPT
FT                   VSYADERFYGLAGYSYKYSKPYKDGDGKKFTEVYPSDSPNRYKPQFINSKAFEINTYWA
FT                   KFGFKPLENHQLELSYTKQDARHVLYPYLLMDAIYDKTDRFNFTYGIDSISDTLKSLNF
FT                   QFYYTKVDHWMDDRYRVSSGMMPWSMATDAKTKTYGGRLEGKIRDFTVGFEAYKRNWDA
FT                   VNYMMSMAQFVIPDVDTKSFGAYGEYRKALFGKLRLVAGIRLDTTKTEADASKANTDLY
FT                   FAYKNTRSTSKTDTYPSGNLQLFYSLSKETELFVGLGHSVRVPDPQERYFALKRMTGSD
FT                   WVGNPNLKPSKNTELDLGVKYSTGKLLTKATIFYSYIKDYITVHDQNKVNMVMGVMNNS
FT                   ARSYENVNAQFFGGELDSRLALTDKVFLFGGLSYVQARKDTKPDKNIYSSKVAEVPPLK
FT                   ARLALRYDRGWYFGEIESILSATQYRVDTDLKEQRTSGYAILNLKVGGSYRGLSITAGV
FT                   DNLLDKKYYDYLSYQRDPFRSGVKVPEPGRTFYVNASYNF"
FT   CDS_pept        complement(84017..84448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68547"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE5"
FT                   /protein_id="BAI68547.1"
FT                   /translation="MRSIALILTNLLAVLVLTIYAQEAHDKTHQAQKEGAILVVNLTHD
FT                   RGISAEMALTFANISLGRGYETVVWLNSEGVRLADAKAKETQAIKLLREFLSKGGKVYV
FT                   CPVCAQKLKVEKIASGTQWANPDIIFPLITQEKTKIVSW"
FT   CDS_pept        complement(84537..85784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="HTH_0081"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68548"
FT                   /db_xref="GOA:D3DFE6"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE6"
FT                   /protein_id="BAI68548.1"
FT                   /translation="MLKEYNRYLEYIDGELHLEGVSLKALAEEFGTPLYVYSASHIRDR
FT                   VRAYREAFPDALICYAVKANFNPSIIRVAREEGAGADIVSGGELYASLLAGVEPSRIVY
FT                   AGVGKTLKELEYAIKSDILMFNVESRMELDVLNHLAESLGKKIRIAIRVNPDVDPKTHP
FT                   YISTGMKKSKFGVDIKHAKQEYQYAGKLKNLEVVGIHCHIGSQILDVSPYIEAVEKVVD
FT                   LYHELVRSGFEIRYVDIGGGLGIKYKPDQSNPEPKDLAEAVMPALKGVDAKILLEPGRS
FT                   IVGNAGLLITRVEFLKDKGHKHFVIVDAGMNDLIRPAMYDAYHHIVPVVKRDTGYIKTD
FT                   IVGPICETGDFLALDREIQKVERGDYLAVLSAGAYGFAMSSHYNVRPRACEVLVEKQSY
FT                   KIIRERETYAYIFKGE"
FT   CDS_pept        complement(85798..86298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA2"
FT                   /locus_tag="HTH_0082"
FT                   /product="phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68549"
FT                   /db_xref="GOA:D3DFE7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE7"
FT                   /protein_id="BAI68549.1"
FT                   /translation="MATLITLLRFLITFPAFYAVILGQLRWALVLILLGALSDLLDGSV
FT                   ARKNKEESKWGALLDPLVDKIFFLSILSAFLYMQQINPVAFLLLLIRELLVSFLRSMGA
FT                   EKGYTMQASYLGKTKTFFEFLSLILLSAGSPLGGWMLWIAVLFAYISMYDYLIKYTTFE
FT                   KSS"
FT   CDS_pept        complement(86286..87050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68550"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE8"
FT                   /protein_id="BAI68550.1"
FT                   /translation="MGINFEEFLAFRFKDGELQPIEHPHIPKFEDLLHIERQKEELRKN
FT                   TLKLVMDLPAHDALLWGDRGTGKSSLVKSMLGLFASKGLRLVQVYQMDILHLSDLYGLL
FT                   RRTSQKFILFFDDLSFERHDQQVNVLKSLLDGDVEERPKNVVVYVTSNRRNLMPENLEE
FT                   EKFPEERRIQIASLVERFGIRLGFFSFSKDEYLDMVRHYAKVRGLKIDAEELEKRALDW
FT                   ARERYGFSGRSAYQLIKDLEGQLMLKSLGWLL"
FT   CDS_pept        complement(87041..87862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0084"
FT                   /product="NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68551"
FT                   /db_xref="GOA:D3DFE9"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFE9"
FT                   /protein_id="BAI68551.1"
FT                   /translation="MKVLIFVKDSQTAIETSRKIEEFLKGKGISTEVFVNLRGNRCRLN
FT                   LKDKDLLLVIGGDGTFLAGARLVAKHRIPILGINEGRFGFLTEVEKENAFEVLELLLED
FT                   KLSIQKRMMVCAYIKRGGKQHFLGDYLNDVVVSKSTIARMLELDAYAGKDFMMRVYGDG
FT                   IIISTPTGSTAYALSAGGPIVYPLSENLLFVPICPHTLSNRPLVLPSGFEIRIVNLSPD
FT                   NMAFLTLDGQKGMALKKGEEIIIKKSKHYCLMYPNPKRGFFEILKEKLRWG"
FT   CDS_pept        complement(87859..88422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="HTH_0085"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68552"
FT                   /db_xref="GOA:D3DFF0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF0"
FT                   /protein_id="BAI68552.1"
FT                   /translation="MMELIINSFKESADVKLAFVELYAQQILDVGKIIAQALKDGNKLL
FT                   LFGNGGSAADAQHIAAEIVGRFKKERKALPAIALTTDTSVLTAVGNDYGFETIFERQIE
FT                   ALCMPGDVVIGITTSGNSENVIRGLSKAHALGATTVAFTGRKGGKVVDVAHYSFIVPSY
FT                   DTARIQECHITLGHVLCELIDNLL"
FT   CDS_pept        complement(88394..89296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0086"
FT                   /product="bacterioferritin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68553"
FT                   /db_xref="GOA:D3DFF1"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF1"
FT                   /protein_id="BAI68553.1"
FT                   /translation="MNKRELINLLLYDVALEHSAIVQYLYHIFLITDKNITEEIEVIAR
FT                   QEMRHLKWFAQKVVSLGGQVVLDRLEDMIVVGGPDWEDMLSKDVDAEQMAIETYTKQLE
FT                   VVKDESVKRLLERVIKDEEDHRIEFTELKELAKESLLIEGQAQKADPKTLEVLNRFLKE
FT                   EYQTIINYLYQFFHTKDCTYRDIMLDLAIESMTHMGKIGEKIGELGGMPSIEADLSPKP
FT                   LRKLEEQVKQEMSYEQSTGEDYKKVVESLKDPDLQRLFRFIENQEEYHKHMLSEFFKTM
FT                   RRLTVGSLKKDDGADNKLL"
FT   CDS_pept        complement(89302..90978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP1"
FT                   /locus_tag="HTH_0087"
FT                   /product="glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68554"
FT                   /db_xref="GOA:D3DFF2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF2"
FT                   /protein_id="BAI68554.1"
FT                   /translation="MIAYFVMELGLEDRIPTYSGGLGTLAGDTLYSFADLSIPAVCITL
FT                   LYKKGYTLQKITHHGMQLDFDTLWDYKKVLTPLDVEVRMHFGDKEQKVRAWEYTLRGHG
FT                   DIKVIFLDTDIPGNEPDIRRLNERLYLDEGLYRLRQEMLLGIGGYRVLKALGYNISVYH
FT                   KNESHSALLVVELLRELGDFQKVRSRCVFTTHTPVPAGHDKFPIDMVKQELKLYDHIDW
FT                   NKEAIDGFLNLSAFALRYSCKVNAVSYKHMFVTKNILIDQVPTEGPCELEYVTNGVYHR
FT                   RWIHPELQELFNEYMPAWDENPVLLNQVYRVPSELLLKKHNKVKNELVNYINKTTGAGF
FT                   SDDVLTIGVARRVTAYKRNNLILRDIDRLIYVAEHFGELQIVFAGKAHPKDSMGKEMIA
FT                   DIFSKIQALKQRTSKVKVAFLENYSIDMAKLLVAGCDVWLNNPKRPYEACGTSGMKAAM
FT                   NGVLNFSTWDGWWLEGGIEGINGWGIGPRPSWSDMSESNDEEDLEDIYGKLAYVILPMY
FT                   YTSKDQWVFMMKNSIATVGPFFNTHRMVSEYISKVYQIGLR"
FT   CDS_pept        complement(90975..92636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP2"
FT                   /locus_tag="HTH_0088"
FT                   /product="glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68555"
FT                   /db_xref="GOA:D3DFF3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF3"
FT                   /protein_id="BAI68555.1"
FT                   /translation="MIAYFVMEVGLEESIPTYSGGLGTLIGDTILTFADLGIPAVCVTL
FT                   LYKKGYVYQKIAKDGRQADLEDIWDYQEVLRPLSVEVEVPIGERKQKLRVWEYTVKGKR
FT                   DIKVLFLDGDLDGNDEKVREAFQRLYYSDKERRLIQEVVLGIGGYRALKALGYDIALYH
FT                   INESHSAFLLFELLKESKDVEDVKKKVVFTTHTSLPVGHDTFPLSMVKEYLKMYDGIDW
FT                   EKEATDDGQLDLSLLSARYSSIVNAVSLRHRFITRRSYAFRDVDYITNGVYHRRWVCEE
FT                   MKDLFDRYILGWDDNPALLKQAHDIPSIELLKAHSEAKERLITFINKNYDVSFVPECPI
FT                   LCIARRITAYKRNNLILKDIDRLIRISERFGCLQVVFAGRAHPADSDGKAIIKDINDKI
FT                   SYAKSKTKSLRMVFLENYGIGLAKLLVAGCDVWLNNPKRPYEACGTSGMKAAMNGVLNL
FT                   STWDGWWLEGGIEGINGWGIGPRPSWSDMSESNDEEDLEDIYGKLQHIILPMYYNYQDE
FT                   WVKLMKNSIATVGPCFNTYRMVSEYFVKIYSAGLKL"
FT   CDS_pept        92657..93997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0089"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68556"
FT                   /db_xref="GOA:D3DFF4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF4"
FT                   /protein_id="BAI68556.1"
FT                   /translation="MRFISTDITCRLDSLPWCRFHTMFVLALGITWVLDAFEVVIVSAV
FT                   LKPMSKALNFTPTQSSLMVSGFLLGAIIGSFLFGYLADKYGRKKLFLLTLLLYAGGTFL
FT                   TGFANSFESALFFRIIAGAGIGGEFAAIHSAIDEFVPSRHRGKVDGTISALWNLGSVLA
FT                   SLSASLILSYFHEEFAWRFAFLLGGVLALAVLFVRLYVPESPRWLLSKGRVQEAESIVQ
FT                   RLEKMAGGRYSIQKCDIPVFEGSIWNATKLILSSYRWRFVFSSLMSITILSAYYGLITL
FT                   IPTSFSSAFGFSSQEIPGILLVGSLGGLVGGLAVAFMNDALGRKITGSLVSFLAFLLSL
FT                   LFLSPLDFNNVYFAYSLIAFSFASVAYVSSTEIYPSYLRAYAIGLFSVIGRVSGALSPV
FT                   LLVKLSSLDYAYGVLGLSLFWLLGFLAFLVWAIKGKEAKGKSIEEIT"
FT   CDS_pept        complement(94031..95176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68557"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF5"
FT                   /protein_id="BAI68557.1"
FT                   /translation="MVHSMAFYVQSNCFRKVCYKISSAVQCKAGHAKGYWVRQAAVFAI
FT                   SLGLLTGGCSQQDQGNKAQESQASKNSVQYSAVELQMDVLEIGKDEKVYNIKQDGNTVD
FT                   SFSVSVKNIEDKQGLRVECILKHRDKSIHKEEECFGLSIKKAFKVGENLLLLLTFATGG
FT                   NTCIVEYAFLTLKPNKEVGLSQRFDNCFPATEVRTEDGSILVKIPSYDEPKLFVYKDGL
FT                   LEEKPDPEFAEPDAKTIKPKDNEKLTLELLKAACLNKVGRSKDGRLECKPCPSFTSFGK
FT                   DSMIEDSLVVEEIYGGDFYPGKKYYIVRYSGCEPNSKGGGGYYMVEETKRGLRFVSVYN
FT                   ESAGKCRVRTKQGRDYLYCTLGECYVKSAGRLGCRFINLDF"
FT   CDS_pept        95210..96409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="HTH_0091"
FT                   /product="anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68558"
FT                   /db_xref="GOA:D3DFF6"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF6"
FT                   /protein_id="BAI68558.1"
FT                   /translation="MRIILFSGKGGVGKTTISAATAYRLSQLGYKTIVVSLDPAHSLGD
FT                   AFDIPESEKVKAKGLPIKINEKLYIQEIDIQEELDRYWGDVYRFLELLFNTTGLDQVVS
FT                   EELAVLPGMEEVTSLLYVNKYYREKEFDVLVLDLPPTGESLRFVSMPTVLKWYMKKVFN
FT                   VERTILKVARPVARRLTDVPLPDDSYFQALENFYEKLKGVDEILIDPETTSVRIVANPE
FT                   KMVLKESQRAFMYFNLFGVNVDAVIINKVLSPELEGCEHLSRWVLTQKKYLNEMSALFA
FT                   PVPIFRVPLLEDEVVGPERLSILASMIYGDTDPSRVLFKEKPYEFVQEGNRYLVKLRAP
FT                   FLTKEGLTVLKSDGEITIRWRNFKSHIMLPRKLRNYDPVGAKIDKGYLIIELVSEKISS
FT                   "
FT   CDS_pept        96465..97502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hynS"
FT                   /locus_tag="HTH_0092"
FT                   /product="Ni,Fe-hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68559"
FT                   /db_xref="GOA:D3DFF7"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF7"
FT                   /protein_id="BAI68559.1"
FT                   /translation="MESLYHIYRRRGYTRRDFLKSVLLLSAVLGFPPTSFGQAVKALEL
FT                   KPKPVVIWLEFQDCAGCTESFIRSTSILPSDVLLDYISLEYHETLMSPSGFYAEEAKRE
FT                   AIEKYKGKYILIVEGSVSPRNKGVYCTVSGKSNVELLKEAAQNAGLVIAVGSCASWGGI
FT                   PHAEPNPTGAVPVSQILGDRQVVNIPGCPPISDVMVAVIAGFVITGKPPELDSMGRPKT
FT                   FYGQTIHDRCYRRPFYNAGKLAGSFDDESARKGYCLYKLGCKGPITRNACATIRWNGGL
FT                   SFPIQSGHPCFGCSEPNFWDRGFIYSPLSVVEGGFGWKGILAGVATGVALGAASAAINK
FT                   KFREK"
FT   CDS_pept        97504..98175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68560"
FT                   /db_xref="GOA:D3DFF8"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF8"
FT                   /protein_id="BAI68560.1"
FT                   /translation="MGDTTFYDLVRGPLLRFALFIFFAGISYRFFRVVFLGLPPDYAKP
FT                   KGNPYYMAVKKIVIKPTMGWTFNEIFSRRAVNFIGGFLFHLGFLGLTFFVPAHALLWRE
FT                   ITGLPIPTIPNLLGDILAYAALGSLLALTIHRMLNPVLKLLTGKDEYFANFLIGAILFT
FT                   GLLATKWAGGGFYVWILSTHMLLADLLIIYIPFSRLSHFVYYFLSVGFMGWNAGKRGVS
FT                   F"
FT   CDS_pept        98188..99498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0094"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68561"
FT                   /db_xref="GOA:D3DFF9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFF9"
FT                   /protein_id="BAI68561.1"
FT                   /translation="MLVESKEEIGQEEIEKFYEFCKKSINTEVASYLEACVRCGICAEA
FT                   CLFYMGENVSGRIDPTLTPAYKADLLRDIYKENYTFVGRIKRLLGFGVKITPEDLREQI
FT                   KLAFYTCTNCDRCTKACPMGIDTPKLVSIVRGALTYAGLTPKDLADATNLSVEKGSPLG
FT                   VDIPTFLKRIEFISEEYEVEMPVDKRPSEYLYIPSSIELMKFPSSVASAAKVLNSSGVS
FT                   WTLSTVAHEATNFGLFAQSKEVTKEMIRRVLEGAKELEVKYIIAPECGHAYQSMRFIAP
FT                   NVFPKEWKFEVLNIVEFIDRMIKEGKLTIKRKVLKERATLHDSCQIGRRGGVLREPRKI
FT                   LSIIAENFKDSVVIPEHNICCGGGGGVLVIKDADYYRQKGFISKMTLFDKAGAKTIVCY
FT                   CANCMLALNMGTQELKRDYKFVSIVDLVAEAIKEEEG"
FT   CDS_pept        99495..101192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hynL"
FT                   /locus_tag="HTH_0095"
FT                   /product="Ni,Fe-hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68562"
FT                   /db_xref="GOA:D3DFG0"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG0"
FT                   /protein_id="BAI68562.1"
FT                   /translation="MSRLVIDPVTRIEGHLRIEAELEGNRVKSAYSSGTMVRGIEIILK
FT                   GRDPREAWAFAQRICGVCTTVHAFASIRAVEDALKIKVPRNASLIRKLMIGTLFVHDHV
FT                   VHFYHLHALDWVNPIQALKADPVKTSELAQKLSDYEKSSPSYFKEVQDKIRQQVERKQL
FT                   GIFSRGYWDHPDYRLPPEANLMAVAHYLDALNWQTKIVQVHTIFGGKNPHPNFVVGGMA
FT                   CPIDLQSDTAINMDKLGRIKSLIDSMIEFVEKVYLPDLIAIASFYKDWFEKGEGVKNFL
FT                   VLGEPEGDSHREGKFFIPPTFIRDRNLENYEDVDYSKIEEYVTHSYYKYSVGDERGLHP
FT                   FEGETVLHYTGPEPPYQQLNVEGKYSWLKAPRYRGLPAEVGPLARILALYARDEHGARE
FT                   LVNSYLSKLGLPVNALYSTMGRTLARGIETYIYAHAIRSYYDQLVQNVKSGDSTTFNGE
FT                   KWEPSTWEKDAKGLGLMEAPRGSLSHWVHIKDGKIANYQAVVPTTWNGSPRDAKGQPSP
FT                   YEASLVGHELVNPKEPLEIIRTIHSFDPCLACAVHLYSDTEDTIIKIT"
FT   CDS_pept        complement(101179..101877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="HTH_0096"
FT                   /product="biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68563"
FT                   /db_xref="GOA:D3DFG1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG1"
FT                   /protein_id="BAI68563.1"
FT                   /translation="MSRFYSLVWLEEVSSTQDWLKEKSINCVVVARRQTKGRGRYGRSW
FT                   QSDEGGLYFSFPLTETFKDEQTLPLAIALSVCQMLEDYGFLASIKWVNDVYIGGKKICG
FT                   ILVEKTKDRTLIGIGLNVNQKRFTESLQATSLLLVSGREYHLADVLLKLLDRIDKNLDL
FT                   LKERGFQVLREEVKKRLLFLGEEVVLYTDPPTVGILADLSPEGYLVLMTAQGEKKVVSG
FT                   DITLRGTMLS"
FT   CDS_pept        complement(101874..103220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="HTH_0097"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68564"
FT                   /db_xref="GOA:D3DFG2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG2"
FT                   /protein_id="BAI68564.1"
FT                   /translation="MLDFETLDRWDKEYFWHPFTQMKVYREEENLIFEKGEGVYLYDIK
FT                   GRKFIDAISSLWCNVHGHNHPKLNKAIIDQLQKVAHTTTLGSSNVPAILLAKKLIEIAP
FT                   EGLTKVFYSEDGAEAVEIAIKLAYQYWRNKGERRKTFITLSEAYHGDTIGAVSIGGIDL
FT                   FHGTYKDLLFETLKLPSPYLYCKERYGKLCDECRDELLSMVEEILKERGEDVVAVSLEA
FT                   GIQAAAGMLPFPKGFLKGVRELARKYNTLLIVDEVATGFGRTGSMFYCQQEGVSPDFMC
FT                   LGKGLTGGYLPLAATLTTQEVFEAFLGEFGEKKHFYHGHTYTGNNLACAVALANLEVFE
FT                   EEKTLEKLQPKIEYLTRRLKEFWELKHVGDVRQLGFMAGIELVKDKEKGEPFPYGERTG
FT                   FKVAYRCREMGVFLRPLGDVMVLMMPLVISYEEIDRVINALKQAISFLS"
FT   CDS_pept        103399..105066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="HTH_0098"
FT                   /product="dihydroxyacid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68565"
FT                   /db_xref="GOA:D3DFG3"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG3"
FT                   /protein_id="BAI68565.1"
FT                   /translation="MWRSDKVKKGIERSPHRALLRACGLSDEDFDKPLIGIANSYIDII
FT                   PGHVHLREFVKPIKDEVRKAGGVPIEFNVIGVDDGIAMGHYGMHYSLPSRELIADSIET
FT                   VVEAHQLDALICIPNCDKIVPGMLMATARLNIPTIFISGGPMLAGEVNGKKVDLISVFE
FT                   GIGQLKAGKIDEGQLKVIEEHACPTCGSCSGMFTANSMNCITEVLGLGLPGNGTIPAVD
FT                   PRRELLARAAARQIMELLKRDIKPRDILTIEAFDNAFAVDIAMGGSSNTILHLLAIANE
FT                   AGISYPLSRINEISRRTPNICKISPSSEYHIQDLDAVGGIPSLLKELIRGGYLPHPDAM
FT                   TVSLKTHKEIAEEAPDADGSVIRRVEDPYSKEGGIAILFGNLAPEGSVVKTAGVDPNML
FT                   TFRGRAICFDSEEEAIEGILGGKVKPGHVVVIRYEGPKGGPGMREMLSPTSAIMGMGLG
FT                   DKVALITDGRFSGGTRGACVGHISPEAAAGGPIGVVKDGDEILIDIPNRKIELLISQEE
FT                   LKRRLENFVPKTKEVKSSWLRRYIRFVTSASKGAILEA"
FT   CDS_pept        complement(105041..105763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68566"
FT                   /db_xref="GOA:D3DFG4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG4"
FT                   /protein_id="BAI68566.1"
FT                   /translation="MFFLKKFLSALLLPPGLFVLALLLISFFERKKRLTYYTSVSLALL
FT                   IYMLSIEPVKDTLLTPLESKYSVPEKFQADAIVVLGGGSYSTGILKEDSMKRLLTALIL
FT                   HKRTGLPIVLSGGAENLPDAEIMKSLLVELGVDKRDIITEVRSRDTEENASYVREICQQ
FT                   RNYKSVVLVTSAYHLPRAVFLFKKEGLSVIPYPTDFKRDLRYNLYSLLPKMSVLNDSVK
FT                   ALREYVALLSLRLPEWLP"
FT   CDS_pept        complement(105763..106155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0100"
FT                   /product="biopolymer transport protein ExbD/TolR-type"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68567"
FT                   /db_xref="GOA:D3DFG5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG5"
FT                   /protein_id="BAI68567.1"
FT                   /translation="MRRRRLSYDERAYIDVVPLVDTLLAVFLFLAILAFQSPMTFLAVK
FT                   LPFAQEGEKKVLSTMRVQVLKDGSYMYEGKKVSLEELDKQMQTKQPGSLVIEADEDTLH
FT                   KFVVALMDIAKKEKVQDVIIATRTRR"
FT   CDS_pept        complement(106152..106766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0101"
FT                   /product="biopolymer transport protein ExbB/TolQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68568"
FT                   /db_xref="GOA:D3DFG6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG6"
FT                   /protein_id="BAI68568.1"
FT                   /translation="MDMIFDLLQKGGFAVYVLLFLSLVSWALIIERLINLRAGSILSKS
FT                   VKDVKSLLAGGDIEGALKLLSLDNSPAGGILYRMLEEYKGGKVDKRTLLNDLSFEVSLL
FT                   VPKVEKNLALLSTIASVSPLIGLFGTITGLIKVFSAFAVAQTEQGIALLAAGISEALVS
FT                   AATGLAVAIPALLAYWVFRIIGNSVLDRVEAELSEALRVLK"
FT   CDS_pept        complement(106768..109308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68569"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFG7"
FT                   /protein_id="BAI68569.1"
FT                   /translation="MWKLTRLFSLLACTLFLISADIKKEFDVSVELIGRSAEEKPKRLP
FT                   PETLQIPEEEPLDLSSRLLEPPSKFEQAQIKPFKEEGGISCGEPKDLVSYRLGIDYYLQ
FT                   GKYGPAKEELFKVVAMPSPFKPMAEYVLGVIYVREGKEDKATELFKHSCSFSHMYQKAS
FT                   CESYYALSFLLNGKVPQNQDPMWKAVADIKSGRITKPVCDGAIFKEYCQYVHEFYEGKE
FT                   GKNYKDSLRLRKAIVLYQRGSLLQAEETFKEYSKPSKPYRDVALYYLGLIEAKRGNERK
FT                   ALDYASILETINPKLSENLYAIISAKDILLSRLTYSITGDKRFLDRAGIIAYNSGDYRL
FT                   AVYNFLESGNVLYAVYSYVKLGEYSKAYDLLKNLSRKNREEYEWELETAYWADRSLEPI
FT                   LEEIRNRYPALYREYTGWFYFKKGDWENAVRYLEDPYYKALAYFNMKDYKGVLNILESR
FT                   NSERDRVLKAKSALFLGDPKLARSFLTDKTDEELYLLGLSYFLEGDYESSAKYFKSISS
FT                   NSPLKPKALLKLGDALYNEGKVESAKAYYYEIISKYPNSEQAKYATLSLIGMGGKNIGD
FT                   VQMQQLLEDYLRKYPNSAVSEDLKYQLAQIYIKNAQEDKAKNILLELMDSPLKYKAILK
FT                   LAQLEKDPSKKAVLLYKVYKEGSSEERREARDELIEFYTQLGDRKSLADLLAEGQDSDK
FT                   VKAVGIYISMGDDADAQKVAKQLMAEGYRDQELESYLLDLYKTSKDRGYLDYLKQSKDR
FT                   NIRSQAVYLSALDYLKSGEKKKALEDFVDITVNYKDSPFYNQAVIEGAKVLIDLNARHD
FT                   ASCLLDKANLDMASKEEVAVINSLKSRLPKCEVR"
FT   CDS_pept        complement(109283..109918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmA"
FT                   /locus_tag="HTH_0103"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68570"
FT                   /db_xref="GOA:D3DFG8"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="PDB:4IJ5"
FT                   /db_xref="PDB:4IJ6"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3DFG8"
FT                   /protein_id="BAI68570.1"
FT                   /translation="MVKLILVRHAESEWNPVGRYQGLLDPDLSERGKKQAKLLAQELSR
FT                   EHLDVIYSSPLKRTYLTALEIAEAKNLEVIKEDRIIEIDHGMWSGMLVEEVMEKYPEDF
FT                   RRWVEEPHKVEFQGGESLASVYNRVKGFLEEVRKRHWNQTVVVVSHTVPMRAMYCALLG
FT                   VDLSKFWSFGCDNASYSVIHMEERRNVILKLNITCHLGEFYVEAHKAI"
FT   CDS_pept        complement(109912..111033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amnT2"
FT                   /locus_tag="HTH_0104"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68571"
FT                   /db_xref="GOA:D2Z0H9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D2Z0H9"
FT                   /protein_id="BAI68571.1"
FT                   /translation="MYQERLFTPGPVEIPDRVREALGRQIIHHRTEEFRRAFLEVRELL
FT                   KRLLDDPSENFVFFSSSGTGAMEAAILNFFEEGQKVLVVNGGKFGERWFLLAKHWGLEV
FT                   VEYRLDWGKSADPEKVKDLLKKHPDCKGVLLQISETSTGAYHPVEDIAEVCKSADALLV
FT                   ADAITALGVYNLKPSVGIDVMVGGSQKALMLPPGLSLLWFSQKAKERLKDRAFYFSVKK
FT                   ELGKQQEGQTAWTPAISLLLALKESLSLLLQEGMERVEKRYRAMSEGTKRAISAFGLEV
FT                   FPERPAISITAVKSDDAERIRKELLRHGIRIAGGQDHLKGKIFRVSHMGVSEKDMLMLI
FT                   GVLEVVLKRLGYPVELGSGVCRYSQTLVEFGLW"
FT   CDS_pept        111032..111883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0105"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68572"
FT                   /db_xref="GOA:D3DFH0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH0"
FT                   /protein_id="BAI68572.1"
FT                   /translation="MLNYFILMFGLVLAFLSSFFWATNDLITKKLIHKGLDEYFVLWIR
FT                   FPVSSLILLPIGIYFWDLSSFVLFSTFLWLPVEVLGGVFFVKALKYTPLSVAMSFYSFM
FT                   PFFSAVFGFLLLGEALSLQGFLGICLMVVGTLFLTGFSPGEFFRKHIGTVYMLISTLLF
FT                   GLNVVIGKMVIISSNPFFFSWYYTFCMSFATLIFVSPKHIIERGNYTDKKLLILGILFA
FT                   LGGVFYNTALVYAPASYVAAVERASLLLSMVYGRIFFGEPVKHLLPGVLLMLLGSALLS
FT                   VG"
FT   CDS_pept        complement(111860..112411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0106"
FT                   /product="putative carbonic anhydrase/acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68573"
FT                   /db_xref="GOA:D3DFH1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH1"
FT                   /protein_id="BAI68573.1"
FT                   /translation="MITQRSKMALVKPYRGVYPQIHPSVYLSENVVIVGDVHIGEDSSI
FT                   WFGTVIRGDVNYIRIGKRTNIQDNCVVHVTHNTYPTIVGDGVTVGHRVVLHGCTLGNYV
FT                   LVGMGAVVMDGVEVEDYVLIGAGALLTPGKRIPSGVLVAGVPAKIIRDLKPEEVELIKR
FT                   SAENYVAYKNSYMSADAQKR"
FT   CDS_pept        complement(112392..113588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HTH_0107"
FT                   /product="3-phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68574"
FT                   /db_xref="GOA:D3DFH2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH2"
FT                   /protein_id="BAI68574.1"
FT                   /translation="MVLGKKRLKDVNITGKRVLVRVDFNVPIDEQGNIEDDTRIRASLP
FT                   TIEYLLDAKAKVILMSHLGRPKGRDSKYSLSPVAKRLSRYINKDVIMADDCIGPSVKAL
FT                   VEKMKEGDVLLLENLRFHKEEEENDEEFAKELASLGEIYVSDAFGTCHRKHASVYTVPK
FT                   ILKPAVMGFLLEKEISYFEKAMVNPQRPVVAILGGVKVSSKIGIIKNLLKRVDKIFVGG
FT                   AMAFTFIKAMGYSVGNSIVEDGYIETAKDIMEVARKLGVKFYLPVDFLLGRELSNNTPT
FT                   RLVPWQEIPQGWMGLDIGPVSIALLREIVSDAQTIIWNGPMGAFELDRFEDGTYETAKI
FT                   LANSSALTIAGGGDTDHAIHRAGVYNSIDFVSTGGGAFLELLEGNTLPCIEVLDNSEE"
FT   CDS_pept        complement(113602..113937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68575"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH3"
FT                   /protein_id="BAI68575.1"
FT                   /translation="MKNTPLDVHLLEELSHLEYFIVKSPVNSPDFWKEWQEKFSRAYMS
FT                   RIAVKKILKTKKPPYEEHSKYKAQILLYEDVLYYLETLKNIALNLRGIFTSDQNVELDD
FT                   EDIDLDL"
FT   CDS_pept        complement(113949..114728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="HTH_0109"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68576"
FT                   /db_xref="GOA:D3DFH4"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH4"
FT                   /protein_id="BAI68576.1"
FT                   /translation="MGFLKEILERKRQEVKKTRELIKNLPLTPKRERSLAFEDALCGKG
FT                   TKIIAEVKKASPSEGKIREVSAWHQAKIYESAGAVAVSVLTDSTYFDGSLEDLYQVRRT
FT                   VNIPILRKDFIIDTVQIEEARAFGADAVLLIVRILEPSLLKDLIEYSYALSITPLVEVF
FT                   DLKEAEIALRAGAKVIGINNRDLDTLKVDTELSKRLTPLLKQMGAKYVIAESGISEREQ
FT                   ILELESLGADAFLVGTALMKSQDPAKKLRELLGYNDV"
FT   CDS_pept        complement(114728..115318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68577"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH5"
FT                   /protein_id="BAI68577.1"
FT                   /translation="MNAVQEKQEFKVLDLSGLMCPLPVVMTSEQMKRLKDGEVLTVIST
FT                   DPGFELDIKNWCAQTGNELLSVKRNGNQVVVEIKKKPFSVEPSLWYWIKFHALGVKLHL
FT                   RHILMQLNPLIKKPDHFITFTAISEGTRAEKFLKGKAKLIPVPDEIDPRCGVVLAVAGY
FT                   QKAKGIYEELLKKGFGVEAIYKKEGKSYRRVYP"
FT   CDS_pept        complement(115328..116185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68578"
FT                   /db_xref="GOA:D3DFH6"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH6"
FT                   /protein_id="BAI68578.1"
FT                   /translation="MLKDVNLILLTIRLLLAFLFFAIAFEKPIHQRALLVFLTTLYVSL
FT                   SLLSYLHPTKARFLKRFLDALVLPPICFIAGDEILTLSLFVPALFYANRDTAVSLTLFW
FT                   AGILLFLYTGGMSSLYYLPLLFALFLASLSPDLVESIRKERYYIRKLRASYRELSKDLS
FT                   KLEKESREKDYLSFIIDKAVEDRSPEDFLLHIKEKFSLKRIAIVPKGEITHKEAIIDKE
FT                   NTALYVPVFFEKGCAYVIFYFNTPFELYDREITTTLEKSAKLLNLYIVGFDDHVKKDSV
FT                   RLAV"
FT   CDS_pept        complement(116195..118405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="HTH_0112"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68579"
FT                   /db_xref="GOA:D3DFH7"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH7"
FT                   /protein_id="BAI68579.1"
FT                   /translation="MVRRVLVVFLGAVSLIFAFVLFALFILSTDLPSVEKLKDWRPPEA
FT                   TLIYDYKGRVFGDVAVQRRYYVPLKDIPLYVRQAFIAAEDRNFYSHFGIDPIAVLRALI
FT                   ANIREREITQGASTITQQLARNLFLTPERSFKRKVKEMLLAIKIERAFSKDKILEMYLN
FT                   YIYLGQGAYGVEAASRIYFGKHVKDLTLDEAALLAGLPKAPTKYNPFRNPEKVKERRNY
FT                   VLQRMYEDGYITQDELKRYSSVPIRVKLENRYYGMDYFLDYVKDYLVEKYGEAILAGGY
FT                   KVYTTIDRDLQMHAREAVKRGVMRVAKANGIPFLPDDPYEVQKKYEEQQVELKPWRIYI
FT                   GKVLDVGSQELKVAVKDYQFTVPRNQLPVEKGDYVLVRFVKRGKDISAEVLPDLEGALV
FT                   ALDAKTGAIRAMVGGYSYLRSPYNRAVYAKRQPGSAIKPIIYLAALMKGYTQASTIDAT
FT                   PKSFFDPSKGKEWTPKNYEGAEYGVVTLRTAIAKSINTATVNLLSEIGFDMPMQVGKSL
FT                   GIDLKPYYSMALGSIEVTPLELTSAYQAFADLGIRCEPYFIQRIVAPDGKVIEENNPKC
FT                   EQVLPPQEVRVLVDMLRAVVLEGTAASASSFGRIVAGKTGTTNDYMDAWFVGFSPYIVA
FT                   GVWVGYDIKKSMGKGMAGARVALPIWLDFMSVAAFMYPNEDFPVPDGVVVVNCPTPMYF
FT                   VDGTQGICSGEQKQDETNELKGIVDPNILKKLEEEPKVKEIP"
FT   CDS_pept        118438..119250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="HTH_0113"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68580"
FT                   /db_xref="GOA:D3DFH8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH8"
FT                   /protein_id="BAI68580.1"
FT                   /translation="MRVLSPAKVNLGLWLLGRRADGYHEIFTIYQAVSLFDEIFIKEGP
FT                   LKVETSSLIPQEKNLVYKALRLMEKYLGRDIDFSIYIKKNIPEGAGLGGGSSNCATVLK
FT                   VVNQLLGEPLSVEDLENIAKEVSSDAVFFLYGGTAVGRGRGDVVEPIKHLDLKITLVYP
FT                   NVVASTRRVYSAVRDASLTDKIEDDKIISCLLEGKFEVLENTLGQVAMELFPEIKEAYR
FT                   FLEYLGYRPVVSGSGSCVFYIGEASEQVKKGAALRGWRLYEVKSYNGV"
FT   tRNA            119241..119313
FT                   /locus_tag="HTH_t03"
FT                   /product="tRNA-Gln"
FT   CDS_pept        119338..120267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="HTH_0114"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68581"
FT                   /db_xref="GOA:D3DFH9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFH9"
FT                   /protein_id="BAI68581.1"
FT                   /translation="MIIKLLTGNSNPSLAKEVSDYLGIPISDMIVSRFSDGEIRVQINE
FT                   SMRGEDVFIIQSLCPPVNEHIMELLLILDALKRASAGRITAVIPYYAYARQDRKDRPRV
FT                   PISARLLADLITVAGAQRLVVVDLHSPQIQGFFNIPVDNLYALNVLYDYLKDKVDENTV
FT                   VVSPDAGGVERARRLANKLGCGIAIIYKRRPEPNVAEVLDIIGDVNGKKAIIVDDMIDT
FT                   AGTIVSATNLLMSKGASGVSVVATHAVLSGPAIERINTSPLTQVVVTNTIPTEGKSCDK
FT                   LKVVSVAPLIAESIKRIHEGESVSSLFV"
FT   CDS_pept        120286..120864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="HTH_0115"
FT                   /product="ribosomal protein L25"
FT                   /note="general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68582"
FT                   /db_xref="GOA:D3DFI0"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI0"
FT                   /protein_id="BAI68582.1"
FT                   /translation="MRKVSLKLIPRELGKKSEIKRMRREGYIPVEVYGKDVENRHAYVS
FT                   LKDLMSLPHGETFLIEADVDGEKRVCLLKDIQVGYLGDDPVHVDLYDISHTKEIEIEVP
FT                   LEFVGTPAGVGLGGTFEVMMHTLTVKASVDSIPDKITVDVSAMNVGDVLHVRDITPPSG
FT                   CVIMDSPEEVIAVVLEPEVEETPTEETTT"
FT   CDS_pept        120864..121436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HTH_0116"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68583"
FT                   /db_xref="GOA:D3DFI1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI1"
FT                   /protein_id="BAI68583.1"
FT                   /translation="MIKLLVGLGNPGKKYQHTRHNVGFMVIDELAKKLKLREYREECLS
FT                   HLYRARIGGRDVLLAKPQTYMNNSGLAVINLLEEYSILPDEMIVVYDDLDLPLGRIRLR
FT                   LEGSSGGHHGIESIIREVKTEKFPRLKVGIGRPKDKNQVVSYVLSPFSEDEQTLLYRVL
FT                   ERSRECLIRCVEFSPEDAMNFCNSPIV"
FT   CDS_pept        complement(121426..123426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="HTH_0117"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68584"
FT                   /db_xref="GOA:D3DFI2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI2"
FT                   /protein_id="BAI68584.1"
FT                   /translation="MLEAGMNRDDTVINTIRFLSVDQVERAKSGHPGMPLGASHIAYLI
FT                   FDRFLKFNPKDPNWINRDRFVLSAGHASAMLYSLLFVMGYDINLEDLKSFRQLNSRTPG
FT                   HPERHLTPGVEATTGPLGQGIGNAVGMAIAEKYLSNFFNREGFPIIDHYTFALVSDGDL
FT                   MEGVSCEVGQLAGHLKLGKLIVIWDNNGVSIDGPTSLAWSEDVLKRFSAFGWHVAHIED
FT                   GYNLDELERAIKSAMEEKERPSFISVRTHLGYGSPKQDDASVHGAPLGKELALETKRRF
FT                   GWSEEEFYVPEEVYNYRKEKIEKGLKAQEEWNRLFEEYRRAYPDLAQKLLKAFKGDWGE
FT                   DYKIHIPVFTEPMATRQASGKLLNAIAKHIPTMIGGSADLSESNNTYLHGMGDFLAENP
FT                   LGRNIHYGVREHAMGTILNGMAYHGGVLPYGGTFLIFSDYMRPSIRLAAMSGLQVIYVF
FT                   THDSVGLGEDGPTHQPIEQLCSLRLIPNLWVLRPADANEVGIAWDMAIQRKDGPVAIVL
FT                   SRQKLPIIDRNRYAFYENARRGAYIIADTQGTPDLIIFASGSEVHPSLSAKHILEEEGI
FT                   KVRVVNVLSFEVFELQKEDYKEYVLSPQVKRRVAVEAGRGLCWYKYVGMDGLVISMEEF
FT                   GKSAPGDVLMDHFGFTGKKIAQRIKEFYFKQ"
FT   CDS_pept        complement(123431..125314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="HTH_0118"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68585"
FT                   /db_xref="GOA:D3DFI3"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI3"
FT                   /protein_id="BAI68585.1"
FT                   /translation="MEKKVKIVIDGREIEAQEGQTLLEVALKEGISIPYFCYHPKLKII
FT                   GACRMCIVYNEKTGRLITSCNTRVEDGMIISTQHQLVKNNQRYLLQAFMTRHPLDCPIC
FT                   DKAGECDLQNYGALFGPQRQIVPVSALEKERHYIDWESDFLEYYTNRCVVCYRCTRVCD
FT                   DVNGARALYVEERGFHTNIVPTVRPIDTSSCEMCGLCVHVCPVGAIISKPFKYWTRSWL
FT                   LKREITVCSVCPVGCQVQVEYGIGDWRSKEKVYRTKPTDDLEICAKTFFGYDALNRDRL
FT                   LKPHRYGKEESIGNVINHLAYMLKSKGEETAILLSSYLSNEVLGVLKEVATRVGAYITS
FT                   PLTVDFYAFLEGYGDYTPLHLEDIKGADHYVLVGDDITSSAPVLSYYIKGKVYKYGRTY
FT                   KDAKLKPINLEGLDHLPGGGIIIVNTTGMACEEARNLGAKIKRISEEKGYRVLILHRDA
FT                   NYLGVYGIFGRDMLSDLGSIMEEVRERRIKNLLVFGEDLPDYYQEEDIQEIFRKLENLV
FT                   VFSPFADGLARWASIAVPMNLYGEAQGNFHTLKGLRSSKRFLPWSFDERSFYEELLKSL
FT                   PQEFKEVKVLRGKNPTLRRHLHIYRSNWITDRSENLTKLYEKNAKAVSFAS"
FT   CDS_pept        125416..125880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="HTH_0119"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68586"
FT                   /db_xref="GOA:D3DFI4"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI4"
FT                   /protein_id="BAI68586.1"
FT                   /translation="MLEESLLEKLKQHAEYFPKREQAILLCLHEVQNHYGHIPEFALEE
FT                   VAKILDLPLNHVENVVSFYDMFDRGEPARHRIRVCVSVVCHLMGKDKLIKALRELLNID
FT                   FGQVTKDGRFKLLAVQCLGACSEAPFFMVDEDAYKFENKEKLNEVLSRYA"
FT   CDS_pept        125855..127126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="HTH_0120"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68587"
FT                   /db_xref="GOA:D3DFI5"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI5"
FT                   /protein_id="BAI68587.1"
FT                   /translation="MRSYPVTPNIYAETTLDMLLRRAKKPRVHLIEEYLKDGGYQALEK
FT                   AINMSPEEIVDWVDKSQLRGRGGAGFPTGKKWKFAIQNPAPRYLICNADESEPGTFKDR
FT                   VLLERDPHLLIEGMIISAYALGANQAFIYIRGEYPAAYYILKDAIEEAKKKGFLGKDIL
FT                   GSGFDLEIYVAKGAGAYICGEESALIESLEGKRGFPRTKPPFPVQYGLFGRPTVVNNVE
FT                   TLCNIPFIIKLGWEDYRYIGPSDYPGPKLFPVSGKVKKPGVYELPMNTTLREVVYKYAG
FT                   GTINNKKVKAVFSGALDCFSADELDTPMDYSPLGFGGTGTVIVLTEEDSIVEMCLKVAE
FT                   FYAHESCGQCTPCRVGTYEQANLLEKIMKGTATERDWEGFDFVNSYIQPTSICGLGAVA
FT                   GRLIRQTMKKFPEEWEKLRKLVSV"
FT   CDS_pept        127093..127341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68588"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI6"
FT                   /protein_id="BAI68588.1"
FT                   /translation="MGKVKKVSFCVVLVLGFSYAQEKDCNTNPLRDHSWCKYAWFLCKK
FT                   ATLYRLDQVKKCIEESKSYDEGVKCFEKPWIEGFLQQ"
FT   CDS_pept        127416..127973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0122"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68589"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI7"
FT                   /protein_id="BAI68589.1"
FT                   /translation="MLHELYETLSKEKKCILYEGSSGYVFGDGNPDSAVVFVGEAPGEE
FT                   EDKQKKPFVGKAGKYLNAKLQEVGMRREDVYITNVVKSRPPGNRKPTKEEMLSCLPYLR
FT                   KEIEIIKPKLIVCLGSTALEGLLGKALPITKYRGQVFEYPYSRNIKVLLTYHPAYVLRN
FT                   PSADREFMEDMKKVKALLGIIF"
FT   CDS_pept        127986..129242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sam1"
FT                   /locus_tag="HTH_0123"
FT                   /product="S-adenosylhomocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68590"
FT                   /db_xref="GOA:D3DFI8"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI8"
FT                   /protein_id="BAI68590.1"
FT                   /translation="MEYHIKDISLKEEGKKRIEWAEKDMPVLRSIRERFSKEKPLKGVK
FT                   ISACLHVTTETANLIITLKEGGAEVYLTASNPLSTQDYVASALVAYYGVPVFAIKGEDT
FT                   QTYYQHLREVIKREPDIVIDDGADLISTLHKEYSDIAQRVLGGMEETTTGVIRLKAMAK
FT                   EGVLKFPIIAVNDAYTKHMFDNRYGTGQSTIDAIMRATNKLIAGSNFVVAGYGWCGKGI
FT                   AQRARGMGATVIVTEVDPIKALEAKMDGFIVMPMIEAAKMGDFFVTVTGNTSVIREEHF
FT                   QVMKDGAIISNAGHFNVEIDIPALERLSVGKREVRSFVEEYQLADGRRIYLLAQGRLVN
FT                   LASAEGHPASVMDMSFANQALCAEYILKNHHKLQKDVYRVPESIDRQIAHLKLKSMGVE
FT                   IDSLTSEQVKYLSSWEVGT"
FT   CDS_pept        129239..129796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0124"
FT                   /product="isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68591"
FT                   /db_xref="GOA:D3DFI9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFI9"
FT                   /protein_id="BAI68591.1"
FT                   /translation="MSLEKFFLNRENSLFVIIDIQEKLAKVMERRESVIENVLHLIELS
FT                   KLLSIPVVLTEQYPKGLGQTVEAIRNAIAEYKPIEKMSFNCCDEEKFLEAIESYGRKNI
FT                   VLTGMETHICVLQTALGLLKRGYNVHVVADGVCSRSYENHLTGLEFMRDAGAVITCTET
FT                   VLFQHLGVAGTPEFKVISQRIK"
FT   CDS_pept        129793..130518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="HTH_0125"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68592"
FT                   /db_xref="GOA:D3DFJ0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ0"
FT                   /protein_id="BAI68592.1"
FT                   /translation="MIYTRYIYSLEEEEFYQFLADQPQGVEVIRRQDNRVEFATYTELK
FT                   WLKPLKVEKIKVKPPESFLRPIRIRSFLIVPPNMKTLIINPGMAFGTGLHPSTQLSLML
FT                   IEEFFKRGWSAIDVGCGSGILAFALKKLSARKVLAIDIDERAIEECEKNASLNRLKITC
FT                   LKAKPEDIKESFDFLVANLELSIFKREIDHIKPLFKKLAIFSGIYGKEELEEFLFFLAD
FT                   LRVVKIKKLKGWYAVVVKR"
FT   CDS_pept        130515..131828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68593"
FT                   /db_xref="GOA:D3DFJ1"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ1"
FT                   /protein_id="BAI68593.1"
FT                   /translation="MKYRKYKIERKTDKKPRSRKFIKLLLLLGVFGFVLYITFQLFVQK
FT                   PQLENLEALAKIPVQKDITLKLKGSPNVKLVKVKLIQGEKEFILYEGKPSKDGKVYLSI
FT                   SPKKMGIEDGKGQVLISLRYGLFGRETYRVSTFIDTQPPKIEPLSYTEYVVQGGAGAVK
FT                   VRVKDGTQAFVYVGSDRYPMYRLEKGYFFTLFPIRVDQDPSTPIKVVAYDDAGNVSELL
FT                   LKTKIAKVNFRIDKIRLTEEFIDKVIIPLLGKHLPPKEAFKEVNEMWRNRDVEKLKKIG
FT                   SVSEGKKLWQGNFLQLPNSKVISTFGDIRYYYYQGEEVSTSRHMGYDFASFEKALIPAS
FT                   NDGIVVFTGSLGIYGNAIIIDHGFGLMSLYGHLSEIKVKKGELVKKGEIIGNTGNTGLA
FT                   LGDHLHFGVLVHGIEVNPKEWLDARWIKTRIERVLDAQ"
FT   CDS_pept        131818..132483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68594"
FT                   /db_xref="GOA:D3DFJ2"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ2"
FT                   /protein_id="BAI68594.1"
FT                   /translation="MRSRIRFLFIKILLPFIALLVRILGRTIRWEKRYDFNLDRGKIYA
FT                   IWHGNALGIALFGMDRGIYTLVSRFRDGDIAAYILKKLGYHVIRGSTEEGRAEKGGRSG
FT                   VIKLIKAIKDGNNVAITVDGPKGPAFKVKEGVVFLAQKTSSVIIPAFAEFDRCIRLSSW
FT                   DGFTVPLPFARGRVHIGKPIKVSEQDSIEEKTKELEEELLRISSLGKESRLTLEQRQS"
FT   CDS_pept        complement(132401..133567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0128"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68595"
FT                   /db_xref="GOA:D3DFJ3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ3"
FT                   /protein_id="BAI68595.1"
FT                   /translation="MHAGAELVYAGFILLFMFSLAYGLKTLKFPYIISFMLSGFLLKSV
FT                   VPEDVSGILLIFEYSAVALLFFFVGLEYSFEKLLGMLRILKAGFLDLLINFLPIFAISY
FT                   AFTKEFILSLVLASALYPSSTAITVKLFMDYKRLINPEVDLLIGILIFEDLICIILLSL
FT                   LTSFVRLGNINYYAISKSIFILTFLFLLFYLIRNPVKVFFEFAERKVDENLFVFLIFGT
FT                   LLLLCGLALKYDVSEALVAFIFGVLIPENSRAFKIVESSLSPLKELSVGLFFFFFTYKT
FT                   DINSLEQLSFVLLLVATALVFKLISTYISSLVYGFDKRVSMRASLSFLQRGEFSLVFSS
FT                   LYPPAQMITFFVVLITSLLGSFSFVFAPRLTDFLFPRKRSSKAPPQAP"
FT   CDS_pept        complement(133567..134052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68596"
FT                   /db_xref="GOA:D3DFJ4"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ4"
FT                   /protein_id="BAI68596.1"
FT                   /translation="MKVRETDLPGIGKKYAVTLAEGRDLVIIIYNTGKREIYLMEQEEP
FT                   ICSFELTDEEAKELGFLVAGVLYQPVKVEKMELILKEVLIEWIKVEQGSNLVGKTIAEL
FT                   QIRKITGASVIAIDRGGRIIPSPDPYREKIEVGDVLIVVGTRQQIKHFIEICGRCST"
FT   CDS_pept        complement(134033..134428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0130"
FT                   /product="transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68597"
FT                   /db_xref="GOA:D3DFJ5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ5"
FT                   /protein_id="BAI68597.1"
FT                   /translation="MKERRRYYTIGVVAQMYSIHPQTLRLYEKEGLLKPSRTKGKTRHY
FT                   TDEDLKKLEFILTLTRDLGVNLAGVDVILRMKEQMEEMERQIEKLVEFIQREMSKIYAE
FT                   DENIKSIVLSERRGVLDIIGKNEGKRD"
FT   CDS_pept        complement(134425..135567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ2"
FT                   /locus_tag="HTH_0131"
FT                   /product="chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68598"
FT                   /db_xref="GOA:D3DFJ6"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ6"
FT                   /protein_id="BAI68598.1"
FT                   /translation="MAQSAKKDYYEILGVPKNATQEEIKKAYRRLARKYHPDFNKDPSA
FT                   QEKFKEINEAYQVLSDPEKRKLYDQYGHAAFSAQGTEGFSQEVFSTNIGDILEEVFRGF
FT                   GFEDIFERATRERRRTYRRPVKGEDIYYTAQITLEEAFTGTILRIPLLREVSCHVCQGK
FT                   GYDPSKGEKVCPTCAGRGEVYQRQFFITISQTCPTCGGEGVIREVCSNCKGRGSVPIRE
FT                   ELTVRIPPGVDNGSKVLFEGKGHAGRNGGPYGDLYVVVKVLPHKLFERKGDNLYLDVNL
FT                   KFTEAVLGTEIEVPTLSGEKIKVRVPPGTKEGDIIQVPGQGMPKLRGNSRGDLFVRVHI
FT                   DVPKLSFMDKVFGNGKKIKQMLEELDKLLPEPSRIKEKEA"
FT   CDS_pept        135685..136170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68599"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ7"
FT                   /protein_id="BAI68599.1"
FT                   /translation="MVINQVGSFNHMYVMLSQEGILPSARGYRRIYILLEGSAKYMLGQ
FT                   KFGISQSPCVFGVEEGDIFALIPVDRASILEISLGKDEECEGETIDLRFVEHGARHPLV
FT                   MKKFSELKKGEGFYIINDHDPLPLYFQMSFAFPKKVGWRYVEVKEDFWKIGIKKLKE"
FT   CDS_pept        136181..136723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tehB"
FT                   /locus_tag="HTH_0133"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68600"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ8"
FT                   /protein_id="BAI68600.1"
FT                   /translation="MSVEDRERWDKRYAGGWKTQLHRTLLEFYHLAPVGKALELACGTG
FT                   ENAVFLAKVGFNVDAIDVSCVAIDKAKQRALEEGVQVNFICADLDEYKLSTDTYHLVIN
FT                   FYYLNRKLSEAIVKALKPGGILIFETYNEKHIILREDFNPLYLLKCGELPDLFKDLELI
FT                   YHAENFNVSTFVGRKIT"
FT   CDS_pept        complement(136716..138488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0134"
FT                   /product="penicillin binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68601"
FT                   /db_xref="GOA:D3DFJ9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFJ9"
FT                   /protein_id="BAI68601.1"
FT                   /translation="MPRRRFIFLAVLGLALYLVVLLRLIHLQIFRRSYYAELSKKNYLR
FT                   LRVLYPQRGDILDRNGEKIAYDVPKYILFLDPQKLEDAVSLGDLLLELKNLFGVDLKES
FT                   DLRQRMKGFEPIPIKTLESQEEIDRFYNNSYKLPGVFINMVPQRYYSYGEITAHITGYT
FT                   GYPTQEELKKYKGRIYTQSSVGKFGIERALDHLLLGFIGGEEIMINAVGRPIRVVRNIP
FT                   SKKGDTVVLTIDVRIQRIIYQVFAESGHKAGGVLVLHAKTGEVLGMLSYPSFDPNAVSD
FT                   RWKEYASDPYKPLFNRCLFAKYPPASVIKPALAIALLEKGLSVKEGVVCTGEFQLGNRT
FT                   FYCWNRHGHGWENVKTAIRDSCDVFFYHYGYYKLGPRGIEEILRAFSYSEGIPFELPCA
FT                   KGFIPTPAWKKRRFGEAWYGGDTVNMSIGQGYITATLLEQVLMMSGIVNNGVIYKPTLL
FT                   REIRDPSGKVVWKNRKSVYKVIKASPEYFSVVREALRDVVRRGTAQLANSHIAEIAGKT
FT                   GTAQVSPFSTRRKHLPYHLRDHAWFVGFAPYRDPIFIVGVLVEHGGSGGAAAAPIAKNV
FT                   IERIYVEGINKEFM"
FT   CDS_pept        complement(138475..138930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68602"
FT                   /db_xref="GOA:D3DFK0"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK0"
FT                   /protein_id="BAI68602.1"
FT                   /translation="MRFYVLSLILAFLQASVITGAFVSNLYVPDLVLVYLFLHLSRENA
FT                   VDIKKPLLSGLYLDIMYDSFGWNTSGKLFSAFILELLKSRYIFATRLSVIISYSLIALS
FT                   EHLLRYAIFRLKYYYPFEPWLFFAGFVVELSLLFFLTFFIIKGDAKT"
FT   CDS_pept        complement(138927..139727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="HTH_0136"
FT                   /product="rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68603"
FT                   /db_xref="GOA:D3DFK1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK1"
FT                   /protein_id="BAI68603.1"
FT                   /translation="MNKKRLLLYLFLFSLSLLTYFLNISSSRYTSFLFDTLYSLILPVI
FT                   ELKTDIANAVKEGVSRYLYLVEVEKKNKKLSKQVQELYFYKSQLRACQMSLKSVSELLG
FT                   VKSEEFGRGLIFASVLGYDPSGRDTFIIIDKGKDQGVEEGFVVFYKDMFVGFVEKVFGS
FT                   SSRIRTVYSRDLTVSSTTEATGKSYIYRGGWMYGQLLYVRLEDQVQKGDVVLLRDTKKA
FT                   LPAFVIGTVFSVEEKGDQFFKRVWVNPSIDIRQLEYVVIVKEKL"
FT   CDS_pept        complement(139724..140740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="HTH_0137"
FT                   /product="rod shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68604"
FT                   /db_xref="GOA:D3DFK2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK2"
FT                   /protein_id="BAI68604.1"
FT                   /translation="MSLLGFFSNNIGIDLGTANTVIYADGKGIVLYEPSIVAIDTRTKR
FT                   VIAVGREAKEMLGKTPESIQAIRPLRDGVITDFEATQVMLTYFIDRAIGGGIFRPKPRI
FT                   IIGVPSGVTQVEKRAVIDAAKGAGAREVYLIPEPMAAAIGAGLPIEEPIGSMVVDIGGG
FT                   TTEIAVISLAGIVVSNSIRVAGDEMTEAIIQYIKKKFHMFIGEQTGERIKIELGNAIYE
FT                   EEEREMEIKGRDITGLPKTVRITSRDVVESLEDVISSIVNAIRITLERTPPELASDIAE
FT                   RGIVLAGGGSLLKNLNIRIEREIGIKTYYCDDPLTAVARGVGKILDQIDLIKRISME"
FT   CDS_pept        140804..142903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="HTH_0138"
FT                   /product="(p)ppGpp 3-pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68605"
FT                   /db_xref="GOA:D3DFK3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK3"
FT                   /protein_id="BAI68605.1"
FT                   /translation="MHTAAEKLKVEGLLKFFEGEDREKVRKAIDFIEERHEHQVRASGE
FT                   PYIMHPIEVAITLAEMGLDADTIVAALLHDVLEDTPTTYQELKEKFGQGVADIVQGVTK
FT                   LGKFEFKDMERQKAENYRKLLLATAKDLRVILVKLADRLHNMKTLGYLRKDKQVRIAKE
FT                   TLEIYVPIANRLGVWKIKTELEDLCFMYLYPAEYERVKNFVGRSKKDLEEYLKRSFIPK
FT                   LKEALRTFNIDAHIMYRPKHLYGIWQKTVRKGIKLEDVHDVLGVRVILSTPQECYLVLG
FT                   IIHSTFKPVPGKFDDYISLPKPNLYQSLHTAVIGPKGRMVEVQIRTWEMHERAEKGIAA
FT                   HWAYKEGKTLKDNSIYAWLKSLVESIQGSKNPQELIENMKMELFSEEVFVFTPKGDLLV
FT                   LPKGATPVDFAYHIHTDIGNQCAGAKVNGRIVSLNYKLQNGDMVEIITNPSRRPNPEWL
FT                   KFVVTSKAKNKIKAYLRQLEKERYLQEGRQILDKITYKLELSKEAILEKLLQEIGFKSE
FT                   EDLLVAVGSGKVSKEKIYSLFQQKIKEKHKEERKEDLLIIDGLGSVLHSVGTCCLPIPG
FT                   EEVYGVITRGRGVVVHSKLCPNLQYIQRNLPEKVIPVVWRVSGGKHPVRIRVVVKDKVG
FT                   VLAEITSSISKVGANILEAKTKSTSTGKAFMEFLVEVSNYAEFLRLLDTIRSVEGVEIC
FT                   ERVFS"
FT   CDS_pept        142920..144218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0139"
FT                   /product="chlorohydrolase/deaminase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68606"
FT                   /db_xref="GOA:D3DFK4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK4"
FT                   /protein_id="BAI68606.1"
FT                   /translation="MLDILIKQAIVPDRGIFDIAIKEGRIIRIERDIKEEARHTIRADG
FT                   KIAIPSFANMHTHISMSLLRGIGSDLTLMDWLQKVIWVLEAEFVSPEFVRDGALLGIAE
FT                   SIMSGTTLLMDMYFFEEAVAQVALSAGIRVGLGFGILDFPTKVASGPEEYLKRAEEFIK
FT                   TFKGEELVFPVLCPHAPYTCSPTTLLKVKELAEREGVLIHTHVAETKSEVEGVKEKYGK
FT                   TPVKHLESLGFVSDRVLMAHMVWLDEEEKAIVKERGAKVLHCPESNLKLASGIAPVWEY
FT                   ISMGIHVCLGTDGPASNDNLDMLEEMSLMAKLQKGYSLSAKAMDARTALKIATENGFLA
FT                   CGIKAGKIEEGYEADLILIDTQKPHLQPLYDPVAQIVYSAKSSDIDTVICRGKVIMERR
FT                   ELKTIDMEELLHIAKKWREKITGFMREKNMLYF"
FT   CDS_pept        144244..144495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68607"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK5"
FT                   /protein_id="BAI68607.1"
FT                   /translation="MEEQMYAVPFSLVGFFFTSKPIEQSIRSDLTPEEMEKLQEILARF
FT                   LFTEDIKIALYPSVVPPDQAEEALEELEDMMFGEGEEE"
FT   CDS_pept        144492..145295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="HTH_0141"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68608"
FT                   /db_xref="GOA:D3DFK6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK6"
FT                   /protein_id="BAI68608.1"
FT                   /translation="MTKAVLCGALGRMGRTILRLSLEYSDFEIVAGVEHPDCVRSTDLG
FT                   EASGIPELRGKVLTSRLEEVVSLCHVVIEFSGNTSAAVSHTKIASLAGKAAVVGTTGFS
FT                   EEEMKEMEECSQNAPLLISPNMSLGVNLLFKLVQISVKALKDKNFDMEISEIHHRFKKD
FT                   APSGTALKLASIVAQELGVPLKDHAVFGRKDIQPRKDKDIGVFAIRGGDVVGDHTVYLL
FT                   GFGERIELTHRATSRDTFAKGAIEASRWIKDKPPGLYSMFDVLGL"
FT   CDS_pept        145292..145708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68609"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK7"
FT                   /protein_id="BAI68609.1"
FT                   /translation="MSFYEVIEDITADAGVRVRAKTLEELICKAILATFNEMTDIDTVE
FT                   SRESYILEVHANFPYLLVDIINEAIVLHETKKFVASKCHVLELSEKHIKVKLMGDKFDP
FT                   EKNESKLVIKAATYHRLKVEKTSEGYMAEVIFDI"
FT   CDS_pept        complement(145705..148047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68610"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK8"
FT                   /protein_id="BAI68610.1"
FT                   /translation="MVEIRGKETPSCMEYFAKGLRVSENGFLYGGVFWCGDENYAESLS
FT                   KLLYKIIKKKDKLEECKKMFKEFLEKVDFSLQGEAIYKKDRVIWLKPRELFRKEREAVF
FT                   ERFRKDKIFRLAEGVVSIASQIEKSSGLAFLRILEAQGEDITKESVWKGREDLIDIWKN
FT                   KTEDGEIKEYLSKVAQIGYIIKTYLAPEDFKKPSIFKLFSYLAPFDFKIFEDAYLVSRA
FT                   RLFERKTKAEDLIEELKQEKVIWEDLLYAFKKEGITEEELKKVLEKAFNEKFLRKLRQD
FT                   WKELLKDIIKGEEKKAIGSFVKKQMREEGWVSYGSFRVPNKEISLYIFYEKGVESKVEK
FT                   FKEGLEKSAKAFSRFTGNIGIKIERSLPIDGLIPDFDKLKNMNFSNLLHQDSFELLFNL
FT                   AYFNCRLKGFVDVMQNKNPVGILLLLDTDIREDGGGYSFWDAFNFIYEFFSLPVQTLNK
FT                   TTINLFCGFSEGKIKEKEVQGVYKNLFISLLKDLKTLEFEFEGFNLPTQLNVFAVLEKP
FT                   STGFCYRRGDPTQKAYRHFLYEIYKISVNGNRATVELEDKYLVLTGGLDFEADKFRRWI
FT                   EEKAKDGETKFCFITAGAWEDSYMNEIISKSGESSNIKSKSLFVEYSELPTAYISDKAQ
FT                   EDCFVIYTSEFEKLKESLGISKESNKVSLAIKPADIKDESRFRLDDGEFFYHSSLQVFS
FT                   TDGLGWERDDVYSERRNLFLFTLLALSQYESESFQSPYSKLDLWQKRKSLYLKIRRNQG
FT                   EYQIPLNAVLYEMIYLISKIPADKNLG"
FT   CDS_pept        complement(148028..151105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68611"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFK9"
FT                   /protein_id="BAI68611.1"
FT                   /translation="MANKFVQFLGFAFEGAFKLGFLKDRIEDYQQFKERQVFEKLKQEF
FT                   IHEHFQELEYIWELLERNIPFDPKVEQPEELRELGLQDDHKTHLLFVFLVGYYEGYFYG
FT                   LSFGDLELIKYTIGEESSQAGVYYNADLIFKSNKTLYVADFKLSGVRSQLTDIITKQIT
FT                   QQKVAIPFRNYGLPVNLALGELTFEGFLKSLTLLEDELLSLQEASPELKGFLQVVSYAV
FT                   DYLHKEKPEDIKEVCLSLLYPLAEPFIARFYLRGEDLSQYREKIISLYDRIRRLELEYK
FT                   QVESPSLARIERLREEIPKEIENLKQQIKVREKQETVLSPDSIYASREHVSKVLDRFFM
FT                   DPDPVKAVCLFHSAGSGKTTQTRKKILQMEGKHIILYMATRKILLDREQKELRKLKDQY
FT                   KIEIVYEKSAKKDNEWVRNIGDTYKDLPKDNAGILKKTVEKIRELTTKDHNFIWAFATQ
FT                   QAIVGTLYKDSTAEYLKELLSKRIINQYTFHFILDEFFGHNNGLFAIEEFFKILNYVKK
FT                   EGGRVNLYLFDANGFAPPLLEKLLEEYKEFQVMPDATILCEYSSGNVFKERDIKVYVSA
FT                   KHGYPSPRINLVKKFIFLSEEEVKLKKKPEDELINKKIAEYIEKTFKNYKEESTALVFV
FT                   QNRGHIARLRELLEGKGFSSMVATANSKRSQREINEGNQDIILSTSAISRGIDLSRPHK
FT                   PVNHIYTVIYDWGIEKNMVELIQAVSRARGDKKTESEPKTIHLIYLVYPTKNENIAYLE
FT                   EDTIHKDLIRLLNEKINLREKIYLDDVITQIITQFIKTPEEKSKVLVPLGEQYKSVYIP
FT                   NKISEIEGCLSFLNDILELEKDDEIKKNILILIEVLTEALYVSVVDISFDKEMEYYHPY
FT                   ILFNNQRVRFGFDNESRGRAKSLFYKVKEKLEEHNPEKTEDIEEIINSFLPVQESALPV
FT                   LVPIYSIVLVKHFLKINELLGFTIDKRIGRGKAETLLGSEKPRTYCFNGEQDREYACIP
FT                   LGEEYPYKEVLSGRFVKFPIEFIKYLLEERNGGDKG"
FT   CDS_pept        complement(151193..151942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirE"
FT                   /locus_tag="HTH_0145"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68612"
FT                   /db_xref="GOA:D3DFL0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL0"
FT                   /protein_id="BAI68612.1"
FT                   /translation="MGKVYIVGAGPGDPELLTLKAYRLIKSADVVLYDRLVNPEILLLA
FT                   KPECQLIYVGKEEGKHTIEQEKINELLLHYAHTKEVVVRLKGGDPFVFGRGSEEALFLA
FT                   QHGVEVEVVPGISSATGVPAYAGIPITFRRLSSSFAVITGHEDPKKGSSSVDWESLKGI
FT                   NTLVFLMAVSNRKEIARRLIEVGRDPKEPVAFIERGTTREQRVVITDLYELANDPPEVN
FT                   PPAVMVVGQVVRLSPYCGQVSATWQAI"
FT   CDS_pept        complement(151935..152990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="HTH_0146"
FT                   /product="NirF protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68613"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL1"
FT                   /protein_id="BAI68613.1"
FT                   /translation="MLLVMLFILILPFLSIAEKLYVVERERGSLAVVEEGKVVKEIEGL
FT                   GNLSHATVKVWEGYAYVISRDGYLSKIDPKEDKLLKRVKVGNSTIGLDFTDNHIVVANY
FT                   DPHTVVVLDEELNILKTLKTGSRNVGIKGFEGGFVFSLMDKDEVWVVERQEIRKFKVGN
FT                   MPFDALLSGDIYLLGFFKESGIGMIDIKNKLYRKLDFKAQGKEVVFKIPHFGTWGIVGD
FT                   EAFIPAVGEKRLYKVDLRKMEILGHVELGGLPVFASVSPNGNYLAVNFSGDREDYLALV
FT                   DVKEMKVLKELKLGQRIMHLRFSQDGTRLYVSSYFDSKLRAFQVPDLKLLYELNIPHPS
FT                   GVFLIRRNHHG"
FT   CDS_pept        complement(152978..154060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="HTH_0147"
FT                   /product="predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68614"
FT                   /db_xref="GOA:D3DFL2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL2"
FT                   /protein_id="BAI68614.1"
FT                   /translation="MLRMTEYIRNTLEGKKPKAFEGVILIWNLTNACNLHCKHCYSSAN
FT                   KDKEELSYEEAISLVHRLPEAGVKFTILSGGEPLLREDLFHIARLLKERGIRTYLSTNG
FT                   ILVKEHLKEIKECFDYVGISIDGKQEVHDLFRGKRGAFETSLEAIRMCLKEGIKVGLRF
FT                   TLTPITAESLPFVFELAEKEGIPKVYISHLVYAGRGRKLSHLEKKDYRRWVEFIVHKAF
FT                   EYVERGLPIDVVTGNNEADAVLLYREFARRHPELADKLYERLLKWGGNQAGVKLMNIDH
FT                   RGNVKPDPFFFHSVGNVKEEDIVKIWQGNGLLGFLREKPRKLKGKCSNCGFVSICNGNS
FT                   RARAYAVFGDYTEEDPACYL"
FT   CDS_pept        complement(154053..154541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68615"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL3"
FT                   /protein_id="BAI68615.1"
FT                   /translation="MAGWIETLSQVRRPHLGEDVPLLVFRAFRVFTGMYLEDVLGHKGA
FT                   TALIQNAGRELGKEVGERLQDSSLDRYIGKVIDFVKDAKIGLLIPVDLKEGSLVVALDE
FT                   CITCAGMPNIGKRICHFEAGFVAGIVEAHTGNKVRAYETKCNAHGDGICEVVVEMNYA"
FT   CDS_pept        complement(154525..156147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirN"
FT                   /locus_tag="HTH_0149"
FT                   /product="NirN protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68616"
FT                   /db_xref="GOA:D3DFL4"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL4"
FT                   /protein_id="BAI68616.1"
FT                   /translation="MKLKNLLLLPLLCSLSFGGGAELYLKYCSSCHGEDRLGGHAPPLF
FT                   PPFFNIPEERLYRIIREGAVGMPSFKELKEEEVKQIVEFIKSPVEKEKLRWDEERIKGS
FT                   VERVYTKKVEVKNLKDYTLVVERGKNLVWVMEGERLLDKFAFSSMHGGIKFSKEGVAYI
FT                   PSRDGWIGRYDPTKGELKRVRACIYLRNIAFYGGLLVASCWVPSRLVVFDSQLNYVKSF
FT                   ELHGRINAVYELYIRDGFIFTFKDKPLVGFLNYKDLKLTYENLGVALEDFIIDPLEEYL
FT                   IGSTRSGLEIYSLNDLRLVKELKALDIPHLASAYFWYSKGDFYFATPLLNKPVLSVWKA
FT                   YSWEHVKDIPLDGNGFLARSSYGTPYVWVDMSTDSMLLLDKRSLEVKKFIPAPGKRVTH
FT                   AEFTGDGRIAYVSVYEKEGALMLYDGVSLKKLGEFPANLPAGKYNFVNKSRYFEGAQLG
FT                   YQVFMEKCWGCHHTTENAFGPSLRWSIQNREKALVIAQILNPENTYRLLGYSRNAMPRI
FT                   ELKEGELKALMKFMEALKDGWMD"
FT   CDS_pept        complement(156147..157802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirS"
FT                   /locus_tag="HTH_0150"
FT                   /product="cytochrome cd1 nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68617"
FT                   /db_xref="GOA:D3DFL5"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL5"
FT                   /protein_id="BAI68617.1"
FT                   /translation="MRKRKKVLIGGALVFVLFAGTYAQQQQKEELPPPPPLTKQEMERA
FT                   KEIYFDRCAGCHGALRKGATGPALTPDKTRKLGTETLKTFITYGTPGGMPDWGRQGILT
FT                   PEEVDLMARYIQHDPPPPPELPLGEMKKSWKVYVPPEKRPQKPEHNRNWQNFMAVILRD
FT                   IGKVAIIDGDTKELVSTVDTGYAVHIARYSASGRYLYTIGRDGKVVLIDLWMKKPDKVA
FT                   EVKTCYDGRSLDTSKYKGPKGDFLDKLAIIGCYWPPSFVIVDGQTLEPLKIVATSAYTY
FT                   DTNEFLREARVASIVASHYDPEWVVNVKEAGQIWLVDYSNIHAPKITMIDAERFLHDGG
FT                   WDASKRYFLVAANFRDTISVVDTKEKKLVKNIKVGTRPHPGRGANIDHPKYGPLWCTGH
FT                   LGDNTIRCIGTDPVKHPQYAWKVVVKMEMPGEGGGNLFIKTHPKSPHLWADRALNNDPK
FT                   LQRSLFVFDKNTFQIKKVIEIPPEFQGRAVHLEYNKNGDEVWVAVWSKKNEPEKQAILV
FT                   YDDKTLTLKKAITGNWVATPTGHFNVYNTMKDIY"
FT   CDS_pept        complement(157870..158610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0151"
FT                   /product="SCO1/SenC/PrrC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68618"
FT                   /db_xref="GOA:D3DFL6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL6"
FT                   /protein_id="BAI68618.1"
FT                   /translation="MLKLISLLIIVCTAFGSFLPDEKKSIGTYIPDIPLEIHTGEVLRI
FT                   KEFAGGKVIIINPIYTRCSSACPLMTEGLKRAIKDLMNDVKVISLSFDPRDSIEDLKRF
FT                   ARHQSLPENWVVAKSEQVDSLLKSIDFRYRYDKSLEEFEHPNIYVVITPSGKISRYIYG
FT                   VNPKVRDIKLSVLEAKRESSKLSPVEGFFLRCFRYDPDRGDYQIDWFFVFDVMGGLLTF
FT                   LVVPALVWGKSAYKSLHDFIVKKS"
FT   CDS_pept        complement(158594..159862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68619"
FT                   /db_xref="GOA:D3DFL7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL7"
FT                   /protein_id="BAI68619.1"
FT                   /translation="MRLFYLSLSLLSLVQAGVFGLLIALTRAPAFSLLKSPSLFYHFLV
FT                   GHVTFSITVWLMTFTLAYWHYKEGRKGRVAPPATLLGMLLLSLSCLLPYGEPYLNNYIP
FT                   VIDSPIFYAGLFVFFLAFFFEALSRVKKLKEITSFENIPQLYAMSVALGLATLLSLIPS
FT                   FFIANAEGGQKLYFERLFWIPGHLQQFLYASVMLAVWHELLKRGNGKEVSSPLLSTVNF
FT                   LLLVFPSLLMAGFFTDIFSREFRLLTVMSFGLGTGVPVLIHTYYVLKNIRLSADVPSLA
FT                   LLSSVSVYYAGVVVAYAGMQSDLRVPAHYHGVVSAVSIAFMGLGYSILKERLGYICWER
FT                   VAKLQPVVLSMGINLLVLGFYMAGRMGAPRKTYGFEYVMNTKVLIALNIAGLGSLMAVL
FT                   GGLLFILYAGQSLLSIYKHAKAY"
FT   CDS_pept        complement(159862..161529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="HTH_0153"
FT                   /product="heme/copper-type cytochrome/quinol oxidase
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68620"
FT                   /db_xref="GOA:D3DFL8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL8"
FT                   /protein_id="BAI68620.1"
FT                   /translation="MFRTCDITGLKVDLRAERLIQLNAVMAVVSLLVGVIAALLLVLTR
FT                   WQVVHLLPVEWYYRILTLHGLNALIFWIIFFEVAGLYFGSTVVLNSRMSSPKFGWLAFI
FT                   LMVLGFLLVNYTILTGSADVLMTSYAPLQASPIYYLGIILFAVGALIGVFLFFANLLIA
FT                   RKERTYGDSLPLFTFGLVAAAIIATLTLATGAIIYIPTLLWSLGIIKSIDAGVYKLVWW
FT                   GLGHSSQQINVTAMIAVWYLGAFLTVGGASINEKVSRFAFVFYVIGINVASAHHLLVDP
FT                   GPSPAWKVFNTSYIMYIAVLASMIHAFAVPSAVESAQRRRGFTKGLFDWLKNAPWGNPA
FT                   FSAVFLSIIIFGFIGGVTGVVNGMEQTNIIVHNTLSIPGHFKGTVVGGTTLAFMGATYY
FT                   LIPLIFRKKIAFFGLAKAQPWVFGLGIAVLAVSMYILGAFGVPRRHYDITFSGGPFTYT
FT                   FNPAVDFFWVLFAIGGITAVIGALMWILIVVFSVFLGQPVRGPQDMQLQIASPPPPAKE
FT                   HHGFEAPGTLTLTLLFMGVFLVFLLLNWGWLAAMWEVK"
FT   CDS_pept        complement(161542..162072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="HTH_0154"
FT                   /product="heme/copper-type cytochrome/quinol oxidase
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68621"
FT                   /db_xref="GOA:D3DFL9"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFL9"
FT                   /protein_id="BAI68621.1"
FT                   /translation="MALLPPEEGWYYKRVAKDEKMWIALALVVCLILFFWMIVWHIYGR
FT                   QNPSFTTYRTTPQEFNALANAFINKYRTGEMNGIPVVEPPPNSDVFLVAKMWRWEPVLV
FT                   LKKGQEYRFHISSLDLLHGFSLQPVNMNFMVYPGYDYVLTFKPTSTGEFAIICNEFCGI
FT                   GHHTMIGKIIVKE"
FT   CDS_pept        complement(162074..162247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68622"
FT                   /db_xref="GOA:D3DFM0"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM0"
FT                   /protein_id="BAI68622.1"
FT                   /translation="MEERKTPFLQLVLDDFMLLLFLGVTIYAVSYLIWGLIELAWLSPI
FT                   PAELKQSLLGGK"
FT   CDS_pept        162415..164358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0156"
FT                   /product="cytochrome b/b6"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68623"
FT                   /db_xref="GOA:D3DFM1"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM1"
FT                   /protein_id="BAI68623.1"
FT                   /translation="METLQKVSPLYMAFQRLSYAVSTFFTSRLNPLYHLGAIAVFLLVV
FT                   DALSGIYLFFFYSIDPQTSHASVEAISSSFIGNIMRGIHRYSSDALILTTLAHMIHVII
FT                   TDRFRMFRWVAWVTGVATLLIFLAIGVSGYILVWDTRAQLTGLLTAKFFSFLPVFGDAL
FT                   MSAFLGSDIKYLGGLFRILLFAHIALTILIVFTLWIHVMRNARPRLIPPRFLYITITLL
FT                   LILLSIIFPAKSDPPAYINKLPFEMSVDWFYLFGYPLLKYIPMSANWLFFLGFFAFLFL
FT                   FPWLIKGKRNPPAHIDFEKCTGCEQCYIDCPYEAITMKDFEDKKKAVLNESKCAGCGIC
FT                   VGSCSVQAIDIPTFPIEEVIKGVSQESPSYVAFRCPFSALPPKRKDLLTFTLPCAGALN
FT                   TYYAEEILRRGVKGIVIISCEYEDCYFREGNKWLEERYERKRRPILRKRVEGGRILVLE
FT                   APYVKSIEREVEEFINSSKEGREVKVVPSGRLNYAFASLVISLPIFLFYPLTTHKVSFY
FT                   PKEKSAVVLSFKYRSSPVVEVYKEEGKGLKHMQTQLAIVKERSPVRVEFYEGGKLVYSK
FT                   VFNPRGIRKDASVFVYEELLLPPGKHSLRVRLEETKGKREVKEVKLDAHLKAKDSLLIT
FT                   YDEDSGGFVVLR"
FT   CDS_pept        complement(164319..164663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0157"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68624"
FT                   /db_xref="GOA:D3DFM2"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM2"
FT                   /protein_id="BAI68624.1"
FT                   /translation="MWLLLVFLFVLSCEKAKVEEKPSLAINTKELIRWRGCTDCHDTKR
FT                   SLVGPSFFDISQRYEEKDILVKSILEGSCGKWKARWECMPPQKVSKEEAERMAEWILHL
FT                   RTTKPPESSS"
FT   CDS_pept        complement(164665..165432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /locus_tag="HTH_0158"
FT                   /product="NosY protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68625"
FT                   /db_xref="GOA:D3DFM3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM3"
FT                   /protein_id="BAI68625.1"
FT                   /translation="MFVKLTKYIFYDLLKSRWVLATFFFYALVVYILLEFGRSVEKAVV
FT                   SYGNLSSLSLSLFSLLLSTTYLYSNRNFFEFLLSQPVKRSTLMLSINVSLSLSLSISYL
FT                   LGSLLPFYYLVGYNQGFFRCVLLNLFLVPLFVSLGILSSLLVEDRIRGFGFSLFLWLFF
FT                   CVFYDAILLYLVIALSDYPVEKMLLTLTLLNPIDLLRLTLLMEVGLYELMGFVGRWLAN
FT                   YLKDLWFLPALLSALYTLLVFLLNLSVFKRRDF"
FT   CDS_pept        complement(165417..166115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="HTH_0159"
FT                   /product="NosF protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68626"
FT                   /db_xref="GOA:D3DFM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM4"
FT                   /protein_id="BAI68626.1"
FT                   /translation="MIRFESVYKSFKGRRLFDGLNLELKEGKTTAILGPNGSGKTTLVK
FT                   MILGLVVPDRGRILVDGRDARKDAEHKRLIGYMPQIPEFPENLSVKEIVSMVKDIRGQE
FT                   AVRFKELIELLNLEMELDKRFSSLSGGTRQKVGALVSLAFDPPMLILDEPMVGLDPISA
FT                   YRLKRFILEEKQRNKTVLFISHIMSEVEEVADYVVFLAEGRKVFDGSLEELKERTGKER
FT                   LEEAVLCLLN"
FT   CDS_pept        complement(166112..167302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="HTH_0160"
FT                   /product="nosD protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68627"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM5"
FT                   /protein_id="BAI68627.1"
FT                   /translation="MFSFMLSLLLVCSTCEFKDIQSALKKAREGDRIVVKSGTYKGGIV
FT                   IDKKVELVGEGKPVVDGEGKLQVITVKADSVKIEGFIIKNSGMSYSEDIAGLKVINSRD
FT                   CVIKNNKFLNNFFAIYLERVQGCLIEGNSIVGFARSEGSSGNGIHAWNSEKVIIRNNYV
FT                   KGHRDGIYFEFVKDSLIENNRSEYNLRYGLHFMFSNDDTYRKNYFYKNGAGVAVMYSKN
FT                   IRMEENTFAKNEGQANYGLLLKDIYDSVLYGNRFINNTHGVYLEGCNRTEFKGNLFENN
FT                   GWAVRIYANSEDNLFIKNSFLGNAFDVSTNTLSYFRNTFESNYYDQYEGYDINRDGYGD
FT                   IPYRPVSFVAVLFERYPLSLLLYGSFFAHIMDAVERYIPLLNPQSLLDSKPLVRRP"
FT   CDS_pept        complement(167304..167759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="HTH_0161"
FT                   /product="nitrous oxide reductase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68628"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM6"
FT                   /protein_id="BAI68628.1"
FT                   /translation="MRFLLRVLWVFLPLLLFSCATDKPQPIKVGEDVCEQCKMVIADKR
FT                   FASEVITKKGKVYKFDAIECMVGYYNENEEEIKRAYVINFLNPEEFLPAQSAYYVRSPQ
FT                   IRSPMGMNLSAYRSREDAQKALQGKEGEILDWQALREFIKREYRFSH"
FT   CDS_pept        complement(167756..168358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68629"
FT                   /db_xref="GOA:D3DFM7"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM7"
FT                   /protein_id="BAI68629.1"
FT                   /translation="MSIFSRGLLALASLLLVLTYFFPLWRIQLIAPQYPEGLRMFIWVN
FT                   RITGGTEFDLYNINLLNHYIGMKHIDPNAIPELKVLPFIMAFLIAFGLISALLAKRILL
FT                   YAWVGTFIALAIIGLADFYKWEYDYGHNLDPSAPIKIPGLAYQPPLIGSKQLLNMTASS
FT                   FPDIGGYIALVSLLLGIAAVALEIKLSKTAKMEVKPA"
FT   CDS_pept        complement(168371..170347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="HTH_0163"
FT                   /product="nitrous oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68630"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM8"
FT                   /protein_id="BAI68630.1"
FT                   /translation="MLGKKKLLVGGLSALVVGALLAGCPPKKELKTEVGTAEVAQKVYV
FT                   PPGKYDEFYAFLSGGFSGQVSVYGLPSGRLIKIIKVFSQDPETGYGYTPETKPMLMTSH
FT                   GFVPWDDSHHPELSQTDGVPDGRWLFINANNVPRIARIDLSTFETTEIIEIPNSAGNHA
FT                   SPFITPDSKYVTAATRFSVPIPQKDVPISSYAENFKGTLSFIKANEPGKMDVAFQILVP
FT                   GYDYDLAHCGKGPSYGWCFFTSYNTEQAYTLLEINASKNDKDYIAAVNWKRAEECIAQG
FT                   KYQEIPATYYHNYYDEKKHMAFSEVKKSVKVIIPKDCPGVMYYLPTPKSPHGVDVSPDG
FT                   EYIIGGGKLATVIPIHSFSKMLKAIEQKAFEKEVDGIPVLKYDAVLHCEVPKPCLGPLH
FT                   TEFDGKGFAYTSCFVSSEVVKYDYKQCKVVDRAPTYYSIGHLMIPGGDSAKPWGKYLLA
FT                   MNKITKDRYLPTGPELFQSAQLYDITGEKMQLLLDFATIGEPHYAQGIPVDIIMKNVKK
FT                   IYPLAENEHPYAVKAEKDARVERKGNEVHVYMTMIRSHFVPDNIEGIKVGDTVYFHLTN
FT                   LEQDWDIPHGFAVKGSEDAEILVMPGETKTLVWKPKAPGVYPFYCTDFCSALHQEMQGY
FT                   VRVSPAGSNVPLKYYTGTPTAQK"
FT   CDS_pept        complement(170375..170821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0164"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68631"
FT                   /db_xref="GOA:D3DFM9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFM9"
FT                   /protein_id="BAI68631.1"
FT                   /translation="MKKAFLLISLSGLLLFSCKEKPPEAPATPPEKPKEEAVSDKGIGP
FT                   IKEVQLGPVDQNLVKRGKEIFDSKCATCHKLEERYVGPPLKGVTKRRKPEWIMNMILNP
FT                   TEMEQKDPIAKQLLSEYLTQMTFQNVSQEDARAILEYLRSVDEK"
FT   CDS_pept        170955..171596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0165"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68632"
FT                   /db_xref="GOA:D3DFN0"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN0"
FT                   /protein_id="BAI68632.1"
FT                   /translation="MGCLFVLSAPSGAGKTTVAEKLIREVSGIKRVVTATTRSKREGER
FT                   EGVDYIFMSREEFERGIKDSIFLEYASVYGNYYGTPKEQVKKVLEEGFDALLVIDVQGA
FT                   KSIKDKLPESILIFLLPPSLEELKRRLITRGYAEENLLEREKKVEVEIACARHFDYIVV
FT                   NDFLDKAVEAIKHIVNSYRHTKERVFKDIEKLVKDDTIKDILLKGRCDIF"
FT   CDS_pept        171608..173986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="HTH_0166"
FT                   /product="ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68633"
FT                   /db_xref="GOA:D3DFN1"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN1"
FT                   /protein_id="BAI68633.1"
FT                   /translation="MIGEEFIKVPQIPAGSFELPTMPLRDLVVFPTMVMPLFVGRAFSI
FT                   RAIEEALKKDRLIFLVLQRERDLEEPSIEDLYRVGTVAHIIRTAPIEEGRLKILVQGLK
FT                   RAKLIDYKKADGYYASLVEVLEDKEIKPEELSKEDRAYISSLKELLDRAVSLGKQVIPD
FT                   LLMLIRDIEDPGKLADITASVLDIKSKEAQAVLETLDPRERLRLVHQHALNEVGLLEVQ
FT                   SRIRNIARERMEREQREYFLRQQLKAIQEELGEGDERKAEIEEYREKLSKLKLEKATKS
FT                   EIEKQINRLEKLHPESAEAGVLRTWLDWVLDLPWNKKTKDRYNLEKARQVLDRDHYDLE
FT                   KVKDRIIEYLAVRKLTKGKKSAVQILCFVGPPGVGKTSLGKSIAESLGRKFVRISLGGI
FT                   RDEAEIRGHRRTYVGAMPGRIIQAIKQAGTKNPLIVLDEVDKISISFQGDPAAALLEVL
FT                   DPEQNKNFVDLYIGMPFDLSDVFFICTANRIDTIPRPLLDRMEVISLAGYSEEEKVFIA
FT                   KNHLLPKLLPLHGFKDDEVALSDDAILEVIRGYTRESGVRNLQRYLGSVLRKLALKKLK
FT                   GENPPFMVNAQDIRTYLGVPRRYIEKEEKPMVGIAVGLAWTEVGGEIMLIEATKFKGKG
FT                   NLLLTGSLGDIMKESAQAALSYIKSKAEDYGIDPDAFSNFDVHIHVPEGAVPKDGPSAG
FT                   ITIATALISLFTERPVRMDIAMTGEVTLRGRVLPVGGLKEKILAAKRAGIYQVILPEKN
FT                   KDEVLEDLPEYVRDKMTLHFVSNLDEVFDLALLTKQSVL"
FT   CDS_pept        174012..174212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspU"
FT                   /locus_tag="HTH_0167"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68634"
FT                   /db_xref="GOA:D3DFN2"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN2"
FT                   /protein_id="BAI68634.1"
FT                   /translation="MAIVEVGENESFEKVLKKFKRIVEKEGILTEVKRRQFYEKPSEKK
FT                   KRKERAARKRLLKALKKKNLL"
FT   CDS_pept        174297..174908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0168"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68635"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN3"
FT                   /protein_id="BAI68635.1"
FT                   /translation="MKKLFLAFALGGVLCKPAVDSSPLGIGGPAKDTFEFTPEKELQKE
FT                   DFDTQSVDRIISVESSVEKAMKELLDVKTVDTIKPDIWPVVGLVTSDYGWRRMGRVKEF
FT                   HPGIDISVPYGTPVSVASDGRVIYAGWLSGYGKTVIVYHGYGFVTLYGHLSDISVSYGD
FT                   KVVKGQIIGRVGMTGRTTGPHLHYEVIRYGIRQNPIAYLP"
FT   CDS_pept        174925..176403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0169"
FT                   /product="UbiD family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68636"
FT                   /db_xref="GOA:D3DFN4"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN4"
FT                   /protein_id="BAI68636.1"
FT                   /translation="MPYTDLREFLKTLEREGELARIKEPVSPILEISEVTDRVSKTPGG
FT                   GKALLFEKVEGYSVPVLTNMLGSEKRIKLALGYENLEDIGWKLYRLLRPEIPNTFLEKL
FT                   KRLPELKKLNDSLPRIVRKGPVKENIIKEKINVLDFPIPKCWPEDGGRYITFGQVITKD
FT                   PESGIRNVGLYRVQVLSPTELALHWQIHKDGNHHYWKAKRLGKKLEVAIAIGGDPVLSY
FT                   VASAPLPPEVDEYLFAGLIREEGVELVKGETVQVEYPAHAEIAIEGYVDPQEPLVDEGP
FT                   FGDHTGFYTPVDKYPRMHITAILHRDNPIYLSTLVGRPPQEDKYIGWATERIFLPLIKF
FT                   NLPEVVDYHLPAEGCFHNFCFVSIKKRYPGHAFKVAYALLGLGLMSLEKVIVVFDEWVN
FT                   VHNMEEVLWAWGNNMDPSRDVLILKGPIDVLDHSTSQVGVGGKMVIDATTKWKEEGYTR
FT                   EWPKVIEMSKEVKEKMDKLWDRIKYQIYGDNRGA"
FT   CDS_pept        176381..177280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68637"
FT                   /db_xref="GOA:D3DFN5"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN5"
FT                   /protein_id="BAI68637.1"
FT                   /translation="METIEELKVHYGWTEEDEENLAKVSWLGEKYKEDFIEEFYRYLEN
FT                   FSDTSKYLPDEEVRKRHKEKVKGWFASLFTSKYDAQYLRKLYRIGETHVRIGLPPHYVQ
FT                   ASMNFVRNYIADKLTMEMGSTLEANSILKSINKALDINLDVMINSFREEELRLYLASGK
FT                   YQRLLIENVRRVSWFFDTFIILTLAVVGVFLIFWIVYEIGLVLKGDFPLERGGLSILGS
FT                   VLVLYAISELLAEEIKHIRGSALSLKVFVGVALAAVIRKILIISLSPEKVQELITLSVV
FT                   TLSLGVVFWLIYRVESKL"
FT   CDS_pept        complement(177252..178160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="HTH_0171"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68638"
FT                   /db_xref="GOA:D3DFN6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN6"
FT                   /protein_id="BAI68638.1"
FT                   /translation="MILLIGGPTASGKSFIACQVAKVLNGEIISADSMSVYRHMDIGTA
FT                   KPLDCMKVIKHHMIDIIDPGQTFDAKTFEELSCKAIEDIESRGKLPIVCGGTYLYIQAL
FT                   LYGIDESPPPDWSLRERLYRIAKEKGSHYLYEKLKAIDKRYALKISPNDSRRIVRALEV
FT                   FIQTGKPFSSFHHWGKPKVEFKAFYIKRSWETLSRRIEERVHQMIKDGLVEEVKRLVDM
FT                   GFESFLTSPQAIGYKELLPYLKGLISLEEAVESIIKNTKEYAKRQIRWFRRQGWEEVDA
FT                   ERLGIEGSADYIVRALTPLCK"
FT   CDS_pept        178189..178938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68639"
FT                   /db_xref="GOA:D3DFN7"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN7"
FT                   /protein_id="BAI68639.1"
FT                   /translation="MAGHSHWAQIKHKKAKVDAQRGKLFSKIIREITVAVREGGPNPET
FT                   NSRLRTAIENARRVNMPAETIERAIKKGAGELGGESYEEVLYEGYGPGGAAIMVMATTD
FT                   NRNRTTAEIRHVFSKHGGNLGSSGCVSYMFERVGYMEVPKEGLSEDVLYEKAIEAGAED
FT                   IETGETSYIIYTKPEMFYTVKDSLLKENIPVENATITYKPLSTVQITDPETAKKLIKLL
FT                   DALDELDDVQNVISNFDIPEEVLRASA"
FT   CDS_pept        178935..179327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0173"
FT                   /product="putative translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68640"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN8"
FT                   /protein_id="BAI68640.1"
FT                   /translation="MKSVYTEKAPKPVGPYSQAVICGSWLFLSGQIGIDPQTGLIKDTF
FT                   EEQVRQIFENVEGILKTAGADKNSIAKVVVYLKDLSLFATFNALYQEFLKDVEVKPART
FT                   TVGVSELPLGAMVEIDIIAAVKQERG"
FT   CDS_pept        complement(179296..180999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysU"
FT                   /locus_tag="HTH_0174"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68641"
FT                   /db_xref="GOA:D3DFN9"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFN9"
FT                   /protein_id="BAI68641.1"
FT                   /translation="MDQERLKKLEKLKELDNPYPHKFEVDRFIEDIRQMFEKDPSGEEV
FT                   CIKGKVKRVSKIDEGFLVRVADQEGVEMLVITAHNLNQGEEYILKGKLVRYEGKLTLKD
FT                   AEPSDNQAIDIKSLKEAYDFDPNFYQVRLAGRLVSLRSMGKAIFGHLQDATGKVQIYIK
FT                   KDVVGDEKFKVFDDLFDLGDVIGVVGRLFRTSTGELTVEVQDFKMLAKSLHPLPEKWHG
FT                   LKDVEVRYRQRYLDLISNEKARRITLLRSKLLSEIRKFLEERGFIEAETPVLQHIASGA
FT                   NAKPFITYHNYLEQNLYLRIAPELYLKRLIVGGFNRVYELGKNFRNEGVDTTHNPEFTM
FT                   LEFYCAYWDYKDLMEFTQELFSHLLKKLVGSLKITYQNYTLDFTPPYKVYRYFDLLLEK
FT                   TGKDKDFFLRHEKEVRKLAAELGIPKAQELTHAKLLDKIFDVLVEDELIGPAFVIDFPK
FT                   LLSPLAKTHREDEDLVERFELFVAGKEIANAYTELNDPIEQRDRFLQQIKEKEMGDEEA
FT                   MQMDEDFITALEYGMPPTAGEGIGIDRLVMLLADVDSIREVILFPALRQR"
FT   CDS_pept        181039..181908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG1"
FT                   /locus_tag="HTH_0175"
FT                   /product="F0F1-type ATP synthase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68642"
FT                   /db_xref="GOA:D3DFP0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP0"
FT                   /protein_id="BAI68642.1"
FT                   /translation="MPKLSPRDIRRKIQGIKNTRRITNAMKVVSAAKLRRAQELLYASR
FT                   PYSERLYQVLRDLSGHIDPETHPLLERREEKQADIIIITADRGLAGAFNSNLIKRAEEL
FT                   INEKRSLGVGVSLILIGRKGFQYFSKRGYQVIKGYDEVFRKEINFSVVKEVGKIVRDRY
FT                   ASRETDAVYLLNNEMVTRVSYKPMMRAFLPFEKPQDGREDYGVYEFEVEKEEFVSKLVD
FT                   LYLNYQIYRAMVESNAAEHFARMVAMDNATRNADELVRTWTLIFNKARQEAITSELIDI
FT                   VNAVEAMK"
FT   CDS_pept        181937..183358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="HTH_0176"
FT                   /product="F0F1-type ATP synthase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68643"
FT                   /db_xref="GOA:D3DFP1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP1"
FT                   /protein_id="BAI68643.1"
FT                   /translation="MNGKIVQIIGAVIDVEFEGEDLPPVRHGLKTRRRFIDDRGNWAEE
FT                   DLYLEVAQHIGEKRVRCIAMGATDGLVRGQEVEYLGGPIKVPVGRATLGRIFNVVGQPI
FT                   DEAGEVKAEDYWPMFREPPPLEEQSTKVEILETGIKVVDLLEPYVKGGKVGLFGGAGVG
FT                   KTVLMQELIHNIAKFHKGFSVVIGVGERTREGNDLWHEMKESGVLPYTVMVYGQMNEPP
FT                   GVRFRVAQTGITMAEYFRDVEGQDVLVFIDNIFRFVQAGSEVSTLLGRLPSAVGYQPTL
FT                   NTDVGEVQERITSTKKGSLTSIQAVYVPADDITDPAPYSVFAHLDATTVLARRLAELGI
FT                   YPAVDPLESTSKYLAPEFVGEEHYTVAMEVKRILQRYKELQEIIAILGMEELSEEDKAI
FT                   VGRARRIQRFLAQPFHVAEQFTGMPGKYVRLEDNIRSFKEILTGKYDHLPEMAFYMVGT
FT                   IEEVVEKAKALGAKV"
FT   CDS_pept        183355..184116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="HTH_0177"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68644"
FT                   /db_xref="GOA:D3DFP2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP2"
FT                   /protein_id="BAI68644.1"
FT                   /translation="MRKDGRKPNELRPIRIVRDYLQHPEGSCLIEFGNTKVICTVSVQD
FT                   GVPPFLKGKGQGWITAEYSMLPRATITRNVRESVQGRISGRTHEIQRMIGRAMRTALDL
FT                   TKIGERTFWIDCDVIQADGGTRTASITGAFVAIADAVIKLYNEGILSSTPIKDFVASVS
FT                   VGTVNGQILLDLNYEEDSTASVDMNVVATGSGRISEIQALGEENTFSREEFDRMLSLAL
FT                   AGISQLIELQRAFYEIVGNVWKRKNVKEARL"
FT   CDS_pept        complement(184118..184735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisIE"
FT                   /locus_tag="HTH_0178"
FT                   /product="histidine biosynthesis bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68645"
FT                   /db_xref="GOA:D3DFP3"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP3"
FT                   /protein_id="BAI68645.1"
FT                   /translation="MMNLKFDQNGLIPVIAQDYRTGEVRMFAWANEEAVKKTLETGYAH
FT                   YYSRSRGSIWKKGETSGELQRVVEVRVDCDEDALIYMVYQEKDVACHTGERNCFFRDIW
FT                   GEKANKVLPFEVLQRLQDVIKSRIEEKKEGSYTYSLFLQGEDRVLQKFGEEAVESLIAL
FT                   KNGDPESIKAELSDMLYHMLLALTIRGVDISQVLEELCSRFK"
FT   CDS_pept        complement(184740..185231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68646"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP4"
FT                   /protein_id="BAI68646.1"
FT                   /translation="MRDIPLRMLIERLEELITAQQKLASLMLLTEDKKAKLSVSTAIDM
FT                   LYTHMEMLDITLEIINALQDTSDDYTREYATMITAEALSWTGFMLPYIEASSPIFIEHI
FT                   KVESQPIISRIKSVVSLMERLGSEMDVFSSEEIIRTIDMVSRAIKYQLFMAKKSYETMA
FT                   "
FT   CDS_pept        complement(185228..186580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="HTH_0180"
FT                   /product="ATP-dependent protease HslVU ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68647"
FT                   /db_xref="GOA:D3DFP5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP5"
FT                   /protein_id="BAI68647.1"
FT                   /translation="MMMTKSLSDLLEELTPKRIVEELDKYIVGQEQAKKAVAIALRNRW
FT                   RRQKLPQHIREEVAPKNILMIGPTGVGKTEIARRLAQLIKAPFIKVEATKYTEIGYVGR
FT                   DVESMVRELVEVSYQMVKQEKIQKVKERAKRAAEERILDYLVPQQLSFGVREQQDTGKR
FT                   ELMREKLRSGELDEKVIEIDLQEKMMPMIGIAGPPGLEELEEQIKSMLGNMMPTRKRRK
FT                   VKVKEALSLLEQEEAEKLIDMEEVSRDAIQRAENFGIIFIDEIDKIAVKTPGAGPGVSR
FT                   EGVQRDLLPIVEGTTVKTKYGPVRTDHILFIAAGAFHMAKPSDLIPELQGRFPIRVELS
FT                   PLTKEDFVRILKEPKNALTKQYIELLKTEGVEIEFTDDAIEEIARIAEEANTKTENIGA
FT                   RRLHTVMEKLLEDISFNAPEMEGQHIIIDTKFVRAKLENIVRDVELSRYIL"
FT   CDS_pept        complement(186555..187022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68648"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP6"
FT                   /protein_id="BAI68648.1"
FT                   /translation="MEFFFFTDVYADRYLIDYYIVSFKLLDESVVSTKEWEGRKYITDI
FT                   KDWEAFKESAYDIVLYEFGDEVERFNDIETALRTAYRMAYTEASRRVPKSTLPSIGIGS
FT                   PPIDVIKRVFPVSFEFEIFPEDLDLFLDRIVRETEEEITRSEFNDDDEIPF"
FT   CDS_pept        187044..187424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0182"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68649"
FT                   /db_xref="GOA:D3DFP7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP7"
FT                   /protein_id="BAI68649.1"
FT                   /translation="MEVISSSDKETIEIGRRLGKSLKGNEVICLLGELGAGKTTLVKGI
FT                   AQGMGLLEGYQVRSPTFTIVNEYPTQKGRLIHIDLYRVNDFDIKEFIGQGVLVIEWAKN
FT                   INCCDITISIEFVPQGRLIKIR"
FT   CDS_pept        complement(187417..188028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0183"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68650"
FT                   /db_xref="GOA:D3DFP8"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3DFP8"
FT                   /protein_id="BAI68650.1"
FT                   /translation="MKRLYLVRHAQSEYNEKGIFQGRLDSDLTPLGFVQARLLAREFLK
FT                   KKVDIIYSSPQRRAYKTALTISDMLGTQLVVDERLREMSFGEYEGKHFWSMLEAHKDVF
FT                   LNWLSNPVKHPLPTQESMEEFEKRVRSFLEDVKSSHYQNMLIVAHGGTLHAIVCLLTGI
FT                   GLENLWNIHMDNAGITEIHMEGEKSTLVYLNKLCHTRQLT"
FT   CDS_pept        complement(188025..188621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68651"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFP9"
FT                   /protein_id="BAI68651.1"
FT                   /translation="MDKILGLDLAGSPKRPTGYAFWKDKKLEVGCVYKDEEILSLAQSF
FT                   DLIMIDAPLSLPEGRKDLETPGPHFRECDMELRKAGIKFFPLSLGPMRMLTKRAIFLAN
FT                   LFKKQNKRVFETYPGAFYDSAGISRRDREAIVRFYRHINLNLEVREYLQDELDAVACWL
FT                   SGVCYTLGKARLFVGKDGQIVLASEECVELLKYTL"
FT   CDS_pept        complement(188614..189840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="HTH_0185"
FT                   /product="osmosensitive K+ channel histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68652"
FT                   /db_xref="GOA:D3DFQ0"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ0"
FT                   /protein_id="BAI68652.1"
FT                   /translation="MEDLEERPSPEELLELVESVENVEFDVGKGYLTVYFGYAPGVGKT
FT                   YSMLYDAHLLLEKGIDIVVGYVETHGRAETEALLKDLEIIEPVIYDYKGLKLREVNYEK
FT                   IIQRKPQIVIIDELPHTNPPGFSEEKRYQSIKRVLQAGIDVFTAMNVQHLESLKDLIYQ
FT                   ITGVEVRESVPDPFIKDAKEIKLIDLPPEELLVRLSEGKVYVKDMAEEARRRFFKIGNL
FT                   IALRTLALRVVADQLDQKLKNYLRRRGITTPLGLKEKILVGVYASPYASQLVRATYRIA
FT                   SELGGVEWIALFVETEKSKDFTEEEKKWLEKALDLARRLGGRVECIKGKNVAQEIISYA
FT                   KREGITKIVLGKPRREGALTGSIYKNLILETEGIDIYLIAPRVKAELPKSIEKKGFDRY
FT                   LDILRRYFG"
FT   CDS_pept        complement(189827..190384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="HTH_0186"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68653"
FT                   /db_xref="GOA:D3DFQ1"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ1"
FT                   /protein_id="BAI68653.1"
FT                   /translation="MWKTFRVYIFLFAITGLIYPLVITGLAQLLFKEKAKGSIIYKDGK
FT                   PVGSELIAQPFVSRGLFWSRPSAVDYNPLSSGGSNLAPTNPELYRRVSQRVKLFNEMPV
FT                   PSYLVFASGSGLDPHLPPSAVYFQIKRVSKETGLTEEELKKLIEKHTEGRTLGIMGQER
FT                   VNILKLNMELLKLMEISTHGRP"
FT   CDS_pept        complement(190388..192448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="HTH_0187"
FT                   /product="potassium-transporting ATPase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68654"
FT                   /db_xref="GOA:D3DFQ2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ2"
FT                   /protein_id="BAI68654.1"
FT                   /translation="MKKRDVSVFNRDIIIEALLDSFRKLNPLELWRNPVIFLVEVASLI
FT                   ITIEFFLELSGVKKGLAWFSGWTAFWLWLTVIFSNFAESLSEIRGKARAESLKSYKTTI
FT                   MAKKLESPDPNAPFVEVPSTELKKGDFVLVQEGELISGDGEIVVGAALVNEAAVTGESA
FT                   PVLREAGSDRSAVLGGTKVVAGNIVVRITANPGETFLDKMISMIEGAKRRKTLNEIALE
FT                   VLLVSLTVVFLLVAFNARAISEYLVAVSNRGEPMSLAVLASLFVSLAPTTIAALLPAIG
FT                   IAGMDRLFRRNVIALSGRAIEAAGDANVLLLDKTGTITLGNRMASEFIPVGNHSFEDCV
FT                   WTAMIASIADETPEGKSIMELAKKTLGVRSDALPRNVKVIPFTPETKMSGVEVDGHSYR
FT                   KGAFSAVRDYIQKLGGEVPHQVEVVVAKIAMSGGTPLVVVKDKEVIGVVALKDVLKQGI
FT                   KARLARLRSMGIKSIMITGDNPLTAAAIAKEAGVDDFVAEAKPEDKLKLVKELQAQGYV
FT                   VAMTGDGTNDAPALAQADVAVAMNAGTQAAREAANIIDLDSDPSKLLDIVEVGKSMLIT
FT                   RGTLTTFSIANDIAKYFVIVPASVAPIYPDLNKLNILHLENPYIAILSAVIFNALVIPA
FT                   LTPLALKGAFYKPISPGRLFLYNLLVYGLGGIIAPFVFIKLIYHLIELFVR"
FT   CDS_pept        complement(192451..193917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="HTH_0188"
FT                   /product="potassium-transporting ATPase A chain"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68655"
FT                   /db_xref="GOA:D3DFQ3"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ3"
FT                   /protein_id="BAI68655.1"
FT                   /translation="MFLVLFFQNLLPLNPQGFNGFSWDMALNTAVSFVTNTDWQAYSGE
FT                   SAASYASQMLGLTVQNFLSASTGIVVAVALIRGLKRTETPYIGNFWVDMVRATLYVLLP
FT                   ISIAGALFLVSQGVIQNLDPYLKVELLDPALKGKEQIIPMGPVASQEVIKLLGTNGGGF
FT                   FGANSAHPFENPTPLSNFFECLLMLLIPTALTYTFGKLTGRQKLGWVIFGVMLFFFTSA
FT                   YLTEYWAMSQLPPSFEKLGISGPYVEGQETRFGLGGSALFGVVTDSTETGAVNGMFDSY
FT                   LPLAGMVLLMLMGAGVVFGGVGAGLYGMLAYMIIASFIAGLMVGRVPEFLQKKLYPKDM
FT                   WASVVTALTPTLLVLVLSSIALLTKAGTSSILNPGPHGVSEVLYAYTSTANNNGSAFAG
FT                   LNANTVFYNLTTAFAMFAGRFVVIFAVLVLAGSFAQKKLVPVASGSLREDSLTFAVWLV
FT                   FTVLLLNVLGFFPALSMGPVLEHFLLYGMR"
FT   CDS_pept        complement(193862..194113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68656"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ4"
FT                   /protein_id="BAI68656.1"
FT                   /translation="MCGESCIRDLLQFLLFILILLITTPLLGSYMAKVFGAESLPGERL
FT                   IYRVLNIDPSDCFQRDRSGGYVSSAFLSKPAASQSAGL"
FT   CDS_pept        194237..194548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68657"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ5"
FT                   /protein_id="BAI68657.1"
FT                   /translation="MGIYVMLTKISPYAVKNLEKLKEIEQHAEKLIEENCPGVKWLMNL
FT                   VVFGPYDYLDIFEASSDEEAAKVAMIIRSFGHATTETWPAIDWKDFKSLLDKIKIDYS"
FT   CDS_pept        complement(194529..195143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="HTH_0191"
FT                   /product="phosphoribosylanthranilate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68658"
FT                   /db_xref="GOA:D3DFQ6"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ6"
FT                   /protein_id="BAI68658.1"
FT                   /translation="MVKIKFCGLKRIQDLEKAISLKIDYVGFVLYPKSPRYVSSEELKA
FT                   LVSLSNSVKKVAVMVNPDYQDVKKVLDIGVDLIQLHGEESFDFAKKVGFERVIKAFRVK
FT                   EKIYISQEWRQVHAVLLDTYSQYLYGGTGKTFNWSIAEELVKNGFRIILSGGLTPENVQ
FT                   MAVRKVNPYGVDVSSGIEVQPGTKDHQKMEAFVRAVRSSLS"
FT   CDS_pept        complement(195136..195795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="HTH_0192"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68659"
FT                   /db_xref="GOA:D3DFQ7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ7"
FT                   /protein_id="BAI68659.1"
FT                   /translation="MLIAVPLNDRNFQEGLKACQEAGADMVELRVDMFEKLDVKRIKNL
FT                   IEEVHKVGLKTILTIRSEKEGGTHIENREELFRELSPISDYTDIELSSQDIIPVVRQAV
FT                   KSSGKKLIISYHNFEMTPSDWILREIFREARRWGADIVKVATKANSYQDVARLLCVGHQ
FT                   EEGEKILICMGKMGSVSRLAGFAFGSVISYAFVDEAVAEGQIHLREMVRLRSLFYG"
FT   CDS_pept        complement(195798..196994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="HTH_0193"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68660"
FT                   /db_xref="GOA:D3DFQ8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ8"
FT                   /protein_id="BAI68660.1"
FT                   /translation="MSKRVILAYSGGLDTSVMVRWLTEKGYEVITYTADVGQGEELSHI
FT                   PEKARQAGAVEAIVEDLKEEFAREYCLPTLRALALYEGRYPLSASLSRPLISKKLVYYA
FT                   QKFKADFVAHGSTGKGNDQVRFELSVWALDPNVQVLAPVREWEFKSREEEVEYALKHSI
FT                   PVKVTKEKPYSIDKNLWGVSIECGPIEDILREPPEDAFEWTTSPEKAPDEPEYVEIGFE
FT                   EGLPTSINGKRYEFLSQLISELNTLAGRHGVGRIDMVENRLVGIKSREVYEAPGATLLY
FT                   LAYRELLSLTTDRFTYHYFLSHVPHEYAKIVYEGLWFSPLREALDAFTSTLSKLVSGSV
FT                   RIKLYKGSAVVVGRSSPNSLYVEELATYSEKDAFDHKAGAAFTKVFGLPLKVLGRVRR"
FT   CDS_pept        197114..199039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0194"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68661"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFQ9"
FT                   /protein_id="BAI68661.1"
FT                   /translation="MKRMIFFSAVLGIGAVSACGGGGGSSAQPIAIDFAPLGIPNTDQE
FT                   HVSYKVTDKLIVTYSDGSKKEFPLSYEVLLQSGDQMGSYKWGQLLDVNAQPMSNIAYTK
FT                   GEISWNPDANSLIKTSDGKYFIITHFEEPPGMLYASELDPNTLKVKSITPIDFSSVGGT
FT                   IINCAGSQTPWNTHLGGEEDYDLNSIYSVSAGGKNPAYVQCTKDSNGYFTGNDVNGKSN
FT                   YFCGYVGGVQRYLKDLNIDPSNGYLGDKFNLYNYGYIVEVAYTNGKWDVAKHYITGKYT
FT                   PEMAVVMPDRKTLYMSDDGDYKGLYKLVLNQPQNGFNKNWCGTLYAAKVKQLSDQNGGT
FT                   FDVSWIELGKACDSEVKAIIDKKPLLTDIFDVEDPSACPTDQGFKLITEDRINECLRLK
FT                   VGQYRSSKFASDDEVKKAAAFLETRKYAAYLGASIEFRKGEGLAYDPDNNVLYYAITEI
FT                   GGSMADGKGDINLPNNMCGAVYRLVLDQNYNAYKMEGIVIGKPINRDPNDPDYQKYGQK
FT                   WACHPDYVANPDNLKYIGYNTLLIGEDTSYHINNMVWAYNVKTGKLTRIAWVPTGAEVT
FT                   GVFAHGLVGNNYTMTLNIQHPFVDTFRNADGNPVNSTYNDQNKDKRKGILGIIKGIPAG
FT                   LLKLTH"
FT   CDS_pept        199041..199307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68662"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR0"
FT                   /protein_id="BAI68662.1"
FT                   /translation="MKKYLLLSLAFITSCGGGDKESFIKELEQKNNISYTKVENFGAYI
FT                   PPQCYTKTLDSDGTVHNPCYTCHTQGTPPNFWNDTDLQESYNF"
FT   CDS_pept        199210..199476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68663"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR1"
FT                   /protein_id="BAI68663.1"
FT                   /translation="MERFTIPATPATHRELLLTSGTIQIFKNLIIFNFPEKMLKNPYIN
FT                   LFIDKTAFVNSISDQEIINYVRNSNYLDKVNPGQETGIKELIY"
FT   CDS_pept        199523..201367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="HTH_0197"
FT                   /product="glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68664"
FT                   /db_xref="GOA:D3DFR2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR2"
FT                   /protein_id="BAI68664.1"
FT                   /translation="MLVDEFDVVVIGGGHAGIEAALASARMGAKTVMFVLNADTIGQMS
FT                   CNPAIGGIAKGIVVREIDALGGEMGKAIDSTGIQFKMLNTRKGKAVWSPRAQADKKLYR
FT                   EYMKKVCERQENLYIKQDEVVDIIVKDNRVVAVKTKLGLEYKTKTVVVTTGTFLNGTIY
FT                   IGDKTFPAGRAWEPRSEGLAEFYKRHGFPLMRFKTGTPARLDGRTIDYSGLEIAPGDDP
FT                   PPKFSFWTEPVGTYWFPKGKEQINCYITYTTPKTHEIIRKNLHRTALYGGLIKGIGPRY
FT                   CPSIEDKVVKFPDKDRHQVFLEPEGLDTIEVYPNGLSTSLPEEIQWELYRSIPGLENVE
FT                   LIRPAYAIEYDVVPPTELYPTLETKKIRGLFHAGNFNGTTGYEEAAGQGIVAGINAALR
FT                   AFGKEPIYLRRDESYIGIMIDDLTTKGVLEPYRLFTSRSEYRLHLRQDNAILRLSKLGY
FT                   ELGLLTQDQYKIIKELQRQIEEWMSFYKSQRTALAIGSEVKSYTPSQLLTSDFTLDDLK
FT                   TFGFDVPTHPFVKEVVEIELKYEPYMERELKINERLKKLEDVKIPEDLDYDKIQGISKE
FT                   AKEKLKRFRPITVGQASRIDGITPATITSLLAYLGKLD"
FT   CDS_pept        201418..201708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx3"
FT                   /locus_tag="HTH_0198"
FT                   /product="2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68665"
FT                   /db_xref="GOA:D3DFR3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR3"
FT                   /protein_id="BAI68665.1"
FT                   /translation="MAKVKINKKIIEIPVGVRFGELHHEIEKAGVEFGCTDGQCGVCVC
FT                   TVKKGLEYLAEPSEAEEETLWRIGEYDENRRLTCQLVIEKEPPEIIELETD"
FT   tRNA            complement(201711..201800)
FT                   /locus_tag="HTH_t04"
FT                   /product="tRNA-Ser"
FT   CDS_pept        complement(201819..203186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="HTH_0199"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68666"
FT                   /db_xref="GOA:D3DFR4"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR4"
FT                   /protein_id="BAI68666.1"
FT                   /translation="MLRAEWIERRKHLKNKSQMYLAREGIITEEMRYVAKREGLHPEFV
FT                   RQEVARGRMIIPANINHLHLEPMCIGINSRVKVNANIGNSGLASDIPTEIEKVRVAIKY
FT                   GADTIMDLSTGDAIKETREAVIKESTVPVGTVPIYEALKRAKGQVKNMTVDLILDVIEE
FT                   QAQQGVSYMTIHAGVLREFLPMVQHRVMGIVSRGGAIMAQWMVEHGKQNPLYEHFDQIC
FT                   EIFKKYDVSFSLGDGLRPGAIADASDDAQLSELKVLGELTERAWRHGVQVMVEGPGHVP
FT                   MDQIEFNIKLQQKICHEAPFYVLGPLVIDVAPGYDHIASAIGAAMAGWYGAAMLCYVTP
FT                   KEHLGLPNIEDVKQGVIAYKIAAHAADVAKNWPGAKDWDLEMSKARFAFDWNRQFELAI
FT                   DPETARAYHDETLPQEGYKTAKFCSMCGPEFCAYRISQNVSEKMEEVILQDNWPSP"
FT   CDS_pept        203296..204129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nlpD"
FT                   /locus_tag="HTH_0200"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68667"
FT                   /db_xref="GOA:D3DFR5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR5"
FT                   /protein_id="BAI68667.1"
FT                   /translation="MREYITIIIAHHEGKPPKTLKIRKSHLKAFVASAVSFCFLSLLSY
FT                   ATSWHLLSERQKLKAEAKKLFEEKKMVLTQKERLNQEKEVMKEKLRAIETKMATVEEYL
FT                   SKRGVIGKTLAVGGASYKDVSYRDVSYLEFLEDRAEYLLSKVKATPLGYPIFGRITSHM
FT                   GWRKNPFGRGYEFHSGIDIEAPIGSKVKATADGVVEFAGRYFDYGKAVIIRHPSGYITL
FT                   YGHLSQIDVKEGQKIKAGDIVGRVGSTGRSTGPHLHYEVIKNNRPINPLDFIAWR"
FT   CDS_pept        204154..205188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsB"
FT                   /locus_tag="HTH_0201"
FT                   /product="citryl-CoA synthetase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68668"
FT                   /db_xref="GOA:D3DFR6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR6"
FT                   /protein_id="BAI68668.1"
FT                   /translation="MERRWKIGTPYLNDSTRIIVMGITGREASQVVAESEALYPGFVVA
FT                   GVTPGKGGSEVAGVPVYNTVREAQERHPEINTGIVYVPPASVKDAVIELIDAGIGVIFI
FT                   ITEHVPIRDTVYFYHYAKERGTIIVGPTSLGCIIPKIPARIGAIGGKDPSVAYADGGLV
FT                   ILSKSGGLTTTTAEMFKRRGWGVYMALALGGDVISCTTFADAIENLADDPNVKGVIIQG
FT                   EVGGSYEEQAAETILRLWKEGRWNKPVAAFVAGRFQESLEGVSFGHAGAIVERGKGKAT
FT                   DKIRAFNEVGKITGLVKVAEFYHDLVHCIEELGVPRDFEDSTPEGKVKPLYSTINEENC
FT                   QFKA"
FT   CDS_pept        205199..207688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="HTH_0202"
FT                   /product="long-chain-fatty-acid CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68669"
FT                   /db_xref="GOA:D3DFR7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR7"
FT                   /protein_id="BAI68669.1"
FT                   /translation="MEVDLKKGTVVPRLRERGKTALIHKAKSITYRELIENIKSFAYLL
FT                   DVAPGDKVAIISENRPEWVYALFAVWQRGAIAVPIDFMSSPQEIEYILKETEPSAIFFS
FT                   QSTRAHLLKALENSDKFPQLFEFDSIALPEKKLEHFFQLSLHDTALILYTSGTTGEPKG
FT                   VMLSFKNLLSNIKAIEKLQIATERDITLALLPFHHSYPLMVTLLVPLYIGATVVFLEKL
FT                   SSEELIKALKDYKVTILVGVPRLYQLMQKKVQERISTNPLASILFKLSAYLPKALRKWL
FT                   FWKVHQSLGGHIRFLVSGGAKLPIDTACFFDRLGFTVIEGYGLTETSPIVSFNPPHRVK
FT                   LGSVGVPIEEVYVKIAQDGEIMVRGVNVMQGYFKKPQETEKAFKDGWLLTGDLGYMDED
FT                   GYLYITGRKKEVIVLAGGKNINPEEIENLILSKSDLIKEVGVLEVDGFLHALILPDMEK
FT                   AKKMGILNVREYIKWTVLDRVNRELPEWKRITGFKLTSRELPKTRLGKIRRFLLPRLYS
FT                   EEEKVKEEKLQMPSTKEWEVLSDYLFRLSGRKVSPSDHIEIDLGLDSLAKVELISFIES
FT                   AFGVKIDEEELLSHSLIHELVSLISEKKEKIEIAQVDWGTILRSAPPYRLEHYPLVFGL
FT                   GRLLLLLFFKFYNRLEVKNSEYLPNPPFILASNHASYLDGFVLAASLPHSMAQNTYFLG
FT                   EEAYFRNPITSTFGRLAHVITVNLDKKLKESLQKTAWALRLGKAVVIFPEGARTRDGKL
FT                   LPFKKGFAVLSKELNVPVLPVALVGTYDSMSLRDRFPKPKKIKVIFGKPIHPEGRSYEQ
FT                   IVEETRRSIEELMREGR"
FT   CDS_pept        207685..208086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcbC"
FT                   /locus_tag="HTH_0203"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68670"
FT                   /db_xref="GOA:D3DFR8"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR8"
FT                   /protein_id="BAI68670.1"
FT                   /translation="MKHTYVRRVQFYETDAQGIVHHSNYFKYFEEARGDLLRSVGLAYS
FT                   QLRKEGYEVVLLEAFCKYKKPLVYDEEVHIEVSLTHMDRFTFSFDYRVVVQRELRATAY
FT                   TKHCLLKNSKLYSIPDKIKEVLTYGRKDT"
FT   CDS_pept        208067..209245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0204"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68671"
FT                   /db_xref="GOA:D3DFR9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFR9"
FT                   /protein_id="BAI68671.1"
FT                   /translation="MEEKTLKKRAYRIVLLFGIVSLLADLTYEGARSIVGPYMSLLGAS
FT                   AFAVSFIAGLGEFVGYALRLVFGYLADRTRLYWGITITGYLINLFSVPLLALAPSWQWA
FT                   GFLLLLERMGKSVRAPSRDALLSFATKRMGHGLGFGVHEFFDQIGALSGPLLVSAVMFL
FT                   TGNYRLAFALLGVPAFMALLTLIYTRISYTESVKKDAEEERDQLKSTFFLYILASSLVA
FT                   MGYADFALMAYHIKTSALLPDGWVPLLYAAAMGVDAIFALLFGVLFDRIGFYALMLGVL
FT                   LASPFSLFAFSLSVPAVCIGIALWGLGMGIQESIMRSAIAKLTPPQARGKAFGIFHFFY
FT                   GLFWFIGSAILGYLYQVSLAYLMTFSVLCQIISLVPLFILSKRVSATYRSSG"
FT   CDS_pept        complement(209173..209832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="HTH_0205"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68672"
FT                   /db_xref="GOA:D3DFS0"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS0"
FT                   /protein_id="BAI68672.1"
FT                   /translation="MISVILLSAGEGRRFGRKKQFVELAGKPIYLHSLEKVIGRFEDIL
FT                   LVLPEEDIERVKVPSGVRKVKGGKERQDSVLEGLLHAKGEIVVIHDCARPLADAKLFEK
FT                   VCKLNDYHGKITAVPSRDTLKEVAGHMVIKTIDRSNVWLSQTPQAFVRKVLLECHFKAR
FT                   NEGFYATDDAALLERYGFKVGVVEGSFWNIKITYPEDLYVAETLLERMKRGTKEMI"
FT   CDS_pept        complement(209829..210170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68673"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS1"
FT                   /protein_id="BAI68673.1"
FT                   /translation="MSVRHQVRGYVEKLFEGLKEKLHGGEYLVFNVYAKEGNILEMVDV
FT                   RVDFSDGEAIKKFLDRTTRETLEQEVKGLRLIAMVLEKDGDYVFSSQEEISEELKEEIK
FT                   EMIEQLKEE"
FT   CDS_pept        210267..210839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68674"
FT                   /db_xref="InterPro:IPR019230"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS2"
FT                   /protein_id="BAI68674.1"
FT                   /translation="MINQNVFIALLHYPALDRHGKIIVTSFTTMDLHDIARPSRAYEIN
FT                   TYYIVQPVDGQRLVIKKQLDYWLSEEGKRTNPTRNEIVQLVKLMYTFEEVVEDITNIRG
FT                   KRPVIVGTDARNYPNAVSYEFLRREIENRDRDFLIVFGTGYGIPPDLMATFDYVLEPIY
FT                   GAGDWNHLSVRNAVAIILDRLLSKNRC"
FT   CDS_pept        210841..211920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="HTH_0208"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68675"
FT                   /db_xref="GOA:D3DFS3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS3"
FT                   /protein_id="BAI68675.1"
FT                   /translation="MLYHLSLWLKDHFFAFNVFKYITFRSLSAVIVAFLITLIITPIFV
FT                   KKMKALQRLFKGYIREYTPEGHLTKRYIPSMGGFVIVLSLLLSSLLLMRLDLAYFWIIT
FT                   FCTLSFAFIGFADDYVKLRNKKGISARVKLTAQVLVSFITVMLIHTFTEVNTKLYFPLF
FT                   KDLQIDLGIFYIPFAVLVIIATSNAVNLTDGLDGLAIGPVMTAAASLGTVSYVVGHYTL
FT                   SKYLNIPYVPYAGDLTVLCFAIVGAGLGFLWFNAYPAQLFMGDVGSLSLGATLGVIALI
FT                   SKSELLLPIAGGIFVFETLSVILQVAYFKLTGGKRLFRMAPFHHHLELSGMPEPKIVVR
FT                   MWIISLLLGILTVSTLKLR"
FT   CDS_pept        complement(211907..212911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirD"
FT                   /locus_tag="HTH_0209"
FT                   /product="NirD-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68676"
FT                   /db_xref="GOA:D3DFS4"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="PDB:4CH7"
FT                   /db_xref="PDB:4CZC"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS4"
FT                   /protein_id="BAI68676.1"
FT                   /translation="MGNEFDKILKIIQKDIPLVKEPFSVLAQEVGIEEGKLLKTIEKLV
FT                   EDGIVRHIAPIYDSRLLGYDSALIAFKVDRQKLEEVANFVNACPGVSHNYERTHDFNLW
FT                   FTLAVPPEISELEDVVRLMAERERVKDYLVLRVVRLFKIGVKLDYESPAEKESVDTKVY
FT                   TYTPLTEEEKRIVSITQGSFPLVERPFLEYAKRLRMSEEELLEKLSALKERGVLRRISA
FT                   VLYHRRAGYVANAMSVWEVPEDAIEEVGRYIAGFKGVSHCYQRTTSEKFRYNLFAMMHG
FT                   KGQEEIKLLAETISREKALSKYALLFSTREFKKVRIKYFSEEFERWFKELISA"
FT   CDS_pept        212929..213384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="HTH_0210"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68677"
FT                   /db_xref="GOA:D3DFS5"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS5"
FT                   /protein_id="BAI68677.1"
FT                   /translation="MIYSETVKYALLALAYLALNRDRLVKVEEIAEAQKIPKPFLSKIF
FT                   HKLARERVLRSYKGPTGGFALAVPPEQITIMDVIRYLDEDYKLDYCALRPGRCEEWQVS
FT                   PCRVHEKWTRLRDTIMDYLNNTTIAELAEVEEKHRHEKPVQLEKFSK"
FT   CDS_pept        complement(213377..215482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="HTH_0211"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68678"
FT                   /db_xref="GOA:D3DFS6"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS6"
FT                   /protein_id="BAI68678.1"
FT                   /translation="MLRIGGVEELKRKVERELPLVVKRDGILVPFDRSRIQRAMFKAFK
FT                   AVGEFVEQSILDELVEDVVTKVLSLGKQRVHVEEIQDLVEETLILHGFAKTAKAYILYR
FT                   KRREELRDISNAIVDAERVVQEYIHKQDWRVQENANASYSFSGLMLHTAGTVIAHYMLT
FT                   HVYPEKIAKAHREGDFHIHDLSHGIVGYCAGWSLEDLLRKGFRGGYGKVTAGPAKHLSS
FT                   LLGQIVNFLGCTQMEFAGAQALNSVDTYLAPFVRVDKLSYEEVKQLIQQLVFSLNVPSR
FT                   WGSQAPFINFSFDWTVPEDMKERPVIIGGVERPDIGYYGDFQKEMDIINRAFLEVMMEG
FT                   DYMERIFSFPIPTYNITPDFVWESPNARLLWRITAKYGIPYFQNFISSSLKPGDVRSMC
FT                   CRLQLDLRELRSRMGGLFGSADKTGSIGVVTINLPRIAYLSKDEEEFLARLSHLMELAR
FT                   ESLEIKRKVIERNLKKGLMPYTREYLDSFDTFFSTIGLIGMNEACLNLLGVSIAEKEGR
FT                   DFAIKVLKFMREKLADFQEQTGHLYNLEATPAEGTSYRLAKIDKAKFPDIITAGEKEPY
FT                   YTNSTHLPVGLTDDPFEVLEHQKDLQVLYTGGTVIHFFLQESPNELAVANFVKKVLELY
FT                   PVPYITITPTFSVCEDHGYIRGEHFTCPECGKPAEVYSRVVGYYRPVQRWNRGKQEEFK
FT                   DRLEYVI"
FT   CDS_pept        215635..216867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB1"
FT                   /locus_tag="HTH_0212"
FT                   /product="2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68679"
FT                   /db_xref="GOA:D3DFS7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS7"
FT                   /protein_id="BAI68679.1"
FT                   /translation="MRGVAFFTLGCRSNEFDTHFIAHQFQLKGYQVVDFDKADIYVINT
FT                   CSVTAGAERSSRQAIYRAKRLNPNSLVVVTGCYAQINPQALSELKEVDLVVGNTHKRDI
FT                   LRIVEEYLSERKGKVYVDNVFRQNSVESFELITYFEKVRPFVKVQEGCNRFCSFCVIPF
FT                   ARGKSRSVLKEKVLKEAELLAERGFKEIVLTGTQLTQYGWDIATDLCDLLKDLVKIRGI
FT                   ELIRLSSLYPSEISQKLLDFVLLEEKIAPHFHLPLQSGSDRILQLMRRDYSVKDYVHLV
FT                   EKVIEKRPLSSVGTDVIVGFPSESDKDFEETYKLLSQLPIHYMHVFPYSDREGTKACKM
FT                   SRKVSQKVKKERVKTLKSLDQQKRAEFLKKNEGKELRALVIEENMLLTENYLNLEREGY
FT                   TSIGELVRVKV"
FT   CDS_pept        complement(216990..217727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0213"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68680"
FT                   /db_xref="GOA:D3DFS8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS8"
FT                   /protein_id="BAI68680.1"
FT                   /translation="MLRVIEEVGRGVILTLMGIYFMFVNPPKLRHFISQLAYLGAETVP
FT                   VVVITSIFSGGVIALQTYSTFHRFNAEFLIGAVVAISMGRELGPVLASLMVVARVGSAM
FT                   TASIGTMRITEQIDALEVMGINPVSYLVSPRVFAGVLGVPMLVILADIAGVFGGWFVAV
FT                   KLFGVNEYLFWEKMRDIAEFYDFIGGLYKAVFFGLIISAVSCYFGFYTGGGTEGVGRAT
FT                   TNSVVVSSMLILISDYFLTAIIF"
FT   CDS_pept        complement(217711..218874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="HTH_0214"
FT                   /product="chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68681"
FT                   /db_xref="GOA:D3DFS9"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFS9"
FT                   /protein_id="BAI68681.1"
FT                   /translation="MPIRFLTAGESHGKAVVCILEGIPANLDISTEYINRELERRQRGY
FT                   GRGGRMKIEKDSVEILSGVRFGKTLGSPIAMLVQNRDWENWQEKMAIEGKRPEGAVPFT
FT                   RPRPGHADLVGGIKYNQRDLRNVLERASARETVGRVAVGTVCKRFLEELGIKIGSYVVS
FT                   IGKCSPPLKEQDLLRRHELAESSSVRFPDPTKDEEFMKVIDEAREKGESLGGIFEVFAV
FT                   GVPPGLGSHIQWDKRIDGRIAQAILSIHAIKGVEFGLGFEAGRRFGSEVHDEIGWSEKD
FT                   GYFRYSNHLGGTEGGMTNGMPLLVRAVMKPIPTLTKPLRSVDIETKEEVRAGKERSDVV
FT                   AVPAASVVAEAMLAIVLADALLEKLGGDFMEEVKERYERYLRHVKSY"
FT   CDS_pept        complement(218874..219074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="HTH_0215"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68682"
FT                   /db_xref="GOA:D3DFT0"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT0"
FT                   /protein_id="BAI68682.1"
FT                   /translation="MARCYVCGKTTKFGKSVTFSAERNSRTFKPNLHKMRVRLNNGTVK
FT                   RVYVCAKCLKAGKVVKAVRTG"
FT   CDS_pept        complement(219096..219380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68683"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT1"
FT                   /protein_id="BAI68683.1"
FT                   /translation="MRLVILGGHDRLKSKVEEMAKRYRLSIKFINQETQQNIDSALACA
FT                   DWVIVFTSLSGHNMVKLAKKYAKDRCIFCHSHGVCSLEKKIKELVNEVK"
FT   CDS_pept        219576..220061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0217"
FT                   /product="putative sterol carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68684"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT2"
FT                   /protein_id="BAI68684.1"
FT                   /translation="MKWVMLSFLGIVGSSFAVPVFMDGEYAKAFCDAWNKTPQLVEELG
FT                   KSESWTAVPERKIFMYREDCGEAKQIQLTIKNEQGKAVCVYGGPAKDKRGPNDFLMYAQ
FT                   TQRWLEMGKGEYGPMKAMMFGRLKFEGPKFVAMKNMGPFEAFLKLIDKPPHDASRCP"
FT   CDS_pept        complement(220062..220787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="HTH_0218"
FT                   /product="pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68685"
FT                   /db_xref="GOA:D3DFT3"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT3"
FT                   /protein_id="BAI68685.1"
FT                   /translation="MPNYVLLLSYVGTNFHGWQVQPNLRTVQGVIKESLEKVFREDIKL
FT                   VGCCRTDAGVHAKEYVANFYAKKEMEPYKLLKALNSLLPEDVGIKRVWVQEGFNARYSV
FT                   RGKVYVYRVLNSFSRDAFIEPFAWRVPQKLDLSKMQKACELLAGRRDFSAFAKKEEEDK
FT                   NTVIDLEEVRLSKVEDLIEISFRARSFLRYMVRRMVGCMVQIGLGRINLSHLEEYLSNR
FT                   KTCPYTAKAKGLTLEKVLL"
FT   CDS_pept        220809..221438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0219"
FT                   /product="diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68686"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT4"
FT                   /protein_id="BAI68686.1"
FT                   /translation="MLYIGDDKNLKVYAVLENVVEIETGNLYGYRLVSRIIYGNEEGSF
FT                   AEVANRELKMRIEMAVLEAVRSANKSGVIFVNLPVSVNIESLPLYGKNVVVNLPMGMGL
FT                   KNLYIYRSRIKRCGLGTALDDFTTIGYELREIMFGAFDYVFFSDSFYTNANKKDLKKAV
FT                   ELVKYYGSKVCFKKIDTTSKLEMARSVGAQLGHGFLFGYEQIKAQL"
FT   CDS_pept        221435..221863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0220"
FT                   /product="TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68687"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT5"
FT                   /protein_id="BAI68687.1"
FT                   /translation="MKKVLVFILSFAFSCAMPRVIVLDDPLTAEEHLNLGYIYERKGEL
FT                   KPAKEEYEKALQKDKNMWKAHFNLGNVYAKMEDYAKAEREYKRALELKPNDPDILNNLA
FT                   WVLYKQGRKEEALLLIKKAISIDDREEYRNTLREIEGS"
FT   CDS_pept        complement(221860..223170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="HTH_0221"
FT                   /product="signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68688"
FT                   /db_xref="GOA:D3DFT6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT6"
FT                   /protein_id="BAI68688.1"
FT                   /translation="MLDLLTERFSKSLSKLRGVRKLTEKQVNDILRDIRMALLEADVDY
FT                   DVVKSFLKKVRDRAINEDIKNKLSPADSVVLTVYEELTSILGGEKADLKRGVVIFVGLQ
FT                   GTGKTTTIGKLANFLKNQSFKVAVSSTDVRRPAAMLQLQRLAEKVGVPYYSFDEASPVE
FT                   IATKALERAKKEGVDYLLIDTAGRLHIDEELMEELKRIKEAVKPSEVIYVADAMQGQEA
FT                   LRALKAFHESITLTGVILTKMDGDARGGVALSVKEAIGVPIKFVGVGEKLEDIEIFYPD
FT                   RIAQRILGLGDLQSLIEKAQQIIPEDEAQVLATRIMMGEFDLEDMLKQIRFIKSMGPLE
FT                   KILGMIPGVSAELKNLKIDEKKFKKTEAIILSMTKEERRNPKIINMSRKVRIAKGSGTS
FT                   VGDVNKVLKEYEEMKKMIKRLKGMQGIPKLPRFPFKF"
FT   CDS_pept        complement(223210..223821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68689"
FT                   /db_xref="InterPro:IPR041551"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT7"
FT                   /protein_id="BAI68689.1"
FT                   /translation="MDADEKEVRRKRQREVSLVGEAIEKRIMQILAQDNKIREECIIGH
FT                   GPAQAVRAETFVLRDFERDESVELPHLILSVKYTRETGEEVYMYMDADIVIYHKLSRRI
FT                   VCVISSKKSFRERGAQSAYWSLKKTGRDFKYIIVTPDSDFELYNPDNPYKQAKWRTILE
FT                   NEMAAVFVIDKGPPFKSRNFYVGNDHLKNCIRELLLSQTF"
FT   CDS_pept        223893..224849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0223"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68690"
FT                   /db_xref="GOA:D3DFT8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT8"
FT                   /protein_id="BAI68690.1"
FT                   /translation="MKYLRKKDFKETKVRILTALYERLKELSIEKGVSLNVLFNKALES
FT                   FLREQEKEDATEAIEKQNLFYDDGQIRLLLNDFLKVDLEELRGKVNLIVTSPPYNVGME
FT                   YGTIDDSMGYEEYLRFTERYLKRFYQLLADDGRVCLNIPLDKNKGGIQSVYADVVCLAK
FT                   KVGLKYQSTIVWNEQNISRRTAWGSWLSASAPYIIAPVEMVVLLYKEDWKRRDRGKTTI
FT                   SREEFIEWTNGMWTFPGENRKALGHPAPFPLELPLRCIKLFSYEGDLVLDPFVGSGTTM
FT                   VACRKLNRKGVGIDINKNYLKLAVKRIKEVSPAMFSW"
FT   CDS_pept        complement(224914..225855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB1"
FT                   /locus_tag="HTH_0224"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68691"
FT                   /db_xref="GOA:D3DFT9"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFT9"
FT                   /protein_id="BAI68691.1"
FT                   /translation="MLEISEDVLYDCIIIGGGPAGLTAGLYTARAKLNTLLLEKGTIGG
FT                   QIAITDLVENYPGFPEGISGKELSLRFKQQAERFGLKVAKAEATKIEKSGKEVFVHLRD
FT                   GRMLRAKTLIVASGSNPRKLGVPGEDKFLNRGVSYCATCDGALFDGLPIAVIGGGDSAT
FT                   QEALFLTRFGSIVYLIHRRDQLRAQKHLQEKVFSNPKIKFIPDTVVEEISGNEFVEKLI
FT                   LKNTKSGEVSELEVEGVFIFIGLEPNTGFLKGSVELDEKGYVITDEKMMTSLEGVFAAG
FT                   DCRSGSTGQVAVAVGEGCIAGMQAEKYIEDNF"
FT   CDS_pept        complement(225855..226181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="HTH_0225"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68692"
FT                   /db_xref="GOA:D3DFU0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU0"
FT                   /protein_id="BAI68692.1"
FT                   /translation="MAGGVIVLTESNWHAEVINSDKPVVVDFWAPWCGPCRIIAPIIEE
FT                   LAMELGDKVKFGKLNTDENPNIAMQYGIRAIPTIMLFSKGEIADTRIGVQPKEALKQMI
FT                   LSHI"
FT   CDS_pept        complement(226183..226470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0226"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68693"
FT                   /db_xref="GOA:D3DFU1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU1"
FT                   /protein_id="BAI68693.1"
FT                   /translation="MVEVVSEEKLEAWAEFLKALAHPIRLRIISVLIEGRQCVKNLSEL
FT                   LHTSQPNVSQHLGILRNKGIVGCKRDGSIVCYYIKDERVLEIYKILSKEV"
FT   CDS_pept        226560..228605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="HTH_0227"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68694"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU2"
FT                   /protein_id="BAI68694.1"
FT                   /translation="MLRTTLSLILSASYAFCLEILSDYLERLPDETVIAEGNVQAYYEK
FT                   YYIEADYVKYHPKSREVYAEGNVYVKSLDGRMEAWAKVAFLNLKEDSGYFIDSHGRFEK
FT                   FYLKAQRVDKDREVYTVQKGDITTCPPDKKEMTLCFSHAKVTDKYVFSYSNSLRLFSVP
FT                   LAYLPLSVFPVGERRSGLLPPLLGSNTYNTFIYQQPVYWAISQDKDTTLTFDIRDKQAS
FT                   GFSLEYRQAISHKKDLQGAVSIYKEPTPPGKWWEGRDLTTFRENRYRLKFDLDLGDFQT
FT                   GLDTISDPYLLQDVYLHTKEKTVPYLTSYVSYKKDADKFLFTFNARKFYDTTSPNNKQT
FT                   LQRLPEIGIYYKDTPVFKDLYFNATLAYTNFYREEGPRASRIIFFPELSLPVNFLGRTF
FT                   YSSFTFENGIYLSSNLSGTDKSFSTVHFVERLPLFFDRRWGKTDFKNVFEVVYSYRPKG
FT                   YNNPRFDTLDNIDKENQIKFVLRNYTAYDGRLLLSWYLEGGYSFLGSFSYAPFQYLLSL
FT                   PFAGQQLSTTFNKTVVNKNLMPIRSIVSLSPLPFLSLSSDTLYDPNSSRFLNNTSYLSL
FT                   NLKNSNITLGYVASKDFFGNRLTDQTLLSANTLYKHMNINLGVVHDNRINKDLLRQLRL
FT                   DYTGACWSLGVLLRDTYDGNRKKYIKEVFLAFNVFDLQRFTLPLKR"
FT   CDS_pept        complement(228583..229251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="HTH_0228"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68695"
FT                   /db_xref="GOA:D3DFU3"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU3"
FT                   /protein_id="BAI68695.1"
FT                   /translation="MKLLAPSILSADFWHLGKQVEAVIRGGADLIHFDVMDGHFVPNIT
FT                   FGPVLLESIKNHCNLLLDAHLMIDNADMYIPEFVKAGADWISVHIENNPHIHRTLQLIK
FT                   DLGAKAGVAINPGTSLSAIEEALHYADFVLLMSVNPGFGGQRFIERSIERLRRLRQMVD
FT                   SINPSILIEIDGGIKLENLEEVALAGADVFVIGSGIFSSDNVEEQTRRIKRKLISLEEV
FT                   "
FT   CDS_pept        229437..229550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0229"
FT                   /product="transposase-like fragment"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68696"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU4"
FT                   /protein_id="BAI68696.1"
FT                   /translation="MVENYDYMSFEDLNIRGLVRDSNLAKLILVVLEFLRL"
FT   CDS_pept        complement(229656..231530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68697"
FT                   /db_xref="GOA:D3DFU5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU5"
FT                   /protein_id="BAI68697.1"
FT                   /translation="MTEGELIKKLEEATLSAQESIKIVSAWIKGDILENLLKGIKDGVK
FT                   VEVFVRAGERKDMEITDFRVFRAVRSVRGRIYLNPRLHAKFLIIDDRRAFVGSANLTYA
FT                   GAHQENFEAVVEITQPEKIEELLSLYENLKKESEELNPNTVAIVISSENSLSSRALLLE
FT                   EIPQQCFLKTPTERGIMLCKLTSVKTVSLDEGVFLGRNKDKDWILAFVKAYANEIGDVK
FT                   IGELRVLCEYKKVREEEKESYFGVPLVPLPVGTQLFKMEEEDPDMQRVMSMNLSGYPME
FT                   KKAYVGRLLNTNLNVYLDITKISSMHMAVIGTTGAGKTTFVRRLIEHLGSDEVKFFVID
FT                   IFGEYYEKLMVDKERIEYIKLPYTLFPIHTDDLKDLFKSYGVDIGERSLEEKTFFMTLR
FT                   RSLKPDLELISYKEKSLEELLLLSAPPSLRSEVEDFLTILKRDFGDSSIKNQVDIYHML
FT                   KKGLYSDKDIVLYDLKDVLNLDARINIVGLLMKEIFILSRLDGKRRIIVLEEAHNFVPE
FT                   RGALDIPFGRENISYTMTKRIALEGRKFGVGLIAITQRPANISKYVLSQLNTQAIFRLI
FT                   TKNDLDAVSVFFEESQLELLRVLPSLRPGTLFLNGLAVPFGMLVSIEL"
FT   CDS_pept        complement(231527..232006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0231"
FT                   /product="putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68698"
FT                   /db_xref="GOA:D3DFU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU6"
FT                   /protein_id="BAI68698.1"
FT                   /translation="MKKQALEFSIEKASEKDIHELAQVYLKGYKGLEEYSYTHIDDVIA
FT                   YLNWLFRRDVAGIFVAKYEGQIIGFVASDGNWFSKREGKVVGAIHELVVLPDYRSKGVG
FT                   KALVEKVIEYFKSRGLDTAELWVGEENYEAINFYRWLGFESKDRFNYWIRMVKKL"
FT   CDS_pept        complement(232003..232605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0232"
FT                   /product="outer membrane lipoprotein carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68699"
FT                   /db_xref="GOA:D3DFU7"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR018323"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU7"
FT                   /protein_id="BAI68699.1"
FT                   /translation="MRYLLLVLIPIISWGQAFSMLEKKLSEIKTLKVAFVQKVSYSWYP
FT                   KADVSKGFFYAQKGGKFRIEYEQPERMLIVSDGREILLYYPKEKSAIIDKVENNRSAVV
FT                   EALFLLSKPISEVFDQVGEIKRDNNTTLVLKPKVIDDNFYRVYVELDEELNIRSIRVED
FT                   KDGTTTTVEFLSLSKNFSPSEELFRIRLPSGVKVQRL"
FT   CDS_pept        complement(232602..233681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0233"
FT                   /product="putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68700"
FT                   /db_xref="GOA:D3DFU8"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU8"
FT                   /protein_id="BAI68700.1"
FT                   /translation="MRSETFEELQRTAEDLLKLNRLAGSEGNKLTKEKIKKFLREKGIT
FT                   YREEFFQIEKSLPIKATIQVNNTTIPCVPYVGSPKGEYEGYVKRDPLEGDIILLGISEE
FT                   RSKLPSLRERGIKAGITYLETLNVHYYGNVDEEFPLVNVKKESIQLVEDAYIKLTIETK
FT                   KESILCSNIVFDIGRGPIIYMVAHMDTKPYVFGAIDNGVGFLLLLFMADELRRNYHLPY
FT                   RVRFLLTDAEELGLEGAKFHVGKGIKHAYYCINIDAIGWQHPAVIYKDAEGYNGDRLMD
FT                   MFLRHLQDMKVSIDFRSSPRAKSDHIPFKKVGVQTLFLSSNPFTIRHTFYDNLEAVNWD
FT                   IVRMWYELILSFLRRFHKL"
FT   CDS_pept        complement(233671..234588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0234"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68701"
FT                   /db_xref="GOA:D3DFU9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFU9"
FT                   /protein_id="BAI68701.1"
FT                   /translation="MEYAFFEGRIVPVEEANINIKTNSFHYGTAVFEGIRAYWNEKEQQ
FT                   LYILFAREHYLRLLKNAKAMFMEIPYTVDELVEITKEILRKSEIKWDVYIRPIAYFKDL
FT                   ALTPKLLGFTPEVAIYTYNFGRYLDTSEGIKVKVSSWRRNDDNSIPSRWKVAGAYVNSA
FT                   LAKTEALLAGYDEAIMLNQHGFVAEGSGENIFLIRGRKAITPSYSEHILEGITRSAIIK
FT                   LLQKELVVEVEERPVARSELYTADELFMTGTAAEVTPIVEVDNRKVGDGKVGPMTKELQ
FT                   ELYFNAVRGNIERYKVWLTPVYEK"
FT   CDS_pept        234637..235431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0235"
FT                   /product="putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68702"
FT                   /db_xref="GOA:D3DFV0"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV0"
FT                   /protein_id="BAI68702.1"
FT                   /translation="MKIKRPNVAGIFYPSDPKKLRDTVLALLKNSKLFPLKPVGLVAPH
FT                   AGYTYSGAVAGAVYKQLENLDLSKDWMVVIIAPSHYFFFEGITFGSYQAFETPLGQVEV
FT                   DRKAIERFIDTRKSLRVSFSDIPYDKEHSLEVQLPFLQVLLKSFRLVPVLYSDAKPEEI
FT                   KEVLNFFEGENTLFVVSSDLSHYHSENTARYKDSFCHAGIESLDVKLLGRCEACGITGI
FT                   TGAIFYARERNLKGKLIDYKTSGEVSEERHRVVGYGGYIFTS"
FT   CDS_pept        complement(235421..236257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="HTH_0236"
FT                   /product="signal peptide peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68703"
FT                   /db_xref="GOA:D3DFV1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV1"
FT                   /protein_id="BAI68703.1"
FT                   /translation="MKRFILVLILLVSVMVIGSLLSRIPVGNRIAVLKVEGIIIDAEPV
FT                   IKKIEKAKKDDSIKALVLRVDSPGGSVGASQEIYRALERFKDSKKPLVVSMGNVAASGG
FT                   YYISVPADYIYANPGTITGSIGVIIEHIDYRELLSRLGVKATAIKTGKFKDTLSPFREL
FT                   TDEEREYLKKTIDDAYGQFLSSILKYRSKKISEDELRSIADGRIMTGLMAQKVGLVDGL
FT                   GNIEDAIDKAKELAGVKEARVFYMEERKSFLRRLLGAKLPSFDLNYYPTMIYYLMK"
FT   CDS_pept        236326..237459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68704"
FT                   /db_xref="GOA:D3DFV2"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV2"
FT                   /protein_id="BAI68704.1"
FT                   /translation="MFYVSKVSPFFFALAVVDLFISLVYKSLNADMTAVWFLVVFGFVA
FT                   HTIMSAMYQLVPNSQSRPIRFPFLSYLVFSLSLICSLLFYARQFYYVGYIYALASLVFS
FT                   LHMVLSIKNWQPITVKFLGLAVFYFLLSSVFLMLSELDYLPLPLAVHTLTLGLMLNAVM
FT                   GVQLAWIPMLYMEPLNVKYGKYLFYSSLLALPPFLLSFYTLNYRLTAYLSILPLTVVAY
FT                   FLWIIYSVFSGRRMPKEIPLVVRYFILAMIFLPFGMLLGSLMASENLVSFIVRIHVDLL
FT                   VYGFTAITIMGGIAHLYPRIIYGWKQSEGVSIQELVDEPLLRKLLPFVPVSVAWMVFCD
FT                   AMGGFLLHISTLPYAVLWTLFFKAVLLKPFLKRKVST"
FT   CDS_pept        complement(237436..238152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0238"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68705"
FT                   /db_xref="GOA:D3DFV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV3"
FT                   /protein_id="BAI68705.1"
FT                   /translation="MLMAHSVKKSYKGREVLKDINISIDKGHIVGLLGPNGAGKTTLFN
FT                   CLVGFTSVDEGSIFLDGKDITHMPAHKRAREGIAFLPQEHTLFEDLTVLENLLIFLEFF
FT                   EESKSSRMARAEELLTDFGLYEVKDTKARYISGGQKRRLEIARSLIPRPKYILFDEPFA
FT                   GIDPILVADIKLMIKNLKSQNIGVLITDHNVRETIKIVDRVYIISEGSILAEGTPEEVI
FT                   AKKEVREVYLGADFSL"
FT   CDS_pept        238271..240364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="HTH_0239"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68706"
FT                   /db_xref="GOA:D3DFV4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV4"
FT                   /protein_id="BAI68706.1"
FT                   /translation="MRRTVGMLGLIMLSTSLAKEVQVEEVSVTATRTERKTEDVPASVS
FT                   VVGKEKLEQRPMLNLYDALQGIPGVNITTRNQGYDTRLIIRGAGLKATYGVREIMVLLN
FT                   GVPITDPDSLTRLDFVDTSLIERVEVVKGPNSTLWGVNSAGGVINVITRSPFERKGGFI
FT                   KLSLGDYNTQNHNLYYSTPLGKGFYIGFNASRRQTDNSWRSHNKFWTNQITLQPSYMFE
FT                   DGSAWENYISYTKASLELPGSLVVDPKRKIDQWSEFKRTGNVPQTADPWRHMGRYSEIL
FT                   FMSSKLDKTLENFQIIPVIYINHWQHYHPVTGRINDANTWIYGLDFQTNYRHSLGVLTG
FT                   GFTVRHDDQNTDYFKYRNIKVVGGRIVSTLSDSRGELLERQNQKTTLAGVFLQESIQRG
FT                   RWIVDIGARLDRVKFDISGYKWGDYSFSKGNYVSCPDPSIDNCFSYSREKTYTAVSPRI
FT                   GVVYKLSPVIHLYGNISTGATTPSSSELSSNPNLKLSKVINYEVGLKARHSRFSLDTAL
FT                   YLMQVKDEVVRVIQPDGYTQFTNAGKTEKKGLEISGSYRLFDGLDVGVSFAYSDYKFKD
FT                   FSEIVGSTNVSRNGNRLPYIPMHQYSLFASYTHSSGFRFRVQTDTWGEYYMDNANTEKY
FT                   GGYDFLTSISVGYAKKNFDVALMVDNLFNKKYAVEVTKDTSGVKRYTPGPPRTFLVRVS
FT                   YSF"
FT   CDS_pept        240378..241793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0240"
FT                   /product="polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68707"
FT                   /db_xref="GOA:D3DFV5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV5"
FT                   /protein_id="BAI68707.1"
FT                   /translation="MQVAKVHFIAKRDKRDILGMPLLGFLFKNRYMLLFYRLLTLFLLL
FT                   YAIIYGFVNPTKENVFTTAVFWSLFWPFFMVISLPTLGNVFCMVCPHGFLGKHLTRIGL
FT                   KLRPPKWLANPYIGLIGSNILAYWFVLYTFPSFLRSPLNTALFFTFFTLLSALLFLLFR
FT                   GMAYCKYVCPIGSVNSAFSRTSFTWLSTYQEECKTCKKPDCALACPYELNPSKFDSRNS
FT                   MFNCTLCMECAHACDAVKLEAKPWGSSLYKEIKQPKMIEVMVYILLTAVITFTMRFHHG
FT                   LSRSGISDFMPWVVVGKYLQSMFNLPKWIDMTGLVAMLMALLLVLSVVYLSFKMVAVVS
FT                   KRSLKDSLLVLGYAFAPLMIVGGLSHVLEFFFTEYYHNIMNGFSQAFGLGIHVEALAKR
FT                   GEAWLHIFKVFPFIAGLWSLQILWRRSALLAEQRRVLVFAVASSLPGLYLMLSIFALWV
FT                   MVSFPSVHTHGAH"
FT   CDS_pept        241795..242553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tonB1"
FT                   /locus_tag="HTH_0241"
FT                   /product="TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68708"
FT                   /db_xref="GOA:D3DFV6"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV6"
FT                   /protein_id="BAI68708.1"
FT                   /translation="MQRVLKAYGLSFLLHFLFFMAYILLFGEALKYKKVVEIDLSLQSQ
FT                   ELQNYTEAPHKEDKKHRSEEKHSERSIHREVKEQAVQKNQKAKESRVQNSQMQETPKES
FT                   GQESKGLESKETHNHVGEGLSKTGGLSSEQGTTKGQESTSTNRGKDAKEEREASPEAYL
FT                   REKLSVISSIVQKHISYPLIARKMGWEGRVVVCFLLRSDGRVENVHVEKSSGYEILDKS
FT                   AVSTVQKVSGLFPKPPVDVLVRLPINYKLE"
FT   rRNA            complement(242560..242681)
FT                   /locus_tag="HTH_r01"
FT                   /product="5S rRNA"
FT   rRNA            complement(join(242716..243151,243990..246491))
FT                   /locus_tag="HTH_r02"
FT                   /product="23S rRNA"
FT                   /experiment="Splicing of the intron was confirmed by
FT                   sequencing of the reverse transcription-PCR product of 23S
FT                   rRNA."
FT   intron          complement(243152..243989)
FT                   /note="group I intron of 23S rRNA"
FT   CDS_pept        complement(243236..243877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0242"
FT                   /product="homing endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68709"
FT                   /db_xref="GOA:D3DFV7"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV7"
FT                   /protein_id="BAI68709.1"
FT                   /translation="MISKRQKEIIIGTLLGDGYLQSTGKRNARLKLEHSERQKDYIFWK
FT                   WEELKNLMQDKPRRIERYNPRWGKSYTYYRCQSHSMPFLGKLKMLFYDQKGKKRVPEKI
FT                   EALLKSPLSLAVWYMDDGYYYRRDKVAYIYLPKYEEEELQRLIRTLEVNFSLKPKLVWK
FT                   KGYPVLYFPKEETQKLMEIVKPWVPEFMRYKTSPDPVTTEGALPEGSTKR"
FT   tRNA            complement(246533..246604)
FT                   /locus_tag="HTH_t05"
FT                   /product="tRNA-Ala"
FT   tRNA            complement(246624..246697)
FT                   /locus_tag="HTH_t06"
FT                   /product="tRNA-Ile"
FT   rRNA            complement(246765..248319)
FT                   /locus_tag="HTH_r03"
FT                   /product="16S rRNA"
FT   CDS_pept        complement(248490..248900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68710"
FT                   /db_xref="GOA:D3DFV8"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV8"
FT                   /protein_id="BAI68710.1"
FT                   /translation="MVKKTDPKLVCSPYVQKLGDTYLYAGSILFYFFSLPFKNSQHDEV
FT                   IYAKFGDRVYDFHLASLYVLGRFALYNLMVFAKLLLLCFLLLRAVLFFAKAENLVFEDL
FT                   FNRLPILLTHFLFRYILNTQKKRDFQGPLKRT"
FT   CDS_pept        248727..249917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68711"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFV9"
FT                   /protein_id="BAI68711.1"
FT                   /translation="MKVIHPVPKLGINYFIMLGILKRKGEKVKKDRSGIKVGIPKFLNI
FT                   WGTHQFWVGFFNHLGIKVVFSSDTSEEQYRQYGKGRITMDSCFPVKALAGHIGELLAKN
FT                   VDILFVPMIYSLPSFLRGHVLDTVSCTRVMMAPENIKAGFTREKDEFSSRGVRFISPFV
FT                   TFGEPELLPKQLYEALKEFLDLSYQEVTQAVKHGLRSLEDFDAYIRGKSLEIVKWCVKE
FT                   NKPAILVLARPYHMDTGIGHEIDVEFQTYGYPVLWYNYLPLDDWLLNWLFGQEVKAGII
FT                   KSPFDISDVWTSSYSSNTNEIIWAAKFACRFPWITGVIRLSSYECGMDQPTFTPVQKIV
FT                   ESRGTLYFKFGELDETKPAGSIKIRVETIVYYLEKYSADIINKKLSMLPPLPKELS"
FT   CDS_pept        250092..250328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0245"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68712"
FT                   /db_xref="GOA:D3DFW0"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW0"
FT                   /protein_id="BAI68712.1"
FT                   /translation="MDLEQKVKEIIADQLGVEVEKLSPEAKFVEDLGADSLDVVELIMA
FT                   FEEEFGIEIPDEDAEKIRTVGDVLNYLKEKVKG"
FT   CDS_pept        250328..251566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0246"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68713"
FT                   /db_xref="GOA:D3DFW1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW1"
FT                   /protein_id="BAI68713.1"
FT                   /translation="MRRVVVTGLGVVSPIGTGVEKFWMNLTAGVSGVDIIKRFDPIEVG
FT                   LSVHIAAEVKDFNPENYFEKKELPRVSDFIKYAVAASEEALKDSGLLDEKFDPYRVGVI
FT                   IGTGIGGLRDIEEQQKILLEKGPKRVSPFFIPYGISNMAAGLVAIRYGFKGPNYCVVSA
FT                   CATGNHSIGDAMRLIQKGDIDVAIAGGCESAITPLGIAGFASMKALSTRNHEPQKASRP
FT                   FDLERDGFVMGEGAGILVLEEYEHAKARGAKIYAELVGYAATDDAYHITAPCADGEGAY
FT                   MCMKLALEDAKIKPEEVDYINAHGTSTPLNDKAETLAIKSLFGEHAYKLSISSNKSMIG
FT                   HLLGAAGAVEAVATVKTVQTGIIPPTINLEKPDPECDLDYTPNRAVQREVNIAISNSFG
FT                   FGGTNACLVFRRV"
FT   CDS_pept        251538..252236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="HTH_0247"
FT                   /product="ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68714"
FT                   /db_xref="GOA:D3DFW2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW2"
FT                   /protein_id="BAI68714.1"
FT                   /translation="MPVSSSEEYKELEEKLGYTFRDKKLLEQALTHKSYAVEKGVKSYE
FT                   TLEFLGDALINLFVVDILLQEFPQAKEGQLAPMKAFFVSEEFLHQLAQELELEKYLLLG
FT                   GKKGKFKVNVSILGDAFESLWGAIYIDTGRDTNFTRSLFERLYKNRIITMARSSDYKKD
FT                   YKTILQEITQKRWKERPTYRVVSVSGPQHGKVFEVECSVRNIRAVAAGSNKKEAEQLSA
FT                   KRVLELLQEL"
FT   CDS_pept        complement(252224..252724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68715"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW3"
FT                   /protein_id="BAI68715.1"
FT                   /translation="MKKSEMLTAILVQDRLIRLNLSLLEGLLSEIKADIEESKILADAC
FT                   LDGKEMETYEKAMLVIEGNLLLKISEMLEHVYDLYEIFNFDITFLASVPEEIEREIERL
FT                   DALNSINTKLELILSVIDELLLFEGESEKLKAILTPFRVYREVIEHSISFNKKVWDLVF
FT                   QSS"
FT   CDS_pept        complement(252651..253049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68716"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW4"
FT                   /protein_id="BAI68716.1"
FT                   /translation="MEKPLSAFVRDLREASKDRAVLVEGKKDRESLIKLGIKNVFTLGG
FT                   KRFADLPDMLEDFSEVILLFDLDKHGERINRKVRDILSTQGYILIEDFRERMRGLNLLF
FT                   VEELYEKVRDADSYFGTGQAHKVKLKSP"
FT   CDS_pept        complement(253052..253726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0250"
FT                   /product="N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68717"
FT                   /db_xref="GOA:D3DFW5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012092"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW5"
FT                   /protein_id="BAI68717.1"
FT                   /translation="MFEDIIEAKASVGHFVKKRIEEFKKLGREGITFYDFRPFLDVQLE
FT                   ADIFSELCFCLLTANSSASIGIRLQKEIGIEGFKRMSFEELVHTISRYGHRFAKQRAER
FT                   IVKARETFEDVLDIINSAKSGREIRDLLSDACSKYKVEGFGLKEASHFLRNVGFDDVAI
FT                   IDRHVLRYLRENKLVPDQKTLTRRIYLMAEERLQDVCSQLNLTQAELDLYIFYIKTKKV
FT                   LK"
FT   CDS_pept        complement(253719..255284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="HTH_0251"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68718"
FT                   /db_xref="GOA:D3DFW6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW6"
FT                   /protein_id="BAI68718.1"
FT                   /translation="MLVRIYLEDFFIIKHQEVEFGEGLNVLTGESGAGKSLTVSSLLFL
FT                   MGHQQEYPEGTAVEAEFLKDGEQILVRREIKKGKSRYYLNGVGSIQKVVKEIVSSMVLL
FT                   QGQNDRMKILRRDFQRDLYDRFAGVLDLRREYEKLYARLEHLKEKLRDWNERQRERKIR
FT                   LAVILEELRDIERVGLSHQEYEDIKEKLSTIEHMEKINALVGRALDHLDTHGGLIDRML
FT                   DLKRALSELCRYDKTVEPFVKGMENISDELKYLRQFLSSKLLDLDPEEINRLNEKVYQV
FT                   QKLERRYGMKYKDILAYAGKLRSQIEAYQKEEDSKEELEEEILHLEKTLTSLADKLSDG
FT                   RRSAKETFEERVMETLRDMGLERSSFKVNFSQEEGRYGRERVEFLFSSYGKDEKPLESV
FT                   VSGGEISRIALSFFLLSPTSETYVLDEIDAGIGGETSLRLAKLLRRLSESMQVIVITHS
FT                   PAIASAAHKHILVKKEFKDDSAFVKIEELSGEERLEEIARLMGVVSEKTIEGAKDLVKE
FT                   TSNV"
FT   CDS_pept        255324..256835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="HTH_0252"
FT                   /product="ATP synthase F1 alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68719"
FT                   /db_xref="GOA:D3DFW7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW7"
FT                   /protein_id="BAI68719.1"
FT                   /translation="MATLTYEEALQLLREHIKDFEATARMEEIGVVYYVGDGVARAYGL
FT                   DNVMANELVEFESGVMGLAFNLEEDNVGIIILGSESGIKEGSVVRRTGRILDAPVGEGL
FT                   IGRVIDPLGNPLDGKGPIKYEYRSPIEKIAPGVVKRKSVHEPLQTGIKAIDAMIPIGRG
FT                   QRELIIGDRSTGRTTICIDTILNQRDTDVYCIYVAIGQKRSTTARIIELLEKNGAMDYT
FT                   CVVVASATDPASLQYLAPFVGCTIGEYFRDNGKHALVIYDDLSKHAEAYRQLSLLMRRP
FT                   PGREAYPGDVFYLHSRLLERAAKLNDELGAGSLTALPIIETKAGDVAAYIPTNVISITD
FT                   GQIYLEPDLFNKGVRPAINVGLSVSRVGGAAQIKAMKQVAGTLRLDLAQFRELEAFVQF
FT                   AAELDKATQQTINRGLRLVELLKQEPYSPIPVEKQIVAIYAGTGGYLDDIPVESVRKFE
FT                   KELYAYMDRERPDILKEIKEKKALDDDLKRKMEEALKDFKSKFIP"
FT   CDS_pept        256832..257623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68720"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW8"
FT                   /protein_id="BAI68720.1"
FT                   /translation="MKVYVGCSGFSYEDWRGVFYPHNLKREEFIVYYSKFFHVLELNFS
FT                   FYSFPSRGAIKSFLSRSKDLRFSVKAHRSFTHTRHYRSEDVKRFLYSLEPLLEEDRFIA
FT                   LLFQFPESFHLTQENLEYLKKLSQDFADMEKAVEVRSKSFKSWDFYRMVEEYGFSLVNS
FT                   DAPKNSRFLVGPWVSVGSINYVRLHGRDVQRPYDYLYSIDELKRLRDKIKKLGDKDTYV
FT                   FFNNTAKAQAVYNALQMKMLFGLKVQIPKSMEDAYREREWE"
FT   CDS_pept        257685..258164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68721"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFW9"
FT                   /protein_id="BAI68721.1"
FT                   /translation="MEDLRKDAQELFNRAYTYHMMGDIEKAIEFYKQSIEIYPTALAYT
FT                   FLGWAYSMLGEYEKAIEMCEQAIKLDPDLGNPYNDIGSYLIALGRYEEAVPWLKRAIVA
FT                   KNYEPRHYPHMNLARAYLAMGRFKDALKEAENAIKLAPDYKPAHILKHQILGMLN"
FT   CDS_pept        258180..258581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG1"
FT                   /locus_tag="HTH_0255"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68722"
FT                   /db_xref="GOA:D3DFX0"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX0"
FT                   /protein_id="BAI68722.1"
FT                   /translation="MKRGFTLIELLVVIIILGLLAAIVVPRITGRVEEAKIETTKVQMK
FT                   AIKDALEQYKLDNGFYPTTEQGLKALVEKPSTPPIPPRWRQYLDKLPKDGWDRDFIYIS
FT                   PGVGHPYELRSLGPDGKDGTEDDIDVWKL"
FT   CDS_pept        258565..258852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68723"
FT                   /db_xref="GOA:D3DFX1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX1"
FT                   /protein_id="BAI68723.1"
FT                   /translation="MCGSSKGFTLLEVLVASALLALFFGVLFELISKARRDYYYSVSLY
FT                   EDIITLTNRLTLNQMEGLGVEEETLRDYPIIKEFTYTYGKAKIYIYAPKK"
FT   CDS_pept        258812..259336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68724"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX2"
FT                   /protein_id="BAI68724.1"
FT                   /translation="MVRQKFTSMLLKSKKGFTLLEVLLVLVLISLLFGTLSYTYYSALN
FT                   SSLDLARDSQKLRQEAYLLWNLKRKVVSAKILHMEKDRLFMITSAGDYYEGMVKCAYIY
FT                   KDGVLYYYEFPYPYGDIKFYEEDKLIKLGKFNAFSFRAYAGGNFYDTFDGIPELLYVKL
FT                   DTRQLVIKLLS"
FT   CDS_pept        259333..260049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68725"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX3"
FT                   /protein_id="BAI68725.1"
FT                   /translation="MTRVAWSITHQEFTITDYYYFSKLSREAQKAGILIEEVDSWDRLK
FT                   DYDTIVFNYPEIPFTEREVQDIERLVWEDGKKVILLGYYKNEDRIADTCNTLAKRFGME
FT                   LNGDEVTDEVNNHQGDAYFVVTSKLRRYTKNEKNEVTVNKILLPCTASIKPLMPDIKVV
FT                   ARAEDTARSNQDNYTLLIAEQIAPTSGGYFCLAGTCVFWDNYSIELYDNLAFSLNLLRH
FT                   KTPLKTVGGKPVVFGL"
FT   CDS_pept        260058..260999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68726"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX4"
FT                   /protein_id="BAI68726.1"
FT                   /translation="MLWGRYRVSLKPWELPDVDLLEYEESEGLVDLAEEPKPYDGEPLQ
FT                   EGITVAFVDGVRRTEYAMYLIDDSGSSYEGAFASLGAGAVLIELGKLNLVKESMLHSIV
FT                   KRYLVVRGELQGIPQKSIGFEMRTTYEDVSKEINRIMREELEVRVARKLAQQVNPTLLI
FT                   CDGTLSNRLRGTTCVGYIKTIKKLFIRRDEANLLAHLKRGQRTPIIKLHYQHKQEQKEK
FT                   VEKYTWYVKLTDAEGVGSLARLEVFENVGLSMAKRIANMTAGILPMLVSTTFQDKRSPQ
FT                   NLLPIKSLENFLRRHLGSYSIVRREIEQLIYA"
FT   CDS_pept        260992..261864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0260"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68727"
FT                   /db_xref="GOA:D3DFX5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX5"
FT                   /protein_id="BAI68727.1"
FT                   /translation="MLEVLLIVASGYLLRKIGVFKKEDARVFINYVIYLALPVVSFRSA
FT                   HSLGISKSVIFVVLLAWIAIIFCLVVSFILGKVLRLKGSDLRTFLLVSSFGNTAFLGYP
FT                   YALSFFGQEGLRYAVIYDSLGSFLLVSTVGFLISRGSVNLKELFTFPPFIGLVLGFSLR
FT                   SYNFDTALKGALDTLAFSLSPVILFALGLSVSFVGIKRYLSISLFALFIKMVVSFLITY
FT                   QVAKALKMEPLAFKISLLESSMPSMMMSGVLALKYGLNHELAFASIGLGLLFSFVIVPL
FT                   LFHLFLASV"
FT   CDS_pept        complement(261821..262783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0261"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68728"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX6"
FT                   /protein_id="BAI68728.1"
FT                   /translation="MRVLITGAAGFIGSHLCERFLKEGFQVIGMDNFITGSPDNIAHLF
FT                   GHPKFKFIHYNVINYIYLEGPVDLVLHFACPASPIDYLSHPIHTMKVDSLGTLNTLGLA
FT                   KLKRARYVFASTSEVYGDPTIHPQPETYWGYVNPVGPRSVYDESKRFSEAMCMAYHREH
FT                   SIDVRIARIFNTYGPRMRINDGRVIPNFITQALKGEPLTVYGDGKQTRSFCYIDDLVEG
FT                   IFRLSTEDGLSGEIINLGNPQEVSIIDVAKLILELTGSSSKIVFRSLPADDPKRRCPDI
FT                   KKAKELLSWEPKVSLKDGLKITINWFKQMLRKGEREGEL"
FT   tRNA            262815..262886
FT                   /locus_tag="HTH_t07"
FT                   /product="tRNA-Val"
FT   CDS_pept        262906..263856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="HTH_0262"
FT                   /product="acetyl-CoA carboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68729"
FT                   /db_xref="GOA:D3DFX7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX7"
FT                   /protein_id="BAI68729.1"
FT                   /translation="MPLEFEKEHLELYQKIDQLRRLYQLGEKDKEAELRKLQREFRKNA
FT                   KELYKKLDPWSRVLIARHPHRPHTVDYISLIFRDFTELHGDRCFGDDRSIVAGFAYLDN
FT                   MPVAIIGHEKGRSTKEKMDRNFGMPHPEGYRKAIRVAKLAEKYRMPVITFVDTPGAYPG
FT                   IGAEERGQSEAIARSLYTFGYLKVPSIAVVIGEGGSGGALALAVANRILMLENAIYSVI
FT                   SPEGCAAILWKDQSKVKEASAALKLTAHDLLKLGVIDYIVPEPLGASHIDPKRSARVLK
FT                   YFLRRCLKELINRSPEEILSERIKKFERMGDFLEK"
FT   CDS_pept        263853..265886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0263"
FT                   /product="glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68730"
FT                   /db_xref="GOA:D3DFX8"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX8"
FT                   /protein_id="BAI68730.1"
FT                   /translation="MNTFVIHGHFYQPYRANPYVGDVMIEDTAYPYENWNERIYRECYL
FT                   PNAYAHLRVDTKVKAIINNYTKMSFNFGWPLLDWMEKNHPELLDKIREGAENAIATSFN
FT                   HTILPLDPQEDKEIQLFWGIRAFEKFFGRRPTGFWLPELAIDKQIVHMLIKYGIKYILL
FT                   APHQTKARGSFLRYYVQDGHLDIFVYNGELSQGIAFGDLLSDAKSLLETLRSRRGLTII
FT                   AADGETFGHHKKFGEMGLAYMFANSSEFKSLEAYYKENMPKLSTDINWNTSWSCPHGVE
FT                   RWRSDCGCSTGGLPGWHQKWRKPLRDGLEAVRSRIKEIVYNKLEEYFFDVHGAILGFVD
FT                   VILGASKDEYFSKYLKRDINKEEKVKILKLLNAIKYIQLAFSSDGWFFAEISGIEPVKN
FT                   LLFAKRAIELIEDSSIERTLLRYLEEAPSNIQAYGNGLGVWKNLVLTQVYSPQTISRTA
FT                   LILHISELKDKKDRLGKWEFEVLEESKIRLIDTETEEELSFEEDLTSFDVSMLPSLYAK
FT                   HIFEKWAMDYMKEEEEFLKDYEFLLEDMVLHSKSLRFRTAQYMREKLRLLLKSKLLILI
FT                   KEKASTDKIKEILTKADTLSVDVRDEHLAQELTSYVVDKAIKAGDEELLRLLEFAREYN
FT                   LSVVRYELAIDLWQVQNIVWERRQAIKNNRIFELLNILPFSS"
FT   CDS_pept        complement(265869..268664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="HTH_0264"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68731"
FT                   /db_xref="GOA:D3DFX9"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFX9"
FT                   /protein_id="BAI68731.1"
FT                   /translation="MIDWIIKKLIGTKNEREVKRLRGYVKKIAEKEMELDALTNRELIE
FT                   LSKELHLKVMGDESLKERIMRGDITEEVLLAFALVREAGKRTIGLRFFDVQMIGGLVLH
FT                   QGKIAEMKTGEGKTLVATSAVYVNALTNEGVHVVTVNDYLARRDAQWMGPIYKFLGLDV
FT                   GVINSDYSSYRVEWVDEEVVKEAIEEDLRVWPKGYFEEILPSHLIDTKAKKAFFTKLEL
FT                   CDRKQAYQAHITYGTNNEFGFDYLRDNMAVSLEDIVQVKGHNFAIVDEVDSILIDEART
FT                   PLIISGPSQMDTSAYYKADEVVRKLKKDEDFTVDEKNRTVLLTEQGIKKVEEFLGIENL
FT                   YDVKNIDLLHAVNQALRAHQLFKRDVHYIVKDSEVLIVDEFTGRVLPGRRWSDGLHQAI
FT                   EVKEGVPIQQENQTLASITFQNYFKLYRKLSGMTGTAETEALEFKEIYGLDVVVVPTHK
FT                   PVRRYDHPDLVYKTKQEKWQAVVDYIKREHQKGRPILVGTVSIEDSEHLSQLLKKAGIP
FT                   HNVLNAKHHEKEAEIIAQAGRLGAVTISTNMAGRGTDILLGGNPEYLAKEILTKRGKTL
FT                   ETATQEEWKQALEEAYRITQEEKEKVVQLGGLLVIGTERHESRRIDNQLRGRAGRQGDP
FT                   GETRFVLSLEDDLMRIFGGDRVKKMMEFLRIPEGEPIESRMVTKAIQNAQKRVEAQNFQ
FT                   IRKRLLEYDNVMNTQRLTVYGIRRDILEGKWLKEYVEEFIRDVIEERLHALLVEDEPEL
FT                   WDTKPLADYLKELTGRDVEVPQARDKEELVEKLTQTIKEMYAEKEESLGKDLFLEVTKV
FT                   VLLNNLDHLWREHLHILDRLREGIYLRGYASKDPLVEYKKEAFYLFENMMLNFKERAIF
FT                   DLMKVEIRSQEELEQEVQREEQQMESLLKQAVFSGVEGKSDQKGPRRKTLKERLQSRRK
FT                   R"
FT   CDS_pept        complement(268763..269158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0265"
FT                   /product="putative modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68732"
FT                   /db_xref="GOA:D3DFY0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY0"
FT                   /protein_id="BAI68732.1"
FT                   /translation="MGGIRKKEIKNFGIKLLDEVLSRIADIDKNRAYDVLSFYMDYEKS
FT                   INNVSKVIKRNGIVAYVVGNRKVKGIEIPNDEITVKFFERNGFSHIKTVIREIPNKRMP
FT                   KRNSPSNIAGITDTTMSHEYIVILKKE"
FT   CDS_pept        269411..270625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0266"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68733"
FT                   /db_xref="GOA:D3DFY1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY1"
FT                   /protein_id="BAI68733.1"
FT                   /translation="MNSKLPKVMVILGTRPEAVKLAPVVLALKKMGFNVKVVATGQHTE
FT                   MLMQVIDFFGMEACLLDCMSADLLENTACMTKALKNKLLEEKPDAVLVQGDTLSCYMGA
FT                   YSAFLNKLPVMHLEAGLRSHDKFSPFPEELYRKLTDSLSDIFFAPTPKAVDNLLSEGVR
FT                   KDRILLTGNTVVDAMHLALKRLDREKIKGEIENITGKKIDAYEGLVFITSHRRENFGKP
FT                   LENIREAILELSKRYSSLLFLWSVHKNPEVRKVVMDGLKSLPENLSLVEPLTYPQTVYA
FT                   LEKSKVLITDSGGLQEEACVVKKPVLITRNVSERPEVVEVGLGKIVGTEKENIIKSFDE
FT                   VYLSYDKFSNLEFENPYGDGRASERIAGFLLCPKVMDFILNYRERYREDLHECSERYSY
FT                   PAFAL"
FT   CDS_pept        270582..271358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68734"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY2"
FT                   /protein_id="BAI68734.1"
FT                   /translation="MSVLSVILTLLLLFETALAYNFRLEVGAGYEYLSPHRIYGDWKSG
FT                   FLRFYHRPSNDLTYFLEADAFSRKNLGEAALGAFGLYKDWSPWLYTYSSLSAGSSSSYL
FT                   PKFRLDHEFNLKLGPQKNIVPSVGFTYIKYHDVHKDYIMYPGITYYGEGFVITYKHFFN
FT                   KSQPGSVSSSTDLISLGIGQEGKSWTYLDMYYGKQAYLATYLTSPEEVRQKSLYISLKH
FT                   ILWIRKDFALFGGVSYFKLKDGYEKYGFQAGFFKDF"
FT   CDS_pept        271309..272121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68735"
FT                   /db_xref="GOA:D3DFY3"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY3"
FT                   /protein_id="BAI68735.1"
FT                   /translation="MDTKSMASRQDSLRTFEAQAVPYARFGRVLKFNRTLFLIQLLVLT
FT                   AFFEAVVLHLLDKYFEALTGITRSMFKEGHILEHSVGFLKIKYFAIFGRLPTAFESFTY
FT                   LVLSGVFLASLLSRFNRLPRNLTAWLIYVDMIYLVSSLYFVLFGERFPYTVAEFGKLYF
FT                   LQQMGVFLLIPVLLGMTLSVYTFGFVNFMLNFLTIALTLFYAFIFGAVRYLAFLSILQN
FT                   WSYIHMPAMFFVAGPLLDTVYVVSFYSLCSYLTVKLLHRKESYYQWGY"
FT   CDS_pept        272109..273371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0269"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68736"
FT                   /db_xref="GOA:D3DFY4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY4"
FT                   /protein_id="BAI68736.1"
FT                   /translation="MGVLTVVLKGYLLFLVFLLLLYTTRHYIFTLNRAFGKQRFYYQDI
FT                   MDSDLPSVSVLVPMHNEEKVARFILDRLVVTDYPRDRYEVIPINDHSTDATKEILEEYA
FT                   SKYEFIKPLHRYGDLPRGKQNGLNDALKVAKGDVIIVYDADYLPSRGQIKILANAFKDP
FT                   EVGAVMGRVVSINAGKNLLTRLLDMERAGGYQVDQQARYNLNLIPQYGGTVGGYRRSLV
FT                   LRFGGFDPNILAEDTELTFKLYINGYKVAYANIAECYEEAPEDWKVRAKQLRRWSRGHN
FT                   QVMFKYLIPLWKSRHLNFFQKLDGTLLLMIYMQPFLILLGLLCSLVLFFLGDMEIYTTT
FT                   LTLLFLFSHNAFGNFAPFFQIGMALVLDGSREKILLLPLMFFSFIFNLIYASLGFVDAV
FT                   IDLLTKRSVVWQKTERFRENA"
FT   CDS_pept        273364..274299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68737"
FT                   /db_xref="GOA:D3DFY5"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY5"
FT                   /protein_id="BAI68737.1"
FT                   /translation="MLDQALFVILLFILLMLLPFGASILEVILKKDAKPIHIDPERTKE
FT                   PDYFGKSFMRILKAALASLKIDHERASSYFYAKVPMPKGEEWVGFITPELLLEEEVSTV
FT                   SVFLSDTHLNVKRTFKKEVVVLGRLLITEECSMRSLYTQGDCILKAPLRIVRWLHVEGN
FT                   LGIDSPADLGQSAYVKGDAAVKGSVKFKRLYARKVSTFAYEQRKTGFKEEPINISGTLR
FT                   VKGSLNIDGTSKSVHIDGDLFSDGKIELQGNVHVKGSVFSQSDVVLKHGVRIGEEGKVK
FT                   SVVAKGRILIKGPFEAYGYLHAEGGGSIEP"
FT   CDS_pept        274296..276110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68738"
FT                   /db_xref="GOA:D3DFY6"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY6"
FT                   /protein_id="BAI68738.1"
FT                   /translation="MRRYVLIVLTLLLLAFLFTGVKRLLSQLALERDKSLQVLLVYDKD
FT                   TYQVRAFRSVLEEEGVPHRLVHINTLISTDPKTLSKTKPALLLPDGSLQYIHPDTMSWF
FT                   KKYLSTGGSVFVSYDAGTKNYAGAYLKEALFTNLLGANYALYDKLRGEAYSKGYLKITD
FT                   RSLEITPGKVDREKRLITGYMYGSLEYPYTKVEMRNSAGKLLAVVLDSRENKEYPVMFW
FT                   ERYEKGYIFYSAVPLGHLKAYSDDLVLRATLRYFLFKLLKLPHLVNTPKGKGGLVVNWH
FT                   IDASIDWKSIPMMLKEGYLRKGIEYSSHITAGPFRDQPGDGLGFDACEKGREYVKMLIP
FT                   YGVIGSHGGWAHNWFSENVLKGKFKEKEIYEYIKKNNDCLASITGYKIREYSAPNGVHP
FT                   QPQTTEVLEKLGMVAYYYTGDSGSSPNRTFINGKMVSAKVIAFPITPFEKAASLHEMKK
FT                   QGVSEEDVAMFLTRLAEYVEKTRQVRLFYSHPYDIPLYPNAILKFLDLVEEKERSKKIE
FT                   VHSMSYFAEFLLRFLKTDYSFRKEGDVLKVKLKNPEGLKDISIAIPRYYGKVLSFPKEA
FT                   VFISQDENYYYFYLADNPKELDFSFKFH"
FT   CDS_pept        276120..276920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68739"
FT                   /db_xref="GOA:D3DFY7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY7"
FT                   /protein_id="BAI68739.1"
FT                   /translation="MKLLLITLLFIKLSFSHPVLDIINNPYAVPYFLNLASIDLISDPS
FT                   NITKVKSYMQWYLNHLNYPDRYGLTGTIYDYYITEDSEVPLYTYDSADAYSATFLFLTY
FT                   LYAERTNDYHFIREKLQKLKDMAYVIAYLQDTDGLVKALPYINLKYLVDNIEDVCGLRA
FT                   FSLLLWKLSDPDWHYYFVLSHNVEKAVMKNLIWHGQIAWAKLDNELFIAGNSAVYPDLY
FT                   AKAVFYSFVGKPVPDEWVSRFDYFQRMVIRMVKMCRRLASNPHP"
FT   CDS_pept        276945..277673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="HTH_0273"
FT                   /product="pyridoxal phosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68740"
FT                   /db_xref="GOA:D3DFY8"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY8"
FT                   /protein_id="BAI68740.1"
FT                   /translation="MRLGVNIDHVATLRQARKTFEPSPVFAALIAQQAGADQITLHLRE
FT                   DRRHIQDRDLELIKELVNLPVNLEMAPTQEMREIALRVKPSRITLVPERRQEITTEGGL
FT                   NVPEMMDFLRSYLKPFKEKKIEVSLFIEPNVDHVRASKDVGADAVELHTGRYANLWKEG
FT                   NKLLIKEEIERIKRAGMEAKSLGLKVYAGHGLTYQNVGEFVTELKGVVEELNVGHSIIS
FT                   NAVIFGLERAVKEFLHLIRG"
FT   CDS_pept        277695..277958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68741"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFY9"
FT                   /protein_id="BAI68741.1"
FT                   /translation="MAQKEELKPESLEQEVEELRKSVFKLLELFLPPKDVRKEIMKNLY
FT                   TAELSLLKVFKTLLDYKVSQIERKIEEKEEKKRERVKKVEVE"
FT   CDS_pept        complement(277959..279389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="HTH_0275"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68742"
FT                   /db_xref="GOA:D3DFZ0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ0"
FT                   /protein_id="BAI68742.1"
FT                   /translation="MRLAGILLHITSLPSSFGVGDLGPTAYEFVDFLEASGQKLWQILP
FT                   LNPTCMEFGNSPYFSISLFAGNPLLISLELLCKEGLLSDKDIQRAKFQSDRVDYERASR
FT                   IKMELLEKAFSNFSQTPEYLSFEEENGYWLEDYCRFKVLRDRFKKPWREWESESVKELE
FT                   LQIKKEKFFQFLFFKQWKTLKAYANSKEIRIMGDLPIYPAFDSSDVWSHRDLFKLDENN
FT                   MPYVVAGVPPDYFSPTGQLWGNPVYNWDRLKETGFHWWIERIRHNLKLFDLLRLDHFRG
FT                   FVAYYEVPASEKTAIVGRWVNAPAEEFFAKLKREFPDFPFVAEDLGLITPDVERIRDSF
FT                   GFPGMKVLAFAFEEDNHPFMPHNHQKNSFVYTGTHDNAPIRSWFLEELSSASKERLFRY
FT                   LGRAVDEEQVSDVLIRLAYMSVAKACVIPMQDILNLGKEARMNTPGKKEGNWEWKLKSI
FT                   PDEKVAQRLRELCTTYGR"
FT   CDS_pept        279405..279824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68743"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ1"
FT                   /protein_id="BAI68743.1"
FT                   /translation="MKKVLAFLTLFIFSCQPVPKNVPIEKYRNQFIKGVVDVSAELKSK
FT                   IPNGDHFLIISVRDLENPMPVAVLRVKNPKFPYNFKITGKNKIDNSRIMEGDVILTARV
FT                   SRSPMAEAQKGDLLGSLQTKVGTQNNNILINAEVK"
FT   CDS_pept        279824..280282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68744"
FT                   /db_xref="GOA:D3DFZ2"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ2"
FT                   /protein_id="BAI68744.1"
FT                   /translation="MIRKMLELGQAIAFLPAISLFLGATFLALYGVYILLETIYSVVFK
FT                   PEVRDPAVLSTKFISVMDIHLLSIVLYIFSVGLYELFVGKLNVPDWLRITNIDQLKAKL
FT                   ASVIVLILAITFTKKVVEWKDPLDTFLFALAITAIVAVLIFYYKVKEE"
FT   CDS_pept        280328..281284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0278"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68745"
FT                   /db_xref="GOA:D3DFZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ3"
FT                   /protein_id="BAI68745.1"
FT                   /translation="MNTMKNIDLDTRLLELFCCVYEKGSISKSSNCLHLSQSTISFHIN
FT                   QLEKSIGLKLFYRKGRTLIPTSNAHILYPYAKKILEIKILALEEIKLISGSYKGHIRIG
FT                   ASSIPGTYLLPDIVSNYLNKNPNSSIEIIVEDSMKVVNMVEDGKVDVGFIGFRCVNPDF
FT                   EVIQMWEDTIHFVGSKNIQRNLSLTDLVKYPFILREESSGTRKFVENLLRAKGIELRDL
FT                   NVIAVVDKNDIIISLLKKVQAVSFISSYAIRGKKDINVLKIKDLEPIKRSFYLIYDRER
FT                   PQSPAVRLFLDMTLKACPGGLEPPTLGFGNPRSIHLS"
FT   tRNA            complement(281217..281290)
FT                   /locus_tag="HTH_t08"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(281268..281555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68746"
FT                   /db_xref="GOA:D3DFZ4"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ4"
FT                   /protein_id="BAI68746.1"
FT                   /translation="MKVKLLRFYPFETSLKKPRLLGYADVELENIIIIRNIKLFESRHG
FT                   GYFIQLPEVQKDGRSYVIIDIKSKDLLESIRRVVVDYYKENILSALSSGG"
FT   CDS_pept        complement(281552..282061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def1"
FT                   /locus_tag="HTH_0280"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68747"
FT                   /db_xref="GOA:D3DFZ5"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ5"
FT                   /protein_id="BAI68747.1"
FT                   /translation="MVREIIKFPHPVLKMPTQKVDVIDKDVQSIVGDMFETMYHAEGVG
FT                   LAANQIGISLSIMVIDTSKKEDSPLLKAVMINPELLEAEGEVKYKEGCLSFPGLSVEVS
FT                   RYSKVKVKALDINGEEKLYLLEGFPAIVFQHEMDHLMGITFIDRVNGIKRRLALDKYAK
FT                   LQKEKV"
FT   CDS_pept        282172..282447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0281"
FT                   /product="transposase-like fragment"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68748"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ6"
FT                   /protein_id="BAI68748.1"
FT                   /translation="MLTLQCKLILDKKDKKKLLDIMRVQSSAVRYAYNRLLESNNPKSL
FT                   HTFNTITKQLQETFKLLERNQNPRKIIFRGRELFEKLQKRRIKGSL"
FT   CDS_pept        complement(282563..282820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68749"
FT                   /db_xref="GOA:D3DFZ7"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ7"
FT                   /protein_id="BAI68749.1"
FT                   /translation="MLYGFLMVLFACFYAILYALGRASHLPSLQRLSYGFGVLEFLSGL
FT                   GMVASDYLDTFWRVLILFSIIAYLFIPPIMWRVVVAFHER"
FT   CDS_pept        complement(282837..284246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="HTH_0283"
FT                   /product="nitric oxide reductase cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68750"
FT                   /db_xref="GOA:D3DFZ8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ8"
FT                   /protein_id="BAI68750.1"
FT                   /translation="MERLYESQRLAIWYFWTAIALFGAQLLFGLLAAYQFINPDFLYGT
FT                   LNFMTNRMLHINAMVIWLLMGFIGGIYWFLPLETQREIVGIKLGKLAYFAFVITVAIVV
FT                   LVFLIKQFGKGDFFTLWFITEGREYVEAPRWADIGVVAVALIVAYNVVATVLASRRLTG
FT                   ILGVLIVDLAALFGLYLAGMFFTPNITVDQFWWWWVVHLWVEATWEVLVGVLMGWLLMH
FT                   LLGTPRKIIEAWLYIEVMLVFGTGILGLGHHYYWIGTPPYWLGIGGFFSSLEPLPLVAM
FT                   VIHAVYDAGVHRLQTVNRPALFWAFAQAFGNLFGAGVWGFMHTLPQINLFSHGTQLAAA
FT                   HGHLAFFGAYVAANLAIFYYILGKTRVKEGYIMNGAVWRIAYIGLIIGMFGMVASLTVA
FT                   GFAQTMIERASLGSTWEAYIQAQMHPWMEHAYRWRFFFGLIFALSYMALLYDLLTAGKR
FT                   VEQVKEAELAR"
FT   CDS_pept        complement(284265..284939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="HTH_0284"
FT                   /product="nitric oxide reductase cytochrome c subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68751"
FT                   /db_xref="GOA:D3DFZ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DFZ9"
FT                   /protein_id="BAI68751.1"
FT                   /translation="MSVGWLEVVVATLFISIVVSLILARGRHWLEPGFWKIAAVITSSV
FT                   MAITLVLLTVDTSRQISMGSKRVPSPSVINREIGYVYDAERMAMVPALGKEVGLFGRVW
FT                   SEEEAEKLVTKGKLVIQSRNCMDCHTLLGNGAYYAPDLTKAWLDPKWEKQLMPMTGAKT
FT                   REEAMRAFLMNPDKYPTWVRRMPNLKLSEDEAMAVVAYLKWMSTIDTNGFPANFPEVKV
FT                   SQ"
FT   CDS_pept        285062..286711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resB"
FT                   /locus_tag="HTH_0285"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68752"
FT                   /db_xref="GOA:D3DG00"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG00"
FT                   /protein_id="BAI68752.1"
FT                   /translation="MLKGFFPIVVSSLFFLATIIAGLFYLDERGVLYYALLFLSASFFI
FT                   LSLVGPTIRVVKAFVEDYRRHKSFLDFLYDFFSSLKLAIFLMVSIGVLSMLGSTYIQQN
FT                   QPLGFYLDKFGVDVGLWFWKLWLTDVFHSWYYMLLIVLLAVNLIVCSVKRLPRVWIQTF
FT                   TKERFQRLDQHTQKHLKPISIKTNSSKDKVIAFLKKMGFKVYTEEEDGKVYFYGEKGRY
FT                   SRLGVYVVHIGLLVIMAGALIDAIWGVRGSVIVPEGSRSDTLVIPSKEVGLKLPFQIEL
FT                   ENFRIVTYGEEAQERGKKISTPFKDDVASFESDIRIIKDGKVVAEGMTAVNSPFDFGTY
FT                   RIFQATYGLTGEAGTVRLVIFDKEKAVKDPRSALVGEVVLKAGKVAEFKDMLLSIDRST
FT                   LNIENEQAGMNGDLKPALVVKVLLNHKAYDVPVVYSPELTLIAYNQMKELKDFPYVFFM
FT                   SDFRPRFFSGFQVSRQPGTPIVWLGSIMVVGGMIVAFYTIHRKVWMRLEGDTLWVAFWS
FT                   HKLKEDFKRSFIKALEELKHEGTSDGKESYAA"
FT   CDS_pept        286671..286973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68753"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG01"
FT                   /protein_id="BAI68753.1"
FT                   /translation="MKVLLMEKNLMLLSRIKSSLSEYEVRVGDKHTDEDVVFINVEAFP
FT                   VDTIKELKSKGAKVVAYCGHKNIDLQSKARKAGADAVVPNSQVIDAKAIIEKLGG"
FT   CDS_pept        286991..290215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0287"
FT                   /product="helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68754"
FT                   /db_xref="GOA:D3DG02"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG02"
FT                   /protein_id="BAI68754.1"
FT                   /translation="MGAPSTDLSFITNEGGISLKDRLLALIKDCETFDCIVGYFYLSGF
FT                   HLIYKALENTKKIRILTGMGIDPKSAHIIHSAKEIKEKAQKKMEEELEDCEDSYEVESA
FT                   IRRFVEWIESGKLEIKAYPDGRLHAKVYIMTFREGDRDLGRVITGSSNLTQSGLEGNLE
FT                   FNVELKNRADYEYAKKKFEELWSQAVDITEDYVKTITEKTWLNDKITPYELYLKFLYEY
FT                   FRDELKAGDFELKLPSGIKRLKYQEQAVINAKRILEAYGGVFISDVVGLGKTYITAMLL
FT                   KQLDGRTVVIAPPNLIDEKNPGSWVNVLDSFKINARFFSTGKLDDAISYIQSKDSEDPI
FT                   KNVVIDESHRFRTEDTKSYEKLAQICRGKRVILVSATPYNNHPIDILSQLKLFQSPRKS
FT                   LIPGVPNLESFFKKLDKKLKEAKKEGEEEYVRVSREVSKEIREKVLKHVMIRRTRRDIL
FT                   NYFREDIDKEGIKFPEVEPPKPIYYQLEKEEDDIFMETLRILTKDIKYSRYKVLTYHKN
FT                   EDIRNKLLTSQKNLATIMKILLVKRLESSFHAFKNSINRFVKYYENFIKEYEKGHVYVS
FT                   KEHINKLFELLEEEDYEAIEKLIEEDKVQRYPREEFFEKLEKDLYEDLSSLRRIKQMWD
FT                   NIKRDPKLEKLIKELEENPILKNNKVIIFTESKETAEYLYQELTKKFGNTVLLFHGSAS
FT                   ENHKELLIKNFDANLPQKQQDNTYRMLVTTDTLAEGINLHRSNIIINYDIPWNPTKIIQ
FT                   RVGRVNRIGTKFDTIYVFNFFPTEKADSEIELTKIARSKVEAFLNMLGEDSAILTQDEP
FT                   VASHELFDKLVSKEVLEEDKEEESEIKYLRIIEEIRDKDPKLFEKIKHLPKKARSSKRF
FT                   SESLRDIASSNSLLTFFRKGKLMKFFLSDKEKTVELDFLTAAKILESQQNEKRAEFPPS
FT                   KDFYELFNKNKEAFMNATEDEIVETHRQAGRSSYNDLLKILKAVLRNGKELTEEQQEYY
FT                   KTLINRLEEGAIPKKTVQKTLKELNALKEDIQDPIKVLSVCQRTIPSALLKSHYAQAPA
FT                   LEESKREVILSLYLQGDEHHKYFGVD"
FT   CDS_pept        290216..294442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0288"
FT                   /product="putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68755"
FT                   /db_xref="GOA:D3DG03"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG03"
FT                   /protein_id="BAI68755.1"
FT                   /translation="MNREQAKRLVIETFENPFDEKKFIEFIANLLKTYDRSKALEPRSG
FT                   IQGITERYLDFISSWKRIGRYEDEDGRKIDILIVYLKKETSLYRARTAQRNFVAEYLQG
FT                   KLGTDSKKYAALVAFVSSPEDWRFSLVKMDYKFVGGRVKEEFTPAKRFSFLVGKNEKSH
FT                   TAQSRFLPLLESDKYPTLEDLEEAFNVEVVTEEFFRKYRDLFIRTKLELDKIVQTNPKV
FT                   RQEFENKNINTVDFAKKLLGQIVFLYFLQKKGWFGVKRGASWGSGPKDFIRRLFNGEYG
FT                   KYDNFYNDILEPLFYEALRTDRSADDHYYSRFNCKIPFLNGGLFDPINNFDWVNVDILL
FT                   PNELFSNKNKTKEGDIGDGILDVFDRYNFTVNEEEPLEKEVALDPELLGKIYEKLNAIR
FT                   PDNFDEYVKVLKSGKKGDETKFNKEYGVYYTPREIVHYMCQESLINYLETELAGKVKRE
FT                   DLEKFVRYADLFLEHERTAFEKRERIERGEQKETKYEHRIPESIIQNAELIDKLLADIK
FT                   VCDPAVGSGAFLVGMMHEIVKLRQLLSVYKSSTGIPESSTGTGISACDTYGEGELKITR
FT                   RNLPHWTKPGSIYWVTFRLADSLPQEKLRQWKEEYEMWLKRNPKPWNEKQWKEYNEKFG
FT                   ERIEKWLDSGYGSCILAKPEVREILKECLFKFDKERYLIHAVVIMPNHVHLLIEPFSGY
FT                   SLSELLKGIKGASAYYINKLLNSTGNKVWMEESYDHIVRSEKEYLRFVQYIIDNPKKAN
FT                   LPDDKYWLYVSQTAMSVVHGVKQAILPVSEKETQKGTLQTGMSSQTGMSQQTGMSVLHY
FT                   DLKRHCIENSLYGVDIDPGAVEVCRLRFWLSLVVDEEDFYSIKPLPNLDYKVVQGDSLL
FT                   GVEKNLFNQEDFRKLEELKKKYFNEANPRQKQNYKRQIDELIYKITNGHKEFDFRVYFS
FT                   EVFHEKGGFDIVIGNPPYVRQERIKHLKPKLEKAYKDFFVSTADLYTYFYKKSYDILRK
FT                   NGVLCFISSNKWMRAKYGEKLRKFLKENTKVIEVVDFSGYRVFEQTVDTNIITLLKSKP
FT                   EKGHLVSFVNVGSDVDDDVIKYIRNNKKTILQEKLSDSAWTLAEDKVLAIKEKIEKIGT
FT                   PLKDWDVKIYRGVLTGYNEAFIIDTETRNKILANCKTEEERKRTEEIIKPVLRGRDIEK
FT                   WRYKWAGLWLIYIPWHFPLHNNPNISGASKEAEERLKQLYPSLYEHLLKYKEKLLNRNK
FT                   EETGIRYEWYALQRWASDYYPEFEKEKIVWQRVTQQFSFCIVPKGIYVLDSMAFMVGNN
FT                   LRFLIGVLNSRLIDYYIRTYVHQYADKGFLLSNQYVERIPIPKVPSSQQKPIIDLVDKI
FT                   LECTTGTFACDYKNTDKNVHATSDYETNQQKQARVKELEKQLDQLVYKLYNLTEEEINI
FT                   IEGNKI"
FT   CDS_pept        294569..295894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0289"
FT                   /product="putative bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68756"
FT                   /db_xref="InterPro:IPR011101"
FT                   /db_xref="InterPro:IPR031009"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG04"
FT                   /protein_id="BAI68756.1"
FT                   /translation="MKEYRLKEVSKAKHIILEKYFPAWARILKSKHQTLIYVDCFAGSG
FT                   RYSSGEEGSPLIVARKANELIEKDKSMKFYLIFVEKNKKSAQELEKQLKSYERENVKIF
FT                   VFNEDSHDFVPELLEKIPKNIPAFFFIDPYGHPLSIPVINKILSMQRKEILLNLMWYAI
FT                   NMHLNNPKAEQTINRMFGNTDWKNQNFIRKERENNFVEYFIRQVNAKYNFKFRIRFSPE
FT                   DKVHGGENRTKYYLIHFANHERAILLMKEVMWTIGDEEGTFDYSASHQEILFSRTPTVE
FT                   QLEDVPAHFIKSVFEVMNRAKHLTFQVLTKRSERLLEISKELEWTENIWMGVSVENSNY
FT                   IYRINYLLQTPAKIKFISFEPLLGPIYEFPTKGIDWVIVGGESGPNARPMLKEWVMEIY
FT                   RICRENNIPFFFKQWGGVSKRKNGRELNGKIYEEYPYAKKQG"
FT   CDS_pept        295918..296238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0290"
FT                   /product="DNA polymerase beta-like
FT                   region/nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68757"
FT                   /db_xref="GOA:D3DG05"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG05"
FT                   /protein_id="BAI68757.1"
FT                   /translation="MNREKITRKDEVIEKLRENMGKLREFGVKRIGIFGSVVKEALRTD
FT                   SDIDLIVEFERGKATFKNVSGLIDFLEDLFGRKVDILTPDGIASIRISHIRHQIEREIE
FT                   YV"
FT   CDS_pept        296231..296584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68758"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG06"
FT                   /protein_id="BAI68758.1"
FT                   /translation="MYKRGDREFVLDMLFACNKIMNYTKGLTYEDFKKNEMVIDAVTRN
FT                   IEILGEASKSISDGLKNKYPEVGWKEIARTRDKIIHFYFGINLEIIWDIVIEDIPKLKT
FT                   ELEKIIKLEGWSL"
FT   CDS_pept        296572..297318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68759"
FT                   /db_xref="InterPro:IPR021272"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG07"
FT                   /protein_id="BAI68759.1"
FT                   /translation="MEFITVKTIDLNHLGEKWLELKKQRMQNLLKIALTDEALYREIMI
FT                   SLGYSKNKVNFLELAIITPYSEIRKLKEKSIIEKALLYRAGFIDDKNGLPDDFDFSLRM
FT                   DKSVWIYKGIRPANFPEKRIEGISVLLSKTTECGLVNFFLERIKSEIGSKNLKKSLKSI
FT                   MNFEGIGLSRKEEMFFNTIMPFMMVYSQDDEVQNFLRFMFENYPPLSENSLIKSFRLSY
FT                   PEVKIENLKTYMGAILFQKTNPGQSS"
FT   CDS_pept        297375..300401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="HTH_0293"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68760"
FT                   /db_xref="GOA:D3DG08"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG08"
FT                   /protein_id="BAI68760.1"
FT                   /translation="MKDIGKYDHKAVESKHSRRWIESAIYSSGSDQREEKFSVVIPPPN
FT                   VTGSLHMGHALNATLQDMVCRWQRMMGKKVVWVPGFDHAGIATQYVVDKKLQQEGKDRL
FT                   EVGREEFLKEVWKWVPISRGAIREQLEKLGVSVDWKRERFTLDEGFSRAVRYAFRKLYE
FT                   DGLIYRGEYIVNWCPNDLTALSDLEVEHEEEDGKLYYIKYPLEDASGYITVATTRPETM
FT                   LGDTAVAVHPQDERYKHLVGKRVRLPLVSWKRKAMSGEEVSEYIPIVADESVLSDFGTG
FT                   AVKITPAHDPTDFQIGKRHNLPFVQVMDQHARMNENAGEFAGLDRYEARQQIVKRLEEL
FT                   GLLEKVEDHRHAVGKCYRCKTTLEPMVSVQWFVRVSDERIKKAAIKVVEEGKIRFIPEG
FT                   WKKIYLQWMENLKDWCISRQIWWGHRIPVWYCQDCGKESVYTDDDFDRVYDKLIFNLIA
FT                   DGKIDYEFTPEEVEKVLHSPSFVHPNMTVLDFYKKFAFHKYHSTEVSAHSLRLFFTQDI
FT                   NPMAILTEKKNRYRYDPKTKKYRFVLRCKHCGSERLRQEEDVLDTWFSSALWPFGVFGW
FT                   PEEAQDLKNLYPTDLLVTGFDIIFFWVARMIMMGTYFTGDVPFVDVYIHALVRDEKGQK
FT                   MSKTKGNVIDPLDIVERYGADALRFTLAILTQQGRDIKLSEKRFEGYKHFANKLWNAGR
FT                   FILMNLDQDLLANLPYAAPPRSEDLWITTKLNQTVRKVNEALSQYEFSEAAQALYEFVW
FT                   SEFCDWYLEMSKLRLYAKPTENLPEEERQKEEQRIKAERITAQATLLKIFDSVLKLLHP
FT                   FMCYITEELYSHLPTSHLESVSLCQYPQYNPQDVFEQAHEKVEKLKGVISSVRALRSDL
FT                   RIEPSRKIRLYCRGEGWKEMLTEFEEHIKSLVKVEELIHTQERPPRAVAGFYKDLEFFL
FT                   SVEEGINIEELINSYTKRHKEVVKSLESVERRLQNPSFLEKASREEVEKVQKIREELLA
FT                   EKAKLEELLKSLEEARVSS"
FT   CDS_pept        300398..301318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="HTH_0294"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68761"
FT                   /db_xref="GOA:D3DG09"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG09"
FT                   /protein_id="BAI68761.1"
FT                   /translation="MRVLITGGAGFIGSNIAKQLERSYPNAKVYVLDDFSSGHFKNLIG
FT                   FRGEVITGNISDPSLWEWLAQNYQFDVVFHKAAITDTTIMDQALMMKTNADSFRHLLKC
FT                   AVKWKAKVIYASSAGVYGNVEPPMREEGPQEPENVYGFSKLIMDRIALNFLEEHKDIKL
FT                   IGFRYFNVYGEGESYKGKTASMVYQLYKKIASGEKARLFKWGEQRRDFVYIKDVIKANM
FT                   LALEKDVSGIFNIATGESRSFNEIVDILSIELNTKPEVEYFDCPYDFYQQHTQADISKA
FT                   REVLGYTPDFSLEDGIRDYIKVLRA"
FT   CDS_pept        301315..302226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="HTH_0295"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68762"
FT                   /db_xref="GOA:D3DG10"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG10"
FT                   /protein_id="BAI68762.1"
FT                   /translation="MIEELIQKAKILQSALPYIRKFYGKTFVVKYGGSAMLEESLRESF
FT                   AKDVLLLRYTGIKVVVVHGGGPQISAALEKFGIKSTFVGGLRKTDQETMHVVEMVLSGD
FT                   INKDIVALINKHSGEQIYAVGLSGRDGNLIRAKKLNKEEYFREIGLEVPREDIGFVGEV
FT                   LSVNTHLLQALMDNGYIPVIAPVGVGEDGQAYNINADIVASEVARYTKAEKLLFLTDTE
FT                   GIKDKDGKTISSLSREEAYRLISEGTIKGGMIPKVKSALRALQEGVGKVHIVDGRIPHS
FT                   ILLEIFTEEGVGTEIVNQRSMD"
FT   CDS_pept        302403..303023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68763"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG11"
FT                   /protein_id="BAI68763.1"
FT                   /translation="MDDVKVKASEYAELTGVSLNTVKNRIRAGVVRGGKEEDGIWYVYL
FT                   SQDEYHHLMRSQEKRGERQREINNSLEKLKASFEGQLIATYIEIQMLKDLQKEELLHEM
FT                   SSLYTLLAVREKEIQIMRNQLEEAEKALKEREESLKELQKKLAELEKSLRALENQLRDK
FT                   ELSLAEKDIQMQKMLLEKEKELLSKTAQIEQLKRELEIKGGKE"
FT   CDS_pept        303034..303900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0297"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68764"
FT                   /db_xref="GOA:D3DG12"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG12"
FT                   /protein_id="BAI68764.1"
FT                   /translation="MDKDHLLDTWKRSLERTKSARTVITYIKSLESFIKHIGEKDLIHI
FT                   DPRRIYEYVDTSSLNTSSILTHLSAIKHFYKFAFRRGYVDKEKYSDIESVIDEVREDLG
FT                   RNIAKRYPKALTEEEINKILSAVKGAKYEKIYVLFLYSGIRLSEYLSLRKSDFYQDKSG
FT                   LLWIRLSADITKRRKERLVPVLGSSKEETYAVIDRLLVWIESYEENFRVKRGSLQVFTN
FT                   RLSRKLCIPFSLHSFRHTYITNLVNSGFPAEVVKEFAGHSNVRTTIDIYYKFSQERARQ
FT                   LVENFLK"
FT   CDS_pept        303897..304643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="HTH_0298"
FT                   /product="tRNA guanine-N1 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68765"
FT                   /db_xref="GOA:D3DG13"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG13"
FT                   /protein_id="BAI68765.1"
FT                   /translation="MKFFVLTIFPEMIHVYAQYGIVKQAIKKGSLTIEVIDLRQYADKG
FT                   RVDDEAYGGLPGMVIKPEPVFRAYKSITERYGRPYTILPEPWGKRLVQQDLDRLSQKES
FT                   LAVICGRYEGIDERVKVLADEELSLGDFVLSGGEIFALALLEGVARLLPDVLSEPESLL
FT                   SDSFRRWLGYPVYTRPPEYEGLRVPDVLLSGNHKLIELWKLWHSIERTLTYRPDLIPED
FT                   ITSLERDMMESIKKGIKFEEWIKTRR"
FT   CDS_pept        304645..305562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0299"
FT                   /product="beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68766"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG14"
FT                   /protein_id="BAI68766.1"
FT                   /translation="MVVRALFTLLMAVFLAFSYEIKLRKVDKDIYMVRGEDALPSLKNG
FT                   GFISNAFAVYTEEGWVVIDTLSTPELSEKFLKELLKVKKAPVKYTIITHYHPDHWYGAK
FT                   TFKDAKAKMVAHKKLKELYDSGEAKAILEEANRSFNGLYDSVVLVPPDIVVEDKVRLKA
FT                   GSRTFDIISMTPAHTNSDIVVYMPDRKVLFAGDLVYYKRIPFMGDRNASSKGWEEVLRR
FT                   IKSMDIKLILGGHNEPMDKKAIDYTLGYITYLRENIRMMKQEGKFIDEIKQALSDSPYK
FT                   KDAMYQEFHNANIFRVDMELDLEP"
FT   CDS_pept        305559..306818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0300"
FT                   /product="putative 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68767"
FT                   /db_xref="GOA:D3DG15"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG15"
FT                   /protein_id="BAI68767.1"
FT                   /translation="MKVGVISLGCAKNLVDTEVLLGKLKAGGATIVSDPRRADVIVINT
FT                   CGFIEPAKMEAIETILEFAGSKKVIVMGCLVQRYKEELKKEIPEVSAYFGTESWDSIVE
FT                   FLNLRSNESKRIITTPSSYAYLKVSEGCNRLCSFCAIPLIRGRHRSRPIEEVVEEAKYL
FT                   ADQGIKELCIVSQDTTYYGKDLYAKPYLVELLKALEKVEGIKWIRLLYLYPTEIDENLL
FT                   SYMAQSEKVLPYFDVPLQHVSTEVLKSMRRGYDEAFVREFVEKVRKNIANAVLRTTFIV
FT                   GYPLERERDYQKLLDFVREGHFHWVGAFTYYQEEGTHAYALGDPIPQREKEERKEELLR
FT                   VQRDITYQKNLSLVGKSFELLVDGFDEEFGFVPVGRIYAQAPEVDGITYVESDKELKAG
FT                   DVVKVMITQVGDYDVGAKVL"
FT   CDS_pept        complement(306815..307372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumB"
FT                   /locus_tag="HTH_0301"
FT                   /product="fumarate hydratase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68768"
FT                   /db_xref="GOA:D3DG16"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG16"
FT                   /protein_id="BAI68768.1"
FT                   /translation="MEKRIFTPLTDETIESLKAGDRVLLTGYIYTARDAAHKRMVEALN
FT                   RGEAPPFDMKGQVIYYVGPTPPKPGQVIGSAGPTTAIRMDKYVEPLLKLGLKGMIGKGY
FT                   RSQLVKDLLIKYKAVYFAAVGGVAVLLSKSIKSSEVIAYEDLGTEAIRRLYVEDFPVIV
FT                   ANDIYGGDVFEEGRKKFAQIDP"
FT   CDS_pept        307415..308506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT1"
FT                   /locus_tag="HTH_0302"
FT                   /product="twitching motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68769"
FT                   /db_xref="GOA:D3DG17"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG17"
FT                   /protein_id="BAI68769.1"
FT                   /translation="MTPTAQSQEVKLIDLLVKTVQLGASDLHITPGAKPSVRIDGRITP
FT                   LAEYPVLTPEITQRLAYSVMSERHRKELEEKGQVDFSFGVKDIGRFRSNVFFQRNSIAG
FT                   AFRRLPYKIMSVKELGLTEKVLELCHKSMGLILVTGPTGSGKTTTLASLINYINENFPY
FT                   HIITIEDPIEYVFQHKKSIVNQIEIGEDVDSFASALRAALREDPDVILVGEMRDLETIE
FT                   IALRAAETGHLVFGTLHTNTAISTITRIIDVFPPSQQEQIRIQLSFVLQGVISQRLLPK
FT                   VGGGRVLAYELMIPNTAIRNLIRENKLQQVYAMMQSGQAETGMQTMNQSLASHYRAGLI
FT                   TLDDAFKYSPDVKELERMIGRSI"
FT   CDS_pept        308509..309732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC1"
FT                   /locus_tag="HTH_0303"
FT                   /product="fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68770"
FT                   /db_xref="GOA:D3DG18"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG18"
FT                   /protein_id="BAI68770.1"
FT                   /translation="MPRFRYRAFGEDGSFIQQEVTYPSHELLVADLQQKGFTIVEVEEL
FT                   EEKKKRELNIQLPFLGGVSDRDISIFCRQLGTMINAGVNIIDAINILAEQLPNKMLSDA
FT                   SKQVAKMVSEGMNLSAAMNRFPKVFPELVVNLAKVGEETGNLDVALIRAAEYYEKMAMI
FT                   KSKIKSASFYPIFVVVIATIIVTGILYYLVPTFAQMYESLGGELPLPTQMLVNASNALR
FT                   NNLLTIIGVILLFSAVFRLLYQRSYAFRKSVHTFMLKVPKMGELVLKSSMAKFARTMAT
FT                   LFASGVALERAFDIAGQVTGNLVIKESVERAKKRVIEGKPMHASLEETGIFPKLVIAMV
FT                   RVGEDTGRLDEMLDTIARFYEDEFDRAVEGMIKLIEPALMVFIGGVVGMILVALYLPIF
FT                   KMGELIKG"
FT   CDS_pept        309767..310864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0304"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68771"
FT                   /db_xref="GOA:D3DG19"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG19"
FT                   /protein_id="BAI68771.1"
FT                   /translation="MSLSVGIVGLPNVGKSTLFNAITESAKAQAANYPFCTIEPNVGVV
FT                   EVPDRRLYEIARLERSKKITPTFIEFVDIAGLVRNASQGEGLGNQFLAHIREVDAIAMV
FT                   LRCFEDPDIVHIEGSVDPVRDAQIIDLELIAKDLETVSKRLEKVEKMARIGDKKAKEEL
FT                   EKLSMLREILEGMEPVRRRELAQDVREYAERVLFLLTIKPVLYVANVDEEGLKGNEHLE
FT                   KVMGYARNEKAPVVAICAKLEAELVSLPAQDRKELLLAYGLEEPGLNRLVREAYKLLGL
FT                   ITFFTAGEKEARAWTIKRGTKAPQAAGKIHSDFERGFIAAEVINYEDYIKVGSISKAKE
FT                   MGLVRLEGRDYQIKDGDIVYFRFNV"
FT   CDS_pept        complement(310854..311897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0305"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68772"
FT                   /db_xref="GOA:D3DG20"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG20"
FT                   /protein_id="BAI68772.1"
FT                   /translation="MKILWLNGNPNPNFGGTEIHTLQMVKELKKEGIDVLLVCARDSYV
FT                   DKHTEGVEKYHISFPNSLALISTIRLTSLAKRRKVDFLIANNGKEYLNVLLAGRLSGCR
FT                   VVFFRHMEKMKQWAVRKLVFPHVDLFLAVSKHVKENLIKEGVNQDRIRVIYNVVDEGRF
FT                   YYQEKQKDPVELVFVGKLDEGKGIMDFLQAFYRLSQTDKRVRAWIVGDGRLRQKVRAFI
FT                   TERGLQDRVFTVGYTPKVEDYYRMAHICVIPSKETEAFPRVALEALACGCALVVSDIGG
FT                   IKEAVEDGQNGFVFKAGSIEDLTEKMALAVRRWIELSQNALSLYRRKFSRDKVVKDFIE
FT                   ALESLKH"
FT   CDS_pept        complement(311894..312574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0306"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68773"
FT                   /db_xref="GOA:D3DG21"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG21"
FT                   /protein_id="BAI68773.1"
FT                   /translation="MKVLTYHSIGMPPPEAKLKTLYVKPSVFKRQINTLRFLGYRFLSV
FT                   DHLLKGNAPRKSVLLTFDDAYLDFWENAFPLLKEYKIPAVVFVPAMLVGKFNQWDHQRV
FT                   NVKKLIMDWQQLRELTKAGIEIGSHSLTHPYLSKIPREKAKREIEDSKKLLEDKLGVQI
FT                   RAFCYPYGDYNHEVRDLVMQAGYLMAFTTKAGSFEQSENLFEIRRITVFGNDFILKLLL
FT                   KILL"
FT   CDS_pept        complement(312571..313386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stpK"
FT                   /locus_tag="HTH_0307"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68774"
FT                   /db_xref="GOA:D3DG22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG22"
FT                   /protein_id="BAI68774.1"
FT                   /translation="MDSTEEKNIILGTYQILSLLGRGTFGEVYKVRVLRGRYRGKMMAL
FT                   KVARNAEVLPYLWREVQTLLLFNHPHIISLQSYLYKKDRGELYVLYELMDVGDLKDYVV
FT                   SNGKLSEENALKVLLHVAKGLEFLHSRGYIHGDVKPENIFGKRVLRDVVWKLGDFGLVR
FT                   IRGSESIIDVKGTAGYIAPEVFRGEIHRSSDIFSLGCVLHFMLTGRDPFECEDRKEKLK
FT                   RNKEGACTIEDGLSERIKTLLHIMLSKDPTKRFRTAKELIEYMIRERLA"
FT   CDS_pept        complement(313388..314551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0308"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68775"
FT                   /db_xref="GOA:D3DG23"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG23"
FT                   /protein_id="BAI68775.1"
FT                   /translation="MSEFEFYLPVEVVFGAGCVSKVGQIARRFGFKALIITGKKSTKEN
FT                   GALDRVLDSLRKAGVGEVLVFDGIETNPTDKLVNEASQMAVREKVDFIIGLGGGSALDT
FT                   AKAVSIVSSNEGYAWDYVNYPEGPRLIPFLNRPVICIPTTAGTGSEVNRYSVISNPIRR
FT                   EKLVISHSLNYPRVAIVDPELTVSMNPRLTAITGIDAFMHALESFTNRAYNPLADELAI
FT                   RSAKIIKDWLPVAIEEPQNLKAREMMSYAAMLAGIAIDKKRVALIHAMEHPVSAHYPHV
FT                   IHGEGLAALAPAVTEFNHRGNPEKYGLFAEALGYPRKAFKAVDVVIDLLQKVNLRVSLK
FT                   SLGVRRESIEKLAEDVCLLSWNSFHLNPVEPSQEDIYRLYNRAYEGF"
FT   CDS_pept        complement(314548..314991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dksA2"
FT                   /locus_tag="HTH_0309"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68776"
FT                   /db_xref="GOA:D3DG24"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG24"
FT                   /protein_id="BAI68776.1"
FT                   /translation="MFTKEMLDNLRTKLLEEKAKILERYRKKEDTQARIGEEVKEPGDL
FT                   EDLSQMTYTQELLDTLSAREVFILREIDYALQKMQAGSYGICEYCGEEIPYERLQAIPW
FT                   TRYHAHCAEKVEEEGIVPTYPTPTFEGTIPEEMEIQREDITEA"
FT   CDS_pept        315049..316383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68777"
FT                   /db_xref="GOA:D3DG25"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG25"
FT                   /protein_id="BAI68777.1"
FT                   /translation="MYTLIQKHKTLLVFIVTVASGAFFLWLFFTGSVRDITSVGKKCVA
FT                   EVNGSCITLRDYRRELLRFSNIQSRDLEEVIKKQVIENLITQELLYQKARSLGFYASDE
FT                   EVVSVIKSDPTFQEGGVFSASKYKEMLARLGLEPGEYEDYIRRMLTVQKLLALVSNSVY
FT                   LSEAEKNINLAVQSTLLSGKLYIITPSDVEVSYTPTQEEMMSFYEKNKELFRRPEKKLV
FT                   RVWAEKDKAKVEEIYRAIKEGKQVQGYTEYLLPDDANRLPKGVSSEVSKLDQKDGILVT
FT                   KEGDEYLIVYLYRVEPAGIRSFEEVKEQIRSALIDKRKASLLRDKAQEIYKRLTEGKDV
FT                   SVKYLTFEDTPVDQIMSIAKVKEGQVVSFILSKQKVFGPYELSQGYGVFVITDRKKKPA
FT                   DEEEIKKLTQDILNMKSDATVNYLIEHLIRSAKIKINEEVIKGGA"
FT   CDS_pept        316383..317162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccl"
FT                   /locus_tag="HTH_0311"
FT                   /product="citryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68778"
FT                   /db_xref="GOA:D3DG26"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG26"
FT                   /protein_id="BAI68778.1"
FT                   /translation="MERIWKTGITQHIGHETYIRGYRLLDLVGNLSFAQAIYLILKGEL
FT                   PTERESRMMEAMLVSVIDHGIAPPSAIAARSVASGGNSLNVGVAAGVLAFGSAHGGALE
FT                   DAMRFIQEGVSSKRSVEDIVKEYLETKKPIPGYGHRYYKDFDPRTKRLMDIARVLEFYG
FT                   EHCKFAEDVAEEIGRQKGKKLVLNVDGAIAAIASEMGFDWRLGKGFFIIGRVPGLVAHV
FT                   YEELTTEKPFSKRLDEERDVEYTGSPPRELPQELKKI"
FT   CDS_pept        317162..317575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68779"
FT                   /db_xref="GOA:D3DG27"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG27"
FT                   /protein_id="BAI68779.1"
FT                   /translation="MQEFISKIYKNFLKLAFNITIIVLTVSLFIGIFRTVSEIGLTLSE
FT                   ATVRLGFKELVTNVLSLVVVLELIRAFIDFFEHERVRVDILLEVLIAFVIREFMLHLFE
FT                   GKMAGQDVFFWSFGIIFLIGARAISLFYRVPKA"
FT   CDS_pept        complement(317572..318876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="HTH_0313"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68780"
FT                   /db_xref="GOA:D3DG28"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG28"
FT                   /protein_id="BAI68780.1"
FT                   /translation="MKVRIGIVGCGVVGTGTVKLLLENAHIIKKKTGIDILLTKVADKD
FT                   WERPREIEVPLNLRTYDYMDVINESDIVVELVGGKTFAKSLILEALERGKHVVTANKRL
FT                   LAEDGFEIFKKAKEKGLYIGFEASVGGGIPIVKALREGLVANRINTIYGILNGTTNYIL
FT                   TRMLEDHMDFSHALELAQKLGYAEADPSLDIDGWDSAHKICILSMIAFGRYVPFEDVYV
FT                   EGIRDLDLLDVELGKELGYTLKLLAISKRTDGEIEVRVHPTFIRSEDALAKVSDVYNAI
FT                   MIEGDFVGKTMFYGKGAGSYPTASSVVSDIVDIAKKVLFCSKDHDEFQWENQPIGIGKN
FT                   FYSRYYIRFDVPDKPGVLAGVSRVLADYNISIASVLQKEKVCKLARREGEATVPLVILT
FT                   HKAYEKNMQRAIEDIKKLPIIVGQPVIIRVEEEAY"
FT   CDS_pept        complement(318889..319755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0314"
FT                   /product="putative serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68781"
FT                   /db_xref="GOA:D3DG29"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG29"
FT                   /protein_id="BAI68781.1"
FT                   /translation="MDQAQPYLNPIAYMFNFLWFFLLIFLFIIPVWRRFLLSRAREAII
FT                   EQLERKRGSRVITLIHRQESLALLGVPIFRYINIEDSEQVLRAIRMTPEDMPIDLIIHT
FT                   PGGLALAATQIANALSRHKAPVRVIVPHYAMSGGTLIALAADEIVMDHNAVLGPVDPQL
FT                   GQMPAASILKVLELKNVNEIDDQTLILADVAKKAIDQMIDYLVNLLKNNGMEEEKARRI
FT                   AQELATGKYTHDYPLSVEKLREIGLNVSTEVPEEVYALMDLFPQPMGSQVPSVQYIPVP
FT                   YKTHGMK"
FT   CDS_pept        319789..321117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HTH_0315"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68782"
FT                   /db_xref="GOA:D3DG30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG30"
FT                   /protein_id="BAI68782.1"
FT                   /translation="MKRERTQFVCQECGYSSAKWLGKCPSCGNWNSFVEESEHVLIKSY
FT                   REKPSVRSICEWEHEGLERKSVGFENFDRAIGGGMVPGQVMLLAGEPGIGKSTLLLQVS
FT                   DRYAQNYGSVLYVSGEESGSQIAVRGRRTGVKSKDVLVLPETRLEAVLDVAQELNPQLL
FT                   VVDSIQTLYTESLSSSPGSVSQVRECAFRITEFCKSRDIPVFLVGQITKEGDIAGPKVL
FT                   EHLVDTVLYFEGERFNFYRIVKVVKNRFGSSGEVAVFRMLDRGLEEVPEPSAFFLQERT
FT                   QSCGSVVFPYTEGSKPVLVEVQALTIQALYTTPQRRSQGYDVNRLSIILAVLEKECKIF
FT                   TRDRDVFVNVVGGMQIREPAADLAVALAIISSIKNKPIPDIVAFGEIGLSGELRAVHFA
FT                   DVRLKEAARFGFSRAFLPKSISIPVEGMEVVGIAHLRDALEIL"
FT   misc_feature    complement(321128..322630)
FT                   /locus_tag="HTH_0316"
FT                   /note="pseudo gene. This gene has an internal deletion."
FT                   /note="transposase"
FT   CDS_pept        322799..323011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="HTH_0317"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68783"
FT                   /db_xref="GOA:D3DG31"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG31"
FT                   /protein_id="BAI68783.1"
FT                   /translation="MNLEEVKVGAEVMIQDLIGKEEVLRRVEAMGLRRGRKVEVLQKVG
FT                   RVILLKLNNSRLAISRDIAKNIFVK"
FT   CDS_pept        323008..325068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="HTH_0318"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68784"
FT                   /db_xref="GOA:D3DG32"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG32"
FT                   /protein_id="BAI68784.1"
FT                   /translation="MKVLKKILRVALAGNPNVGKTSILNHLAGTTLKVGNWPGVTVEKR
FT                   EGKATYKDYTLILIDLPGIYTLEPVSEDELIAYRFLTEESPDVIVNVIETPNMERDLLL
FT                   TAQFLELGMPMVIVLNMMDEAQKLGIEIDTQRLEGLLGIKVVKTNGRTGLGVKEILSAV
FT                   IETYEKGIKPKEVRYSEEMEKILDALREEASESKHQLIKKLLSYREHAQKLERLYGKPA
FT                   YHIIRDNRFAFVHGLYNEVVKRKAITSMDITSLLDKFLLHPYLGMTIFLLVMFALFKVS
FT                   FDFSKPFMDWLDGFLNGFVSPFVRIELEKLGVENWVVRFISEALIGGVGFVLTFTPLIA
FT                   TIYLLLSFLEFTGYLPRIAFLMDRFMHRLGLHGKSLIPLLLGFGCNVPAIVATRTMESR
FT                   RDKLLVITMIPFMSCPARLVVFSFFAITFFSHPVLVIFSLYLLGILVAFFTAILLKKVA
FT                   FKGGLDHFVMELPPYRLPTLKLLLRIVWVYLKDFLYRAGTLIFAVSVLIWLSLNLPPGV
FT                   KTTQDSLAGRFGKLITPIFEPIGITDWRISTSLVPAFLAREIVLSSMATIYSVEKEETK
FT                   EFLPLQEAKKQVYALKDAAEEAFSSLINPLPKTFEVSEEHNTLRAAITKSMSGASALSF
FT                   MIFILIYTSCLGTVAVMWREAGRGFALGFLIYSFVMAWIVSFLVYRIGSLV"
FT   CDS_pept        complement(325162..326346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC2"
FT                   /locus_tag="HTH_0319"
FT                   /product="fimbrial assembly protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68785"
FT                   /db_xref="GOA:D3DG33"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG33"
FT                   /protein_id="BAI68785.1"
FT                   /translation="MALLYTGIDRQGNIRKGKIEAPDQSTAYRLLVSQGIKPIKIEKEK
FT                   SIWSRELIKRKPSDEDLSFALLQLSLLLSSGLNLTKALEMLAHQVEDKKISSAIASIKE
FT                   AIERGEPLHLAFKRVEIFPEFLVEMLKTAERGENLEEIFAIAGNFLQRISDIRSRIFSS
FT                   LTYPAFVIVLSILSVLVVVKFVVPKIATVLASFGKDLPLITKVLLFISKIIGYLFYLLP
FT                   AFVVLMVFGKRFVRKEKLHEISLKIPVFGKVFYYFNLSRFAGSLRMSIASGIPLTKALS
FT                   LSRGSITNSYMRNSLNNIEEELAKGKSLSEVLTRTDLFPPLFVNLISTGEKSGELERML
FT                   SLIEELYDREAMRTISFWIRFAEPLSMLIIGIIVAFVVFSVILPITELSAGIKR"
FT   CDS_pept        complement(326347..327813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0320"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68786"
FT                   /db_xref="GOA:D3DG34"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG34"
FT                   /protein_id="BAI68786.1"
FT                   /translation="MEDAQFFEGYTFDDILLIPQYSEVLPNEVDVSTQLTKRIKLNIPI
FT                   VSAAMDTVTESRLAIALAREGGIGIIHRNMSIEKQAQEVEKVKKSESGMILQPITVHPH
FT                   NTVREAMQIMERYKISGVPVVDADGMLVGILTNRDLRFLKTTDYDKPVSLFMTKEGLIT
FT                   AQERVTLEEAEEILHRHKVEKLPIVDKEGRLRGLITIKDIVKRKKYPNACKDEIGRLRV
FT                   GAAVGTGPDTKRRVEELVSVHVDVIAVDTAHGHSKRVLDTVEMIKSNFPQVDVIAGNVA
FT                   TREGVRDLIKAGADAVKVGVGPGSICTTRVVAGVGVPQITAIMWAYEEAKEYGIPIIAD
FT                   GGIRYSGDIVKALAAGASAVMLGNLLAGTEDAPGETIYYQGRAYKVYRGMGSLGAMMSR
FT                   YSSDRYGQENMEKFVPEGIEGRVPYKGKLSDVIFQLVGGLRSGMGYVGASNIRELREKA
FT                   KFVKITYAGYRESHVHDVIITKEAPNYWVE"
FT   CDS_pept        complement(327835..328320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68787"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG35"
FT                   /protein_id="BAI68787.1"
FT                   /translation="MVTLNLREIFKRRSKFTGFYRISPKELLLPADMGELMEPVNVYVE
FT                   ITKEKGGYRVHLEIEGSLTLECSRCLSLFARDMSLSEDIRIEPYPTKDIVHIKPKDLDV
FT                   SFFEDEESFDLVNLVREQIILSIPIKPLCDPQCKGIPLEEGQSIDIRFSALKKFIKE"
FT   CDS_pept        328367..329344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68788"
FT                   /db_xref="GOA:D3DG36"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG36"
FT                   /protein_id="BAI68788.1"
FT                   /translation="MNIVAIGGGTGLSSLLRGLKKEVGERVKSLSAIVTVADSGGSTGR
FT                   LRKAYNLPAPGDIRNCIVALSESEQIMQQLFQYRFKGGELEGHAFGNLFLIALTDITGS
FT                   FMMSIKIASQILRTKGDIIPATVGDVHLCAEFSDGKVVMGEEEITNYGKENKVRIKRIW
FT                   IQPEDTLTPIDAVGRIESADMITFGPGSLYTSIIPNLLIKDIREAVERSNALKVFIVNA
FT                   MTQPGETDGFTAYDHLMTFLKHSGIKKVDAVIVNTKMPSSSILKRYLDEGQEPVVPDIA
FT                   RIAREGFNVYAEDLIGDKEDFVRHDPDRLADLLMRVYYNYAVLP"
FT   CDS_pept        329328..330857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0323"
FT                   /product="L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68789"
FT                   /db_xref="GOA:D3DG37"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG37"
FT                   /protein_id="BAI68789.1"
FT                   /translation="MRFFLNFDTSKLSEEKVDVLVCGSGIAGLTTAITLRELGLKPVIL
FT                   TRGMGNTYYSQGGIACAVHPQDSPLLHFIDTYKAGRGLCHEMALRVLVDEGIQCISHLE
FT                   RWGVKFDTKDGLYETTLEGGHSFPRVLKVKDYTGRAIYQALLKKAQSLEIPIITGELQE
FT                   ILAYDGVKGVLYYDGSLKFLRVKALVLATGGAASIFLHTSNPVKVRGDAIGIALRCAVD
FT                   IKNPEFVQFHPTVVEGTNLLISEAVRGEGALLVDDKGERFVNELEPRDTVARAIYNKLK
FT                   EGKRVFLDMRPIKGGEKYLQERFPTIVEFLEKMGLDPRRDLIPVVPAAHYFIGGMEVDL
FT                   YGRTQIFGLYAVGECACSGVHGANRLASNSLLEGVVFGHRVAHRIYHDIKYFSFSASHF
FT                   KSEREAFLKPPYSFDHLRKLMWDACGLEREEGELLQAIEILKSWLKDMEKWEDTIQNRE
FT                   LLDITLVALSTLKASLSRRESRGVHYRRDYPYEREELRRDSLVKLEELLGL"
FT   CDS_pept        complement(330843..331145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68790"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG38"
FT                   /protein_id="BAI68790.1"
FT                   /translation="MSCMKYLMLFVMIFTLGCATVNKKLDPKAKLFYERGYEGQMDFKV
FT                   LVKDEPCKERIRSSYRVKVEGGDFLVLTLTHSELKKLLQDDCITFVSATQRLEPK"
FT   CDS_pept        331178..331609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0325"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68791"
FT                   /db_xref="GOA:D3DG39"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG39"
FT                   /protein_id="BAI68791.1"
FT                   /translation="MLQELIATGFFVGRFRYAPGTVGTLLGIPLVYLFAFKWWLVAILG
FT                   IFLYLVGFWACSYVVDMRKESDPEDVIIDEVLGYFLSYMLIEPTLESILVGFFTFRLLD
FT                   IFKPYPINLFEKLPKGHGVMADDAIAGLINSVILFFLFH"
FT   CDS_pept        complement(331589..332359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="HTH_0326"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68792"
FT                   /db_xref="GOA:D3DG40"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG40"
FT                   /protein_id="BAI68792.1"
FT                   /translation="MFKSIKYILYTIYISITEGYTYHASSLTYSFIMVLGSLILFSSFL
FT                   ASFLPFFDFNKIINYAVLLFPEQAERVILEILKVYQHRTSGSILSFTVAYFFSVSFSKS
FT                   LYRAFLYVLSEARSEKEWVFWVKTPALVLLYTLCLSLLFFLNSFLKVYLGNYNAYLFYF
FT                   INLLTFWVLIFLTYTLFLPRKYSFKDVYVGAMLSSCALLLFNKLFSAFVVKLVALNPLY
FT                   SFMGSILIFFIWVNLSFSVLLAGAKYIQLMKEKE"
FT   CDS_pept        complement(332352..333455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kamA"
FT                   /locus_tag="HTH_0327"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68793"
FT                   /db_xref="GOA:D3DG41"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG41"
FT                   /protein_id="BAI68793.1"
FT                   /translation="MRRFFENIPKDLWRDYGWQIKNRLKTREDIQKYIKLLPEEVEGIE
FT                   RTKGIYPLAITPHYFSLIEPEDPNDPIRLQCIPRREEVDENAQRLGEPDPFREEGQVPG
FT                   LTHRYRDRVLLSVTTFCAVYCRHCMRKRIFAQGERSRSTEELRKMIEYIKEHEEIRDVL
FT                   ISGGEPLSLSYEKLEYLLSQLRKIKHVEIIRFGTRLLVLAPQRFFDNKLLDILEKYSPI
FT                   WINTHFNHPKEITEEAEEAVERLLRRGIPINNQTVLLKGVNDNPQTMLELFRGLLRIKV
FT                   KPQYLFHCDPVKGAVHFRTSIDKGLEIMEYLRGRISGMGIPTYAVDLPGGKGKVPLMPN
FT                   YIINREGDKFTFRSPFGDVVEYEITDV"
FT   CDS_pept        333479..334705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="HTH_0328"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68794"
FT                   /db_xref="GOA:D3DG42"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG42"
FT                   /protein_id="BAI68794.1"
FT                   /translation="MDRIFVWGINFKTAPVEYREGLACSREETAYLLSILKTIKGVEEL
FT                   ILLSTCNRVELYAVAQEYACMENLVNTLLELKGASWDLKRYSFLLQGKEAIHHIFKVAS
FT                   SLDSMVVGETQITSQFKDAFSIARNVGTVGKVLHRLYEKALRTAKRVRTETGISKNAVS
FT                   VSYVAVDLARKIFGNLKKAKVLLVGAGEMGELAARYLKKLQASLSITNRTYEKSVDLAR
FT                   ELEGHALRFESLEDYLYEFDIVILSTASKEPILKKDMVKKAIKLRNYKPMFIIDISVPR
FT                   NADPSINDLDEVFLYNIDDLRSIAEKNLSERLKEKEKGEIIVWDEVEKLVKWLELLKVE
FT                   SYIIKIKNRWKDVEAREPAVRKLIHSVIEEIRKQPSSAERLFKIFVQEVDDGDTFRGLS
FT                   YVHNRADGA"
FT   CDS_pept        334650..334949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0329"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68795"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG43"
FT                   /protein_id="BAI68795.1"
FT                   /translation="METRSEGYPMSITELMELESEYSIKAYILIKADPREIPSIMLALS
FT                   TFDGVKTADVVTGPYDIIVFAELRNQDELGRLVINKIHSLEGVREALTCVVVKI"
FT   CDS_pept        334946..335119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68796"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG44"
FT                   /protein_id="BAI68796.1"
FT                   /translation="MKYPQILEYEDRIVVIYSADEPNYTEEDDGVILFYSKKGDVVKII
FT                   IKKDEKHHIIYF"
FT   CDS_pept        335091..336380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="HTH_0331"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68797"
FT                   /db_xref="GOA:D3DG45"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG45"
FT                   /protein_id="BAI68797.1"
FT                   /translation="MKSITSYTSDYLVIEGGHRLVGKVRISGSKNASLPIMMSSLLTDD
FT                   VCYIEDVPDLLDVRSTIELLQVFNAEVSYHQGKLRLDASKIKSFIAPDYIVRRMRASVL
FT                   AMGPLLGRFGKAVVAMPGGCSIGVRAIDQHLKVFERGGARINVQHGYVHLEVDKIKPVE
FT                   YTFEVVTVTGTENALMFLSRCEKRSILRNIAIEPEVMDLVEVLRSMGVSIEIDGRTAIV
FT                   RGSRELKGFAHRVIPDRIEAGTFLVAGFITGGDIELENVRVDHLGSVIEKLREAGACVE
FT                   VSSDRIRVYSNGGGIKPLSISTSEYPGFPTDMQAQFTSMCCLAEGLSEITENIFENRFQ
FT                   HVAELQRMGADIHIRGRTAFIKGVKKLTGAEVFSTDLRASASLVLAGLVAEGKTVVRDI
FT                   YHLDRGYERLDEKLKSLGAPVERHSITDVI"
FT   CDS_pept        complement(336373..336804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0332"
FT                   /product="small heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68798"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG46"
FT                   /protein_id="BAI68798.1"
FT                   /translation="MRRSIALWNPFAELERIRREFDRLIEEMWPREEVERAFAPAVEMY
FT                   ETDNEIVVKAELPGVKKENIEVSIKDNTLHIRGEKKEEREEKTETIHRLERVYGKFERV
FT                   LTLPVDVKAEEVKAEYKDGILEIRLPKSEVSKEKKIEIK"
FT   CDS_pept        complement(336935..337522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="HTH_0333"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68799"
FT                   /db_xref="GOA:D3DG47"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG47"
FT                   /protein_id="BAI68799.1"
FT                   /translation="MRVKLTDKDALIVVDMQNDFMPWGALPVPDGDKIVPKLNAYIDIF
FT                   SSRGLPVYFTRDWHPPDHISFLENGGVWPPHCVQNTEGAKFHKDLRIPKDNKFIISKGT
FT                   SRDFDAYSGFQGTMLDSLLQERGIRRVFVGGVATDYCVKNTVMGALNLEYQAFLLIDAT
FT                   KGVDVKPGDTERAIDEMLSSGAVAIEFENLTA"
FT   CDS_pept        complement(337528..338172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0334"
FT                   /product="sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68800"
FT                   /db_xref="GOA:D3DG48"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG48"
FT                   /protein_id="BAI68800.1"
FT                   /translation="MRFPSLVSGEFVKRINRFVCVVRIKDKEHFAYLRNTGRLSELLKE
FT                   GTCVYLKEKDKGKYSYELLLAEGEKGILVCLDSQIAPKLYAEGLPAGELVYEPKVVGGK
FT                   LDLLVGKELIEVKSVNLVRDGIALFPDAPTQRGSRHIDLLIKAYPKYTPKMVFVIQRED
FT                   AYAFSPNREMDPIFANKLKVFKSLGHRVVAYNCKVSLEEIKLKEEVEVLWR"
FT   CDS_pept        338393..338953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0335"
FT                   /product="gliding motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68801"
FT                   /db_xref="GOA:D3DG49"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG49"
FT                   /protein_id="BAI68801.1"
FT                   /translation="MVKSGTFGKSSFSLSSRSLREGFFSSFSFLEKLKEIYSSCVYDRL
FT                   HQQTREGRTVYLDVLSLKLKTRLEGVELMVSLFTTPGQKRYSILRPWLFGHTFAVVFVF
FT                   DSSRGVEENLESFREIKDSDKVVVQANKRDAEGAVPLEEIKRIFENYTVIPAVAKDGVG
FT                   VIETFKEALRIALHGAGKAFRPS"
FT   CDS_pept        338922..339392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68802"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG50"
FT                   /protein_id="BAI68802.1"
FT                   /translation="MVREKLLDLLKRAKPTLGPISRDAVNLSWILEMHSWSLQTGVYTF
FT                   QSLERSSLLPMVDGHLLGSLEDSFDMLSFYRTTKNALVHTFKLSIPLELPLRKANPIWI
FT                   NLESLSFNLKEFFRKIEDFGTTGFVEVEDRIKKERGYIFLYNGLVVSAKVGE"
FT   CDS_pept        339400..340188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68803"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG51"
FT                   /protein_id="BAI68803.1"
FT                   /translation="MKRILRSLSENACLLNIYELNHITLEFLLSKPKLLSYFWDFEEAE
FT                   RFLKEISKRHASLTALLVSVSLYEYGYRMYMDGEVIYEEGFDTEALFFEIYVIKSFMEL
FT                   NFLKPEDYISEHEKIKVLKSDEKSTIIYFCPACWSIVSQKDITCPNCGYDLTEFHNMPY
FT                   EYKLLMGLEHPVVEMRMNVIHTVGVKDLKEAMPQLEYMINRESNPMLLMAVVDALAKMS
FT                   HPEALELLRKLAHHTYPIIRSRAKYALEKRLTGGRRSPAV"
FT   CDS_pept        complement(340157..341092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="HTH_0338"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68804"
FT                   /db_xref="GOA:D3DG52"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG52"
FT                   /protein_id="BAI68804.1"
FT                   /translation="MSKIGVVLLNMGGPDSLSAVEPFLYNLFSDHDIIEIPRLIQKPVA
FT                   RLIAKLRAEKTKHYYEVMGGKSPQREQTEQQAKALQNVLGENYKVVVAMRYWHPFTEEA
FT                   LRELFTEDISKIVLLPMYPQYSKTTTGSSFNEFERVFKRFPQVPVIRIISYHNHPAYIR
FT                   AMVENIKEHLQSWESYFFLFTAHSLPVQVIKRGDPYKDQTEETVKLIMEHFPEVSYALG
FT                   YQSKIGPVKWLEPFTDKLIEELIKSGVKRLALIPVSFVCEHSETLYELDVQYKSLAESL
FT                   GVESFVRIPTLKDHPSFIEALRQLVISSLQ"
FT   CDS_pept        complement(341085..344549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="HTH_0339"
FT                   /product="chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68805"
FT                   /db_xref="GOA:D3DG53"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG53"
FT                   /protein_id="BAI68805.1"
FT                   /translation="MGAWIEKIVVEGFKSYGKGRVEIPLGPGFVGIVGPNGAGKSNIGD
FT                   AISFALSLATAKTLRAKNLSYLIYTKDSDSSHHAYVEVHFKNEGTFPLEDSIIVISRKV
FT                   DKDGRSIFRINGSVIRERDLKDLLAKAGLYENAYNIVLQGDVIRFLRMTPVERRKLIEE
FT                   VAGIGEYEEKKQKALADLGEVELKLREFRLLIDEMEVQMERLSEDVRKLRRYRELENTL
FT                   RDLHIKLLMKEAKATSQSIENLQALIEERKKELLEIREKLKVLELEYQQREEELRSVND
FT                   QLLPFREKLGKISSDIEYLEKSIKEAIKKREETQEEILRSESHLRSLRANLETLLEEEK
FT                   HINSLITQKERQISAKEEEAKALYSALKSKEERLKVSLEEAQATQEKISIIRKDLDSKK
FT                   RLLSSIDIKLREMDLKRERIMEEMQRLREEKEKLKSQMGENILKMENYRKMQKEEEVSL
FT                   RKKKQELESLEERLRRIRKEREELIKEKAMLEAKLMSSEGDTLPFEGIEGVYGRGSELI
FT                   RVKDHEYIKAVESAGGARLSYVVVEDENVAKACIERLKEVKGGRMNFIPLSRIKVPSLP
FT                   PYPRRKGFIDFVVNLVEYDRKFEKAVRFIFGDTLLVENFQSAKDLGIGTYRMVTLEGEV
FT                   FEKSGVISGGDAQSKGELGREFYAKEVDRLSLMEKRLKDEEEQVERLLKTVRQELIEKE
FT                   GVLKILERRLKDTEESDKMSFERIKEMEDKLRKSQEYLEVLAKEREGLLKEREALGQEV
FT                   FYLEEKLNNLLIKKQSILEHYRESGIESLRESYERELKNLDKLKEHLFSLNMKLKDVQK
FT                   DLQNLQMEIKRKMAFLESAAGAVKEAEERIKKLKEEKAKLEESVKDLERTAYELYSKRD
FT                   KLEDVCRDLQASIGGLRMQEETKREELAKYEMEKAKLEEKLNETTKKLRDLEFFGDVQD
FT                   VKEGYTKIKEVMEKVRKQMEELGTINFKAEEDYKEYEARHRDYTERYQRLNQEKKAIRD
FT                   MIEEIEAKKLNAFTEAFESINESLKKVFAELSPGGKAYMQVEKPEDPFSGGINLVVKPK
FT                   GKEVQYLEAISGGEKTLVALSLIFAIQDYKPSPFYYFDEVDAHLDEANAKRVGQLIRKR
FT                   SQKAQFIVVTLREVLASYADKLIGVSMRGGVSKVFPVKNMLVEVSNE"
FT   CDS_pept        complement(344556..345701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0340"
FT                   /product="putative fructose 1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68806"
FT                   /db_xref="GOA:D3DG54"
FT                   /db_xref="InterPro:IPR002803"
FT                   /db_xref="InterPro:IPR036076"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG54"
FT                   /protein_id="BAI68806.1"
FT                   /translation="MRITLSVIKADVGGYVGHSGVHPQLVETIKEFVQEEVKKGILIDA
FT                   SVLVCGDDTAIVMTHTHGVDSEIVHGIAWRAFEKATEVAKKLKLYGAGQDLLSTAFSGN
FT                   VKGMGPGVAEMEFEERPSEPVIVFFADKTAPSAWNLPLYEMFADPMVCAGLVIDPKMHD
FT                   GFTFEVLDTYTGKAVKLSTPSELYELLALIGTVERYAIRSVWRNNDGEIAAVASTQRLS
FT                   LIAGKYVGKDDPVMVVRAQAGFPAVGEILEPFARPWIVEGWMRGSHNGPLMPVSFKNAT
FT                   PTRFDGPPRVIAAGYQIAEGKLIGPRDLFDDPAFDKAREQAQLMADMLRRQGIFEPHRL
FT                   PSEEMEYTTLPKILKKLEERFYELEAPRKAVEDPVEKHDID"
FT   CDS_pept        345743..346951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68807"
FT                   /db_xref="GOA:D3DG55"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG55"
FT                   /protein_id="BAI68807.1"
FT                   /translation="MREALKVLFLIVSYNFLLEYVSSKLPLPVRLFPEDIHSFVMLLSF
FT                   DSALYLAWLFGYRSTTLLWLAYLFFFQILGISFIDGTYTPIAEYTPSFLITLLFLRFSE
FT                   SPTERRTREIKEEIKKLERELEINRGELETLRQQVKLSEDLILHLNKEKAMIEEKLNEL
FT                   RDSQMAEGQALLKERDQLAEKIRQAEISLSEYKNKLERITEANRKLFELLEILQRREEG
FT                   SQKGEIAQLRKERKKLVKEVLELRSLWESSEREKAQLKLEVLELKSSLEKLQRERDLLE
FT                   LELQELKSKMLSKEEVYREVLGFVLDNIEMEERALREFISLPVDKKREFMKELLLLNMK
FT                   GRDESLEAMKGLKNVFKLKPRGGRIYFTFGQKLRWKVLGLIASEDDKDKDRYAKEILVK
FT                   YMQ"
FT   CDS_pept        346973..348193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0342"
FT                   /product="peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68808"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041374"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG56"
FT                   /protein_id="BAI68808.1"
FT                   /translation="MKSLKASLDTLTSFKPDKYMVISLYLKLSPEERADRKYLLTFKSM
FT                   VKKQKEYLTKRDLDAQVLQSLMEDFSRIEAYLSEIDNLKGCRGIAVFSSSRRGLFEVIK
FT                   LPYVYRDRLMIAPNPQIREIAAIDEELGKIGILLIDRKHVKFYLMDLEGAYEVMDFLEP
FT                   LVTRSHKFHSGGGLLKGAQGAMKYAMPSRTSAPNMVQHSYGEYRFHMRIREEKHRLFKL
FT                   ANDALMEAWKEHKFDKLVIGSDREDVKEIENHLHPYLHKIFMGYVQVNPTEVTDTKLKS
FT                   TVIDFLLQKDREQEKELIKQLEELQGRGLATNGTSHVIEQLAVGNVRMLLVPDGFEKPG
FT                   YLCSQSHLPSLKPECPIEGELVYEVPDIVDEVIELALEERALVKVIVDPQLQKKIDGLA
FT                   AFLRFPL"
FT   CDS_pept        348190..348789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68809"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG57"
FT                   /protein_id="BAI68809.1"
FT                   /translation="MIDERVIIFIDGSNLFHAIRYLNIRIDYQKLVDFLTEGRRLIRAY
FT                   FYGAMPHEKDVKKNTPEWESLLRQKRFLEELSLMGIKVKTAHLKKLPSGEYVEKEVDIM
FT                   LATDMLSMAYMNTYDTAVLISGDSDYSYTVEEVQRIGKKVENASFKRTSSYQLRKACDR
FT                   FILLDDYLDRFLVEEKPAITQETSFWERIVRIWKRS"
FT   CDS_pept        348786..349727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="HTH_0344"
FT                   /product="riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68810"
FT                   /db_xref="GOA:D3DG58"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG58"
FT                   /protein_id="BAI68810.1"
FT                   /translation="MRALSLKWDSQCVKSLECVENIQESTAVTVGNFDGIHLGHRFLIE
FT                   KLKEEAKKRNLKTLVLSFHPHPLKVLSPKQSPCELTNLEEKLNLLEALSIDYAVFIRFD
FT                   EKFSLMKADDFIREILYKRLSAKFLLVGYDWRFGYRREGEIELAKELGEKLGFEVMSVE
FT                   PFKINGHIVSSTLIRRLLHSGRLEEAQVYLGRHYWVKRKVVKGDGRGSSIGVPTANLEG
FT                   TENLCLKEGVYAVLVEESLLGVANYGYRPTFGGRRKVLEVHILDFNENLRSKKIKVEFV
FT                   KFLREEKKFNSLEELKKQIKQDIELTRSLLLG"
FT   CDS_pept        complement(349701..350006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68811"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG59"
FT                   /protein_id="BAI68811.1"
FT                   /translation="MDMLKEEDIVARSVSIEVVGEIHRCKEGPSSRFYCLPVVIHFDNG
FT                   EKRAYMLKAHSEPKTLQDFLENKKGLKDRMEKSFALLKNGEIRYASYLLTQQETSG"
FT   CDS_pept        complement(350012..351568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0346"
FT                   /product="sigma 54 specific transcriptional regulator, Fis
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68812"
FT                   /db_xref="GOA:D3DG60"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG60"
FT                   /protein_id="BAI68812.1"
FT                   /translation="MDFNILEHLFDAVLVIDKDRRVIYANSSAKGLIGDAKEGESCKGL
FT                   FSICSHCPMSYVEEEREGLQVYDARIRNGKHVCWSMTPLFEKGDFVGVIEVFRDVSNVV
FT                   SCILEAERQKAYKEAIFNSIVEAILVLDTQGYVVEHNQIAKRMLCREEEENLTGKYIKE
FT                   LVNLDLEELPPEGERADVYINTPCGKQKASVLLSPMQSGFGYIVSLYVVNEVAVCGFGE
FT                   EMIITKSSAFQKVIDLARACAEHDVNVLIEGETGTGKSLLAKYIHNLSPRRAGPFVKIN
FT                   CAAIPDHLLEAELFGYMRGAFTGAVRDKPGKVELAEGGTLFLDEIGDMPLHLQAKILHL
FT                   VQEKEFERLGDTKVRRANVRIISSTNKNLRELIKKGLFREDLYYRLGVVKLQVPPLRER
FT                   KEDIPLLINHFLEKYSKAYSRKIKGVSSEAMKLLLSYHFPGNVRELENVIERAIITCKG
FT                   SVINVEDLQLEFQEQVPQKEEDREKIRQVLEQTGWNKSLAAKVLGMHRTTLWRKMKELG
FT                   L"
FT   CDS_pept        complement(351577..351963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0347"
FT                   /product="sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68813"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG61"
FT                   /protein_id="BAI68813.1"
FT                   /translation="MYAFLSEEWIKAYADEWNRNEKLRSDLKDFSARIKYYIEGSEDRA
FT                   VELVVENGVAKSVGLANSHSYDFELWASLENWKKMASGDMGPKAAMLTKRLKFKGSMIT
FT                   AMKYMGAFEESLRMMGRIPTNWNL"
FT   CDS_pept        complement(352012..352347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68814"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG62"
FT                   /protein_id="BAI68814.1"
FT                   /translation="MANLDRLMQVKGVWAAGEFSPDGKLIAYKGNISEEHAAMAAKMCA
FT                   ANTLMAEMQAEGYTAFSGQEWVPLIGWALSGPKYSVCVVGNVGVFVKNDEVSFNEVFKA
FT                   LREVAGK"
FT   CDS_pept        complement(352363..352704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68815"
FT                   /db_xref="InterPro:IPR018685"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG63"
FT                   /protein_id="BAI68815.1"
FT                   /translation="MATISKLKELMSLPGAVAAGEFADDGRLIAYYGDIDEKSAEIAAM
FT                   MCAANKLMGNMQAKGWSAYTGEGGFYPVLGFAVAGGKYAACIMGNVGVFVKLDQADFDK
FT                   VFETLSKYI"
FT   CDS_pept        353298..353723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68816"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG64"
FT                   /protein_id="BAI68816.1"
FT                   /translation="MSIKEYLTDEHRECDKLYAKVESLVQEGNWGQAEEAFRAFKDANL
FT                   LHFKREEDVLFPAFEETTGVVMGPTQVMRMEHAQARDLMDRMEKAIKEKDKKSFLSLGD
FT                   TFVVLLQQHNMKEEQILYPMCDQHLVADEVIEKMKQL"
FT   CDS_pept        353720..354898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68817"
FT                   /db_xref="GOA:D3DG65"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG65"
FT                   /protein_id="BAI68817.1"
FT                   /translation="MTGLSIVQAPPFIIVFSYFLTATLFGFLLSTFEIYMAFKHTLFPP
FT                   PIVHLYTLGFALFTMFGALFQMLPVVAGVVIKNPKPKAAVSYVLLITGIPTLLYGFYTG
FT                   KFLLFGSLMTYVGILYTSLLMLYHLLGIKSFTPTSRGMKFSLVFLLLGATAGFYRVLSY
FT                   YGYLPAFEENLIIHYSILLFGWIGLLIASVSFQVVEMFFITESYGKRFSMNYPIMVLLF
FT                   LPLSFLGGFFSLPLSLLFIIYSLMTLKRLIRRGRKMEDYTLYFWYLGQISLIFSAILLV
FT                   FKERFLIQFLFFYAVFFTSIIMGMMYRIIPFLVWFHMSNEGGANIPLMSEVIPPERIKL
FT                   SFYLHLAWVVLTSIAYVLGDFYVVASFIHFISSLLLLYNIYTGGIVYFKTQP"
FT   CDS_pept        complement(354882..356696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0352"
FT                   /product="potassium transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68818"
FT                   /db_xref="GOA:D3DG66"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG66"
FT                   /protein_id="BAI68818.1"
FT                   /translation="MFYGVKSVIRAMGAVFGDIGTSPLYTFSVIVLLTKPTQQEILGIA
FT                   SLIIWTLIILVTVQYAWFAMNLSIKGEGGTVVLGEIAKSLTNNRKLRNFYRVLVFIGLG
FT                   FLLGDGVITPAITILSSAEGVRLIPGFENIHQSEVILIAIAITVGLFLLQPKGTGKIGD
FT                   YFGPVMLLWFATIGIIGFYHALSYPYVFYAVSPHHAIEFLINHPIKGFIALSEVLLAAT
FT                   GGEALYADMGHLGRISIRRAWAFVFPMLVLNYLGQASYILTHQDKEHQAIFFESARSLL
FT                   GDTLYLPFLVLVMCAGVIASQALISGAFSIVFQAINTRIAPLLNIKHTSTEISTQIYIP
FT                   VVNWMLLAGVIFMYFNFKTSENMASAYGFAVSAVMVITGFFLTFIHFMKRQVFFFIGSV
FT                   LLLLIDITFFISNFYKIPHGGYWSVIFALIPLSVMVLYTAGQSKLYKSMKFTPFREFIL
FT                   SFENLYLQNPKIKGTAIFLVRDLKNIPPYVTQTFFDHGILYEDNVFLSLVKKDEPFGVE
FT                   TFLKGSIAQGLRLVEIRYGYMEVLDIDRELREAGIWERAIFYGVEDIYTNKLLWKLFSF
FT                   LKRVTPSFVEFYRFPHGKLHGVAVRVEF"
FT   CDS_pept        complement(356698..358488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="HTH_0353"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68819"
FT                   /db_xref="GOA:D3DG67"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG67"
FT                   /protein_id="BAI68819.1"
FT                   /translation="MLKRTKYCGQVSEEDIGKELILCGWVHRIRNHGGVIFIDLRDREG
FT                   IMQVVVEERTSPKAYEIADSLSSEYVIAVKGSVRRRPPGTENPKLKTGYYELLAQEIEV
FT                   LNTSEPLPFPVDEETPVSEELKLRYRYIDLRRESMKESILFRHKAYQIIREVFIKHGFV
FT                   EIETPFLTKSTPEGARDFLVPSRLHPGKFYALPQSPQLFKQILMVAGFDRYFQIVKCLR
FT                   DEDLRADRQPEFTQIDFEMSFVEEEDVISFSEELICKLFRELLGIELKRPFDRMSYKDV
FT                   LERYGTDKPDRRFGIELVDLSNIFKNTEFKVFKDALQSGGSVKAINFKNSHLSRKEIDE
FT                   LTKFVQTLGARGLAWIKVEDGKLNSPITKFLSDEEIKNLLEKTSANEGDTIFFSADKQD
FT                   MAYKILGSLRLHIAKKYQLLRDNTFDLLWVVDFPLMEWDEEEGRFVSLHHPFTSPKEED
FT                   LPLLEEALKSQDLEEKKQLLKRVRARAYDLVINGYEVGGGSIRIHRREVQELVFKLLGI
FT                   SEVEAEEKFGFLLRALRYGAPPHGGLAFGLDRLIALMRGLDSIRDVIAFPKTQKGICPL
FT                   TGAPDYVSPKQLKDVHIKLE"
FT   CDS_pept        358513..359052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HTH_0354"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68820"
FT                   /db_xref="GOA:D3DG68"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG68"
FT                   /protein_id="BAI68820.1"
FT                   /translation="MPYVSIKGKKLKLLIDEERIKSRVKELATSIETDMGESFIAVGLL
FT                   KGSFIFLADLIRHINLPVKVDFMWVSSYGSKTISEGHIRILRDLSMDIENQKVLLVDDI
FT                   LDTGYTLKEIKQILMLRKPKVLKTCVLLDKYERRKVDVEVDYTGFRVPDAFLVGYGLDW
FT                   DEEGRNLRGIYAVEGL"
FT   CDS_pept        359062..360342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="HTH_0355"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68821"
FT                   /db_xref="GOA:D3DG69"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG69"
FT                   /protein_id="BAI68821.1"
FT                   /translation="MKVEDLRNTAWRFNERLRYIAKRGEVLEEEYEPIVREIIKRVKEE
FT                   GDKAITYYTEKFDGVKLTPDTMEVPYEELENAYNEIEEDVRSALEIAYERIRRFHELQR
FT                   EKAFFMEESGTLLGMKVVPLERVGVYVPGGKAAYPSTVLMNVVPALVAGVEEIIMVSPK
FT                   PNKYTLAAAFISGVSRVYQIGGAQAIAGLAYGTEMIPKVDKIVGPGNIYVAIAKKLLFG
FT                   VVDIDMIAGPSEILIISDGSCEPSWIATDLLSQAEHDEMAGAFMITTDEKHALRVKEEL
FT                   ERLMEDFPRKEIAKKSIERFGTIFLVEDMFKACEVANYIAPEHLEVLTEDPFSLLPYIK
FT                   HAGAIFLGRYSTEALGDYILGPNHTLPTGGTARFFSPLGVYDFIKRSSVLFVSKEGFER
FT                   LAEPTESIAKAEGLFAHFTSVRIRRET"
FT   CDS_pept        360339..360896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68822"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG70"
FT                   /protein_id="BAI68822.1"
FT                   /translation="MKRVFLVCLLMLSYACAPVVCPGEKEVRSRYSEDTAPKNYEAFTS
FT                   LRYGILRVPIYIEKSEGKYTIRSPQTGTVFLKDSNLCVNATCLDLPVNPDGLIFGALLR
FT                   GDEKPSCSFGTITFERDDQMYKRKYIFSNGELKRVELTDKNRDRILILEYGDRSKEGYY
FT                   KRVKASLGDMTFLFSVDELKRR"
FT   CDS_pept        360901..362067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0357"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68823"
FT                   /db_xref="GOA:D3DG71"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG71"
FT                   /protein_id="BAI68823.1"
FT                   /translation="MSFEYSERIKSLPPYLFAQIDKKKKEKIAQGVDVIDLGVGDPDMP
FT                   TPEPIVKAMQRAVEKPEHHRYPSYEGMLSFREAVAEFYRRRFGVFLDPEKEVITLIGSK
FT                   EGIAHFPLAFINPDDVVLCPDPAYPVYKIGTLFAGGVPYIMPLKEENNFLPDFKSIPKD
FT                   VLKRAKIIWVNYPNNPTSAVADESFYRELIDWARENNIIVASDLAYSEIYFGNQKPMSI
FT                   LQIDGAKEVAIEFHSLSKTYNMTGWRIGMAVGNEKLISGLGKVKTNVDSGQFQAIQEAG
FT                   ITALKMPESELQKIREVYRQRREAMVKALQDAGLEVYSSTATFYLWVKVPKGYTSAQFV
FT                   SLLLDECGIVCTPGNGFGEHGEGYFRISLTLPTERLLEAAERIRKLKI"
FT   CDS_pept        362064..363347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68824"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG72"
FT                   /protein_id="BAI68824.1"
FT                   /translation="MMKEVELLQLCTLVPTVDYRMTPQEALKLFNEHELHEFLVVVKDG
FT                   KPVGWVKKKDVRLALYRQELCVGDLTRPLTNIRNLKTTVDNMSGLFDFFNLRKDPLIVV
FT                   NRNGSYMGVLFYHVLLNYVCMHREAEASLFQKLRNFFGQAYYLYVFFLKGKKTFREAYG
FT                   TVKEEGLYKILYEDIKDSISGDVSLVKDEGEVYALSKEKLQRDKIKEIIENFHKEFSLL
FT                   YADAKPVYVQGYLIPLDTVKNYEELFRIASDTKDKLRGVDASFFVIHGLQPSVIMCEYK
FT                   AKELILKIKEQITEDFKRILERINREDRELWEYVLYDFFKEYPYFELFYIMNERGVQIS
FT                   NNVINPKISYSIKAGKKGADRSEKSYFKQAMKDGTYISDIYISQATDDFCITLSARFQH
FT                   KDKTYVLAGDINYREIHQLVKSYTKASL"
FT   CDS_pept        363344..364471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuC1"
FT                   /locus_tag="HTH_0359"
FT                   /product="acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68825"
FT                   /db_xref="GOA:D3DG73"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG73"
FT                   /protein_id="BAI68825.1"
FT                   /translation="MKKLVGSLKYRNLRYTQNHPLRIPRVSLLIEFLKAMGLIEEQEII
FT                   QSREATEEELLLYHTEDYLRALEESDRCMCVKDRYREKYNIGTYENPVSPAMWRGSLLA
FT                   TGSSVQAVEVFLEGGVAFNPAGGMHHAYPSRANGFCFINDPAVSIEFLKKKGFKKILYI
FT                   DLDAHHCDAIQESYYQDDSVFVLSLHQSPEYAFPFKSGFAHEIGRGRGKGYNMNVPLPK
FT                   GIKDGEYLYALEESLKIVKEIFSPDVYILQLGTDSLKEDYLSKFELSNAGFLKAFDMVR
FT                   DMLGEGIYLGGGGYHPIALARAWALIWCRISGREIPSKINSEARQVLLSVNFEEFDEDI
FT                   DRTYMYDYLLDRSDGEPPRGEVKRLIERLKALFLL"
FT   CDS_pept        364480..365745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="HTH_0360"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68826"
FT                   /db_xref="GOA:D3DG74"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG74"
FT                   /protein_id="BAI68826.1"
FT                   /translation="MKLLVVGNGGREHALVWKLKQSPLVKQIYIARGNAGSWQIAKGVD
FT                   IDYLDIKGLAEFALREGIDFTVVGPEAPLVGGIVDEFESRGLKILGPNRRASMLEGSKV
FT                   FAKDFMQRYQIPTAEYQVFDDAVKAKRFVMDFGTPLVIKADGLAGGKGAVVCYDQKTAM
FT                   EAIDRIMVRGELGSAGRRVVIEQFLEGEEASYIVLLDGDRYIPLPTSQDHKRLLDGDMG
FT                   PNTGGMGAYSPNPFVGEETEKAIKHQIIERLIRGLKEEGIYYRGFLYAGLMLTKDGPKV
FT                   LEFNVRLGDPEAQPILMRIKGDFMKNLLDFYEGKAINLEIDKRCALCVVLASRGYPEKP
FT                   QVGGVIYGLDAIKEEDVIVFHAGTDIKDGKVIAKGGRVLNVCAWGKSIKDARDKAYRVI
FT                   ESIKFEGMQYRRDIGAKALNLL"
FT   CDS_pept        complement(365732..366802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0361"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68827"
FT                   /db_xref="GOA:D3DG75"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG75"
FT                   /protein_id="BAI68827.1"
FT                   /translation="MSREKVFSYFLLGITVFFTFLVLVILTPFLKPILWAVIFSLVAYP
FT                   LHLSLSRLLRNNTLSALMVTLLVLTFIVIPFLIIGLVAAKQSVEITKAIIQYLQNHTLT
FT                   DVLHSLYSLPVVNKLITEEILQRVYEYMQSEEFKNTITSYLSKLTQKAGEIFTSMLFAT
FT                   GSVIFKSFVFLISFFFILRDGRRFVEFFARFLPMHKEDLYEVLLTIYKTILAVVYGSIG
FT                   VALVQAVLSFIAYTVVGINYSLLWALITFIASFVPPFGTGFVWVPIAIYTFLNKGLFYG
FT                   IFMLLWGSLVISTVDNILRPLIMKKGIKMPYIVLFFSTVGGLLTFGFLGLFLGPIVFTT
FT                   LFSLAIIYERRILKEG"
FT   CDS_pept        366816..367367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68828"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG76"
FT                   /protein_id="BAI68828.1"
FT                   /translation="MIIDMGKSLLFIFVFFALSCAEKTVVVKEEPKSRAPGMAVASGKA
FT                   VENGKKQLSKGHCKQAIHEFYKALEKDPQNFEALYWLGVAEGVCGYYPQAYDRLTFVVR
FT                   YAPDDIWRARVYATMGITLLYMGKEDDAVAYFEKARAIDPRNELVVAYYENDHKKNKKH
FT                   KIKKRPKDREGYEITFRWMY"
FT   CDS_pept        complement(367351..368376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0363"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68829"
FT                   /db_xref="GOA:D3DG77"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG77"
FT                   /protein_id="BAI68829.1"
FT                   /translation="MRLVFSGGWIGKGGLYQARIKRVSFLKSLHELSPESFPCFLVLSY
FT                   HLASEVFGLPIKTSSLPLVVLVEIESFKAIDPREKRVSLTLLESSISDEGFKEKVNEVK
FT                   KLIEEGIVYQINLTNRFTFSLKGDPFDLFLKFYARQPVDYAFFLDLDDFYIISGSMELF
FT                   LRREGKKLRSEPIKGTASKREELKKSEKDRAENLMITDVVRNDLGIVGKCVEVKDLFGI
FT                   RKYKTLYHMYSAVECETTASLKAILFATFPPASVTGAPKRKAVEVIDSLEPHCRDLYCG
FT                   CAGFLKSEEDFTLSVLIRTALGDGKTLSYYAGCGIVWDSDPQKELREVYLKMKAFFSTS
FT                   T"
FT   CDS_pept        complement(368376..369161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0364"
FT                   /product="aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68830"
FT                   /db_xref="GOA:D3DG78"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG78"
FT                   /protein_id="BAI68830.1"
FT                   /translation="MLLRHFGKELYTIKPYMANRSFFYGEGLFETILYRGRTKKLLRHY
FT                   ERLSKSAEYFGIPYPDLETFCDRIEKKVKGKKDIYVKVCLVSYGKPKYYQMPYRSELKV
FT                   FVYKYTPLQNPVSVCISSIKRHSSDPLIKHKTLNYLTNVLVKREAIQRGFYDGLMLNEK
FT                   GHITESSSANLLLVRKDSIYTPHIASGLLLGTTLKSIMEKVEIKEKEVKPEDVFGADHL
FT                   FLVNSLIGVLPVMRLEDKIFSVDESLTQYLKSIVEEENR"
FT   CDS_pept        369147..371246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="HTH_0365"
FT                   /product="exoribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68831"
FT                   /db_xref="GOA:D3DG79"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG79"
FT                   /protein_id="BAI68831.1"
FT                   /translation="MAQEHITEEDVLELLKKSKKPLHFEQIVKELELDKEGKKKLKKVL
FT                   KTLKRSNKLTVERGRYKLAEEEIVVGTVIPYPAGFGFLQIGEGKKDIYIPPFEMVKVFG
FT                   GDVVKARVVEFKGKKEVRILQVIKRGKREIICKIVKGKTCYAIPLYDNPHQKIQLSQES
FT                   CKDLKKDTVVVVGIKEYPRAKAPARGYIKEVIGHPKERVLTIELLIRKYDLPLSYPEEV
FT                   IKEAQKFRLHIKKELKNRKDLRDQICFTIDPERARDFDDAVAIQMTPEGHYRLWVHIAD
FT                   VSYFVKEGSHIDEEAFKRGFTFYLPDRALHMLPEKLSSDLCSLKPNEDRLTFTCEMVFD
FT                   QKGNLLNYDIYESVIRSKARLTYDEALRLIVGDPALEEKYPHLVEPLRLMENLYRILSK
FT                   KRWEKGSIDFDLPESEVIVDEFGQPVAVVPYERHIAHRIIEHFMISANETVAMHLEHLG
FT                   YPCLYRVHEKPDPEKVENLIEILAGLGYKVKRVSLEPKFFQKIIEDFEGRPEENLVRFL
FT                   TLRSMKRAYYSPHNVGHFGLASEHYAHFTSPIRRYTDIIVHRILKKAIKGEDVPYEQMV
FT                   SYLEMAGQYLSERERLADNVEREAIELLKARLMKGHIGEAFAGIITGVVPFGFFVEIQD
FT                   YLVEGLVSINTLVDDQYIYDEPAHRLVGVRTGKVFRLGDVVKVKVVGVDEERGRIELEL
FT                   VKEEG"
FT   CDS_pept        371243..372544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsd"
FT                   /locus_tag="HTH_0366"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68832"
FT                   /db_xref="GOA:D3DG80"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG80"
FT                   /protein_id="BAI68832.1"
FT                   /translation="MRITVVGGGYVGLTTGICFSHLGYEVKVVEKVPQKVSMLNEGVVP
FT                   IYEPGLEDMLKDSLRLKRISFTTDLVEGLEFSEVIFICVGTPQQEDGSADLSQVEEVAR
FT                   LTAEHMESYKLLVEKSTVPVNTHKLIKKTLQRYMKRHVEFDVASNPEFLREGSAVKDFL
FT                   EPDRIVVGIESERAKNLLQKLYEPIKAPILFTDPATAELIKHASNSFLAMKISFINMIS
FT                   DLCEKTGADVKLVADGMGYDKRIGRAFLDAGIGWGGSCFPKDVRAFIKMAEDYGVDFSL
FT                   LREVDKINARRIENFLEKVKNALWSLKNKKLAVWGLSFKPNTDDIREAPSIKIVSALLR
FT                   EGAKLQLYDPKAMGNFRRIFPEGEDLIYAQGMYEAIKGCDALLILTEWEEFKKADLERV
FT                   KHLLKLPVVIDGRNIYEPAHMRELGFEYYCMGRR"
FT   CDS_pept        372541..373521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="HTH_0367"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68833"
FT                   /db_xref="GOA:D3DG81"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG81"
FT                   /protein_id="BAI68833.1"
FT                   /translation="MRNLPTFPIAIIMLFVIFALFADFIAPYPYDLQSRKTPYHPPTRI
FT                   HIVKDGRITFPYVNPYVMEDPIFKSYRENKKVSCKIEFFTKTPYGFKLFGVKAPCKIHL
FT                   LGADKLGRDVFSRLVYGARVSMFIGLVGITVTFLVGSLVGGFSGYMGGKVDSFIMRIVE
FT                   VLLAIPTFYLMLSLRSVFPLTMGSFEVFLMVVFIISFIGWAGLARVIRGMVLSIREKEF
FT                   VQSAKTYGAGTFRILTKHILPNTYYYLIVSATLSFPGYILGESALSFLGLGVQEPQPSW
FT                   GNMLSDARNVNLISSYPWILSPGVAIFLLVMAFNLLGDELLRRQK"
FT   CDS_pept        373518..374267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0368"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68834"
FT                   /db_xref="GOA:D3DG82"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG82"
FT                   /protein_id="BAI68834.1"
FT                   /translation="MKALKVKVLKNAPLSLRTYVMELSAPDIAHSVKPGQFVMLKVSHT
FT                   NDPIGRRAFAVGDVRGDNLYIFYDVVGRGTYLLSSLPEGSHIELFGPLGKRTFELSGDK
FT                   HLLIGGGIGIAGLTLLGKELRKEGKKVFFVYGAKGKEHLGLKSWLEEENFEHLIFTEDG
FT                   SEGRKGLVTEAVKEFDRSWTVSACGPKGMLKSLKNLVEPSRLYLSLESRMACGWGVCLG
FT                   CVVKGTQGNYLRVCYEGPVFRADEVCL"
FT   CDS_pept        374267..374890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribC"
FT                   /locus_tag="HTH_0369"
FT                   /product="riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68835"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG83"
FT                   /protein_id="BAI68835.1"
FT                   /translation="MFTGLVEDVGKVKNIKISSKGGTLEVITSLKEIKVGDSIAVNGVC
FT                   LTVTKVEDSIISFDLSPETLRRSNLSKAFVGDLVNLERAIKVGDRLGGHILLGHVDFTS
FT                   RIESFRSVGDHYELKIYIPDEWILYFVEKGSVGIDGISLTVNTVEGNLISLNIIPHTYQ
FT                   NTNLKGRKEGDHVNIEVDILGKYVINYLSKRRERRLDQLLERLF"
FT   CDS_pept        374908..376131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68836"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG84"
FT                   /protein_id="BAI68836.1"
FT                   /translation="MNVLCKQAIYDRSGRVAFYEVFIQDSITGEYPEGLDPLKATTLAI
FT                   DTITELNPIRVGNGKIVFVNVPAIFLEASMFDLLSPDYVGIELVENRRLSKELFEAINA
FT                   LLKKGFKFCIDDFGFEKIDYLPLLSKCHYVKINLKKNPYDKEELKEVIGILKSLKKGII
FT                   AKHIETKEDYELAYQLGFNFFQGFYLSKPVRFRDTRTISYLKATILRLYRAIKDKDMKG
FT                   IVDILEKDIGATYKFLKFLNSAYSTRTKDISRIDEAVAHLGLENIAKFTIVLALSEMFV
FT                   EEHEMDLWKRSLFRASLAERLAQMYAPHVREKAYIAGLFSLAGEALGQKPEDVVRDLML
FT                   DKEIVEAFERRLNEIGFILSLVELLEDNKSERIISRVSRIMNVDPEAVKNSIKEAEKES
FT                   SELLSSIT"
FT   CDS_pept        complement(376128..377048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0371"
FT                   /product="cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68837"
FT                   /db_xref="GOA:D3DG85"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG85"
FT                   /protein_id="BAI68837.1"
FT                   /translation="MRHVIHQRNVWMLSDYLIAFIGIFIAMLLSLLQVDNVFWYKSATL
FT                   LYALSSVMYLSYPLFRNSLFGKVSTLTLFLGLLLNLAGMIRRGVQSYQLGVFHPPWSNL
FT                   FEALTFWSFIAGSIYLLIERKYALRILGTFVVPLIFGLSAFAMLKASKDITPLMPALRS
FT                   YWLYLHVVTAFVGYAGFTVAFAGAVLYLVKGRFPQTKLLPSQDTLEEITYKAIIVVFPV
FT                   WTASIILGSAWANEAWGGYWSWDPKEVWSLIVWLFFGAYLHARQMLGWRGRRVAWMVVL
FT                   GFITVLICFFAINLYFPGLHSYATD"
FT   CDS_pept        complement(377101..377544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="HTH_0372"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68838"
FT                   /db_xref="GOA:D3DG86"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG86"
FT                   /protein_id="BAI68838.1"
FT                   /translation="MKVVLLQDLEGYGVFGDVINVKDGFANNYLIPRGIALPATEGNLR
FT                   HVKSIIQQRMRKLQREKEKAISLAKALEGLMLEIPRPVGEKGKLFGSVTAADISNALKE
FT                   KGFDVDRKRILLKTLIKDVGIHTVQIRLHPQVNVEIKVEVKPA"
FT   CDS_pept        complement(377556..377774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="HTH_0373"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68839"
FT                   /db_xref="GOA:D3DG87"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG87"
FT                   /protein_id="BAI68839.1"
FT                   /translation="MEIKKTAKKACRFCEEKKDPSYKNYEELRQFMTERGKIIGRRQTG
FT                   VCAKHQRMLSREIKRARQLALLPYLVA"
FT   CDS_pept        complement(377787..378209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="HTH_0374"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68840"
FT                   /db_xref="GOA:D3DG88"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG88"
FT                   /protein_id="BAI68840.1"
FT                   /translation="MLNKVLIIGRLTKDPSVRYLPSGNQITEFSIAYNRRYKVGDDWKE
FT                   ESHFFDVKAYGKLAESLSTRISKGYTVVVEGRLTQDRWTDKEGKAQSKVRIVADAVRII
FT                   NKPKLDEAPEEEVIPDTYEQEAEEKLWNSQDDEIPF"
FT   CDS_pept        complement(378202..378534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="HTH_0375"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68841"
FT                   /db_xref="GOA:D3DG89"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG89"
FT                   /protein_id="BAI68841.1"
FT                   /translation="MAKRYYETTRHYESVFVLKPTLTEEEVQRRLQEIRETIQKKGGQI
FT                   LQEEDWGIKKLAYPIKNFQHGRYFIFRITSSNPELPNHLDFYYKISDDIIRWLNFQVKV
FT                   KEGKNA"
FT   CDS_pept        378654..379112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0376"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68842"
FT                   /db_xref="GOA:D3DG90"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG90"
FT                   /protein_id="BAI68842.1"
FT                   /translation="MEVRKAVLKDVQDIYTLINEYAKEGILLPRSLNSIYENIRDFWVC
FT                   EREGEILGCCALHVVWEDLAEIKSLAVKKDARNSGVGSMLIERCLQEAKELGIKKVFVL
FT                   TYATDFFGKFNFREIKKEALPHKVWGECINCVKFPHCDEVAMILEVKA"
FT   CDS_pept        379109..380839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="HTH_0377"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68843"
FT                   /db_xref="GOA:D3DG91"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG91"
FT                   /protein_id="BAI68843.1"
FT                   /translation="MRYSYITSRDGLRSLKERLKDESYLFLDTETVSEKIRLVQLGNNE
FT                   DVFIVDLFETGSYGVDFLKDLLVDKGIVGHNLKYDLKFLYRYGIEPYAVFDTMIASQLL
FT                   GELDRHSLQKVAMHYLGEVLDKSLQMSNWGRAVLSKEQLEYAALDVKMVRDLYSILLDK
FT                   LNSTAHQEETLLKTRTSRVFGLKNPVAIIEMAFVQEVAKLELNGIGVDIKELEDLIREY
FT                   KKNLNKKVMEFMMHYRIDPLSPKQLGELLSKRLGLDLPKTEKGNISTDDKILSQFIHHK
FT                   PVQMILEIRMTKKLLDKLDEIRSFVKDGSVYPEFKQIGAITGRMSSLNPNVQNIPRDLR
FT                   GVFKAREGKVLVISDFSQIELRIASEYVGDERMIKAFREGKDLHRYTASVLLGKKEEDI
FT                   SKEERQLAKAVNFGLIYGISARGLSDYAKSYGIDLSVDDAQKIRDRFFEYFRSFKEWHE
FT                   RVKRELKQLGGSRGYTLLGRSYVAHTFPDAVNYPIQGTGADLLKLSVLMFDAEIKREKI
FT                   EAHVVNLVHDEIVVECQMEKAQLVRDLLERAMKHAGRVVLKQVPVEVESTINERWLKEG
FT                   "
FT   CDS_pept        complement(380836..381543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0378"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68844"
FT                   /db_xref="GOA:D3DG92"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG92"
FT                   /protein_id="BAI68844.1"
FT                   /translation="MPLCTYTNRAPWVPSKLTCFFKKMARRGSYKLFSSKDIDVKVALF
FT                   IKRVAHLFIKKKGRFNCALAGGETPLKAYSILANLPLDWTKTSFFLTDERFVPPEDERS
FT                   NCKKIRQILSDRVKCFDLSLDIYESAKLYSENFKEIKCLDLVLLGIGEDGHTASLFPNT
FT                   ACQKVTPYVCISRSPDGIKRISLTEEFINLSEKIAFFAKGDRKREVIKRLLRGEDMPAT
FT                   RIKNCRSIIIFTD"
FT   CDS_pept        complement(381452..382807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="HTH_0379"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68845"
FT                   /db_xref="GOA:D3DG93"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG93"
FT                   /protein_id="BAI68845.1"
FT                   /translation="MNRKFSIFILGGTGDLAKRKLLPALERLYKEGHLKNLHKVYSLAR
FT                   KEDPSWKVLVSSLEPSEKFDNFLQFDVNLDSSYHHLGRILRELKGQELIFYLALSPFLF
FT                   ETALRKLGRLLRDFTNPRKIVIEKPFGFDTASARKLNQLLYTYFLEEEIYRIDHFLGKE
FT                   TIQNIFSVRFSNTIFESLWHRNFVDHVQIVAIEDIGIEGRGEYYDKAGAIRDMLQNHML
FT                   QMLSFLAMEPPCCMYPEFIRDEKVKLLRSVRKISPEETVKGQYEGYLLEKAVREGSKTE
FT                   TFVAVKLHIDNPRWQDVPFYLMTGKRLSKKLSQMAVVFKEVPRSFANLFDCMPNQNKII
FT                   FQTSPKNKIAIHFELRPPAGKFIACPVETVMEYDMESYVGKKLPEAYETLILDIIEGDR
FT                   SLFIRGDEVELMWEIVQPILESDAPLHIYKPGTLGPEQAHLLLQKDGKAWII"
FT   CDS_pept        complement(382800..383702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="HTH_0380"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68846"
FT                   /db_xref="GOA:D3DG94"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG94"
FT                   /protein_id="BAI68846.1"
FT                   /translation="MKVLVVGLGRMGGGIVRRLKSKGYQVAGYDSHPDVRNAFKDTAFV
FT                   MDSLSQMTEFFGDQRKIIWLMVPHHAVDDVIESFVPFLSGGDIVIDGGNSYYKDSQRRY
FT                   QKLAKIGVSFLDVGVSGGVYGEQMGYCLMIGGDEKTYDLIKDLFKDLSYREEGYAYLGG
FT                   PGAGHFAKMVHNGIEYAFMQAIGEGFELLKESGFNYHLGEVARIYNAGSVIRSWLMELT
FT                   QKVFEEFKDLETLEAYVEDTGEGRWTLIEAIERAVPVPTIADALFMRFRSRQENSFRDR
FT                   LLAGLRYQFGRHSLKRKDE"
FT   CDS_pept        384147..384602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68847"
FT                   /db_xref="GOA:D3DG95"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG95"
FT                   /protein_id="BAI68847.1"
FT                   /translation="MAKRGLKALLLSSCLFLTYLVSLPVSSAEGENPYKANESKLPPMK
FT                   NPYEGDQKAAQDGRKLWFANGCNGCHGGTGGGGMCPPVINKVWVYGKSDAILFNLIKLG
FT                   SVGLREKYGLVRIGRENVVGDMPPFSSLSDEEIWKLITYMRSIYKGD"
FT   CDS_pept        384604..385176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68848"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG96"
FT                   /protein_id="BAI68848.1"
FT                   /translation="MRLKALLMSLCLFALAQEKSLVKTEIKFQKAECIKVDKGGACLIY
FT                   SPSSSDNLRYNLLIKSVNPIKQGKYTLLVLASHVGFMDPLQISLIRSIEYKNLNDGLKL
FT                   EGTIDKERLPLKDCADFRNRILLTPFIFNKELTQKEIEDMLNASRYCPDPKNKYACSYS
FT                   AFFAYVQKTGMVLNAVNHEFVTLCKGK"
FT   misc_feature    385157..385765
FT                   /locus_tag="HTH_0383"
FT                   /note="hypothetical protein"
FT                   /note="pseudo gene. The initial codon of this gene is
FT                   missing probably by a mutation."
FT   CDS_pept        complement(385727..386302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="HTH_0384"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68849"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG97"
FT                   /protein_id="BAI68849.1"
FT                   /translation="MELVVKESFETKADFKEAWKFFSNPEFIVPCIPGAEIREIKEDGS
FT                   FEASVKLKLGAVSLNFVGNMKYEKLDEAQGLMVLSGEGKEKGGAGRAKANIEATLKEEG
FT                   DVLKVSVIATVDISGKILQYGRGMFEQVAKQYFAQFSQCAKSYLEAEQSEEKKMPPEPV
FT                   KVNALNLILKAFLAWLLSPFRRIFGGKA"
FT   CDS_pept        complement(386274..387251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxF"
FT                   /locus_tag="HTH_0385"
FT                   /product="xanthine and CO dehydrogenase maturation factor,
FT                   XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68850"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG98"
FT                   /protein_id="BAI68850.1"
FT                   /translation="MQTWKEAKLLAEGILDCKKRGVRCALLTIVSVRGSSYRKEGAKFL
FT                   VTEEGEEICSISGGCLEKGLLDTALEVINSNYSVLERINMEEESSWGMWLGCPGEVDIY
FT                   IEPLHFDEVMDAWVDALITGEKFVLAKKLFSSEKLLVTERSIVGSLLVAEEEAKAMIKE
FT                   YGVRPYLKGDIFFDTLLRYPPVHIFGGGEEAHHFREIAQILGFEVFLHEPSEKVKMAKG
FT                   SFVIVANHNLKADRLSLKQALMSEASYIGVVSSRKRFLKLSEGLDLDDRVYCPAGLDLG
FT                   SFTPEEVAFSIMAEILKVYWGKTGESLRKVKQEVTHGIGSQGIL"
FT   CDS_pept        complement(387254..388111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxM"
FT                   /locus_tag="HTH_0386"
FT                   /product="carbon monoxide dehydrogenase middle subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68851"
FT                   /db_xref="GOA:D3DG99"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D3DG99"
FT                   /protein_id="BAI68851.1"
FT                   /translation="MIPVSFEYYRANTLDEALELVKKFGDEAKVLAGGQSLIPMLKLRF
FT                   ARYSKIIDIGRLQELRYIKEEGGQIWIGGLTTHREVEKSSLIKEKVPVLSACASEIADV
FT                   QVRNMGTIAGSLSHADPSADYPPTMLALGATMVARGSKGSREIPADNFFVGTFTTALEP
FT                   DELLVEVRVPVIKNNERAAYMKIGHPATGFAIVNCAVKFSLRDGKIEGARVAFGGFVTV
FT                   PYRDTRVENLLAGKDVSLDTLKRASELVGEGQDIIGDYYADADYRRSLAKALFVRVARS
FT                   ALGV"
FT   CDS_pept        complement(388115..390460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxL"
FT                   /locus_tag="HTH_0387"
FT                   /product="carbon monoxide dehydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68852"
FT                   /db_xref="GOA:D3DGA0"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA0"
FT                   /protein_id="BAI68852.1"
FT                   /translation="MVIGQPLRRFEDDRLIRGLGQYVEDIKLPRMAYAVFVRSQVAHGR
FT                   IKSINTEEAKKAEGVIAVITGQDIKDKVGKNFTAWIVPNSNQVSAEVSSRPLLAVDKVR
FT                   YVGEPVALVIADSRERAFDAAELVEVEYEELPAVASVEKAIQEGAPLVHEEAPGNIALR
FT                   WHVKSGDVERVFSEADRIVKQRIYINRAAPVPMEPRACIADYNPATGRLTLWVTSQNPH
FT                   IHRFYLAVVLGIPEHKIRVIAPDVGGGFGAKIDIYNEELVVSYASILLKRPVKWVETRS
FT                   EHFVASLHGRDFLAELEFAVKNDGRVLGIRGKSYANMGAYLGTVAPGVATVLHGLILPG
FT                   PYRIEAFDYVMHGVFTNTMLLDADRGAGRPEAIFLLERMMDLVADELGMDPLELRKKNY
FT                   LPAGENVQTVTGLSYDSIDFGKVLKKFEEVVDYKALRDMQKKAREEGRYIGIGIVSSID
FT                   ICGFAPSPVVGAVGLQAGQWESAVVRVHPTGKVTVLSGAHSHGQGGDTTYAQIVADVLG
FT                   VPVDAIEVLHGDTDMIPMGWGTYGSRGTSTGGSAVYKAAEKVREKGRLIAAHMLGTRPE
FT                   DVEFSEGIYYLKTDPSKKVSIQDVALQANVAWNLPPGVEPGLEAEAFFDPPNFTFPFGI
FT                   HCCVVEVMPDTGEVKFLKYVAVDDAGRIINPLLAEAQIQGGIVHGIGHAMYENIVYTED
FT                   GQLLTGSFNEYALPKAHLIPKMETYFTETPSPANPLGAKGIGEEGAIAGQIAVANAIID
FT                   AIKPFGVKHLDGPYTPSRIWRAINKLEV"
FT   CDS_pept        complement(390474..390950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxS"
FT                   /locus_tag="HTH_0388"
FT                   /product="carbon monoxide dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68853"
FT                   /db_xref="GOA:D3DGA1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA1"
FT                   /protein_id="BAI68853.1"
FT                   /translation="MKERVSLTVNGVSHTLEVEPRTLLVYAIREILNLTGTHIGCDTSS
FT                   CGACTVLMNGKAVKSCTVLALQADGAEIITVEGLASDSELHPIQEGFKEEHGLQCGFCT
FT                   PGMMMVSCDILETEEELDEDKVRKLLKGNLCRCTGYQNIVKAILYAKEKSAVTK"
FT   CDS_pept        complement(391150..393192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0389"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68854"
FT                   /db_xref="GOA:D3DGA2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA2"
FT                   /protein_id="BAI68854.1"
FT                   /translation="MKRVWVWYTILLSLTVSSGSSLAQDMEVPPIVITATRTEKPLFEL
FT                   STSAGTVEKENIQTALPNLQPADVLSRISGVYAQDRGRNFAQDAKIIIRGFGARTQFGV
FT                   REMKLFWDGVPLTMADGQGDIDKLDMSFIKHVEVLKGPLAVLYGNSAGSVIYFESEDGG
FT                   LKPISAQLKISGGSYGFHKENLRLGGQVERLNYMFGLTTLYTTGFRDHSSARRNYANLK
FT                   TMVEVTDRSSLTLFLHLFDEPFAKDPGALTKAEFEKDPKQASPIYKANDAREIIQNREI
FT                   GFLYQHELVQNHSFKVTGYLGHRDFTGYTPVIVNDFGRDYYGVGFNWLSKFKVADRRIE
FT                   TTLGIDTDFMKEDRNNFQNASGNKGNLQYTQNSDVKNLGLYALVSLDITKSLQLNGGAR
FT                   YSKVNFSADYNRLSPSALFVSSERNFQFTSWALTLSYKPIQRVNLYTGVGRGFITPTLI
FT                   ELINSPSGPGGLNQNLKASKFYNYEAGIKTLLGQGTYLDTAIFLVKTSDELIPKQLFPG
FT                   TNYYVNAGKTERKGVELYLTHELPFNLYTTLSYTYMEATFKDFIDTDGLNKSGRRVPGI
FT                   PRHTFFYELGWKPTKNLVASIDVKYADKIWADNSNTASADSYTIVNLKSSYKFNIFGHN
FT                   LDAFFRIENLFDKKYVTSVVPNATGGRYYEPGPGRNYYVGMALSF"
FT   CDS_pept        complement(393215..394045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0390"
FT                   /product="extracellular solute-binding protein, family 3
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68855"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA3"
FT                   /protein_id="BAI68855.1"
FT                   /translation="MRKNYRLPWRVLGKFIILLPLLIPLIARPAPKELTACSDPGLIPL
FT                   FDMQGRGIYNKIEELIASYYGQKIGRYFFPMQMGFIRHTLVEKACHFVVGVPAGYELTL
FT                   NTKPLFRSTYVLVYRSDSGFDIKGIDDPILSRLKIGGIVNNPAFFYLKDEGITNYVGYN
FT                   SFYDSFNRPDDNPNLQIIKDLLDKKIDVAVLWGPIAGYFVKEYNGKLKMILPNPKSQSD
FT                   VRLDYKVAIGVRKGDTLMKEYVEKAILEQKEAIKSLLVSNNVPLLPCDNCVINP"
FT   CDS_pept        complement(394077..395060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68856"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA4"
FT                   /protein_id="BAI68856.1"
FT                   /translation="MRYFFALFLSFFIYLEAMASYVFVSDEEQGIYAIDTDKLELIKHI
FT                   ELKGMGIRGVGVTKDGKYLAVASKKLGKLLVVSTESWKVVREVPLGENPEFVKVHPKRD
FT                   LLFVTYEETGKVEKAYIVAIDTKNWKEAFRFEGGKESEGMAFSKEGRYLLVTNEGENSI
FT                   SVYDLDTKKKLRDVDLKSYGDRPRGIVSSPDGKYYAVTFENSNGLLLLDNNFKVIRSVK
FT                   TDAGPYGVTFSPDGSEIIVASFRAGKLDIFDSKTLTKKSSVETGKRCWHFTYSSDYTKL
FT                   VVPCGNSQNVLIFDVNGFHVIKTFSGLGKPWGAVAFPRAWGSIDTP"
FT   CDS_pept        complement(395147..397018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0392"
FT                   /product="methanol dehydrogenase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68857"
FT                   /db_xref="GOA:D3DGA5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA5"
FT                   /protein_id="BAI68857.1"
FT                   /translation="MKRRAYHRLLFLLILSAVSWVGLSIANPQVEELSKKAGLWPAPGR
FT                   DYHLTRYSPLSQINTHNVKNLDLAWSFSTGVLRGHEGQPLVIGNTMYVQTAYPNIVYAL
FT                   DISKGNDYKILWKYVPQQDDRAVAVACCDTVMRGISYADGKIVMNTLDGHVIALDAKTG
FT                   KELWKVKHADPYKGETITMAPIVAKDKVIVGISGGEFGVRGRVAAYDLNSGRRVWLCYN
FT                   QGPDQDMCYGSRTPASYKGLGVNTWQGDQWKIGGATVWGWFSYDPKLNLVYYGTSNPGT
FT                   WNPYIRCSASWEECQSGRYDNKWSTSIIARDADTGELVWAFQMTPFDQWDYDGVNESIL
FT                   LDVNVGSKKVPALIHFDRNGFAFLLNRATGELIYAKPFVYVNWAKSWDERHARDGHTFK
FT                   VTKDPTKSPWKPGDNKKDVCPSAMGGKDQQPAAYSPETGLVYVPTNQWCMDYEPAETKY
FT                   TEGAPYVGANVLMKFYEHKSSVHGLSKTPGHYGRIIAWDPAKGEIKCYIDEKYPTWSGV
FT                   LVTKGGVGFYGTMDGWFRAFDLKTCKVLWSKKLGSGIIGNPISFEVNGKQYIAVYSGIG
FT                   GWAGLPVTANLDPNDPYGGLGATNLSLELDLYRQATMSGVLYVFSLE"
FT   CDS_pept        complement(397154..397558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68858"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA6"
FT                   /protein_id="BAI68858.1"
FT                   /translation="MKVDDVEMLIRSIAGEGVSKMFRKFAQQVEGKDTEKIAFALEVLE
FT                   RFFGISTLVPIMIFVGKNLNLQHSTEADGSKLKVVCLFEKLSINKKPLEHPLCYPCWGS
FT                   LHTFGNPQFDGQEESKCIFIIEPKERFLTL"
FT   CDS_pept        397661..397822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68859"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA7"
FT                   /protein_id="BAI68859.1"
FT                   /translation="MKARIENIIERLEREKSYYRRCLKKVGSCRQPPYKPPSFCRQPLS
FT                   LLLLRIEI"
FT   CDS_pept        complement(397868..398128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68860"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA8"
FT                   /protein_id="BAI68860.1"
FT                   /translation="MEKKELAQELEKIKQELEELKKKMTVAEEERSIKDLPAEAFQKVM
FT                   EVSKDIVKSTTEIAEKALKLIKYSAEGAKRALKSEEEKKEE"
FT   misc_feature    complement(398183..400207)
FT                   /locus_tag="HTH_0396"
FT                   /note="metal-transporting ATPase"
FT                   /note="pseudo gene. This gene contains three frameshift
FT                   mutations."
FT   CDS_pept        complement(400221..400535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68861"
FT                   /db_xref="GOA:D3DGA9"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGA9"
FT                   /protein_id="BAI68861.1"
FT                   /translation="MLNINIPNTLGGCISTNAMLYGFGALAGLVILSKLLRDSRPILVS
FT                   ATKEVIAFQQWLTGNLEEGKEFWEDVFSEARHLYRLEVEKKLEVLQKQQEILQRIKDRL
FT                   "
FT   CDS_pept        400724..400894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68862"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB0"
FT                   /protein_id="BAI68862.1"
FT                   /translation="MFSLPSKSYTPSISLIPRIKRSLSSLVEKYSLALPSLTDMYSIIC
FT                   LQFIEKLLSFC"
FT   CDS_pept        400924..402099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livK"
FT                   /locus_tag="HTH_0399"
FT                   /product="ABC-type branched-chain amino acid transporter
FT                   periplasmic amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68863"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB1"
FT                   /protein_id="BAI68863.1"
FT                   /translation="MKVLLAILLVLVSLSFPQDVIKFGAAISLTGKLAKEGQLLKQGYE
FT                   LWKERVNALGGIKVGGKHYKVDVVYYDDQSDPVTSARLVERLIVEDGIKFILGPYGSAQ
FT                   VFSSAPIVEKYGAIMVQAGGASSDIYQKGYRNVFGLYTVAPNYGRDLVELATNLDRGAK
FT                   RIAIIYEKDIFSQDAAEGALEHARRKGLNVVLYEGYPKQVQDLSSLMQKLRLLKPDIVI
FT                   GSGHFQDAVLMVKQLKQFRINPRFLGLTVGPALPAFAEALGEDAEGIFGPVQWSTALNY
FT                   RDPLFGNNREFVKLYRERFGSDPEYHVAGAVAAGIVFQKAIEKAGSVEVDKVRNALRKL
FT                   KVETLFGVIGFDDTGKVVTKPMAVIQIQRGRQVTVYPFEEAKPIYPKPQWR"
FT   CDS_pept        402090..402953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="HTH_0400"
FT                   /product="ABC-type branched-chain amino acid transporter
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68864"
FT                   /db_xref="GOA:D3DGB2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB2"
FT                   /protein_id="BAI68864.1"
FT                   /translation="MEIVFQLLLDALLLAGFYSMLSSGFSLMWGVTGIINLAYGSFVLL
FT                   GAYLLYTLYLSGVGLLTAFFIVLAVGLLSGAVLEMFFFNKLMNYEPFTLLVLTFGLDIL
FT                   LTNFLNLLFKADIRSLSVKGLEGSLLLGDFIVPYNKLSVFLLSSLVISALQFYLKFSWT
FT                   GKAIRAISADPIGAQLCGINPKRVYTVSTSLATALAMISGGFYAFLQGFTPFDSESITL
FT                   RAFFVCVVGGLGSTHGLLAGSFILASSEVFSGFYLGEGWKTAVSLLILVFFLIFRPRGL
FT                   IGIKYA"
FT   CDS_pept        402946..403821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="HTH_0401"
FT                   /product="ABC-type branched-chain amino acid transporter
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68865"
FT                   /db_xref="GOA:D3DGB3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB3"
FT                   /protein_id="BAI68865.1"
FT                   /translation="MLKLFILVIAGAVFPLLADPYWLRVASSALLLSSLAYSHNLFFHF
FT                   LGYPTFGGVAFFGIGAYTFSLLFSHNLPIYASLPFAGILSSLFAIPLLPVVLRLKSHYF
FT                   AIGTLALQITLMEVAENLSITGGTKGYALKVSESSNLIAFYLFLLLTVILLIYCAFLER
FT                   SILGKTLKAIKEDEEAAQILGINPTPYKMLMLISMTFSLGLLGGTFSIWSAYIDAPTVF
FT                   SPVLSVKTFFILILSMRAPILGPLLWSILFELIFELMWSSFPQVHGLLLGIAIILLILI
FT                   FPKGVLWKGS"
FT   CDS_pept        403806..404525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="HTH_0402"
FT                   /product="ABC-type branched-chain amino acid transporter
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68866"
FT                   /db_xref="GOA:D3DGB4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB4"
FT                   /protein_id="BAI68866.1"
FT                   /translation="MERLLEVIDVRKSFGGNRVLEGVSFSVKGGEILGIIGPNGSGKTT
FT                   LLNVISGLIRQDSGKILLMGKDISDAKPHVRARLGMGRTFQNPRAFPSLIVLECLKIAQ
FT                   LHSGRDVQIDELLKKTGLYELQGRASDKLSLAQRKRLELAKALAIKPKVLLLDEIFAGL
FT                   NPASIGEVSHLIKQLKDEGLGIVIVEHVLSALVPLADRLLVLAGGRVIYDGDKYEAFRD
FT                   EKVRRAYLGERYSSLGV"
FT   CDS_pept        404515..405213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="HTH_0403"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68867"
FT                   /db_xref="GOA:D3DGB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB5"
FT                   /protein_id="BAI68867.1"
FT                   /translation="MECDGINCGYKDAQVLYHVRITVKEGEAVVVFGSNGSGKTTLLKV
FT                   LSGIIKPWSGIVRFRGRDITKLSPHDRVKLGIAFASDTRNLFLSMSVEENLILGAYTRK
FT                   KNVKEGLEMVYHYFPDLASQRKKLAGELSGGFQRMLSIGRAIMSKPLLLMIDELSLGLS
FT                   PKMVDKLGQALMSINRERGIAMLVVEQEVYLAGSMCRRGYVFDLGRVVAQGDVQKLLKE
FT                   DTVRRIYMGV"
FT   CDS_pept        405387..405860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA1"
FT                   /locus_tag="HTH_0404"
FT                   /product="rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68868"
FT                   /db_xref="GOA:D3DGB6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB6"
FT                   /protein_id="BAI68868.1"
FT                   /translation="MTWLHFVCYYATKFLNGRLKMWILLLVFMLFGVVLAKGECEEIEG
FT                   YASWYGKGFHGRRTASGESFDRYKYTAASKVFPLNTYVLVRNLENDQEVIVRITDRGPF
FT                   VKGRILDLSKASAEKLGILKKGIVKVKAMPLYCVADVDRGDEDEYIMDIIRTF"
FT   CDS_pept        complement(405857..406651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0405"
FT                   /product="putative Fe-S cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68869"
FT                   /db_xref="GOA:D3DGB7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB7"
FT                   /protein_id="BAI68869.1"
FT                   /translation="MKLLSTFKSELNRLFVFELEDSNKIEAVFYRGDTLCISTQVGCAI
FT                   RCPFCLSGSAGFVRNLTYEEILAQYYLLRDTLPIKRIAVAGIGEPLMNYSHVIRAFWKF
FT                   KEEGLKVSFYTTGFPHIHLRELIHIPHNGLTISIHSTKSEKRRKLIPHGGDLNALIDML
FT                   REELPRMSKRKRKKVSLAYLLLKGVNDSYEDLEEFAKLVRDLGVSATLLYYNSTGFFET
FT                   MSKSEYEERFLYLRGYGIRVSLSTRFRKDSLGGCGTLVINRC"
FT   CDS_pept        complement(406623..407492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0406"
FT                   /product="signal peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68870"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB8"
FT                   /protein_id="BAI68870.1"
FT                   /translation="MLYIKARFQDTGKIFQVEGVWDDGIKRDDLIVVSSEKGEEVVKVL
FT                   GLSKQPSQIKATFLRKAKDEDILKMEENEKKAQNLYSLCKEKIAQHGLGMKLIKAYIPL
FT                   DAGKVFFYYTSEQRVDFRNLVKDLAKVVKKRIEMRQIGVRDAVQMTGWVGACGDIPCCV
FT                   RFSENFESISLKDIEDQNLPLSPTKFTGPCGRLLCCLAYERDNYMIRNLLPEVGTELCF
FT                   KGKIYKLLYIDPPMDKVLIESEGKKEELSISSLLPYGYEKALRHCKSCGLCCRRAYKED
FT                   EAFINLQE"
FT   CDS_pept        407641..408264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI2"
FT                   /locus_tag="HTH_0407"
FT                   /product="NADH dehydrogenase chain I"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68871"
FT                   /db_xref="GOA:D3DGB9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGB9"
FT                   /protein_id="BAI68871.1"
FT                   /translation="MIKKVFERQLSWLERIFFVDFIKGLSVTIRHAFSKTITTHYPYEK
FT                   LTPPKRFRGFLGHKVVDGNEPQPAFDEWVERFKIEVRPGRSRCVVCMLCKRACPVPQLF
FT                   EIEGEKLPNGKRVVSIFNMNLMLCTFCGFCVDACPVDCLFNSDIHETASYTRKDAILNL
FT                   EALEQIGRDWQARREKEPDRIWIDNHQRQKLWRENDLKLPEVKG"
FT   CDS_pept        408261..408794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ2"
FT                   /locus_tag="HTH_0408"
FT                   /product="NADH dehydrogenase chain J"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68872"
FT                   /db_xref="GOA:D3DGC0"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC0"
FT                   /protein_id="BAI68872.1"
FT                   /translation="MIQWITFLLFSLLAVVSSLGVVLLPNPVYVILSLLSSLIAIAGVF
FT                   FVAGAELVGALQLLIYAVAVTVFYVFVLTAVPWEKALKKDSHYRVEGVLSFPILLLLYF
FT                   EILIVFSLGVSASPKGQIKELSKKFGNTEVIGSILFSKYFFAFELVSLVLLIGMIGAVI
FT                   IGRKEAQTYDSNTP"
FT   CDS_pept        408775..409083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK2"
FT                   /locus_tag="HTH_0409"
FT                   /product="NADH dehydrogenase chain K"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68873"
FT                   /db_xref="GOA:D3DGC1"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC1"
FT                   /protein_id="BAI68873.1"
FT                   /translation="MTAIPLEAYMLLSIVIFGLGLFGIVVRRNLVTVLMSTELALNAVN
FT                   IAFVGIDAHLSLANGQIFALFIIALAAAEAAVGLGIIISIFRLRRVESTDEITDMRG"
FT   CDS_pept        409085..410971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL3"
FT                   /locus_tag="HTH_0410"
FT                   /product="NADH dehydrogenase chain L"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68874"
FT                   /db_xref="GOA:D3DGC2"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC2"
FT                   /protein_id="BAI68874.1"
FT                   /translation="MEALVLFLPLFAFLVVGLLGRYMGDLLSALITIGAGLLSFVLSLT
FT                   ILSKAISSPFSVKLYDFLPFLSFGLYFDALSSITSAVVTLVACLIFVYSIGYMHNLFGH
FT                   WTFKFYAYLSLFLFAMLLIVLSDNLLGIFFGWEGVGLASYLLIGYFHTQKKAADASLEA
FT                   FVMNRVGDWLFIFGIISSFYIFGSLSLLDIFGKVSSVPSALLSVCALLLFGGAVGKSGQ
FT                   LPLHTWLPNAMAGPTPVSALLHAATMVAAGVYMVARLYPLFEATPESLKVVALIGGITA
FT                   LFAALAATSHTDIKKIIAFSTMSQLGLMYLALGLGDKAGAMFHLTTHAFFKALLFLAAG
FT                   SVIHAFHHQVYDIYQVGGLKKYMPATYWSFIVGALALSGIFPLSGFFSKDRIISSAYEA
FT                   GTGWGLLASFVSLLTAYYIFREGFVMFVSKREYEEKPHESEKVMVLPMVALSVLSVVSG
FT                   LIEGWYMRVMGSKSELHLSIAISSVLIGLTGIGIAYAVYVKGAIDHRRAYRALKPIADT
FT                   FREQFYTEKLYHKLIAYGYLVVSKALYRIGDRITIDGFINLLAFLYFKVVRFLWMKLDI
FT                   MVVDLFVNGVAKLSFKTGRYVRNLQTGLLNNYVLFLLMGIVFILGVITYSLR"
FT   CDS_pept        410976..412487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM2"
FT                   /locus_tag="HTH_0411"
FT                   /product="NADH dehydrogenase chain M"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68875"
FT                   /db_xref="GOA:D3DGC3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC3"
FT                   /protein_id="BAI68875.1"
FT                   /translation="MERLEATFPLLPLSMMVPVFGSLLILLLPERFSKGISLFSAGISF
FT                   LIALSSLLFFDFSKAQAVQFYQYYPLIPELKVGLALGLDGLSMLMYLLTTLVSFVAILW
FT                   SVRDRQINHRLREYYLWFLLSEAFLIGVFSSWDLMVFYVFYELTLVPMLFVIGIWGYKL
FT                   RLYSAYKFFIYIFVSSLFLLLGIVSLAVEHYKLFGKFSFSYFDLLNNHYSLEYGLFLFL
FT                   LFFIAFAVKTPIVPFHTWLPDAHGEAPTAGSVVLAAILLKMGTYALLRFNIGLFPEVAV
FT                   FLMPVLVLWGIFSIAVASWYTISQSNVKRFVAYSSVSHMGFVVTGMFLLNMEGLRASIM
FT                   EMFAHGLTSASLFMIAGFIYNRLHSFNMDSLKGSAKYMPLFAIITVLTAFSSMGLPGGS
FT                   SFWGKFLTILSAREYTTLLAFLVLVGAFFSAVYILYLMKVLFLDSKEESKLVHFTDVRG
FT                   FKLSAFLLLVFPMFMVGLAPYLFFNIFDKSAKELLLLVMRKLVGG"
FT   CDS_pept        412494..413954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN2"
FT                   /locus_tag="HTH_0412"
FT                   /product="NADH dehydrogenase chain N"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68876"
FT                   /db_xref="GOA:D3DGC4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC4"
FT                   /protein_id="BAI68876.1"
FT                   /translation="MELRDLVGVIEFPHLQLLMPEIIVLLTGFILFSLDLLYKKAHHRL
FT                   FTVVSAVGYTLALLYITLNPFLSGSTFYHLYVRDTFSSFLQFFMILITLFVLAFAYRYY
FT                   QQKLSLYREFYYILSFSLVSAMFLASSYHLITLYVALEGVSISFYILTALLRGDFNSKE
FT                   GAFKYLILGGISIALASYGAAFMYLYAGSLDLKEILTHVGENRYFLVLGLVFFLIGFAI
FT                   KIGAVPFHFWLPDAYQGAPTPVTAYMASVGKLAFFAPVVRIMPLIEEHFAYAWVITVSI
FT                   ISAMTMLYGNLVALVQKDVKRLLAYSSIAHSGYILAGISVAKVIGLKAVLYFLVAYALM
FT                   GAGAFLVLALLERHPEWQNRMEEFSGLRFSMPWVATSFMIFMFSLLGVPPTVGFVSKAL
FT                   IFTTLSFDRLWWLAFIMILATGISTGYYVRLVVLTFMKENSKPFQVKSSLAERIVLIVL
FT                   TLSVVFLGAVPIIIWSFVSPSAEMLFKR"
FT   CDS_pept        413958..414335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA1"
FT                   /locus_tag="HTH_0413"
FT                   /product="NADH dehydrogenase chain A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68877"
FT                   /db_xref="GOA:D3DGC5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC5"
FT                   /protein_id="BAI68877.1"
FT                   /translation="MDYMGLLAFFGVMLALALILISLNALLGPKTPESMEDYPYECGVP
FT                   LYDQSAQSTFHQGYYLLGLLLLLFDIEAAFLFPWTVVYKYLGVFGFIEMFLFILILTYG
FT                   LLYAWRKGALDWQFEEEVLER"
FT   CDS_pept        414340..416058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD1"
FT                   /locus_tag="HTH_0414"
FT                   /product="NADH dehydrogenase chain D"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68878"
FT                   /db_xref="GOA:D3DGC6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR026662"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC6"
FT                   /protein_id="BAI68878.1"
FT                   /translation="MPWAKEEDFIELKKRFPDLEVEVKPTITNLHITKEKLIDLLKVLK
FT                   DQLGFKLFVDHSVIDFPDKKPRFQAFYILYHVDERKRVVVKTWTDGTLPSIEKLWFAGK
FT                   WAERECYDMFGIRYEGHENLVRAFMWETYPYHPLRKDFPLEGYANTYLPSLNEVLRGDE
FT                   LTGTMNYDRMHTAVPTLEDLEITEKRRLKKKAQIVLNWGPLHPGTHGTMWFLFDLEGER
FT                   VVQCDVILGQLHRGVEKLAESQMYNQFLVYTDRMDYISALCSNQAWVVAVERLLGIEDI
FT                   VPEKAKYIRTMMSELQRINSHLLWLGTYALDLGALTIFLYAFKEREKIMDIIEGITGAR
FT                   LTISYPRVGGVRMDLPEGALEVIKAFIKRFPKELRDWENILTRNRIWLRRNVGVGVINK
FT                   EDVYFYGLTGPVARGSGVAYDLRKLEPYDAYPFVEFDIPVGENGDVYDRYLVRLEEMRQ
FT                   SVRIIEQCVAFLEKLPPSAPYFAESPDPKKIKLSLDGIGLKVPEGEIYSSGENPRGELG
FT                   FYIYSTGGVKPYRVKIKPGSMYNLCVYPKLMQDRVIADAVAILASLDPVVGEIDR"
FT   CDS_pept        416069..417118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH2"
FT                   /locus_tag="HTH_0415"
FT                   /product="NADH dehydrogenase chain H"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68879"
FT                   /db_xref="GOA:D3DGC7"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC7"
FT                   /protein_id="BAI68879.1"
FT                   /translation="MENIVASLIIVGIKILVLLAIVLGLGAYLTLVERKVAAHIQRRPG
FT                   PMVVGWHGLLQPLADGLKLLTKEDLFPRYGNKFLYNLAIVMALVPASLVFAVIPFGPEF
FT                   EVFGIRVKPILTDVNVGLLLFFALGSLAVYAIALAGWASNSKYALIGSMRKAGIVISYE
FT                   VVITFAAMGPIILAQSLSTYSIVQNQIDQKLWYIWLQPVAFVVYMFAMLAETGRVPFDV
FT                   QEAEAELVTGFTVEYGGMKFGLFPLVEWYVETLSLSAIGVILFLGGWSSINIPFVGFFD
FT                   PLFFLGPLSPFVWFLLKVGLVFLFVLWLHWTLPRYRIDQITSTAWKVMLPLTFVNLVFT
FT                   ALIAPLVWK"
FT   CDS_pept        complement(417093..417872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="HTH_0416"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68880"
FT                   /db_xref="GOA:D3DGC8"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC8"
FT                   /protein_id="BAI68880.1"
FT                   /translation="MLAKRIIPCLDVAKGRVVKGVRFENLVDAGDPVEVAKAYEEQGAD
FT                   ELVFLDISASYEGRSIMIDVVRRVAEQVFMPFTVGGGIRDIEDIRKLLLAGADKVSINT
FT                   AAVKNPGLIRESAIRFGSQCIVVAIDAKRKYGGWEVYINGGRTPTGLDAVEWAKKVASL
FT                   GAGEILLTSIDADGTKSGYDVELTRAVAESVNIPVIASGGAGTFEHFYSVFTDGKADAA
FT                   LAASLFHFKEISIHELKEYLHSKGIPVRRITSTQEVL"
FT   CDS_pept        complement(417872..419149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="HTH_0417"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68881"
FT                   /db_xref="GOA:D3DGC9"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGC9"
FT                   /protein_id="BAI68881.1"
FT                   /translation="MFVYTLPEEVISKISAGEVIESPADCVKELVENALDASSSRIDVE
FT                   MLKGGKRYICVRDNGTGIHREDVHKVVQRWTTSKIKDMSDLMSISSYGFRGEALYAIST
FT                   VSKMIIKSRFFQDEIGIKMEVEGGKVINKQEIGMPVGTCVEVYDLFYNLPVRLKFLKKE
FT                   DTERNKIIKLIKEYALSNWNVHFTLHSNGRKVLDLYPCEDKKERIEALFGCKFEEKSIE
FT                   KNSINISLYTSLESSRGEIYLFVNSRPVHNKNLLEYIRKVVGYKKICVCYIDLPPYMVD
FT                   VNVHPKKREVRIYKENIIKEMIKELFRRQEWYPFELAQERAYYLPTPVVIDIIDNTLIL
FT                   VRIGDYLYFFDQHLLSERILYEKTREVERSCAFAIKAGKAISKEEAKELVKAWMSLENR
FT                   EVCPHGRPMYYRLYLGDIYKSLDRRR"
FT   CDS_pept        419171..420148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="HTH_0418"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68882"
FT                   /db_xref="GOA:D3DGD0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD0"
FT                   /protein_id="BAI68882.1"
FT                   /translation="MFGEVKTDSCDLSITLFGITFKNPVWVASGTFGYGLEAREIYDVS
FT                   LLGAVVTKGISLKPREGNPPERIAETPCGMLNSIGLQNPGVEGFLKKIYPHIEKIDTHF
FT                   IANIFGETEEEYVEVCMALEDARKIVAYELNVSCPNVKKGGMLFGHDAVVLGRLVESVK
FT                   AKVKKPVLVKLSPNAGNVVEFAKVCADAGADGLVLINTLLGMKIDVKAQKPDLSTFTGG
FT                   LSGPAILPIAVRMVWEVFSELGDKLPIIGVGGIHDTDSALEHILAGASAVQIGTANFSD
FT                   PLCPLKVIKGIQDYMQNMKEKNFKSLVGKAHGIKLQPYLFQQGP"
FT   CDS_pept        complement(420116..421414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="HTH_0419"
FT                   /product="adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68883"
FT                   /db_xref="GOA:D3DGD1"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD1"
FT                   /protein_id="BAI68883.1"
FT                   /translation="MKKDLLILGAQWGDEGKGKIVDLLSANYQVVVRYQGGSNAGHTVV
FT                   VGNEKFILHLLPTGILHNHTKGVIAQGMVVDLELLKAEIEELEKKGISVRERLIISDRA
FT                   HLVMPYHKLLDALFERKSKIGTTLRGIGPSYMFKYGRKGIRMCDLEDKDRLYHLIKEDW
FT                   EFVKDICEKVYCENHSIDIDRVYEETLMYYSYVKECISDVSKFLMENKDLSLLFEGAQG
FT                   TMLDVDMGTYPYVTSSNASALGLPNGTGLSPKFFENTFFWAVSKAYTTRVGEGPFPTEL
FT                   FDEDGNMLRNRGKEYGSTTGRPRRCGWLDLVALKYAVDVNGLDGLILTKLDVLDTFEEV
FT                   KVCVAYEYEGKEITRFPASLSLLEKVKPVYKVFKGWLKHTKGIKDPKDLPERAREYISF
FT                   IEEYTGVPVVMLSTGPEREEYLWLRPLLEEVRL"
FT   CDS_pept        complement(421414..422526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="HTH_0420"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68884"
FT                   /db_xref="GOA:D3DGD2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD2"
FT                   /protein_id="BAI68884.1"
FT                   /translation="MKALLVSLSYPDQNKEEVREYIEELKELVKAVGGKVLGYVVQRRS
FT                   APDARYYIGAGKLEEIKQVIEGVSADTIIFNTFLSPSQIHNLENALGVKVLDRADLVLE
FT                   IFSRRVRSKTAKLQVELAKLELELPRLYGRGKELSRLGGGVGTRGPGEQEAEVRRRWIK
FT                   KRIQQIREELEEVKKQRKEQRKRRDRWHSDIRIVKVALVGYTNVGKSSLMRLLTGRETF
FT                   VADMPFATLDTKTSDVYLSKDIKVLITDTVGFIRDLPHELIESFKATLEELQEADILLH
FT                   VVDISDKKWLEKIKVVRKVLAELKVDEKPTLYVFNKADKLVESEQDIELLTEPAFLGEK
FT                   SVVISAQKGWGIKKLLSTIKEMVEEFIEVS"
FT   CDS_pept        complement(422526..422738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq2"
FT                   /locus_tag="HTH_0421"
FT                   /product="RNA chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68885"
FT                   /db_xref="GOA:D3DGD3"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD3"
FT                   /protein_id="BAI68885.1"
FT                   /translation="MYPIEKNNNIQDELIEEFKRKGATVTVFLTRGNRITGKVLEHDKY
FT                   TILLEVDGQPNLIYKHAISTIVQGA"
FT   CDS_pept        complement(422800..423330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68886"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD4"
FT                   /protein_id="BAI68886.1"
FT                   /translation="MIDLLRQFVVETGKPLDIILVGAMALPFYHVKLRFTQDLDAEIKQ
FT                   GDIEELYSYLKAKGLESDLSENISGWSIISMPSGYRERSRVVYKDQLLTIRVLSPEDYI
FT                   IMKLRRGTAQDIEDAIEVAIAQKVKKEDLEVLFEKVLKESIKDTALFNFRRIYQVFTEE
FT                   LGRKVYNQNRPMP"
FT   CDS_pept        complement(423323..423637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68887"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD5"
FT                   /protein_id="BAI68887.1"
FT                   /translation="MREKKIKLKLKRLYGKERATLKELLSDRAGQKLLPYEIALNGLVD
FT                   WKELGVPEDIYRKACVIYSNYHHLIKRETPLPALNEKLPDEEVRRVFEVLRSLESGESD
FT                   "
FT   CDS_pept        complement(423681..424817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="HTH_0424"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68888"
FT                   /db_xref="GOA:D3DGD6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD6"
FT                   /protein_id="BAI68888.1"
FT                   /translation="MYVMETYTRLPVSFVRGEGVYLFDQEGRKYLDLVAGIAVNALGYN
FT                   HKDLIDAICEQSQRLMHVSNLFENPWQEEVAKMLIEKFWTKGRVFFCNSGTEANEAAIK
FT                   LVRKYFKEKGENRYRIITFYNSFHGRTFGSMSATAQEKVQKGFEPLLEGFDYAIYNSFD
FT                   SVLKALRKDTAGIMLEVIQGEGGIRVANYEFIQKVQELCHNEGLLLIVDEVQTGVGRTG
FT                   KFFAYEHFDLKPDIITLAKGLGGGFPVGAVIAREKVSEVFSPGSHGSTFGGNPLACACA
FT                   KVVINKVSELLHHVSDVGEYFKRGLERLKVGKVRGMGLMLGLDLERDCSTIVRKALEHR
FT                   LVINCTAGTVLRFVPPLIIQKDHINTGLAVLDRILKAR"
FT   CDS_pept        complement(424820..426517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="HTH_0425"
FT                   /product="NH3-dependent NAD+ synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68889"
FT                   /db_xref="GOA:D3DGD7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD7"
FT                   /protein_id="BAI68889.1"
FT                   /translation="MKSKLNITIAQMDITVGDVEGNAIKILKIWEEYHRVSHLIVFPEL
FT                   ALSGYPPEDLLLRMDFIKECQRWLDIIRDASAKFEAMALIGTPFYEGDLYNSALLVGGG
FT                   KLLAYYHKHFLPNYSVFDEKRYFRKGTYGTMVELGEVKIGISVCEDLWHPDGLERTYAI
FT                   MGAHALININASPYYFGKYEFKEAFLKARAEDNLCYVVYVNAVGGQDELVFDGRSLVID
FT                   PDGHICARAKAFEEDVLTVSLDVEKVKRRRLLDTRLREGKEKYHVISCGADTYRELEVF
FT                   PPRVERNPKDEEEIYTALKTGLEAYVKKNNFSKVVLGLSGGIDSSLVACLAVDALGSDR
FT                   VVGIFMPSEFTSKESKEDAVSLAKNLGIELYQFPIDVIFKSFRDTLGFTDFGVADENLQ
FT                   ARIRANILFYLSNRYGWLVLSTSNKSEASVGYTTIYGDMAGGFAPLKDVYKTLVYRLAR
FT                   YRNSLRPDIPERVFQKPPSAELRPGQKDQDTLPPYQMLDQILTLYIEEGLSQEEIVQKG
FT                   IDRETVEKVIRMIRLAEYKRRQAPVGIKITPRAFGKDWRMPITNMWGY"
FT   CDS_pept        426558..427214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68890"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD8"
FT                   /protein_id="BAI68890.1"
FT                   /translation="MKKLALLGMLSFAVFSCGGGSGSGIYGSYDTVLVGITSLVPAKVN
FT                   SDTVVFVGDAGQRCQLTFQDDAINIKIKSETIKNVAGQPVTPNPSPVYFDSYRVIWSSA
FT                   VSNNACEGAPECRQIFATPFAQLTSITVPPDSEVEVQGLVVTLASWKSSVLSQYCVSSL
FT                   DNCIYNAILELHGREVLTGKEKIVRGSFNIQFANYDQGNACGASACAQDSTVCIR"
FT   CDS_pept        427229..428887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68891"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGD9"
FT                   /protein_id="BAI68891.1"
FT                   /translation="MKRVFLSTLSLLVVFGFSFSLQPVIRIFPSSPYDYGPTTIDTTKT
FT                   TDFAITNIGDATAGPLRICGTSVPSGFENFKIVADNCTGKSLNYGESCTISVRFEPRQK
FT                   LAYTGTLSVIYDDDGDATACNTQKNAIVNLTGKATAIKISGTGCDPSRFICDFSDVDIG
FT                   TNAYKTVRICNASGDPLLLLNPAFTLIENPVGDLPAYGIVTTNCNGANLSFFAGNTDDC
FT                   VNNYCELQLAFSPHDLKTYFGTAQINDANGGPLGQNSGVGIFLRGNGRYPNADIDFGTV
FT                   PIGSFIDRFVNVSFTCPGSGSVTLPDSLVSVSGTYFSLGGSSCPTSCTGGQPVSCNVAV
FT                   RFQPFTAGVFTGRVIVAVPNGTSVERTLVGRGGPATQNFLSLSISSIDFGTVPRFSSVG
FT                   RTIVVRNITSSTLEFNVDVAGSGFFAVMVGCTCNDNYVSNGSFCVPGTPPPTSLRPYKL
FT                   RPGEVCTVAVGFSPPLTARGTLGGVLIFDTQAQAISVPMTAQVAVSNPPTTPPSLPSVG
FT                   SGGGGGCSVSYGNFSTLMAWLSLPIALLMRRFMRR"
FT   CDS_pept        complement(428911..430350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="HTH_0428"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68892"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE0"
FT                   /protein_id="BAI68892.1"
FT                   /translation="MDAEVGRHINHEFLSANGIAPLEEGENFVKFACLKEDAYLKELLE
FT                   RALGKKVIFELVDQEKLKNLLEDPISIGLELEALSEDALDEKKLENIAEEAPIVKFVND
FT                   TIKDAIMRSATDIHIEQFENHVVVRYRIDGILYTVREYPKYIAPPVISRIKILSRLNIA
FT                   EKRLPQDGKLSYSLNGQDYDIRVSTVPSVHGEGVVLRILKRGEINLSLHTLGFREQDVD
FT                   ALLSFIRKPYGMILVTGPTGSGKTTTLYACMKEINTGQKKIITVEDPVEYNLRGVVQIQ
FT                   VMPKIGLTFANALRNILRQDPDVIMIGEIRDLETASIAVQASLTGHLVLATLHTNDAAS
FT                   AFTRLIDMGVEEFLLASAVVGVISQRLVRKVCPNCIYEYKPTTFEEEVLKMNGIERPQK
FT                   LYRGKGCERCNNTGYSGRTVIGEVLKVTEDIRSLVVKKSDAGKIKEQAIKDGMVPLLKD
FT                   GLLKAVEGITTVEEILRVYRD"
FT   CDS_pept        complement(430335..430913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68893"
FT                   /db_xref="GOA:D3DGE1"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE1"
FT                   /protein_id="BAI68893.1"
FT                   /translation="MKRHIHNIRLLSERRVFRAALSFIIAGLFFIGFYYGVYKPFQKKK
FT                   QEMKSLYEERKKLRDELRHKAQELKSLMKEEEKINDQLSKLKDKVATGGDENTIVEQVK
FT                   ALISDKARAYKLTETSFSKEEVQDINGVKKIVLKAGYTSNSVESILRFLKDIEASGIMI
FT                   ESLSLGIDNPSNPSAYYVELRVYKLWMQR"
FT   CDS_pept        complement(430910..433012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="HTH_0430"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68894"
FT                   /db_xref="GOA:D3DGE2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE2"
FT                   /protein_id="BAI68894.1"
FT                   /translation="MFFVVGGKVKKAVALISLSLMSFSCAQMVSGYQEPYTIKQGETEK
FT                   TIKVEKEEKKGKAFEERKEEKVLYEKDYEEKAKEKEVKKAGNISIHFDDITISELLNEV
FT                   FYKILGVSYLAPADLNQRVSVHINHLTKDEVITYMQEILSLYGLGLSVDKGRLVVLPSG
FT                   RSPVGDNLSALVYSPENVSASSLSQAISTFISPSGKIIAQQRLLVIIDYREKLSKLKKL
FT                   LTEIDTPFYGDKKIAFIKTKVDASQIRDNVRKILKLLGKADADSVIDSLEKEGIVIVVS
FT                   KDPVLFNDIKRWIEVLEETSSGTKREIYIYRLNFLDAESTAELLNTLGIFEEGIGISSQ
FT                   QQAQTEAPRSTQEITKIQALPPTDQKPKQTTPETQKKEEMPPAVIEEKAKSEAKEEKKI
FT                   VKVGNIVADKSTNTLIIKATPIEFEVIRSLLRELDVVPKQVLIEMVIAEVSLGKGLQYG
FT                   VEGLLKGFLDSSSFTIGTSFGLAPQADTLQGFKTIIFNKNNDIRGILNFLASKTSLKVL
FT                   SAPHILVKDNEEAKIEVGAEVPILTQQIVPVTGGTLNVQNMVQYRTTGVILKVRPTVSA
FT                   DNSVTLKITQEVSDAVKNTVQPELTSPLITKRSASTTLILRNDQVGLLGGIIQNRLQRQ
FT                   KSGVPLLSDIPGLGILFSNESVSSSNTELILLIKASVITTPEEGQGVKTSFENKLKHLK
FT                   DLLKEE"
FT   CDS_pept        433053..434504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="HTH_0431"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68895"
FT                   /db_xref="GOA:D3DGE3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE3"
FT                   /protein_id="BAI68895.1"
FT                   /translation="MYIPFARKYRPKFFKDVVGQEPVKRILLNAVRLQKVSSAYIFAGS
FT                   RGTGKTTVARLLTKSLNCINLQESGEPCGQCENCLSIDRGSFPDLIEIDAASSRGIDDI
FT                   RAIRDAVSYTPIKGRYKVYILDEAHMLTKEAFNALLKTLEEPPPRTVFILCTTEYEKII
FT                   PTILSRCQRLIFTKLSQEEIVQRLKHICQEENISYDEKSLITIAKLSDGGMRDAVSLLD
FT                   QVSTYAEGNIKEGVLEEFLGIVSQERVREFLRMLLESRVDEAIDFLRQITTRGFNLVRF
FT                   WDALEDEIRMILLYRSLKDPSKVIKVEDFHRSMSQVPINALLYLEKVINTARADAKTRD
FT                   FLRACELAIIKTLVVKDIIPVGELFKRTDLHLTKEDAPQEVSLKDKVINEVEKAFGVLE
FT                   AQRLKNLEAKEEKGRITFLVPESEAKTIDINRIKTRFPEIDFEILSSSKENKEELPEFS
FT                   KKVKDLFGAKVIKHGKGDKGKDTSG"
FT   CDS_pept        434467..434724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68896"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE4"
FT                   /protein_id="BAI68896.1"
FT                   /translation="MERAIKARILLVKVPPELIGIFTSLIDGSGRRAIVRTKESKGDLV
FT                   YLIATPDTYEELIFTVEQIKKHLPQVEMLGETEPSELEIN"
FT   CDS_pept        434814..435860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0433"
FT                   /product="transglutaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68897"
FT                   /db_xref="GOA:D3DGE5"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE5"
FT                   /protein_id="BAI68897.1"
FT                   /translation="MDRREFLSYTFWGACGLISLPSIIYGRNTYRTKFSYAVNLPYEDA
FT                   VRLWVPVPENTSYQKLLHMEVKTNASYYELTADRVYNAPILYAEFKGGNENKSLEVIFD
FT                   VEYTDRSVDMSKLPKNNGNIPDEVAFYLKPTDHVPTDGIVKEYADRITSGKKSQLEKVK
FT                   AIYDWVVENTFRDPQVQGCGTGDVKSMLETGYFGGKCTDINSLFVALCRASGIPAREVF
FT                   GIRVRASSLSKGISSVTKDATKAQHCRAEFYLGQWVPADPADVRKLILEERLSIDHPKV
FT                   RQVREFLFGNWDAHWVAFNSARDFSLEPPLTSGEKVNEFMYPLAEVKGKLIDKYKLTFE
FT                   LSKYTILA"
FT   CDS_pept        complement(435857..436537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="HTH_0434"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68898"
FT                   /db_xref="GOA:D3DGE6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE6"
FT                   /protein_id="BAI68898.1"
FT                   /translation="MKFAICVFPGSNCDYDVYYVIKDILGQEAQFVEYTQKKLEGFDCV
FT                   ILPGGFSFGDYLRAGALASKTPIAKAVQDFAQKGGLVLGICNGFQILTELHLLPGALLK
FT                   NENLRFVCKDVYLRVENNRIAFTRKIEEGEVLNIPIAHGEGRYYVPEDILQQMERNQQI
FT                   VLRYCDKEGNVIPSSNPNGSVGNIAGVCNKEGNVFGLMPHPERASEDLLGSHDGLLFWY
FT                   SLIS"
FT   CDS_pept        complement(436534..436746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="HTH_0435"
FT                   /product="phosphoribosylformylglycinamidine synthase PurS
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68899"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE7"
FT                   /protein_id="BAI68899.1"
FT                   /translation="MKVRVLILPKKGLLDPEGRAIKEMLLENGYQVNDVKVGKVVDLDV
FT                   EEGTDIKMLVESFLVNTLIEEYTIE"
FT   CDS_pept        complement(436842..437012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68900"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE8"
FT                   /protein_id="BAI68900.1"
FT                   /translation="MNHPPTGTVLIYLECVRKRYVVAVFSVCQSEEVENFPLISVLALS
FT                   VLTVFKLFPDC"
FT   CDS_pept        complement(437009..437272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68901"
FT                   /db_xref="GOA:D3DGE9"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGE9"
FT                   /protein_id="BAI68901.1"
FT                   /translation="MGLYDRDYMRKDRKREKREENRILDSLSELFEKLQHREERIEKPK
FT                   QEGVKTEKERQVRKPDLALYFWILSGVIAVGLLIFMLIKAHA"
FT   CDS_pept        complement(437323..437652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68902"
FT                   /db_xref="GOA:D3DGF0"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF0"
FT                   /protein_id="BAI68902.1"
FT                   /translation="MSRKGKEFEDIACKYLESLGYQILARNFYCKGGEIDIIAKDGDTL
FT                   VFVEVKGTKAKSFGDPAERIDRIKMERLLRCIEEYLSLCHTESLRLDALIIRGKDIEHI
FT                   RGIEL"
FT   CDS_pept        complement(437627..438577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaE"
FT                   /locus_tag="HTH_0439"
FT                   /product="ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68903"
FT                   /db_xref="GOA:D3DGF1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF1"
FT                   /protein_id="BAI68903.1"
FT                   /translation="MKLDKDTVLRVFERLRSLKILVVGDVILDRYVFGKVERISPEAPV
FT                   PVVEVEREEFRLGGAGNVASNLSALGVKTYLVGITGEDYGMHMIKGLLRERDIQDLTVR
FT                   DSSRPTTEKVRVISMSQQLIRIDRENTRTVQGENLRKILDRLEVYVDGIIISDYAKGVV
FT                   CKEVIEKVKSTGKFYSVDPRPQNVHLYQGAHLMTPNEKEARQMFKAQTLEDLGWGLKRE
FT                   LSLQALAITLGPKGIALFENRLSLYPARARQVYDVTGAGDTVIAVLTACRVAGFDWDIS
FT                   CELANVCAGIVVGKLGTASPSIEEVIEYVEEGERV"
FT   CDS_pept        complement(438567..439802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="HTH_0440"
FT                   /product="aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68904"
FT                   /db_xref="GOA:D3DGF2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF2"
FT                   /protein_id="BAI68904.1"
FT                   /translation="MHLVIKFGGTSVGSLERIENAARKVIEKVKEGYKVVVVSSAMAGE
FT                   TDRLINLARQLDNFPPEREVDMLISTGEQQAIALFAITLNKLGYPAVSLCGWQVPIITD
FT                   HVHTKARVRKVGIQRIKNLLKEGYIPVVAGFQGVTEDWEITTLGRGGSDLSAVVLAHAL
FT                   GADCEIYTDVEGVFTADPRIVPQARKIPRISYEEMLEMASLGAKVMQARSIEFAMKYNV
FT                   RIHVRSSFSDVEGTWILPEEEVMEKVAVRAITLDTKESRITVVRVPDRPGIAYSIFKAL
FT                   GDAHIVVDMIVQNVSHQGYTDMSFTVNKTDADLAESIVRKVAGDIGAQEVVRDDHVAKI
FT                   SVVGIGMKSSYGTAAKMFEVLYRNNINIMAISTSEIKISCLIESKYGELAVRELHSAFI
FT                   EEGEEVKVINET"
FT   CDS_pept        439827..440609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68905"
FT                   /db_xref="GOA:D3DGF3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF3"
FT                   /protein_id="BAI68905.1"
FT                   /translation="MRILLVGVGNMGRKYLTKITELGHTPILCDTDPGKRVNGFSFYCH
FT                   VEEVKEQVDAAIVAIEPSQHVKVSKPLLEMGLPVLLEKPPALSYREFQEIEPYTHLYIS
FT                   EIETFSSCLKYFPEKVQSLSIERLGRSKGYVSPLWDLAWHDLYLLQLFFENIRITQVKT
FT                   GEVWEINGEVDRIPFSLKVAWEHPAPSRKWIINEGELILDLAKEEVWVKGELLHSEPRD
FT                   KLKLMIQAFLKDEFNQRSRERAKRNLSLLEEAESLLRT"
FT   CDS_pept        complement(440571..441932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0442"
FT                   /product="sigma 54 dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68906"
FT                   /db_xref="GOA:D3DGF4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF4"
FT                   /protein_id="BAI68906.1"
FT                   /translation="MERLLYTKDQHFRLEGFERVEELPEDISKSLVIVDIDSVGLSCLP
FT                   DLLEGENIAVAVTGKRIPGYTIKLVSLGFYHVLFKPVSSNKLKELLRSLESLERERDVI
FT                   LLPEEENLSGELCKELCSIVGDPEGKMRDVLLKIGKAAPLDVPVLLLGETGVGKEVFAK
FT                   ALWKTSKRWNGPFVAVNCAAIPPELLEAELFGYEKGAFTGAFSSKEGLIESAKGGVLFL
FT                   DEIGDLPLHIQPKLLRVLQEKKLRRLGSTKEVHCDFRLVCATNRDIKKLVKEGLFREDL
FT                   YYRISAVEIHIPPLRSRREDIPLLINCMLRNLSKEIGKRIRGYTEGFLKKALTYSWPGN
FT                   VRELENALRRAITLCKGEVLRAEDLEVEHQDYSQENLEDALKEEVKRLLTEGEGNLYYR
FT                   LMDRVSKIIVGEAFSFLGRNYSRTAKVLGINRITLKRILQKTSSPEKALSFLQE"
FT   CDS_pept        442063..444717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0443"
FT                   /product="ferredoxin-nitrite/sulfite reductase and
FT                   phosphoadenosine phosphosulfate reductase fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68907"
FT                   /db_xref="GOA:D3DGF5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF5"
FT                   /protein_id="BAI68907.1"
FT                   /translation="MREEVIEKNPRERLKAEKHPLDILEELPTIIDRGYEDTPEEDMVR
FT                   LQWYGLYHDKPRVGYFLLRVKVPGGILNPEQLRVVGELSSRFGDYAEITLRQDIQLHYI
FT                   RLEHLPDVFESLKSVNLFPVGACGDTVRNITTCPLCGLEKDELFDVRECVQKLEGFFHH
FT                   PENRDYFNLPRKFKITVSACPYHCNMPEMHDLAFVGTVFEGKEGFAVWIGGGLSSTPRI
FT                   ARKLGIFVEKERVLSLAKAVVDLWSEDPENRKSFVKARFKYMVDRLGVEKIKSMILERL
FT                   DFTPQPLDEEPLPVKRYFHTGVGRQKQEGFYYLGIPLPAGRVRGSQLLALAELAQEFNL
FT                   SIRLSQRQNIILVNISQEDLREVRDRVKELGFHLDVGETRAISVACTSDPFCNYSVGSA
FT                   KEALLELLDYLEEKLGKLEGVSIGVDGCPHACAHHWLNDIGLQATHLRHPDGSVETTYN
FT                   LVLRGGYGRRASIGKIVAKKVPLERVKVYVERLILAFRSSKLEEFYEFVNSKSDEELLS
FT                   IMEGKATQAKEEVKRSVKIRIFGPLTRFSGGLSELEVSANTVRTALEHLEKEFEGFKGR
FT                   LFDERGELKPFVKVFLNEEDVSFLKGLETPLKDGDELMLYPALAGGSHTFDELELHELA
FT                   LEFEEKPAQELLVWAIENFHPRLYIAWSGQVEDMVLLDMAWRINPDVRVFAVDTGRLHE
FT                   ETYRLMQEVEDRYGVRVEVYFPDAKDVEELTRKYGINCFYKSVELRHLCCHVRKVKPLL
FT                   KALSQVDAWITGLRREQWASRHNIMKIEVDHDHGQIVKINPLADWSEREVWEYIKKNAV
FT                   PYNKLYEAGYRSIGCEPCTRPVAPFEDPRAGRWWWEKDAPKECGMHCSIETGGFEKIAD
FT                   KVIKEEKDGSEDT"
FT   CDS_pept        444698..444985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68908"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF6"
FT                   /protein_id="BAI68908.1"
FT                   /translation="MALRILERVNIEKLKEELFKRGWNEGKFNSRQAMLKEFNDYLWVA
FT                   VLEKEPYFLSLPKEESSRVHSEGMKALREEVESLALTLGFSLPTKGGSYA"
FT   CDS_pept        444978..445727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0445"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68909"
FT                   /db_xref="GOA:D3DGF7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF7"
FT                   /protein_id="BAI68909.1"
FT                   /translation="MLEYLLLGFFIAFAIGLTGVGAGTLTAPVLILLGLNPAQAVGSAL
FT                   SFSTLVKFPGFLFHALYKNVEYRLLMFMCFGGVPGVLLGSSLLSRLSQADKLKNLIMFI
FT                   IGITVILLVILNLLGTLMKRRIDLTRYFYLIPLVCFFIGLEVGFTSAGAGALGMVLLLY
FT                   FTRLPPSKAVGVDIGFGLACSLTGSLAHLLQGHTQPHVFLPMSLGGLLGIWLGTHLTRR
FT                   INPKPLRVGISMLLILVAFNLIKRGLS"
FT   CDS_pept        445727..446494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA1"
FT                   /locus_tag="HTH_0446"
FT                   /product="uroporphyrinogen-III methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68910"
FT                   /db_xref="GOA:D3DGF8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF8"
FT                   /protein_id="BAI68910.1"
FT                   /translation="MGKVYIVGAGPGDPELLTLKAYRLIKSADVVLYDRLVNPEILLLA
FT                   KPECQLIYVGKEEGKHTLEQEKINELLLHYAHTKEVVVRLKGGDPFVFGRGGEEALFLA
FT                   EHGVEVEVVPGISSATGVPAYAGIPITFRGLSSSFAVITGHEDPKKERTSVDWESLKGI
FT                   NTLVFLMAVSNRKEIARRLIEVGRDPKEPVAFIERGTTREQRVVITDLYELANYPPEVN
FT                   PPALMVVGQVIKLRKLISFKEVVACFYPTVENL"
FT   CDS_pept        446464..447615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0447"
FT                   /product="sulfate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68911"
FT                   /db_xref="GOA:D3DGF9"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGF9"
FT                   /protein_id="BAI68911.1"
FT                   /translation="MLLPHGGELVNRVVPERERAKVLEEAKSYPSLVVDTDALLDIENI
FT                   AVGVFSPLKGFMTHEELLSVAYHMSLPGGVVWSLPVLLQLREKPEVDGRVALKDTSGRI
FT                   KAIVDVKEVYRIDLPLIAKLVWGTESEEHPGVKLFYSKGEWAVGGDVWLLEKVEFPFRD
FT                   WILTPEETRKIFEYRGWKTVVGFQTRNAPHRAHEYLQRIGLEVADGLFVNPVLGWRKSD
FT                   DFDPLTVLEAYEYLINSYYPKNRVLLSGLATAMRYAGPREAVFHAIVRKNFGCTHFIVG
FT                   RDHAGVGDFYDPYEAHRIFDRLPEDIGIEIIKVSAVFYCRSCDCIASEKSCGHEENQRV
FT                   YVSMTKIRNMLREGKFPPEEMIRRDVAELLIKRRTKSLTNVHS"
FT   CDS_pept        447630..448826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA1"
FT                   /locus_tag="HTH_0448"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68912"
FT                   /db_xref="GOA:D3DGG0"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG0"
FT                   /protein_id="BAI68912.1"
FT                   /translation="MEHFDVVIVGSGPGGYMSAKLLLERGKSVALVEKSVFGGVCLNAG
FT                   CIPKEGLYKLALEKSKPRWKVAVQMVQGKVIEIRDTSLKALLSKGLTYVEGDGELIDER
FT                   VIKVGNRRLTASHIILACGSKQREPGISPEDVLRGWAIPKNNVCIVGGGAAGCELAFIL
FT                   SSFGFKVYLVREDTVLKGYRNIPEEFALKLEDALERCGVKLVENTKNVDADLVIRATGR
FT                   IPNFCQERFPFVAVDERGFVRTDSFLETDTKGIFAVGDIVPPMGAGYAFEKARVAVRSI
FT                   LYDKERVFDPRKVPVIISSAYQIGFVGDVKDAKIFVTKPLGTNPKAYVTENDGIISVGF
FT                   DDSGRLVYCCLIGREVGEILNLCATLLGKNLEEHLSFAHPSYGEIINEILSIKQEVCR"
FT   CDS_pept        448823..449311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68913"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG1"
FT                   /protein_id="BAI68913.1"
FT                   /translation="MKDQEVLSRVRIFLREEGVIVPKGPIKEFYSQLMKLSGFGIGGLL
FT                   VFSGKKAGKMAGTYIKSIVGDENPSVEKVADYVSAFLEETGICKVENYELSDSQIIFKV
FT                   KDSIFAQDVDNKKPVCMPLSGALAGVFEEVTKKEWDCREIECQAQGKERCIFEIKLKH"
FT   CDS_pept        complement(449301..450284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0450"
FT                   /product="NHL repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68914"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG2"
FT                   /protein_id="BAI68914.1"
FT                   /translation="MKIEVLGIVGAPSNFSLQVPDAKASPYTLYGPRGVFLKGDVFIVA
FT                   DTGNHRVLVWKAIPLHGEPALVVLGQRDFYSDSPNAGGDTERGLFMPTGVFLSDDGKLF
FT                   LADAWNHRVLMWEKLPEENFSKPDHVIGQPSLKSVDRNMLFWCFGVYYDGYLYVCDTGN
FT                   RRILRWKGVPDSMQKPDDVYEGFSWPHTLCKNEDRFFVADAGTGVSKVYVFENSLSDAY
FT                   NCNSYIGQREGCDEMSLNLPYGVSANGDFLFIGDTSNNRVLVFRGDSVKPVAVVGQRNF
FT                   FECGENRWEKVDEQSLCWPYAVFSTENILLVADTGNNRVIIYRFSV"
FT   CDS_pept        complement(450281..451108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0451"
FT                   /product="nitrogen-fixing NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68915"
FT                   /db_xref="GOA:D3DGG3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG3"
FT                   /protein_id="BAI68915.1"
FT                   /translation="MTEELSFEKLAERIDELLAKVKNFEDEKRETVGELIKSIEEFTRM
FT                   ALVKLVKLMKEDSAGKDILLKAVREPEIYSLFLKHGIIREDDRTKAIKALELIRPYIRS
FT                   HGGDVEFVDLKEKTLYVRLRGTCTGCSQVSFTLQQTILEAVQAYIPHIEKVELAKDTPV
FT                   EAFLELSGKEEGYIKAFDISELKEGHVYRFLHEGVDVILMLWKGRVYAYRNSCAHQGHP
FT                   LHEGELTEKGVLVCPWHRFEYSITSGECLTVPYVQLVSVPTKIQNGWVLLKVR"
FT   CDS_pept        complement(451092..452267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68916"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG4"
FT                   /protein_id="BAI68916.1"
FT                   /translation="MSWREVFPQPVGILPFPFDFLILPHSNLWQEHIPTVLLLKLEGLP
FT                   SEWKFILSLKEKDWKQALQNILSISEEDVKNYNLSLITGSKQTVKDKTLAYLLDIVFSD
FT                   RFDIRDMGRDDLNALVLYRKAQLLEGEGKIEDAIAMIENALRLVRDLSPLFYANLLLKK
FT                   AKLFMEHKGVNYAVLALLEELEEKLSEADFLRAEVQFNLGNAYSSLGNLSKAISYYWKA
FT                   LDFFTVDKDPYMYALINNNMGLAYLSSDVSDLEDQVRLAYGVQSLRNALKVFTKERYPK
FT                   EWASTTMNYANALQYLPTANPAKNLLKAVELYREVLDYRKEVGDELGYARTLANMGNAL
FT                   AHLGRLFEARRHLIEAFEIFKKYGMEEEMNGIREVLEEIHMLMEARHDGGA"
FT   CDS_pept        complement(452267..452485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68917"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG5"
FT                   /protein_id="BAI68917.1"
FT                   /translation="MFKDRALIAETFVEEKDGQWSVFIEVLFKDETVRYEVGRYFTKKK
FT                   AELAAGYIKRCANRDIPHPNDGLGGCC"
FT   CDS_pept        complement(452501..453259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxM"
FT                   /locus_tag="HTH_0454"
FT                   /product="Ni,Fe-hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68918"
FT                   /db_xref="GOA:D3DGG6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG6"
FT                   /protein_id="BAI68918.1"
FT                   /translation="MRKVVIVGCGNPIRGDDGVGPRLIRYLWERGLPPHIKLVDGGTSG
FT                   IDVVFHMEGADEVVFVDACCTGEKPGTVFCVPHEEVEELPSSEEANLHSIKWYHAVAIA
FT                   RHLLNGNYPKSIKVYLIEGKSFGIGEVLSEEVESAMKRLAERIIKEYSIEGGKVVELEL
FT                   KEDGYLIIPADVAERYLGGCMSVLVIPRGMHFTLLPLPTSAQGGLLLKRINKEGDRAVL
FT                   LWELLPPGTPFGKKKAVWSDEEGGLVVSLI"
FT   CDS_pept        complement(453256..454890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxL"
FT                   /locus_tag="HTH_0455"
FT                   /product="Ni,Fe-hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68919"
FT                   /db_xref="GOA:D3DGG7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG7"
FT                   /protein_id="BAI68919.1"
FT                   /translation="MATKQHLVIDPLARLEGDVRADVFVEDGHVADVQVEAVMFRGFEI
FT                   ILRGKDPLAGLIVTPRVCGICGGSHLYKACQALDTAWRTEVPPNAWHIRNIAQACETLQ
FT                   SVPRWYYAIFAIDFVNKNYAKSKLYDEVVRRWAPFVGTSYKIGLEVSALPVKVYAMFGG
FT                   QWPHSSFMVPGGVMCAPQLDHITRAYALLERYRTEWLEKVWLGCSVDRWLENKTWDDVL
FT                   KWLDENESHRNSDCGLFIRFCLENGLDKYGAGVNAFLACGTYIDPEFYPVSTIEGRNQA
FT                   LQSPSGVVYNGKYYIFDQMNVREDITHSYFEGSSMLHPWEGETVPLDPEVAKKQGKYSW
FT                   AKSPRYLIDGKPVPLEAGPLARQVVAGYEEAKSACSASGCIEHAIDPLFKNIVSKIGPS
FT                   VMVRVLARMHEAVKYYKWVKTWLAKVNFDDDRFYKKPKELPEGKGYGGTEAARGALQDW
FT                   IVIENGKIKNYQIVTPTAWNIGPRDSKGQMGPIEKAIVGAPIKNPEDPIEVAHVARSFD
FT                   SCLVCTVHVYDRKRGKELARYKLGTFK"
FT   CDS_pept        complement(454916..455887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxS"
FT                   /locus_tag="HTH_0456"
FT                   /product="Ni,Fe-hydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68920"
FT                   /db_xref="GOA:D3DGG8"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG8"
FT                   /protein_id="BAI68920.1"
FT                   /translation="MATVLWLHGGACNGNTMSFLNAEYPSVCDLVTDFGIEILWHPSAG
FT                   LEMGNQVQALLRDILAEKIPLDIFVFEGTVVLGPNGTGRYNMFAGRPMKDWVYELAHVA
FT                   KFVVAVGNCACQGNIPAVPPNPTESTGLQFHKTKKGGFLGEHFVSRGGLPVINIPGCPA
FT                   HYDWITQILVALAVGRASDIQLDEYNRPLTFFKTFSQTGCTRVQFHEWKISAEEFGQGT
FT                   RKGCLFYELGCRGPLTHAPCNRILWNGVSSKQRSGHPCIGCTEFAFPWFDLAPGTIFKT
FT                   QKVAGVIPKESVYEADKFTYMLHAVTARIAAPKWATEDIFVV"
FT   CDS_pept        456038..456469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68921"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGG9"
FT                   /protein_id="BAI68921.1"
FT                   /translation="MSYHEQTLLEGLTVGEAKEQLSQLIDKLETINFLLSSLEELMQRT
FT                   PFILESISSEVIRFREKFRESEDGIKNILELAYNAVDFLGKENLASLLNGLLEAYTEVK
FT                   QHDYRTSITGIVRAMTDPDVQRALAFVLLTLKKMGMSMR"
FT   CDS_pept        456474..456923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68922"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH0"
FT                   /protein_id="BAI68922.1"
FT                   /translation="MENHYIFLRRPEDELVEAYFKKDENIRHLTTFLNSLDALAYFAEI
FT                   LHEYVESREDLSRYVHEREDRREAVKAGAEKLDFLIRELVGTLELGNLAHFARANYEAY
FT                   EDTKKNPRRVGLLGIYRELRDPDVQLALGFVFTLLKRIAYLFKEK"
FT   CDS_pept        457039..457722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68923"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH1"
FT                   /protein_id="BAI68923.1"
FT                   /translation="MKRFFLPLILSSLSMSHDLWVEREGSQYALYYGHLHPVQGEEKFI
FT                   KYKPEDVLKFECVSSGGKPLQYKFEKSYPARLKGSCGAVLAVFSSGYWTKSVEGLKNLP
FT                   KDRVQGAIEGWLSYESVKRIDSWSQELKKPLTDDLEIVPLENPLEAKVGDKLTFAVYYR
FT                   GKPLKDAVVAYDEKPVGSTDDDGRINIRIKRKGLQLISTSVKEKADGVKADYVVKTANL
FT                   SFEVK"
FT   CDS_pept        457722..458144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68924"
FT                   /db_xref="GOA:D3DGH2"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH2"
FT                   /protein_id="BAI68924.1"
FT                   /translation="MWLLLLLLSLSFAHDLQHSLLREGNCIVLSFYFPDNTKFSYEKYE
FT                   VYKEDEKLPFQVGRTDALGRVVFCPDKRGEWTVRTTSEDGHGAIVKVRVDKASVKTESS
FT                   LFERYQKVFVGMGIVLGIFGALELYIRRVSWVRKFL"
FT   CDS_pept        458141..459172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68925"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH3"
FT                   /protein_id="BAI68925.1"
FT                   /translation="MTALLCCGLSFAHHGVAALGAASLEGPGAPLETSSSATLPEGSWL
FT                   FYLKLDHVKWKKYSFQDFPDQKSTYDFWMYGLGYGVKPWLSLYLFVPYYVKKELKSING
FT                   DPTQGQYSYTNSDFADISLMAVLGFKYDRGFRLVPKKESLDDLMDWHFTLYGGLSLPTG
FT                   NPNKYDRARDPKGEFEPDMSTGFGKPAITLGFTATKQLVSLPRLTFVFDTNYIKFFENT
FT                   YNFRESPDAPRKKYKFGDEFRLNTALAYRLYTNAERKFRADALLEANFQYNQRDKEDGV
FT                   KLEGSGGKILYGVLGTRLYYKNISAGLGVKVPVWKKLNEESQQQGAEGKEKYRLILTLS
FT                   ALF"
FT   CDS_pept        459184..459831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="HTH_0462"
FT                   /product="cobalamin biosynthesis protein, ABC-type cobalt
FT                   transport system permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68926"
FT                   /db_xref="GOA:D3DGH4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH4"
FT                   /protein_id="BAI68926.1"
FT                   /translation="MHIPDGFVAPQVYVPAYLIDGLFLVYSFGKFRKALKEKTIPYIAS
FT                   LSLLSFVLMSVAVPLPGGTSVHSLGVASLSLLFGPWVAFLCVSLLLFLQAVVFGEGGIT
FT                   TFPINSIGMGLLGSFCAFYTYRVMRAFFSDKISLFLAGFLSTLFSALLIAVILGLHPHL
FT                   FKDASGKPLYFPFGFSVVIPALLLPHIIVGVGEGILTYLVVEFLKGRVGYEG"
FT   CDS_pept        459821..460393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="HTH_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68927"
FT                   /db_xref="GOA:D3DGH5"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH5"
FT                   /protein_id="BAI68927.1"
FT                   /translation="MKDKALFLLYITFLIWASSMHSVESLLAILLLLLVLLALLPVKAR
FT                   EKLRVLKRTFLSVFLFSLFVPLPYFVVGLFTGENRLDYLLMINARTFAMTMSTFMFLET
FT                   ANLFKALDFSKNLSLLLVLVSSHALSYARILKEFTDAFRSRSPSRRMKKEDTKHYLIRV
FT                   LSYFFDKSKETSEDIYTAMKSRGFYYD"
FT   CDS_pept        460386..461159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="HTH_0464"
FT                   /product="ABC-type cobalt transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68928"
FT                   /db_xref="GOA:D3DGH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH6"
FT                   /protein_id="BAI68928.1"
FT                   /translation="MIELRGVYHSYDGEEVLRDINLTVKEGERVVLLGINGSGKTTLLK
FT                   ILNALILPQRGAYTYCGVRVDKSKLKDRDFVRSFRKEMVMLFQNPDVMLFNPTVYDELA
FT                   FSLRQLGFEEKQVEERVLHWADRFDLIEHLDKPPFKLSGGQKQKLCLACLLVLEPKILL
FT                   LDEPTANLDPRTTGWLIDLLYDLNITTIVSTHNLSLVPELGDRLVVLGEEHSIVYDGKI
FT                   ETFLRDEEKMLKAGLLHKHRHKHGDREHAHYHFHL"
FT   CDS_pept        complement(461150..461656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def2"
FT                   /locus_tag="HTH_0465"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68929"
FT                   /db_xref="GOA:D3DGH7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH7"
FT                   /protein_id="BAI68929.1"
FT                   /translation="MRRLEILKYPDERLKIPSKEVSDFGKFFSEFLESLVFTMRSSPGC
FT                   VGIAAPQVNVHKRVIVVDTSISKHKENKLSHGLLVLVNPIILQREGEIVIREGCLSVPD
FT                   YTGNVKRHYWIKVSALDVKGNPVEFETEGFEAVVIQHEIDHLDGKVFLERLVSPKELFK
FT                   RKVYR"
FT   CDS_pept        complement(461653..462177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0466"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68930"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH8"
FT                   /protein_id="BAI68930.1"
FT                   /translation="MKFFILSIFGKDRPGIVAGVSEALYRLGLNIEDSSMTRLNGEFTI
FT                   MLIVSSERNITSENILESLKDVKEKFHLFTLCKEVQKLDQKEHKPTELYRLVVFGSDKP
FT                   GIVYSVSKLLAQMGINIYDLKTEKRGDLYVMIIQAESQEDVFEELSKKLDDIRESLRVD
FT                   ISLEREEEELL"
FT   CDS_pept        462192..462512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68931"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGH9"
FT                   /protein_id="BAI68931.1"
FT                   /translation="MEEKDQLKFYISEIAKLMGLAQPVGFMLSYEVGDIWIDVYVERGE
FT                   DEWQNRTYTISVPKNKGDKLRNFVEAVGGNTSDMMADAERVYASLTQEDWEQVSTSIMN
FT                   LL"
FT   CDS_pept        462521..463375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0468"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68932"
FT                   /db_xref="GOA:D3DGI0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI0"
FT                   /protein_id="BAI68932.1"
FT                   /translation="MRIGFAGLGHLGKEIARRLISEGIELVVWNRTKEKALDLGVAIAD
FT                   TPADLIKQVDRVFLIVFDSQASEEVIFGKGGFVEGDVKGKTIIDMTTNHYAYAERAYQE
FT                   LKKYGAYYLDAPVLGSVVPAQKGQLVMLVGGDKEKYEENLPLFEKFCRKIYYVGKAGNG
FT                   TKLKLINNIVLGGFMELLAEAIAIGELAGFDRELLISILSEGAGKSYILDVKKQKLLDE
FT                   DFSTHFSVDLIYKDLHYAQDLLRDVKAFSFALQNVKEAYGKARSMGLGELDFSAVYKIF
FT                   KKT"
FT   CDS_pept        463423..464091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="HTH_0469"
FT                   /product="phosphate uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68933"
FT                   /db_xref="GOA:D3DGI1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI1"
FT                   /protein_id="BAI68933.1"
FT                   /translation="MKLFEELEETKQLVLKMAGLIKNAVEKAIESLNKQDIELAESIIK
FT                   GDDEIDQLEVEIERRCIRMIALYQPEAIDLRLIMGIYKVVSDLERIGDEAENIAERAIL
FT                   LAQEPPLKPYVNLTLMAGHVKDMIEDAVMSFFQRDTELAKKVIARDDTVDELYHQLERE
FT                   LITYVMEDPRNIKKVINLSFVGRHFERMADHAENIAEMAVYWSEGEVIKHQHIKEKGMV
FT                   "
FT   CDS_pept        464088..465848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0470"
FT                   /product="histidine kinase sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68934"
FT                   /db_xref="GOA:D3DGI2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI2"
FT                   /protein_id="BAI68934.1"
FT                   /translation="MRLYLTFLLIFLIFLGINIALLDNLRKVWQIGFPIILLVINIDLL
FT                   VLVIVFAIFFRKFIKVYLEGSKKRLRKKLSQALLLYIFVPILFLNFATSFILIQSTKTL
FT                   VSSQLKDVAQKAQILYESLKKREQERIKLYREFFAFLVSRGEDPRAYLRGLKEVESIEP
FT                   AKNCLENLMEDKAVMCIGGYRIVLKRDKETLGNINSLYYVSRQIRNLVKSRDVISSVYV
FT                   YFLVLITLITLLATVWFGNLVARYISLPLERLSSKVKEIAKGNFSIKVGVPYTGDEIQE
FT                   LSEAFERMRSELQRTYTKLENDKRMLEGLINALPVGVVYIHKDGSLMVNESFKKMFGEK
FT                   VKAEEDLAKIQNKAYIRQVAVESEEGKVFIYEDLQPVILSERFKTWQYAVKRIAHEIKN
FT                   PLTPISLNLERVLRLLEKEPLSKEKITESIRVVLEEIARIRDTINKFRDLSVEREPKLE
FT                   ELSLKDIIRDISKLYTGISVEVQGDKKVYADREMLRDMFLNLFNNSLEWHAKKVSINIR
FT                   EDALEYVDDGRGIEKGKEELIFIPYHSESPQGMGLGLAVVKHIAQVHGWSVKALHNPAG
FT                   FHLVVSFRPM"
FT   CDS_pept        complement(465818..466267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68935"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI3"
FT                   /protein_id="BAI68935.1"
FT                   /translation="MKNPFQEFTRYSEWKERFLKDRDRIKEINPKSSRLSEAIAAMYVG
FT                   GLEHRTQDEEIKKWTDWAGEKTYRTFNGFPQLSDEELSFLFYCLGKLFVPLLLHEKGVK
FT                   SESFKALTQEEQESAVSDVLDTIWENHIIRILQVLPYMGLKETTK"
FT   CDS_pept        complement(466264..466833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68936"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI4"
FT                   /protein_id="BAI68936.1"
FT                   /translation="MICLTHLELCPYCKRVALQVCEYDEPYPRVTAECQCCGYKAHDVP
FT                   MKLTREDFKSILDKLGRKLIGEVCIDDRCGSDKVLKLLQEGAYAEYRCLDCGAEWNSEE
FT                   IQRAINRVKRVQNALKNGNRLLEVLKAGEGECPLCGWDVGHIHVGYAVAIECFVCGYYS
FT                   KVEEIIPDVDLTTLECPEYERSEETG"
FT   CDS_pept        complement(466869..467960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0473"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68937"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI5"
FT                   /protein_id="BAI68937.1"
FT                   /translation="MQAKEIKRSLLFSLEFANAGKKKFLDQLWEEYKNALQYFVDKGFD
FT                   ERSLPSYEHVKTYSHKTWLSKRYLGCALLQAVDILKSVFQRKKKVNKPEVKKVSLKLDK
FT                   RFYRLERGNNSFNFWFLLRNPKDKNWVHFPVKNYRYAQKYFDEWKLSSGMELLKRDGKW
FT                   FLKLTFKKEVVLEERGPKGIDIGYRKLITLSDGQVFGREIKEIIEKKILPKKQGSKRFK
FT                   RVLDYLKTEVNRVLKQVIDGSFSPVLEKLKNLKRGKRGKWRRDINRRFNYWMYGYVLRR
FT                   IKELCEVAGVQWHIVPASYTSRTCPQCGYEDRANRDGEWFHCLNCGYENDADVVGAVNI
FT                   LWRFGREPIVPYPAKPPSVSLNL"
FT   CDS_pept        complement(468021..468953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="HTH_0474"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68938"
FT                   /db_xref="GOA:D3DGI6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI6"
FT                   /protein_id="BAI68938.1"
FT                   /translation="MGKIAYIFPGQGSQYVGMGYDFYREFSEASDVFHSAEVALRYNLT
FT                   DIIFKGPEDELNKTINTQPALLTVSLAIYAVLKANGLPKADFVAGHSLGEYTALAVVGG
FT                   VELFEAVRLAYLRGKYMQEAVPEGVGAMVAVLKLSPEKVEEACRLASDVGVVEPANYNS
FT                   PEQVVISGERQAVEKASQIVKEMGGKVISLKVSVPSHCSLMKPAADAFRLKLAQTPIKN
FT                   IDLPLVQNYTAKAHTMAHEIRENLYRQIFSSVRWYQSLQYMAEQGVDTFVEIGPKNVLS
FT                   KLVVQTLPHARVMNVEKVEDVEKVIKALR"
FT   CDS_pept        complement(468957..469142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68939"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI7"
FT                   /protein_id="BAI68939.1"
FT                   /translation="MEGTLVNGTKSKPYMGKDTPGRVPFPLVSIHQKLLETSYLKPKSL
FT                   IKYSHADKYELGKMER"
FT   CDS_pept        complement(469190..471523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lonB"
FT                   /locus_tag="HTH_0476"
FT                   /product="ATP-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68940"
FT                   /db_xref="GOA:D3DGI8"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI8"
FT                   /protein_id="BAI68940.1"
FT                   /translation="MALKKLSADELFLSFSYNRGTGDVSPVELFPGQDRVEKAFDLALS
FT                   SSSDGYNVFVSGPESVGRTVYTLKRLKEASQNKPPPEDVCYVNNFENPLRPLYLLLPAG
FT                   MGKKLSQNIDRAIEDLKEALPKAFESKEYEDEIAKINKMADQQRERILQELGEEAQRHN
FT                   LGVLFTPAGIRLLPIMGRRLVSEEELLSNEKLQEAYERNLSAFEERFREFMRKLRELDH
FT                   NVADQILDLRRRVAYYVVEKVFSRFENGYKSHEHVRNFINRLKEEIVKSADLFMLWHTS
FT                   KGNLAAMRSLERAFNAFRVNVIVDNSDLKGLPVVHEEVPTLQNLFGRVSYTVEMGVLQA
FT                   DHMSISAGSLHRARGGYLVLRAIDLLKNPYLWNAFKKVLMHKKIHMAGGVLEDSLLPYV
FT                   GISPEPVPADIKVFLIGDPLLYQLLSLYDPEFNRLFKVKAEFNPIIDLNEDFVESFPKI
FT                   IKKIIVDEGIKDLTAEALSELLRYAVTLSGSRKKVSLLMGYIVDVIREANTLSGDSQSI
FT                   DAKHIKRAIEEKIYRSNLIEEKIRKAIEEGKIIVKVDGRHTGQVNGLSVYELGDISFGK
FT                   PSRISASVYIGEKGVINIEREVELSGPIHSKGVLILTGYIGNKYGKDFPIHLSCNITFE
FT                   QSYEEVEGDSASVAELIAILSAISGIPVRQDIAITGSVDQHGNIQPVGGIKEKVEGFYK
FT                   VCKVLGLTGQQGVVVPSRNYDNLILDDELIDHVKAGRFHIYTAESVDDVIELMFDMKAE
FT                   KFHKLVSKKLYEFYKKVAKPKEKG"
FT   CDS_pept        complement(471525..471845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68941"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI9"
FT                   /protein_id="BAI68941.1"
FT                   /translation="MSFIVFVSMTPLGKEESVSKYVARVVDIVDKSGLDYVLTPMGTIV
FT                   EGEDWDQVMEVLKKGFEALKTDCNRISIVMKIDYRKGRTKGLVSKVRAVEEKVGRDIKK
FT                   AM"
FT   CDS_pept        complement(471862..472833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0478"
FT                   /product="aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68942"
FT                   /db_xref="GOA:D3DGJ0"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ0"
FT                   /protein_id="BAI68942.1"
FT                   /translation="MKLLKFLAPLSLIVAYIFYSFLPVSLEKKTVEIPYGMPSTDIAWY
FT                   LYREGVIRSPVSFLFIHTIKKGRLEAGEYEFDGLVFPWDVYRKIHYGFRKTYKITIPEG
FT                   SDVYDIASVLDSYKICKAEDFLKYALSPKTAQNYGLNTFSMEGFLFPDTYLFSKNTHPL
FT                   TVISVMYRNFLKKTEPLRRELEKSGMSLEEWVTIASLIEKETALKEERPLVSAVIHNRL
FT                   KKGMKLQIDPTVIYAMKRKGIWNGKLSSKDLDIDDPYNTYAYFGLPPSPICNPGLDSLE
FT                   SALRPAKVNYLYFVANGNGGHRFSSTYSEHLANVKAYIELKK"
FT   CDS_pept        complement(472830..473231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="HTH_0479"
FT                   /product="Holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68943"
FT                   /db_xref="GOA:D3DGJ1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ1"
FT                   /protein_id="BAI68943.1"
FT                   /translation="MKVLALDYGSKRIGLALGDTSLNIASPLGVFENREGVVEKIRNLI
FT                   SEYRVSLLIVGLPLTPRGQKGQRAKEVEEFVKKLRESLPEEIELLMWDERYTTKEAYWL
FT                   LQDLPPTKRKKLKDSLSAYIILKEYLESL"
FT   CDS_pept        complement(473228..473413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68944"
FT                   /db_xref="GOA:D3DGJ2"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ2"
FT                   /protein_id="BAI68944.1"
FT                   /translation="MEKNMATWDRAVRVLLGIIFLYLAFTKGGAWWILGIIGIVFIGTS
FT                   AVGFCPLYKVLGFKTG"
FT   CDS_pept        complement(473446..473898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68945"
FT                   /db_xref="InterPro:IPR008304"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ3"
FT                   /protein_id="BAI68945.1"
FT                   /translation="MNAFEEFIETLKEGIVCKGKRLYLSKRDKGRFAEEENLTLSLDER
FT                   SLLFAKVFYGRKPYWREWIELFNIEPEFFSSPFEDELYQLISRHFGRIFVEYYEDRETS
FT                   FQLEKGVPAENTRLGQKLIKCGYKYLRNWYYPEGWMEGGQKLQGEK"
FT   CDS_pept        complement(473885..475111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS1"
FT                   /locus_tag="HTH_0482"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68946"
FT                   /db_xref="GOA:D3DGJ4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ4"
FT                   /protein_id="BAI68946.1"
FT                   /translation="MAEFQSVRGFHDIFGQELKKFRYVSDTVRSLLKLYNFEEIILPVV
FT                   EYLEVFQRSIGEVTDIVQKEMFVFQDRKGRWLALRPEGTAGAVRAYIQNRLYALKPYVK
FT                   LFYEGPMFRYERPQAGRYRQFHQIGAEVFGTLDPQVDAQMIEMVHTILTKLGISATIEI
FT                   NSIGCRVCRPSYKKALSDYLEDVVGHLCDVCLDRKDKNPLRVLDCKVETCKEAVKQAPK
FT                   MVDYLCQECATHYETLKSYLDMLSIPYRENHHLVRGLDYYTKTVFEAVSDELGITIIAG
FT                   GRYDYLVEEMGGPPTPAIGFAVGIERISMLVKDLPQEEPLYMVIPFGDTLDYAFEVIKK
FT                   LRDMGKRVETSYKKANLKKQLELANKLKADYVVLIGEDEKRQNTITIKNMHTGMQESIS
FT                   FLELAHERL"
FT   CDS_pept        475161..476147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="HTH_0483"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68947"
FT                   /db_xref="GOA:D3DGJ5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ5"
FT                   /protein_id="BAI68947.1"
FT                   /translation="MEFPKLRPRRLRSNESIRRLVRETKLSLDDLICPVFVRYGEGIEE
FT                   EVPSMPGVFRYSPDKVIDEVKKIRDLGIPAIILFGIPEHKDEVGSDTWSKEGIIQRTVR
FT                   LIKKEVPDIYVITDVCFCEYTTHGHCGVLKNHHVDNDATLENLKKQAVSHAESGADMLA
FT                   PSGMMDGMVKAIRSALDEANFYEIPIMAYSAKFASAFYGPFRDAAQSAPAFGDRRTYQM
FT                   DPSNAREALKEVLLDLQEGADIVMVKPALSYLDIIYRVKEATLLPVCAYNVSGEYSMIK
FT                   AAGKLGWIDERKVMWEVLTSIKRAGADMIITYFAKDVAILINRGELA"
FT   CDS_pept        476144..477445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB2"
FT                   /locus_tag="HTH_0484"
FT                   /product="2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68948"
FT                   /db_xref="GOA:D3DGJ6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ6"
FT                   /protein_id="BAI68948.1"
FT                   /translation="MKYYIKTFGCQMNFNDSERIKGMLQTLGYQEAKDWQEADIILINT
FT                   CTIREKPDQKVFSHLGEYKKLKEQNPKALIGVCGCLAQRMGFELIQKSPVVDIMFSSFN
FT                   MHQLPELIQQAQAGYKAVAILENPPDDEDKLWDYPTVRDNPYCAYVTVMKGCDKNCTYC
FT                   VVPKTRGRQRSRSLESILKEVRDLVSDGVKEVHLLGQNVTAWGKDIGKHFSELLYRVAE
FT                   IDGVERIRFTTGHPKDLDEGIAKAMGEIKKVCEHIHLPFQAGSDRILKLMDRGYTKEEY
FT                   LEKISMLKEYVKGITFSTDVIVGFPTETEEDFEETLDMLKKVRFEQVFSFKFSPRPDTP
FT                   AYSMEGQVPDQVKTQRMSRLLQLQKEIMGEVAKSYEGTIQEVLIESIEHGNKLIGRTRT
FT                   NRWVSMEGGVEMLGKVVKVKVIRSYPFNMECELV"
FT   CDS_pept        477459..477941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68949"
FT                   /db_xref="GOA:D3DGJ7"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ7"
FT                   /protein_id="BAI68949.1"
FT                   /translation="MIEMVVHGVTLDPVSQMPIVVLRAKDNEEVLLPIWIGIFEADSIV
FT                   RELQKIEPPRPMTYELLKSIVQQMGGVVEKIVITDLRDSTYYAEVHILHGSNTLIVDSR
FT                   PSDAINLALRFEAPIYVEPEVLEKSKVPKPEEDEEKQHLREWLENIKPEDFEKGLS"
FT   CDS_pept        complement(477933..478364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68950"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ8"
FT                   /protein_id="BAI68950.1"
FT                   /translation="MRSWVYYIQLRAYYQDGTFREEGALYVVAIPDEEKLKDVDMECYA
FT                   KEYLPQQTALSSARAYAVGTDIAIKDISPYQLAGYRKDMDLYVFKEGIGFEEGLSRVFK
FT                   ILLDHLAESGEIKMVEPVIDVGTPSADVMYACLKKALST"
FT   CDS_pept        complement(478366..479007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0487"
FT                   /product="Zn-dependent protease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68951"
FT                   /db_xref="GOA:D3DGJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGJ9"
FT                   /protein_id="BAI68951.1"
FT                   /translation="MDLREAVITIPAIMMAVILHEYAHGWMAYKMGDATAKEAGRLTIN
FT                   PIPHIDLFGTIILPAMFILVGSPILFGWAKPVPINPLRFRDLKLGTFFVSTAGIGMNLL
FT                   LALLSGFFYRLIDAGYLDFLGSAVVLPLAIFCAKSVLINVVLAVFNAIPIPPLDGSRAL
FT                   MSFFSIKYWELFYRFEMYGFLIITLLLFTGVLGRIIYPPILFLYNLFLGS"
FT   CDS_pept        479048..479797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="HTH_0488"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68952"
FT                   /db_xref="GOA:D3DGK0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK0"
FT                   /protein_id="BAI68952.1"
FT                   /translation="MFCIDLSGKRALITGSTRGIGKSIAEHLAKAGASVIITGRDKAKA
FT                   EEVAKELNQKYSTQAFGIELRLDDPQSIKSGYEQVEKLIEGVDILVNNAGITKDKLFLR
FT                   MSLEDWEEVIKVNLTGTFFITSLAIKSMLKNRWGRVINISSVVGFMGNVGQVNYSSTKA
FT                   GLVGFTKSLAKELASRNITVNAVAPGFIETDMTAVLSEDIKQNYLKNIPLGRFGKPEDV
FT                   AGAVLFLCSSLADYITGEVLHVNGGMY"
FT   CDS_pept        479801..481399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="HTH_0489"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68953"
FT                   /db_xref="GOA:D3DGK1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK1"
FT                   /protein_id="BAI68953.1"
FT                   /translation="MNLFIVESPTKAKSIAKYLGNGWVVRATLGHIKDLPERELGVDIK
FT                   TLEPKYVWLKGKKKIVDGIKKAAKKAKKIYLGTDPDREGEAIAYFLKEELLKVNTSIYR
FT                   ATFYEITKKAITEAIGGASDINLNLVSAQFSRRVLDRLIGYKLSPFLWRDLKERGLSVG
FT                   RVQSPTLRLIVERERQIQNFKRKKYYYIKAEFVVDGVEFSAVFKQRFEKPSNAEPFMKK
FT                   LKDVMFVVKSVSKEMQKEPPPKPFNTVSLQAEASKILGISVDKVQKMAQKLYEEGLITY
FT                   PRTDSYRMNKEKAQEFMKYIERTYGKDYVGRLRKYKEKALAWGAHECIRPTSLDKKPES
FT                   VLELKLWSLISSRALASLSSDAIREKFFVVLLALSDHTLEFTAEGSKLVFDGWTRIYPK
FT                   EVKDRALPHLEEGQVIKPKRIYIEEVEVPPPPRYTEGSLVRTLENLGIGRPSTYATIIK
FT                   TLKDRGYVVLEKGYLKPTEMAFKVVDYLMEKFPNLMDYGFTKYMEDNLDAVEEGKKDWK
FT                   EVVRESYRRVLNAKE"
FT   CDS_pept        481386..482381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="draG"
FT                   /locus_tag="HTH_0490"
FT                   /product="ADP-ribosylglycohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68954"
FT                   /db_xref="GOA:D3DGK2"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK2"
FT                   /protein_id="BAI68954.1"
FT                   /translation="MLRSKFRGTLLGAALGDAIGKCVEDITKEEVYDFYGSRVEGFVEP
FT                   HPLSPSYGSHPEEISDETKITLILLESVVDKKAIDPQDFYKRLILWREDEKSHRYPDPA
FT                   LLTALDLLSSGISLEEAGFSSASVEGILRCIVVGLFHFYNPLLASEGARLVSIMTHRSP
FT                   EVYDASAVLAVMISNLIRDAYHLDNLDERVKLLEELKLFVKHDRHKTYLDRVAELLQEG
FT                   ADLERAINTLGNSTYVFESLPLSLFIFLSNIDEPMKALWDAVNSYGDFGGDTDAIGYLV
FT                   GAYLGAYLGQEIFPLDLVENLENSGYYISLADKLYHVVEEHIERRLQDAL"
FT   CDS_pept        482371..482613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq1"
FT                   /locus_tag="HTH_0491"
FT                   /product="host facter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68955"
FT                   /db_xref="GOA:D3DGK3"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK3"
FT                   /protein_id="BAI68955.1"
FT                   /translation="MPYKLQESFLNTARKRRVKVTIYLVNGVRLQGRVRSFDLYTILIE
FT                   DGRQQTLVYKHAITTIIPAEKLEIEFEEEGVPGAV"
FT   CDS_pept        complement(482626..482958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdx7"
FT                   /locus_tag="HTH_0492"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68956"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK4"
FT                   /protein_id="BAI68956.1"
FT                   /translation="MNFKHLFICVNQRPPGHPMGSCAEKGSRDIYQKFMEKLQMDPELF
FT                   MSVVITPTGCLGPCGMGPTMVVYPDGVWYGNVRPEDVEEIVNNHLKNDQPVERLVVSKG
FT                   KPPGMF"
FT   CDS_pept        complement(483026..484999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="HTH_0493"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68957"
FT                   /db_xref="GOA:D3DGK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK5"
FT                   /protein_id="BAI68957.1"
FT                   /translation="MLNPSQERAVKHFGKPLLIVAGAGSGKTKTLTYKLEHLVVKRGLR
FT                   QDRILILTFTNKAAREIRERIVKLTNKEVPWAGTFHSIALKILRQEGYKMGIDPSFSII
FT                   DEDDRKKILKEVLRRMNLSKDMLEVANNYITSRRESLREPEDSTLEEVYRQYSSVLKSR
FT                   NFLDFSELLFKTYQLLKNYSDGWRDFFEFVMVDEFQDTNIIQYEMVKLLAKENICVVGD
FT                   PNQCIYEWRYARPDNMLKFVEDFKPDIIKLEYNYRSKAHIIAVANAVLSASKAQWKSLT
FT                   PVLKPVRDGEEKPVVRRFSDPLEESLWIAREIKRLLSRYKPQDIAILVRALYLTDIFER
FT                   TFFNARIPYKIVGSVKFFERAEIKDVLAFLKLMVNPSDELSFKRCLENVQIGERTFAII
FT                   KRFHQGDWIASSILAIKHMSEEKSKRLYHLIRNLIKLKQSIDEYPTALWEILEHVGYLN
FT                   YMQVKYQKDYKEREENIKELFRFLEEKKKEGASVLEVLEEVMLISQEEETAQAVNIMTI
FT                   HASKGLEFPVVFLPRLEEGILPHEKSKEDIQELEEERRLFYVAITRAKDMLYMTYTRDK
FT                   NSKPSRFLSDIPKEHLDLSSFKVKKTTYSLELKRNNLKVGDMVIHRVFGKGKVIALEEE
FT                   RATVDFGDKVKTIHTDFLEPIG"
FT   CDS_pept        complement(485011..486102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0494"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68958"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGI5"
FT                   /protein_id="BAI68958.1"
FT                   /translation="MQAKEIKRSLLFSLEFANAGKKKFLDQLWEEYKNALQYFVDKGFD
FT                   ERSLPSYEHVKTYSHKTWLSKRYLGCALLQAVDILKSVFQRKKKVNKPEVKKVSLKLDK
FT                   RFYRLERGNNSFNFWFLLRNPKDKNWVHFPVKNYRYAQKYFDEWKLSSGMELLKRDGKW
FT                   FLKLTFKKEVVLEERGPKGIDIGYRKLITLSDGQVFGREIKEIIEKKILPKKQGSKRFK
FT                   RVLDYLKTEVNRVLKQVIDGSFSPVLEKLKNLKRGKRGKWRRDINRRFNYWMYGYVLRR
FT                   IKELCEVAGVQWHIVPASYTSRTCPQCGYEDRANRDGEWFHCLNCGYENDADVVGAVNI
FT                   LWRFGREPIVPYPAKPPSVSLNL"
FT   CDS_pept        486189..487388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68959"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK7"
FT                   /protein_id="BAI68959.1"
FT                   /translation="MKIAFLKTGNETGPNRHILALLRHFQNKGLQVKEFDLTNGDIQQT
FT                   VNQMLEFSPTFSLDVNATGVIVGQQGEERIPICDAFGFVHVSIFTDDPLLYFPTLLDMR
FT                   TANNFLPVLCDLKYMDSLRMLGINKGLFYITPFVEREFMREPQGEKDIEVVFVGPVSDP
FT                   EVLAKQVINNLQEHLIPFFFEVAEFMFRNPEVSVHVASEYILSMFHQNLQEEINKWRNE
FT                   KPEEYLRLLNDISIYATSKKRWYLLSFLDGIDLKIVGEFQGELREGHEILPTSSYEDFL
FT                   EVLGRSYMAILSFPFSVPSGIGFTPLEVGFMGCAPLIDYRMTLQGFLTPGSECITYLPL
FT                   DRADIEEKILYYLEHPDEALSIGQSVRQKVLQKFTPEDRGDFLISVFEQILEGVKKSSE
FT                   "
FT   CDS_pept        487388..488044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68960"
FT                   /db_xref="GOA:D3DGK8"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK8"
FT                   /protein_id="BAI68960.1"
FT                   /translation="MFPGFGTLVNASLILLGSFVGLRASRYIPTSLKDGAINAIGLFTL
FT                   MLGVKLLYENKPETLKVFFTILIGSALGHLAKIEESLHELLKNRGGDSLSGFVSASVLF
FT                   TVGPMTLLGCILEGTKGDSTLILSKAFMDGFSSIILSSSLGKSVAFSAFFVLIFQGSLT
FT                   MLAFYLGSFLPKDSMSNALFVGGGLMLLTGAKILGLLERIKVLNFFPSLFISLLV"
FT   CDS_pept        complement(488140..489405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0497"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68961"
FT                   /db_xref="GOA:D3DGK9"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGK9"
FT                   /protein_id="BAI68961.1"
FT                   /translation="MEVKIKALTRVEGEGALDIVLDKDQIKDLKLRIYEPPRYFEEILR
FT                   GKPYHFIPDVTARICGICPVAYQMSGVQAVEDAFGIEVPEDILLLRRLMYYGEWIQSHA
FT                   IHIFFLHLPDFYGVSSIAQLAKVDRELVQGGLRLREVGSKIIQMLGGRTSHPVSVTVGG
FT                   FHSLPEHPSVSCKDIEEAIDICYRLLEKLKHLKFPHFELKNILFVSLTDEDYPILSGDI
FT                   LTSEGEVINKKEFKEYFVEYAVHYSTAKHARTKGGSIYVVGPLARFNNNYQKLSPLATE
FT                   YAHKLPIKFPELNPYKSILIRMVEILHSLERSHQIIRDYKKPEVIKVSYQVKAGEGFGV
FT                   SEAPRGILWHSYQFDQQGNILKADIVPPTSQNQDAMEHSLKERCNQLKKEESIIREEAE
FT                   KLIRSFDPCISCATHFLKVNII"
FT   CDS_pept        complement(489396..490007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0498"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit/hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68962"
FT                   /db_xref="GOA:D3DGL0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL0"
FT                   /protein_id="BAI68962.1"
FT                   /translation="MLRYLEKLQVLYFLEAQSENHYGEFDISFVEGSVSNREDEERILD
FT                   IRRRSGMLVAIGACAISGGVQSAGNFEGIIKSEPIDAFVKVDYQLPGCPINKEILENFL
FT                   KSILHGKSPYVPEYPVCLECKRRGAVCITVAKGEVCLGPITRAGCGAICPSFERGCYGC
FT                   YGPVHKPNLESFLAYFPQAYQTIKLSANAYNKIYREKLWK"
FT   CDS_pept        complement(490073..490633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0499"
FT                   /product="putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68963"
FT                   /db_xref="GOA:D3DGL1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL1"
FT                   /protein_id="BAI68963.1"
FT                   /translation="MKVEFLGSYREDLPKDHFKEVVFVGRSNVGKSSLINMLVGEPVAR
FT                   VSKEPGRTRSINAFLLEGRIKLVDVPGYGFAKVSKAERESWKRLIESYFRERRQNIRCV
FT                   FVLIDSKVGPTDLDKLMIEWLRHINIPYKVVLTKTDKASQKELSKSLELLKVVGVNEVI
FT                   ITSAKEGKGKKELYRSILEVVEG"
FT   CDS_pept        complement(490630..491859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="HTH_0500"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68964"
FT                   /db_xref="GOA:D3DGL2"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL2"
FT                   /protein_id="BAI68964.1"
FT                   /translation="MLLYNLYRGKDYHIVPTLERIQKASQFLGLERLPYTSLQVGGTNG
FT                   KGSTCAFSEMILRQHGYKTGWFVSPHLVEEEERWRINGEKMPSEVLEEYVRELKPIFEK
FT                   FELTYFEACTLIALEYFKDQKVDVAVFEVGMGGRWDATRVCNPSVCVITNVERDHTKWL
FT                   GRDVESRAVEKLGIYRKGFPLVLGSMKFPLYSKALDLCDDRDLIVGGIDFFSYGRVSRY
FT                   ETLLEHYEWKDIRLENVPLGLWGKWQIGNASLAITAASCLIKPDLKRLKQALQNTRWEG
FT                   RMEIVRREPLLVLDGAHNTDSIKKVVREVKRYMGSLTPVFTGLKEKEWRESMHFLRELS
FT                   HRIYLVQIKHHRGEDLLELESYAKKVGFEEVMLLSSSEDVLCLEEDIIVIGSLYLVGEV
FT                   KQALKKVKKS"
FT   CDS_pept        complement(491898..492107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /locus_tag="HTH_0501"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68965"
FT                   /db_xref="GOA:D3DGL3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL3"
FT                   /protein_id="BAI68965.1"
FT                   /translation="MALKGTVKWFSKEKGYGFITRDDNQGDVFVHFSAIQQRGFKTLEQ
FT                   GQRVEFEIEEDSKGPRAKNVRPIS"
FT   CDS_pept        492265..492441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0502"
FT                   /product="twin-arginine translocation protein TatA/E family
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68966"
FT                   /db_xref="GOA:D3DGL4"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL4"
FT                   /protein_id="BAI68966.1"
FT                   /translation="MHFPLPWQLILILLVVFVIFGASRLPELGKGLGEGIRNFKKALSG
FT                   EEEQKKVPEKEGG"
FT   CDS_pept        492444..492653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0503"
FT                   /product="twin-arginine translocation protein TatA/E family
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68967"
FT                   /db_xref="GOA:D3DGL5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL5"
FT                   /protein_id="BAI68967.1"
FT                   /translation="MFHTPTLPELIVILAIIFLLFGASRLPEAGKALGEGIRNFKKALS
FT                   GETEEEKKAKEVKAQELDKEEKKA"
FT   CDS_pept        492677..492973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="HTH_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68968"
FT                   /db_xref="GOA:D3DGL6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL6"
FT                   /protein_id="BAI68968.1"
FT                   /translation="MDFPEIALILLVAFIFLGPEKMMELATKMGELLRKIRETWDELRY
FT                   QMYVENINKKVLEEQEEIQSTEEATHEVKEDGTTGTTQDASDRTSEGTQKQTD"
FT   CDS_pept        492927..493661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="HTH_0505"
FT                   /product="Sec-independent protein translocase TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68969"
FT                   /db_xref="GOA:D3DGL7"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL7"
FT                   /protein_id="BAI68969.1"
FT                   /translation="MPLTEHLRELRSRLIKSILALLVGTGASFYFASYIFEVLKEPIKR
FT                   SYPKVQLITLSPTEPLFILIKISLVFGLILASPVVLYQIWRFVEPAMYPNEKKLILPIT
FT                   FFSIILFLLGGSFAYFAVLPIALKFLIGIGFSQLQATPFLSVNLYVSFLLKMIVGFGLA
FT                   FEMPIVLYLLQRAGIVTEEQLKSFRKYFIVIAFTVGALIAPDVTTQVLMAIPLLLLYEI
FT                   SILLGKLTKKKSKTKAIEVAQE"
FT   CDS_pept        493658..494599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nueM"
FT                   /locus_tag="HTH_0506"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68970"
FT                   /db_xref="GOA:D3DGL8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL8"
FT                   /protein_id="BAI68970.1"
FT                   /translation="MKVLITGSTGFVGRYMVKALLNEGFEVASIVRNLDKLRRLYGEKV
FT                   KGYEGNFEDKASIRKAFEDFKPDYLIHLIGILYEEKSKGITFHKVHYIYSKNLYQVAKE
FT                   FDIKKVLHMSALGTHKNAPSSYHKTKYQTEQELIKTGLNYTIFRPSIILGPEQRLFFDM
FT                   WSITRYLRVIALPSGGHYLFQPVDVRDVVCCFLKAIKSEETNGKIYEVCGDKKVSFKKL
FT                   LEDVFSYWNRKVLLLPMPKALMYLGGLLIERIMEPPPFSSDQMLMMWRDNICGLDPEVE
FT                   SQGVQKVCQKAPIPYQESLLWSLKEFKNLMIT"
FT   CDS_pept        494637..495272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68971"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGL9"
FT                   /protein_id="BAI68971.1"
FT                   /translation="MIEVKPVEQDLEALVSRVFLKAIELLGGFSKLVEYRTLTWLPSLV
FT                   RAAYAVVLREEYFKTEQEIAQIVGLTGQTVRNILRADPTITMEKIRRLEELVEEEKKEM
FT                   KVHTAGGLAKLAYKLIKEGHEESRLFVEYCERIAYALDIPWAYMTLRRLKGVDFPIKSA
FT                   EEVKERLSGVYIKGRPAQDVISELEYPIKDPAELLHKIKENLKMHGIE"
FT   CDS_pept        495275..498676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68972"
FT                   /db_xref="GOA:D3DGM0"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM0"
FT                   /protein_id="BAI68972.1"
FT                   /translation="MRYIGYILLFLLFLYFSFVKPYMLLRGIQVELRGFYIDAKGKKIG
FT                   VESFLLFVPSSKGRTLFIGAKSVSLGPEGIYAGSVSVIEVSKEVSKEPFDYDFTHLVKL
FT                   SEKVKARAGKVYVSINTLPLKESITVFVGDTKLERGNITSHEWSRVFYMKGNSTHQLYV
FT                   LLKEAHAKGGIFYADDVIVTATSYTFYGRGEWRGKEGNFYANGFIKGYESENFKVPVLK
FT                   VQGKGKLTYTSLKVDFSVETDLLEIKGRNMGSLSGRGEYTYTFGKEERIRGSFTAGESF
FT                   VSIDYRIHPDDILYANFKNVPLDNHLLRIDTPFRLALWGSLTLYPTRKELSLKGFSENL
FT                   FFLEQSFRGINVELSLDYSKNAGKIYLSVNDPAKIILSGYFSKKDFEGDLSVYMLPYTY
FT                   EGFSAYINYLGSVSYREGVFHAYGSGKLIKPIYRDVSPGDITFNINLADDNYGIVFSGI
FT                   GFGGEGKGSIKERVFAGTVLFKGFSMNYTNLKVDNLVGGFALKISPAQTQITGGGEALL
FT                   TKDEVSALVRAGVDLTKGGDWHGTFSAHLQDIRRGDLHVNQVDIKGRVRKSLISAEYSS
FT                   KYAKGRVEYSLSDSSFSSSGELSIEEGDYSAKAHYTLHGRKEGFSAQLSGQGSYKGYNF
FT                   PLRASLTRESGKLRGFVKGFSTKVGLLSVSLADSFLEGTEDKGILKLGDITLSINSERL
FT                   LTVQSSSGQLSIKDRSFLLPLSLSGGLRGKAEVSYGESGLSISSQGVLDLEKLSNLIKS
FT                   RVFTYAKGEISYTLQKEGKFFRIRVFSAQDIEVRSRFLAVPLKGRVYALYNGKVWEGFA
FT                   NLKGDDADLKAQVVGDDKLLSVKLATQRLPILFRSESVRFNGFAKANGEITTDYRKVRI
FT                   KADVDLSGNLIIKNIARKIQEKPEGYKLIDLDIKLSTAEPLRISLPEGYIYSYADGQIK
FT                   GSLYKPDYRVKLSLVGGSLEYFNREFHVREGTLLMSPERTTLDLTMMAPTPDYNIIIGI
FT                   KGDAGNPKAFVRSEPPRDTREVLTSLILGGPAGEGMFSLSSALVAQFPEFSKLLQGVEK
FT                   AIGTDVRVNISPTTSPTGEAAVNTKVSKDITNRLNIEYQQSTLKDPKETYGGANVKITP
FT                   NTSVGVKVYSNNAQEYKVRFRKKFDF"
FT   CDS_pept        complement(498654..499184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA1"
FT                   /locus_tag="HTH_0509"
FT                   /product="phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68973"
FT                   /db_xref="GOA:D3DGM1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM1"
FT                   /protein_id="BAI68973.1"
FT                   /translation="MLGFYRNLPNILSLLRLFLSPLLLSADKNLLPYLFSILALTDALD
FT                   GFLARRFKRETQLGRILDPLADKVLLLTALFVCTFELKNMPQILLFSLLARDVFILLGA
FT                   SVIYLKLKKVPKPSLWGKITTTVVALSVLLCMFLHSPFINFLLSSLCLLFIIISWIDYA
FT                   VKGIKTFKNQTSS"
FT   CDS_pept        complement(499165..500496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lnt"
FT                   /locus_tag="HTH_0510"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68974"
FT                   /db_xref="GOA:D3DGM2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM2"
FT                   /protein_id="BAI68974.1"
FT                   /translation="MKRSLLAILNGILLYLPFSSYNLWFLIFPGIFMLLRRPNQMHYLL
FT                   TGFTFFFLSLRCVNIASIEYGDINPFLAYTLFALFCLFLTIYQMNLPLYMWKKMGGRLW
FT                   LLPVLYTLFEVARSYVPYGGFPWLIVGETSVNFPAVKYSLRFLTVYGGSLLIWYITYLA
FT                   FKRRFLALLALLSFSFLLGLSAKQQILKALEDAKILKVALLQTAVPQQDKLSDKKFREY
FT                   TDEMLSMVSQAVKEKPDLVVLPESAFAFFFSDEFDRGRQELFELSYQAPILVGLVDIRE
FT                   GLKPYNSAYLVADGQLVGYYDKIRLLPIGEYMPFPFGFLKDVFSAISGLDYVPGTQKRP
FT                   IVYKNIQVATPICFEIAYWDLVKELSKKANLVAVLTNDGWFNHSDCSYQHFMWAKVRAI
FT                   ENGKFILWVNNSGDTAVINPFGEVVKKMPYMKRGILIEYVRLLP"
FT   CDS_pept        complement(500493..500918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68975"
FT                   /db_xref="GOA:D3DGM3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM3"
FT                   /protein_id="BAI68975.1"
FT                   /translation="MKAILLTISASLVWGFAPSLFKMVLKEGIPPSVALIFHNLSAFII
FT                   ATLITAILGERIFISPKYLMLTFLGGFLSGFLGLYLFFLALRHGDVSVVSPIASTSPLW
FT                   SAVFAWLLLGEKLSFTKLLGIALIIIGVSLLSVSFKR"
FT   CDS_pept        complement(500915..501721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0512"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68976"
FT                   /db_xref="GOA:D3DGM4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM4"
FT                   /protein_id="BAI68976.1"
FT                   /translation="MQGKDKDNRSFKIASYNVNSINTRKELVLSWLERDPVDILCLQEL
FT                   KTTDENFPKEDFMKMGYECYTHGQKTYNGVAICSRFLLEEVFKGMGDATYDQEKRVIGG
FT                   RFKDVWIINAYFPHGESRGGRKFFWKLGFYEKFLRFITESFSPNDKIVLVGDMNVAMED
FT                   IDVYDPVLLKDTIGTMKEERDALKKLISWGFVDAFRYLYPEKRQFTWWDYIGGMVWKDQ
FT                   GMRIDYILITKPLLAYLRDVYVDMWPRKRRNPKPSDHAPIVGVFEL"
FT   CDS_pept        501783..502055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="himA"
FT                   /locus_tag="HTH_0513"
FT                   /product="histone-like DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68977"
FT                   /db_xref="GOA:D3DGM5"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM5"
FT                   /protein_id="BAI68977.1"
FT                   /translation="MTKAELVSAVAKGAGITKKQADAALKSAISAIAGSLKKGERVAIP
FT                   GFGIFTVRKRAARKGRNPRTGAVINIPARKVVTFRPAKDLRESIK"
FT   tRNA            502115..502187
FT                   /locus_tag="HTH_t09"
FT                   /product="tRNA-His"
FT   CDS_pept        complement(502126..503628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0514"
FT                   /product="resolvase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68978"
FT                   /db_xref="GOA:D3DGM6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM6"
FT                   /protein_id="BAI68978.1"
FT                   /translation="MSLRGIVYARVSTDKQAERETPIESQISQCLKYAQEKGIEVVAIF
FT                   KDEGISGSTDKRPQFQQAISYAVKNNVDCFIVFDTSRFARNREDAIYYKRLLRKNGIEL
FT                   HYVVTPLPDDPVSSYLTEGIFELLDEYYTLMIKKHTLRGIEESIKKRIYPKNKCPVGYK
FT                   VVKGEDGKGRIYKDEETSHIYLKILTLFRRGLGALEIAHYLNRELGTDEWNKKKILRVL
FT                   KNPLYKGIIEYGEIKVYFEDLRYISDEEWGKIQKELQRRHKEEKGRHKAKMFFVGLLKC
FT                   GRCGSAMTTRTGKGKGGLYFYYVCYNRLHRKCKQEILPAHKVDEFLSKEILDYILNEQT
FT                   LQELTARLKETIQKASNNFLEREKELREEKEKIENQINNLIKAITAGIDPHTVKDELNR
FT                   LQAIKDKISAELSHIKNLKTLNVAPRINPAQVRAVFEELVASNDYRRIRSFFKTLIKEI
FT                   VYDNKTFDIQYSPALFVIEGNQGRVTGLEPATRGSTVHCSTS"
FT   misc_feature    502190..537518
FT                   /note="prophage Ht1"
FT   CDS_pept        complement(503689..503889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68979"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM7"
FT                   /protein_id="BAI68979.1"
FT                   /translation="MYVNFAIRKILQEQLPVNKFEILSAKRDKDGVYKVEAQDDRFIYF
FT                   LCFQVGRDDVKVLYYDFKERV"
FT   CDS_pept        complement(503891..504091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68980"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM8"
FT                   /protein_id="BAI68980.1"
FT                   /translation="MKALILDRRGCVIGKLPVPLPIPYRGGYSLLEINGSLYRLTGACE
FT                   EGFFVKPWTLPAPAFEKEKED"
FT   CDS_pept        complement(504088..504873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0517"
FT                   /product="phage recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68981"
FT                   /db_xref="GOA:D3DGM9"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGM9"
FT                   /protein_id="BAI68981.1"
FT                   /translation="MLSKANTNTIVREEDYKKVLQMLRVALPSLAKVDDETLITAVAYA
FT                   RHLGLDPLRKEVHFVPYYNKELNKTIIQPIVSYTEYLKRAERSGKLKGWSCKFRKEGDE
FT                   LVAVVEIKRVDWEIPFVWEVPLSEVKRDTPLWQSHPLFMLKKTAIAQAFRMCFPEETSH
FT                   LPYEEAEFWEEPSIPEQTQPTKTDVDTDTESDYITEAQRKRFFAIVKKELGYREDAIKE
FT                   ILKERFGIESTAEIPKDKYEEIIDYFRSLSKPIEAEAQS"
FT   CDS_pept        complement(504886..505179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68982"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN0"
FT                   /protein_id="BAI68982.1"
FT                   /translation="MRALRKLYFRAVRTACAPTIEEYRDWRGRKYTRIYYFALPKYLED
FT                   LPHARWLVSSSKTLRALGIFRFFIIGWLARKEYQIRRNLRRLIVYKKEELHF"
FT   CDS_pept        complement(505176..505541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68983"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN1"
FT                   /protein_id="BAI68983.1"
FT                   /translation="MSAKEEFERTWEEVNYPASKMQGFGWVYTLFWVPYHHRRVHTAPT
FT                   PTLPKAEIPLGRWSYFQPLHLSTPPLKSLNPFSGTVGHLSYLLIYSTTALLSTPSGRAV
FT                   SPHHRYKVLARKFPIKR"
FT   CDS_pept        complement(505538..505774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68984"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN2"
FT                   /protein_id="BAI68984.1"
FT                   /translation="MLKRIRSIKDGWEMTLSLFAVFASLVVLVLSLRLQAEAQRVVEEN
FT                   QYLRYHLVQVCKYIDTLPKRERVVFDVCLEVGK"
FT   CDS_pept        complement(505750..505992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68985"
FT                   /db_xref="GOA:D3DGN3"
FT                   /db_xref="InterPro:IPR036858"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN3"
FT                   /protein_id="BAI68985.1"
FT                   /translation="MEVGAMTLKVVELNANSRCEFDLFYYRHLWLTPYLLAVQQVKGWV
FT                   LYEVLKYEPNLLIVREIRKLKDLEEVEQCLREYAV"
FT   CDS_pept        complement(506076..506423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68986"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN4"
FT                   /protein_id="BAI68986.1"
FT                   /translation="MKEVKTIGRSMEALAVSLRENHDFLNFLRGHGVLAERILNPPYPF
FT                   LMDWFRRYERVQELLAEARALKLSGWIKKRLKTLREETSYVELTNEQILELLFDFIDDL
FT                   ETVISAEVERC"
FT   CDS_pept        506503..506799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68987"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN5"
FT                   /protein_id="BAI68987.1"
FT                   /translation="MTLVWRKLGKLNKGGRVMKKVLLVLVVLGGAFALDRLYDYRLPKS
FT                   SRPYKDYWGNSYKHYDNLWKDTDRDGVMNYYDYNDRNPNIWTPYQKGYKNWDW"
FT   CDS_pept        complement(506807..506962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68988"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN6"
FT                   /protein_id="BAI68988.1"
FT                   /translation="MEVVATIFISITNMKMYPASRLGNPKRTDLMVEAYLLDDFIDYIQ
FT                   RHRRTR"
FT   CDS_pept        complement(507005..507667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0525"
FT                   /product="putative phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68989"
FT                   /db_xref="GOA:D3DGN7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN7"
FT                   /protein_id="BAI68989.1"
FT                   /translation="MVKLIEMKATRRGYFIGEKLKKLLQEKGLSIYRLAKLTGLTQSGL
FT                   SMIINNQRAVSPAILRKIAETLNIPEVYFIEEEPTKEYPPSPEVIEREYIAIPIITGVG
FT                   AGGEVITDDYTLIKRTQLPKKTVSAFEVEGDSMEPTIPKDWLVLVDPTDLQLYEGGIFL
FT                   FASQGNGLFIRRVHKVDNQWELVPDNRKYAPQKLTEEIKVLGRVLKKLPKIEPMEVE"
FT   CDS_pept        507737..507985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68990"
FT                   /db_xref="GOA:D3DGN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR031856"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN8"
FT                   /protein_id="BAI68990.1"
FT                   /translation="MVKQTELARKIGKAPSAISQILHKKRRADLPTAVAIEKASDGQLK
FT                   VEKLVRPEVAQALKEYLRLRCPSMPKNVDVGEEDVSK"
FT   CDS_pept        507972..508370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68991"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGN9"
FT                   /protein_id="BAI68991.1"
FT                   /translation="MLVSELKDKLTDSLNKVVRKYSARVVAKVFRVKPPTVWQWSAGER
FT                   ENPLTKTLEFLMWLKHRDPEMFTEIASVFMQVVSEEAHKTLQIKEFAVKLFKYYIDDHK
FT                   YDVKERAELEREFKRLLEEVKILEEVKR"
FT   CDS_pept        508367..510319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68992"
FT                   /db_xref="GOA:D3DGP0"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP0"
FT                   /protein_id="BAI68992.1"
FT                   /translation="MKGEQAIKILWQTLFPVKFAKGEYAEVIYDDGDRHFKYALHIETL
FT                   EELEEFIREYNEKVNFAICPNTREPKRLAKRTGYTEIKRQKAILIDIEDPESHTLKKPE
FT                   EVRHYIIEFAKSVPESIRKAVKFSAYTGGGGLICIELSRWVERGEIEIVYDWLRERVKD
FT                   FRYVDKSSLNPAQAQRLIGTINAKYKVETFIFKLNENCESLDVDAIITEFNARQNVEIE
FT                   RHAEIERHKGKIKNIEEIVREIKKRIKFKDLGLEGEDYGYYERISCPFHPPDRTPSFVI
FT                   YHNGDGDVGVDFHTGEAHDIIGIYQKLYEKDFITAVRELAQRAGIKVVLSSEEKKKLQK
FT                   EQALADFDPHAYITEELKIRSAIRYRINGEYHFDFFVENREGEVVKLSESLFKLQEWRY
FT                   SLRLFGAHTGYKPAPLPAKAQEEAWELVIDALFEVSEKDEEFDKSELPWELEELQRVIR
FT                   EAPATDIMDDFVLSKSRYVKLVVGDTVYVSLTALLRRLKINPTFERINLKKVSQLLREL
FT                   GAKPERIYVDGYRIRAWRLPEGDWRVVDTMDTTGHYKGDGSVHKESLETRGADGFVDTM
FT                   DTIEEDEKKVMKKNSIENGCVVSTSGHIQNVETQAFEIGMDTMDSMDTTTGGQSVQRGD
FT                   KKVDEDDDDLSWLNF"
FT   CDS_pept        510336..511916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0530"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68993"
FT                   /db_xref="GOA:D3DGP1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP1"
FT                   /protein_id="BAI68993.1"
FT                   /translation="MVEKIIGPPGTGKTTQVVKRTAELVGRGEVRTDKICATSLTRATK
FT                   WALLGKFRSKGVNIGEENIRTLHSWAYKSFLKDGKKPRIVSQKEIAEFFKNKGFEYEIP
FT                   DTSGQENEYAVYETGKDGNRLLQMFNLARITWDGEAPLRHTKMVYKQVEQDCPVSFRTF
FT                   VLLFKDYINWLRDNDLYDYTRLLTEAFKGGLSIQGDLLILDEFQDLGNLHNLIVKRWFE
FT                   NFKYVLVCGDDDQAIFTFAGATPTHLINLRGDREYVLPVSYRLPRGVHELAEGVISANK
FT                   QRIPKTFKPRDETGRVDTLFSLEDALALLQNGEKKSLLLARNNYFVEQWKEILDSYNIP
FT                   YKEIGKHVPIPALATHLRTLKRIKEGKPVDDKDIITLIAYLKGAIRKLTGKKQIRTHLI
FT                   AEIGECIKKRQWTGTAGQVAYWILTRSPEELFTEHDAKVIKKWEKRVEDLHKWLNPAIQ
FT                   VGTIHSAKGLEADRVILDTRITKKVVETFMQEPEAERRVLYVGITRAKEELYLLRLAKS
FT                   YTYEHLGLL"
FT   CDS_pept        511924..512388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68994"
FT                   /db_xref="GOA:D3DGP2"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP2"
FT                   /protein_id="BAI68994.1"
FT                   /translation="MSRIMTIDPGYSALGYAVGEENKLIEYGTVYFKGKEETRLTEIYL
FT                   KIKELIQRHNPDTVLIEDYRVYKDGYKGKHKTAIVVGIICAIAYEHKIKPTFVFHNSWK
FT                   AKFQRVYFTIVNRLSEEWKKALGEGSEHSRDAVMMLLPEVVSLKALLKGG"
FT   CDS_pept        512560..513363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0532"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68995"
FT                   /db_xref="GOA:D3DGP3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP3"
FT                   /protein_id="BAI68995.1"
FT                   /translation="MIAVLVSGGKDSTATLLVALERFPKERVIPIFTDTGWESSITYAY
FT                   LNYLETKLSIEIVRLKSRKWQDLLTCIKEKKMFPHGNQRFCTYHLKLIPTAEFLAEHPE
FT                   IEEVWLGIRASESFRREKKYGDLTPEDTYSYVETATGLPAELRQKIKHLRARLPIVDWT
FT                   EEEVFRFLKEKGIERNPLYDMGHSRVGCYPCILGGLREWKACWKTEEGRANILKLIELE
FT                   KELREMGYNGRIKDNYDGEKLLRLLKMEDVQGDLFKEETCEFCKV"
FT   CDS_pept        513522..513812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68996"
FT                   /db_xref="GOA:D3DGP4"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP4"
FT                   /protein_id="BAI68996.1"
FT                   /translation="MREEKTLKIKAKSDFEIKILRKIINGEMNGFIRGDYLYYEAGNGF
FT                   LWIRVEVEIEKEAEEGRMKEITFIDLIKALVWFLVLLVFMVLVVVVVSKVI"
FT   CDS_pept        513825..514772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68997"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP5"
FT                   /protein_id="BAI68997.1"
FT                   /translation="MEELVAKALELAREGLPSRRKLMEKLKVSEALAREIRAIVKYLMM
FT                   KNGSEPISFDLNPVDIIDIPEPLDKNDRGPYRLKGYRRIGVISDVHFPYHDKTALKTAL
FT                   KKLYELEIDTLVMNGDIVDFYSVSFWERRPDRRNLQKERELALMAFDRIRKIFPDAEII
FT                   YKEGNHEERLARFLSRKAPELYDIEELQTDTFLRLKDFGIVYVKEKRRIEAGELDIIHG
FT                   HEYRSFASVNIAISYLRKSFRNILIGHFHRRQEDTKKDIRDELSGAWVVGCLCDLKPDY
FT                   SPNNEWTHGFAFVELFENKHFQVRNFLIQGEEVF"
FT   CDS_pept        514772..515107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68998"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP6"
FT                   /protein_id="BAI68998.1"
FT                   /translation="MRLFKELSDSELLYCREIAKKIRIANRKYERACEILNGGRSVITI
FT                   GQGKPAKNHVENAYVNKVVWQEFLSALDESEKKLVEEIVEGLDYFTKDELLMLGKINST
FT                   GQMLGLW"
FT   CDS_pept        complement(515129..515659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAI68999"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP7"
FT                   /protein_id="BAI68999.1"
FT                   /translation="MSFNEALFKYELVKYLHEEPPTYTSLSLTRGEAVKLVGEGKLKEV
FT                   EENLRKTIQQHLKDLPPDFEIPISLRFSPIQTSITITSKDFTSEELEITYYPLDVLLKY
FT                   IDQTLLKKAQLFKKLPEILSASSLTLVKKKRLLVLRAYKNKTRKALLTTTNKDPTLIEA
FT                   LEYLIDLHRHLKS"
FT   CDS_pept        complement(515656..516030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69000"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP8"
FT                   /protein_id="BAI69000.1"
FT                   /translation="MLNAEVVITAYKFVSPLSRKEARERLGVLKRYLLPFEKELSKETF
FT                   REIFLSLFGKEVEEVEVQKGLFIFLYNYLLRKAKGEELLKEDEEYEIVKQYEHLVKHFP
FT                   NIDPKHYRGDVLKFFRGGSS"
FT   CDS_pept        complement(516023..516877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69001"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGP9"
FT                   /protein_id="BAI69001.1"
FT                   /translation="MKIWKLVKEAEGYRVYSSEVRNPEEWDNKKGGYVLKGIEEIPELS
FT                   QEGWEYTLTGGQYPELIVYDPSKIAIVWLSAREREEWEKGKLKVEGMLDWYPASVHKGW
FT                   KIVRRQAILILDATKGKVYENYTIESYDPQEPTPKDIEKVESLLKSAKRVIDGDETIEK
FT                   TTEPDPENPYITHIRYDKCEFCKKIQEKFNNPYTSCFVHSIYESIISTSPRKSVVVVRN
FT                   EHLRDEELKRTIDRIVIQPSPSVALAVLTKEGDVLFLKKEGKPLVKLNCLKGNVFEEVL
FT                   QNA"
FT   CDS_pept        complement(516989..517312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69002"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ0"
FT                   /protein_id="BAI69002.1"
FT                   /translation="MRTVRKEVIAEAWRKLSKKQKRELLEEILYLLERNSTDAAPVFLQ
FT                   YDPVDDEMYVRSHFIGRGAVVRRFCPSFLEDWLPREWGKRARLQRLEELIEETLEELDG
FT                   LEF"
FT   CDS_pept        complement(517398..517895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69003"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ1"
FT                   /protein_id="BAI69003.1"
FT                   /translation="MSDLQKKLYRLYEKSLGKDMFEVKEEERVESEEGQVRMFFMTPPE
FT                   FILVLKKEGDLNVIVPLTSYLQLAITNKYPPLIRWKGFRLVPLPFWVYANEKLLQKYSV
FT                   PVFKLSNLEKIREYVKSARTKGIGKWREKFIEKTAERYADLSLSSLLYNFTEYDEDHKK
FT                   GT"
FT   misc_feature    518006..518773
FT                   /locus_tag="HTH_0541"
FT                   /note="pseudo gene. This gene has 5'-terminal deletion."
FT                   /note="transposase-like fragment"
FT   CDS_pept        518851..519249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69004"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ2"
FT                   /protein_id="BAI69004.1"
FT                   /translation="MRTAHLRIVEKLLDYYRNPENWGKSLKQVAQAFGHSYPYILKCIQ
FT                   LYGTERFRKEKDAIYHEILSEASNIAIARLYEMLLSEDKEEFKQAQAEVRQWYKTVFGE
FT                   KQYHTHEAGDKLSTLLSALAEIRQKYAK"
FT   CDS_pept        519239..520633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0543"
FT                   /product="phage uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69005"
FT                   /db_xref="InterPro:IPR006517"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ3"
FT                   /protein_id="BAI69005.1"
FT                   /translation="MQNETIEVLDLLLSKPLPDLAELLFPHYCTHKPADIHYELAELLT
FT                   ESKQNLVIAFPREFAKSTYVWIFFPAWNILHCKYRYIVYIASSKERAEEQLRNLRAEIT
FT                   AHPLLSSLIEIKKDNADELEYLDLASMNRCLIRAYGAGQNLRGIRYHEKRPDIVILDDI
FT                   EDSESVQSETQRKKLKEWFHADVRPLSSTGRIFVIGTVLHEDSLLNNLLTNPPFSFRGL
FT                   RYGIIDEEGKPTWEDRFTLEWIERKREDYRAQGLLHVFYREYMNIALAPEEQIFKKEYF
FT                   QYYDPVRLDTLNFNIFTTVDLAISKSDTADFTAIATVAVSPENHWFVLDIDYGRYDPSE
FT                   QIEAIFRAVKKYKPLIVGIEKVAYQSALAHFLQKEMLARGLFFRVQELKAEKKKELRIQ
FT                   ALQPRFTIKAVWFPAGAHFLTELESELLMFPRGKHDDLIDALAYMEQIAYPPIHHSEGE
FT                   LPSWSL"
FT   CDS_pept        520653..522509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0544"
FT                   /product="putative portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69006"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ4"
FT                   /protein_id="BAI69006.1"
FT                   /translation="MKIKDEEKILSYVLADIQNAENFYQQVIEPKLIERYQLYNADPEY
FT                   YAQKFPKLFQRSKITLTDIADTIEWAMPSLMRIFFGGEDVVSIVGRQAEDVKKADILQE
FT                   LINFQIQNQNQGFLIFYKWFKDALIGGLGVVKCYWEREYETQKKEIVLGWDELQLAQHD
FT                   PTAVVESAQDLGNGIYRVALKISRLSKNQPCLENVPATEFIFHPSTLSVKDSPFVAHRK
FT                   VVTVDYLKRKEKEGIYKNVDKVIESASSDDLRYTQMADYYLKPYKKYAVSESDQDLARR
FT                   KVLLYECYTKYDINNDGLLEDVIITVGNNTILRIQENIYGRPPFFVLAPILEPYQLWGK
FT                   SFADVLKDIQDLKTALVNQIIVNVGMNNDYKIAINDTLVNVQDIVNDKPVIRMKAGADI
FT                   RQAIMPLPTQPLAPWSFNFLEYIEGTKENRTGITRYNQGLDGRSLNKTASGISMIMQAA
FT                   NQRLELIARIFAETGIKDLFSFLVYLNQQFIDQKTVIRLTNKSLPIAPDDLSGEFDVVI
FT                   SAGIGVGTKQTNMANLQLLLQLYPKLLQLGIATPKNVYNLVKKLIEEMGYKNVDDFLQD
FT                   PEQAQMKMMMGGLNGGITGEIGIPQGGIPQGVNSSAGEGLPQ"
FT   CDS_pept        522681..523502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69007"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ5"
FT                   /protein_id="BAI69007.1"
FT                   /translation="MPITGLSSSTLKTRFFNILAGGNATDLENFLSQFTSAYDKLVLNS
FT                   EIFSNPAVMDAVVNSPQLATVFNSTTALNMFFASSVAITQLGRSYNGIQTLAQNAQAMR
FT                   SAIQSQELLNLISRNPSFRQIFTSSTAIPSKSVPTMTSNTTPEGQALGSSIYSSSNDFY
FT                   KAFDKNSTTLWEPATPNPSEWVGYMFSVPVFVHTLSYTNIENINLCVVQRSSDGTSWED
FT                   ILTFSPALRLATPVQLPLPLLVNYYKYYRILTVSTSGYPLIRELDFSGFTQ"
FT   CDS_pept        523514..523699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69008"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ6"
FT                   /protein_id="BAI69008.1"
FT                   /translation="MIFVIIDKQTKRVLGFTYSSEYKTYHPEVELIQISQDSEVFLSAT
FT                   PQSYVYDASTNSFVIK"
FT   CDS_pept        523712..524674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69009"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ7"
FT                   /protein_id="BAI69009.1"
FT                   /translation="MDEHNQGTPVEQPKAQEEQKPEIALTHEGELSVDLSSWGLSEEEG
FT                   EQPEKQETQEQAQGEKQEYYTPEEIQKIGIDKLDPNRIPPELLPWYKSMQADYTRKTQA
FT                   LAEERKAIEKLLDKALTDPELAKRFIQDPELVQTAQKHPQLAQKLMAVSQLAQPKKNPF
FT                   DDIVEQAKRMVEAQFGEPFDEFNPKHTLALTLAGQNILARQAQMLQIYNRIGEIREKEP
FT                   AFEEIDRLAEQKLYSLPYAEALKIERAIKVGDIDTVLRFWEDVRKEYYQQKLTTKQEPP
FT                   KVESAGTGEVKTKPSFDPRELAHLSEEEKVRWFIEAGLV"
FT   CDS_pept        524697..525572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0548"
FT                   /product="putative phage major head protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69010"
FT                   /db_xref="InterPro:IPR035198"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ8"
FT                   /protein_id="BAI69010.1"
FT                   /translation="MALTTYTAVGNREDLSDIITNISPTETPLYSMFGKATAKATYHEW
FT                   IEDSLAAPGTNAMVEGANYPIADPQTRVRKGNYTQIFAKGYGISETQEAVLKAGIKSEI
FT                   AYQMQKAMKEIARDVEYAIINNTAAVAGNATTARQMGGIQAFVITNVLANGGSPRALTE
FT                   TLLNDGIQQAWQAGGNPDVVVVSGKNKRTVSSFTAGVTKTVAAEDKKLVSTVDVYESDF
FT                   GLVRIVADRWMPDSKVFILEKGRFKIAYLRPFKQQEIAKVGDRIERVVVGELTLEVRAE
FT                   KANAIIADIA"
FT   CDS_pept        525662..525925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69011"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGQ9"
FT                   /protein_id="BAI69011.1"
FT                   /translation="MAVIFDYDEKTGKITLTRVVDITPYLRANYEERKEIGKGISKSKV
FT                   WRKVASIPIDVLISHGIDINDDEAIKDFIKKHPEYRTSEGGF"
FT   CDS_pept        525928..526107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69012"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR0"
FT                   /protein_id="BAI69012.1"
FT                   /translation="MVKMKKPEKHEATHWIFGVDVLGKDIIEVPEYLVSLFEEEGFTRI
FT                   SDEKPKKEREKERG"
FT   CDS_pept        526111..526671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69013"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR1"
FT                   /protein_id="BAI69013.1"
FT                   /translation="MTVAEAVLRLRTLLNDPQAIEFTDAELINYINQAQDYIVLSAVNL
FT                   GFQGFLKNVNLTLTNDQALLPSDFIREYSVSANNYILNSVPPDAEVTDKTYKIIGNTLY
FT                   SKNASVSLYYFYSLPNYSNLSDTIQIPQIFNNLLFEICVYLAKNRIEVPNAFDVQLSSL
FT                   YEQKIAQLVSAYGMSFIERPMPF"
FT   CDS_pept        526682..528301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69014"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR2"
FT                   /protein_id="BAI69014.1"
FT                   /translation="MIVSAINFAGVVNTKPPNSLNANELVNCTNFYVTPYGSLKARRGL
FT                   SLLGSLPSADFRSICYFSKTNLLYLASGTTLYSFDPASGRFTVIGNVDTPECSFIEAFG
FT                   KLWIADGGKLKYYDGTTFGTVDDFIYKTQTIGTGDGTTTSFTGTLATPVTPSSVSVSYT
FT                   VGSTTYTAVDDGKGNITGDYISTGTVNYQTGSISLTFSTAPANGTQINVKYSNSEVINV
FT                   FADDIAFKDERIYVAYGSDIYISLVRDPSAWFFISVNKQDGAKIKGIHVYYDKLVIFKG
FT                   DPKPAIYILSGYNLQTYTLSRVAQHVSVNNKYSVRPFLGDLYFNWGRSVYALSKLLGYG
FT                   EVEPVPLTLHFDTYDTTSQERFALPLPGEYVIFFLSRSDALPFAFTPERNACTFLNFAV
FT                   PCVCGVVVGTDVYLAGGGGVFKFAPINTDAGINIAYSVDFAHIGNYINNTLVKRIAIRV
FT                   LPFMDGDLSVFVKGKRVLFTQITPPSVWDRALWDSARYGTDTNTPIYKRQVIFGRTLDF
FT                   TMRTGTPLELFAFEIDMEVKHG"
FT   CDS_pept        528294..528647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69015"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR3"
FT                   /protein_id="BAI69015.1"
FT                   /translation="MADPIVRLYDFQPGTIIKSSEVDNELNQLISFLNRIWTNGSWDGV
FT                   VWKLLAQYVSSDNWTVSDLRTFLAAAHNPDGTIKSDGISDALIYAHNHDSTAHPEVQSA
FT                   LSLLSAGVAFFMS"
FT   CDS_pept        528658..528921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69016"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR4"
FT                   /protein_id="BAI69016.1"
FT                   /translation="MLAIASLNNQTDVVIYTAPAGKTVFAFVDIYAVSSTNITLKINNT
FT                   VFLSQPLSAGVSLSIKLILNGGDSITASSTGQANFFVHGIVQ"
FT   CDS_pept        528932..529870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69017"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR5"
FT                   /protein_id="BAI69017.1"
FT                   /translation="MGWVPGWEIDPADVGWDTGGSRYFSINKDFVDWVQQNRPDLYNAA
FT                   VNLIDKAGAVQERSNGPASWYNIDFASPAAKGAFSDIYRAATQAYTAAAFGTTPEALYG
FT                   PGAGQIGSSRGGYYGGGGGYYGGGGGGMYVATSGGQSLSGNVNFSGLYPPILQQLADFQ
FT                   LRLMSSPEFQDVFNTILGGGVNSKTLSAFNDVNNKLIESWKDLTRPVFQTNILGAIEGL
FT                   ANRGVLDSSVAKGLLGSISSEYMTQLSNYATQLLRDAYEKAYSQPFSAVKALIPFMSLA
FT                   QVSGGGGTSSSSSYSYNPAPLVGLLTSLIGL"
FT   CDS_pept        529881..530579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69018"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR6"
FT                   /protein_id="BAI69018.1"
FT                   /translation="MDFGLGLALGLGSTLLGGLLGGGDAPETSSYFIPKPQGYANLARY
FT                   YQGILTKMLNDMLDIQAPIPGDNSTPIGDQPQPMPRITSSRLPQLRDNIKTAFDVLVSG
FT                   TPYFDASQLKAWENLPTVDVLGMKIPVYGVGRARARMLNEALGLMANQLALDQQQKERY
FT                   LKNVLTPIDVMNFLFQIPLSYSREAEFPISAGVVQYPSMSTTLGGLLSGFGQGLLQYTL
FT                   MNNLLRGIGG"
FT   CDS_pept        530583..531617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69019"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR7"
FT                   /protein_id="BAI69019.1"
FT                   /translation="MDYFGQYMQMGRGLLAPIVDTIQRLALMKLQQQEQMSALQKRAEI
FT                   VQNLASQLTSSLPSDTETKIENPPSFTLPTPTLFKPSSVSTVPQPSKITEQPKSPTEYA
FT                   QELYEKTLPILAQANVYGLDFSPMLSNLIKKQEETFQSLNKFQTMTKVLPKLFPDMDQN
FT                   TASYLALGIAQGDISVKDIKDLRKKDVQFIQAKSADGTVYVLGFDKDSGGQVFSAKIQP
FT                   DLNLLQQITSVKEGAILRRELALEGARHANRMAEIQLEKSLQNNDTKYQHVKIRVPASQ
FT                   EEIKQNPVLGVQGKEIPALFDPRSGNFYDPVTKQQIDPRTGSPVSQSPNTRQPARSVFD
FT                   LYRR"
FT   CDS_pept        531620..535045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69020"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR8"
FT                   /protein_id="BAI69020.1"
FT                   /translation="MPNLEQVLSYLDPAFANASQEQRNAILNDLKGNPQKIDKVLSYLD
FT                   PQYAKAPPEMKTKILKDLSGVSLPEKIGRAFAYGAGELAEDMGQILKKGRGLVEKLPFV
FT                   PKTQGQGLAETLIQLGQEAKSYWIPEQYKEVYDFPGSSIVQEIPSLIGFSPVLKTGGAV
FT                   GKAIARKLGQKGLTEAIAENVGAGLGYSATQATSGDYTGQDVLTQTALDVGVGAGGYTV
FT                   GKWLSSLLKGKTPEQAVKVLDTLEAKLPEGEQKEAVKLVKQKLIKKSPQPAETTATPAE
FT                   TVIQKPTIEELTVKGNEKPVSDEVLNFYAGGPSTEQLKGLTKVPEDPLTYAKDLGVEKP
FT                   AKEARAGIFANAKRWVLPQYEWLKETPETASVYRAAKDYTEGFEKDIKTWLQDRLGQIK
FT                   ETIKNLPDEDRAKIVDYVEGKTKELPESYKPVANQIRQYLDDIYNYAKGQGLNISYRKD
FT                   YFPHIFDGHIRVQVGDEFKSAKTWDEALEIAKKGIDEGQQVNIKAMLPPSIYELRITNP
FT                   RFWSLVNELKDGVELTTEEVKGLLQEAGIGRRPKYRFVSNLLERKYDIDGYIKDPEVAL
FT                   PIYTFNIIKKIHQDRFLSEFEKGYEQIKDPRLRRMLDEYKTQVLGYPTKPEEVAADTIN
FT                   AFLKTPFGRWFLDKLGRSVGTEVSPYDVRRIAGQTNYWLNYLPDLGLSISSALVNSTQT
FT                   LTNTLPILGAKKSALAGMLKYTRALLTDNEQIKKELFDAGILTESSFEGLRFSLSGLKD
FT                   LPMSLFSGVEVLNRVATYGAAKEYGLREGTEGMLKTLNKLLGVPEHDPLYKLIQSNVPL
FT                   EKKATEFAKEVVDKTQFRYEKFQNPRALGSLSKLALPYKTYLINQLLLSYRMLTGAKAN
FT                   PREAILFFAAPVLLAGKDGNPLTAWTWGALNELYGHITGKDLEEDIKDKLGKAGDVLLE
FT                   GLPKQVGVDIRGAVKLDFPNPFDERFYGRPGRILKDVYDIAKGEKGTDALKEELTPKFV
FT                   KSISQAYDIIRSGYVKDNKGRVIKEGDWKDALLTSLGVKPTEYYDFLEKKDLIYKMEKK
FT                   FKNDYEPLINEYTDSIISGDEDRRRDSLKSINSALQELNNKIQNSEGQRQKAYLYLYLR
FT                   LAGALKDESLIRRMKERLAPSSGDKYKQMLIQEE"
FT   CDS_pept        535062..535343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69021"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGR9"
FT                   /protein_id="BAI69021.1"
FT                   /translation="MWQVILAMVPWEKLILYVFAQLTGLSGELINKLVPRAVDLVIEIE
FT                   KQLGDKPGKEKAEYFNSKLREILGGMSEFVINLLRELAVAYAKKKKLI"
FT   CDS_pept        535357..535599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69022"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS0"
FT                   /protein_id="BAI69022.1"
FT                   /translation="MFDLLRRLLGLASAYSSAERQYGKKWYKSKTIWVNLIAFIALLLS
FT                   EKLGISLTKEEQGALLVVINIALRIITKEPIVWSD"
FT   CDS_pept        535587..535754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69023"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS1"
FT                   /protein_id="BAI69023.1"
FT                   /translation="MERLKKVIERYKNSRVRVEIGSETGMEDSPEYRIQEEKRGKGILK
FT                   KLGIKLTFRF"
FT   CDS_pept        535765..535989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69024"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS2"
FT                   /protein_id="BAI69024.1"
FT                   /translation="MGREISYICDACGSDCTEHYYIVSVVRRGEGHSVLHVNGDDPILC
FT                   PECALSVITLLSHLEGMGWKEEEDEDDGF"
FT   CDS_pept        535970..536554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69025"
FT                   /db_xref="InterPro:IPR008565"
FT                   /db_xref="InterPro:IPR018537"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS3"
FT                   /protein_id="BAI69025.1"
FT                   /translation="MKTTAFDYALLFTLKWEGGYVNDPNDPGGETNYGITRRTLELARQ
FT                   KGLVFKESVKDIDREDAAVIYRRFYWEPLKCDDMPLWVAVLVFDTGVNQGIRYAGLHLQ
FT                   SALNNLKHHGGAYFSLAEDGMIGDKTLSALRELSIHPLEVKQLFIRLYCVNRDIRYTEL
FT                   VGNNPKLKKFLKGWFFRTSSLQDYANSLMEV"
FT   CDS_pept        536633..536767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69026"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS4"
FT                   /protein_id="BAI69026.1"
FT                   /translation="MAGRKKVPEIVEHAVADIMKKKKVSREQAYAIAVGQFQKEEEEG"
FT   CDS_pept        536809..537015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69027"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS5"
FT                   /protein_id="BAI69027.1"
FT                   /translation="MAKKSKKNWIQSAIKKPGSFTQWCKKRGYEGVNEECIAEGMKSKD
FT                   PKTRARARLAKTLRGMSKRRRKK"
FT   CDS_pept        537012..537263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69028"
FT                   /db_xref="GOA:D3DGS6"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS6"
FT                   /protein_id="BAI69028.1"
FT                   /translation="MSDKLLEHGEKIAKLETKVDLLYHAVNELKQQNNRIEEKLDTHMA
FT                   HIASLQSRVAGIAFVVGAIVSGITSLLFKLIGFKVGES"
FT   CDS_pept        537260..537448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69029"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS7"
FT                   /protein_id="BAI69029.1"
FT                   /translation="MKVFLLSLFIVFLVFRSGEGWSYRVLDKANGRFIIMVQLTDTSFL
FT                   QIEFAKDGIKLQELLVS"
FT   CDS_pept        537535..538980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0568"
FT                   /product="glycine dehydrogenase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69030"
FT                   /db_xref="GOA:D3DGS8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS8"
FT                   /protein_id="BAI69030.1"
FT                   /translation="MKLIFELSKRGRKSFALPSLDVPEVSLEEYLGEHFRKELDFPEVS
FT                   ELDAVRHYTNLSKLNYSVDTNFYPLGSCSMKYNPRIAEEISRWEEFTDMHPMTPEDYAQ
FT                   GSLEVIYRLKELLKELGGFSEVSLEPAAGAQGELLGLLLMRTYHTDRGKEYKRKILIPD
FT                   SAHGTNPASAAVCGFEVITVKSDTNGELDWRDFSDKLKDDVAGLMITNPNTLGIFERRI
FT                   KDMAQALHEKDALLYMDGANFNALVGIAKPGLWGVDIMHFNLHKTFGTPHGGGGPGGGA
FT                   VGVSEKLVPYLPVPQVEFDGEKYFLSWDRPKSVGKMLSFYGHFSVMLKALAYILSYGNE
FT                   ISRVAKYAVLNARYLRHLLKGCLLDPYEHVPCMHEFVLSALNLVQYDIKAIDIAKALLD
FT                   RGFYAPTVYFPLIVKEALMIEPTETESVDTLRAFAKSLMEIIEEAKRDPQKVKASPEKT
FT                   PVRRIKEVEANRKPVLRYAFKSS"
FT   CDS_pept        complement(538967..540052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HTH_0569"
FT                   /product="DNA polymerase III beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69031"
FT                   /db_xref="GOA:D3DGS9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGS9"
FT                   /protein_id="BAI69031.1"
FT                   /translation="MRFSVDREEFLDALTKAKSATEKKSALPVLNNFLLQAQKDRLIVK
FT                   ATDLENFLTFSVRAEVYEEGVVAVNADKLTSVIKAIPSATLQAQLLEDKLSITGGRSKF
FT                   NLTALEAEDFPEFPEVKVSSQIPAVDFLKAIDKTEYAISKEDTRYALQGMYIHEHKGKT
FT                   HFVGSDGHRLALYFTPSPFSLELLIPRKSLKVIEGLLKDYIGEISIGKDGSFAHLQGED
FT                   FQLSIRLLEGEYPDYLSVIPESFNIEVLINKSEFLSALKRLSAIAESSAFPVKISLQDN
FT                   LAVFEITEPEYGEGRDEVDIEYSQEPMELGFNGKYLIEALESFDTEKVWLKIVDPDSAI
FT                   VLDSEDKESDPYMCLVMPMRI"
FT   CDS_pept        540069..542531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0570"
FT                   /product="poly A polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69032"
FT                   /db_xref="GOA:D3DGT0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT0"
FT                   /protein_id="BAI69032.1"
FT                   /translation="MEKVIFLEEGADLDALSSAYGLLLIYPESSIFKPKHLSRRASEVF
FT                   RDFRHLFRIREDLPQEFDLILADTHHYEVYLEEFKGKVKDIIIYDHHPAHMAGVKGKVQ
FT                   QVGSTTTLVVEELMERNMDISPVSATLLSFGIYEDTGFLSYEGTTSRDARALAWLLEKG
FT                   ADLRIVRKYLSDTLSKEQIDMLSKHLQSIESLFFNGKKIVIATLKAEEYEPDLLRIIYD
FT                   LREVRDSSALFVIVSAGYKTYVFGRSLRGELDVNKILEHFGGGGHTFASATKLEGAHAE
FT                   RVKSVLTSLLEGKRVALKVKEVMTSPPFVLHQDTGISDAILELSQRNFAGAPVVDDAGK
FT                   LVGVIYKKSLVRALKHYPEGRVRDFMLEEFHTLTPEDFIWKAEEILSRYGEKLIPVVEG
FT                   DRLVGVITRLDLLYSMRQQTAYLKAYERKIKLPPHIEEVGREIGIIAEGLGFKAYLVGG
FT                   VVRDILLGKEVWDVDFVVEGDAIKVAELLAQKHKVEFHPFPEFGTAHVKVKGLKLELAT
FT                   TRRETYPHPGAYPLVEYASLREDLLRRDFTINAMAVSVNSQDFGTLIDYFGGLRDLKDR
FT                   LIRVLHPLSFVEDPVRILRALRFAGRLGFKLSKSTERLLRSAVSLGAISSAPKGRIMNE
FT                   VRLALREERFLEILELYRKYQILAEIFKGITWSPKLEKKLLRLRDIITWHKIEFPKEVM
FT                   DYGWVYLLVLLEEMKEEEGMAFLRDISAPSWVRETYKIMKRGSKSTEKSLLEAKRNSEV
FT                   YLSLKNKPLYFLLMLMTKENLKEKVKLYLEKLRFVKVNVEKFRGLSGRELGEAIEKEKM
FT                   KIMDEALE"
FT   CDS_pept        542543..543400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0571"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69033"
FT                   /db_xref="GOA:D3DGT1"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT1"
FT                   /protein_id="BAI69033.1"
FT                   /translation="MSMVSLLLSSFYQYCIEILPYFLFAALITSLIQAYVNLNLLRRFL
FT                   TGSKLAPVFTASFGGLLPLCSCSMVPVAQLINHLSKNYSSVVAFLMVAPVVSPITVALT
FT                   YGFFGLKMALLRVFATLVFALVVAYAMDVLFKKNKGPSLHITAGQKSEKKAEIFVKSLR
FT                   YNLFFTGRYLLIGIAIASLIKTFVPIQVVKYIAGSPLSYPLISLVSIPIYVCSGEDVPI
FT                   AKALVQIGFTHGNAFTFMLASSGICMPTILAVKSFLPSRVVFAYAVSWFLLSTLLGFAI
FT                   DVLF"
FT   CDS_pept        543431..543784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69034"
FT                   /db_xref="GOA:D3DGT2"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT2"
FT                   /protein_id="BAI69034.1"
FT                   /translation="MDRYAQVLQELIKNTGLEGASLVSADGLPISSVLKPGLEEDRIAA
FT                   MSAAILSLGERVAEELAKGGLEQITIKGDNGYVILTGVGHDAVMVVLADNNAKLGLLLM
FT                   EIKKAQEKLKALI"
FT   CDS_pept        543795..544487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69035"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT3"
FT                   /protein_id="BAI69035.1"
FT                   /translation="MALTGDLSTFSFVDIFQILAKDRRSGILLVEWQDMTVAYYVKEGE
FT                   VVFARPVDRVFRVYAERDFDNLIDKLRISKESLPKTVERFLISKLGSKEGVFSFTPGFI
FT                   RYNSDMPFYYPIEKLIMIAARTLTPEEVERKISDEMLTFERAHDYVEKIRKAELTREEE
FT                   RILMLVDGERSVADIRRESGLDNLTVDRTLYGLLALGVLRRKKREKRHKPSITLELLAK
FT                   IIERIKEL"
FT   CDS_pept        544487..545035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0574"
FT                   /product="small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69036"
FT                   /db_xref="GOA:D3DGT4"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT4"
FT                   /protein_id="BAI69036.1"
FT                   /translation="MKPIKKIKIVVAGPFAAGKTQFINTVSEIKTVSTERRTRAVGERN
FT                   VKDYTTVAMDFGKIRIDEEHELYLFGTPGQSRFDFMWDILGEGALGIIILVDSTDPSTF
FT                   HEARKIINFFQSRFPVPMVVGANKQDLPNAWSPEDVRVALDIDEEEGIPVLPVSAIDKN
FT                   NVKNVLLTLLNIIREELLS"
FT   CDS_pept        complement(545032..546054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="HTH_0575"
FT                   /product="N-acetyl-gamma-glutamylphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69037"
FT                   /db_xref="GOA:D3DGT5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT5"
FT                   /protein_id="BAI69037.1"
FT                   /translation="MEQALRVCIYGATGYTGIELLRILAHHHYVRIVSAVSRTYAGKHI
FT                   SDLLPYFSNSYLSKVPLSEEPQEDFDLAFLCLPHETSLELTPTLLEKGKSVIDLSGAYR
FT                   ISRGELYPEFYGFEHTHKELLNFAVYGLPEIFRNSIKGARLVANPGCYPTVALLSLYPF
FT                   LREGVDFDSIIVDAISGVSGAGRKTTQHFHYPEMEQNIMAYSVQKHRHTPEMEDVIKRL
FT                   SRRDIKVRFTPKVVPASRGMLSTVYIPTQEKRIRDLFYETYKEEKFVKVVQEPPMTKHV
FT                   IGTNMCLIYPYYDERTDTAVVISAIDNLGKGASSQAVQNMNIMMGIDESAGIENLPLFP
FT                   "
FT   CDS_pept        complement(546039..546479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="HTH_0576"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69038"
FT                   /db_xref="GOA:D3DGT6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT6"
FT                   /protein_id="BAI69038.1"
FT                   /translation="MITKLKDFRIGFDNAYYGTGRRKESIARVWLLRNTDKMIVKVKDS
FT                   GKEFLLKDYVQRSSLFNKILYPLKLTGLEGKFGIYATVEGGGISGQAEAIMYGIGKALL
FT                   KYNPDLRPTLKKAGLLKRDAREKERKKYGLMKARKGYRWSKR"
FT   CDS_pept        complement(546476..546910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="HTH_0577"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69039"
FT                   /db_xref="GOA:D3DGT7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT7"
FT                   /protein_id="BAI69039.1"
FT                   /translation="MKTYRVRPEDVVRNWWIVDAEGKTLGRLASQIAKILRGKHKPYYQ
FT                   PDVDCGDFVVVLNAGKVKVTGKKLEQKVYASHTNYPGGIKERTLKWMLENKPEEVIRLA
FT                   VKRMLPKNRLGHRMLKRLKVYSGSEHPHQAQKPQTLEVKA"
FT   CDS_pept        547095..547556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69040"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT8"
FT                   /protein_id="BAI69040.1"
FT                   /translation="MKVESPSFKNGEVIPQKYTCDGENVSPPIAWSGFPEGTKSFVLIV
FT                   DDPDAPIGTFTHWVVYDIPANTVSLKENFPKSKQVDNIKQGINDFGRVGYGGPCPPPGH
FT                   GYHRYFFKVYALNVESLGLPPGATKEQVESRMKSHILSEGQMMGRYRRD"
FT   CDS_pept        complement(547553..548380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA1"
FT                   /locus_tag="HTH_0579"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69041"
FT                   /db_xref="GOA:D3DGT9"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGT9"
FT                   /protein_id="BAI69041.1"
FT                   /translation="MDWLKVKAPQNQVIERTLRVIKKYSLNTVCEESLCPNISECFSEG
FT                   TATFMLMGKVCTRACKYCHVATGRPQKPDASEPHRLYLAVKELALKHTVLTSVDRDDLK
FT                   DYGSGHFKRCVEYIKFRMPEVTIEVLVPDFRGDVSAMKKLISSSPDIIAHNIETVERLF
FT                   KQVRPQGDYRRSLNALKYYADNSNRPVKSGIMVGLGESLDEILKTFEDLRRAGVSRLVI
FT                   GQYLSPSPRHYQVRKYYRPEEFERLRELALSFGFERVLSLPLARSSYHAQNLV"
FT   CDS_pept        complement(548382..549185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0580"
FT                   /product="oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69042"
FT                   /db_xref="GOA:D3DGU0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU0"
FT                   /protein_id="BAI69042.1"
FT                   /translation="MHTENPYLLREGRVKKVIREAEGVFTFYIETPIKAFPGQYNMLYA
FT                   FGMGEAPITIAHAENGHLIHTVRAVGDVTKHIDTLKEGDILYYRGPYGNTWDIESAYGK
FT                   HLLIVSGGLGLAATRWIYEKALKEASAFKKLVHLYGAKDYDSLIYRYLYQQWGMGENFL
FT                   ITLDKPDERWKGPKGLITELLKMVNVEPDTVVFMCGPDPMVKAFIAELEKRGVSVRNIY
FT                   VSLERHMKCSVGTCGHCMIGPFFVCKDGPIFRYDRIREFFERKEV"
FT   CDS_pept        complement(549186..549683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69043"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU1"
FT                   /protein_id="BAI69043.1"
FT                   /translation="MSLLRLSSILLCFSLAFAKEIKVYAIVEGQVKKVYVKEGDKVKVG
FT                   NVLVEIDPTLYITRRESLSAELESQKLNLEKVERDFKRYEELFNRDLLSKSEYEDWKNR
FT                   YERERSRYISLQAQVERINKLIEYCTLRAPTNGVIRKVLIREGSFVNGTMIPQTLLIME
FT                   ER"
FT   CDS_pept        complement(549661..550941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0582"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69044"
FT                   /db_xref="GOA:D3DGU2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU2"
FT                   /protein_id="BAI69044.1"
FT                   /translation="MMYLLVILIFSFALGQEVIRLTPQKAYELAWENNAELRKLRYDIE
FT                   SANFQLEEAKNYFLPYVMLGGGLVYNSKTEEWEKPFGVSFISLLYEYKKTSSRIRSAEL
FT                   SSEIKKEALRQLERDIKVRILELFAQANLYKKLTEVKREEMAIAYVRFDRAQQRKELGL
FT                   ATNLEVYQLESIYREKRKDLLQAQYEYNRALLEIKKLVGMDMDTLIDVQDIDLKPQVGD
FT                   IDREKLLAYILKNNPILKIKKKQVETYDELIRQAENILTPRMQIRGEVGNTIRIGIPQT
FT                   RAYNQTGWRAGIEIFVPLFDASSLYRIGSLKAQKRMAQVDLEDTLNELKLLSNSAEYRY
FT                   LYLLAQWDSAVSKNRYAEENLMLRRSEYELELAFDLGYAMAEKSETERQLMQAKYDLLL
FT                   FLARLYALAGLDPYLIFEKSDEFIKTQ"
FT   CDS_pept        complement(550938..551432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0583"
FT                   /product="thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69045"
FT                   /db_xref="GOA:D3DGU3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041737"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU3"
FT                   /protein_id="BAI69045.1"
FT                   /translation="MRKLLMLIFILPFVAFSAVGIPFLKPSLLNLKDDLEDAKRDGKYL
FT                   FIMFHQEGCPFCDKMRKVTFQDKAVQEYFSKHFYMVEIDIRGANEVVDVDGKKMTERQF
FT                   AHKYGVRLTPVFMFFDQKGNVVAKVPGYIEPKDFLLIGRYMVEGHYRDTNLVKFIKENK
FT                   K"
FT   CDS_pept        551468..552118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0584"
FT                   /product="rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69046"
FT                   /db_xref="GOA:D3DGU4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU4"
FT                   /protein_id="BAI69046.1"
FT                   /translation="MIPIKDINRSRSFPIVNTFLILLCAAVWLHQVGLDEYQENIFIYK
FT                   YGLVPADVFQRPYTLLTHMFLHGSWLHIIGNMWFLWIFGDNVEDRLGRLRYLLFYIISG
FT                   LGAALLQTFVSFVLGGEDVPMVGASGAISGVLGAYLWLFPHARILALVPIFFFLTFMEV
FT                   PALLFIGLWILIQVINGILTLPFAQAGGVAWFAHIGGFAVGYILVKVFYTKRW"
FT   CDS_pept        552118..553083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="HTH_0585"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69047"
FT                   /db_xref="GOA:D3DGU5"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU5"
FT                   /protein_id="BAI69047.1"
FT                   /translation="MMLKIGITIGDPAGVGPELVVKLLDHLNPKNAYIIYGERKIIERA
FT                   MRLLGKEHTLRDIYVIDEVKAPGTYIADLDISETDRPIPSLTSGKVAVAYLGRAVVDAA
FT                   YSHIHGLLTMPINKFWAKMAGFSYEGQTEFLAQACNVKDYAMLMYSEKMKVVLLSTHVP
FT                   LRDAIEKVKAQNIKSKVEFVVREFKRLFGYEPSVGVLGLNPHAGEMGQMGREDMEEILP
FT                   AVEELKAKGIKVDGPLSPDSAFLKTDAFDVFLCMYHDQGLIPFKLLAFREGVNLTLGIP
FT                   FVRTSPDHGTAYDIAWKGIADISSSLHALRLCEELATKRA"
FT   CDS_pept        complement(553084..553995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0586"
FT                   /product="tetratricopeptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69048"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU6"
FT                   /protein_id="BAI69048.1"
FT                   /translation="MKRQVFKNLLLSVSFLLSSCASAPFYANECRRYLEAGDYQRAIQR
FT                   GKEAIDAYAKNTEPYLCVSTAYLQMGHLEKAIDILKEAERQAPSYEDLALIYNKLGFLY
FT                   HLKGDLDLALTYHQKHLLVSRELSDTKGESTALANMADIYESKGDYTKALFYYNKSVEI
FT                   STDPTDITFAYTNMARIYQKKGENEKALENYLKAYTYAKKTNDRKFIAVSLINVGDAYR
FT                   LVKDFKSASEYLISGLELAKQEKDKKLQAYAYARLGFLYRDKGDRRTAKEFLKRAYDMY
FT                   ISLNDKSGAKSTLSELKKLEGR"
FT   CDS_pept        554032..554319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69049"
FT                   /db_xref="InterPro:IPR007546"
FT                   /db_xref="InterPro:IPR036746"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU7"
FT                   /protein_id="BAI69049.1"
FT                   /translation="MLLGILKVELFFPENGSLKEKRYYLRSIKDKIKANFNVSVAEIDH
FT                   HDLWQRSQMAIVCVGAERSIVEETLAKVRNFFDRNYPEFIIGMSLDYLKV"
FT   CDS_pept        complement(554320..554736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69050"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU8"
FT                   /protein_id="BAI69050.1"
FT                   /translation="MLRIKGSALEKAITQAERDYPYETCGLLLGKIEGDVRTVFGCFET
FT                   PNANPDRKNDRYEIDAKDYLKAEEKARQFGLEIVGVYHSHPDHPDRPSAFDEERAFEGW
FT                   SYLILSVNKGKVVSYRSWELFEGKFRQEEIYIFG"
FT   CDS_pept        complement(554739..555749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="HTH_0589"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69051"
FT                   /db_xref="GOA:D3DGU9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGU9"
FT                   /protein_id="BAI69051.1"
FT                   /translation="MGYRVAIVGATGEVGRAFLKVLEERDFPVDDIQLFASERSEGTFL
FT                   TFRGQKVKVQALNKRGDFKGIDIALFSAGSSVSKEYAPKFASDGAVVIDNSSAWRLDPQ
FT                   VPLVVPEVNPEDVKEHKGIIANPNCSTIQMVVALKPIYDAVGIEAIIVSTYQSVSGAGA
FT                   KAIRELERQTRAWCKGDKIPDPEALPKRIAFNVIPQIDVFTENGYTKEEMKMLNETRKI
FT                   MHDPNIKVSATTVRVPVFYGHSEAVSVKLKKEISPEEVKKILSKAKGVIVFDETSSYPT
FT                   ALDVAGRDEVFVGRIRRDLVFDPGISMWIVADNIRKGAATNAVQIAELLTQFAMV"
FT   CDS_pept        555771..557111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0590"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69052"
FT                   /db_xref="GOA:D3DGV0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV0"
FT                   /protein_id="BAI69052.1"
FT                   /translation="MGLLSLLLLAFMSLLPNINTYQFRNEESLRVTIAYEMSKSSQYLQ
FT                   PYLLGEPYYNKPPLFNWLIALYSNFIPWSELTARAVSLTFLALTLLVIFIFSYHLFKNL
FT                   SLSLLSALSFLTFGNVLFFYGYLAEIDMTFAFFTFCMMLSLHVWLRQDKLLWGVCASFL
FT                   AGIGALLKGFPAYAFYALTFLSLVIYQIRWNILTSRKVLLVHSISLILPALWLVNTCDP
FT                   LLYLKTLFDESFSRVSSGDFSRTKHMLTFPFFNLKDMLPNSLLFLVALYMLIRQRKFEF
FT                   PQDIRLLSLVFFVNYLPYLFSNSAGRYVMPLYPLLAVIFSFYMHKSTENAGFRKLFYTT
FT                   ILLTILLRFAYGFVYFEYFNQRESSRKLIAEKIIKSIDLSSAIECQCRQELSVCLYVSL
FT                   AKGEPLKQKLPNALYSISCEEEKTGEVLMRFHVDSYQIKLLRLKPNG"
FT   CDS_pept        complement(557088..557762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69053"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV1"
FT                   /protein_id="BAI69053.1"
FT                   /translation="MKFIFAILALVSLALAVDKEDMERLVEESTWVVKDLRLGAEGIPE
FT                   ELLKRARGVIVCPGLIKGAFIFGGGGGNCTVSYRNPTTGEWSAPAFYTLAQASVGFQIG
FT                   VESVDLLLVVNTDRGMRSLLRNKVKLGADLSVAAGPAGRSASASTDLALKADIYSYSKA
FT                   KGIFAGVSLQGAVLIPYEDGISAYYGKHLTPKEILFGKVQMPPSAVKFTQTLKALTVRF
FT                   QP"
FT   CDS_pept        complement(557759..558844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0592"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69054"
FT                   /db_xref="GOA:D3DGV2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV2"
FT                   /protein_id="BAI69054.1"
FT                   /translation="MFFLEKDRLIEVFERLKGDYTVIAPKIEKGAILYQRVSAFEDLPF
FT                   GYRDHQKPGYYRIEKMDTEEFFTYTHPVNSLKNFLHPPELTLIRVEKGDKRVRFSYDVP
FT                   RERYAFFDVRACDLKALKILDGVFIEKNNFPDPYYRSLRENIFVVAVNCTYATDVCFCA
FT                   TLSSGPEVKEGFDICLTEIREGFVVEVGSNKGMELLKDMHLKEANKEQIKEKERRVANL
FT                   KVREEKLPEDLRDRLYEAMEHPFWDQVAKRCLACTNCTQVCPTCFCFDVLEINDMDLKE
FT                   SVRMRVWDSCFNSSFATLHKFNLRESIMSRYRQWLMHKFAYWVDQFDTLGCVGCGRCIT
FT                   WCPVGIDVLESVKELLKEIGS"
FT   CDS_pept        complement(558844..559953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="HTH_0593"
FT                   /product="peptide chain release factor RF-2"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69055"
FT                   /db_xref="GOA:D3DGV3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV3"
FT                   /protein_id="BAI69055.1"
FT                   /translation="MLADIKNKLEELKEKLLDVQQAMDISSMKEELKKIDMSMSSTNFW
FT                   EDQGKAKEITQRRKWLEETIKEFERIKSTLETLQELLEEVDEEDLETLSMIAEEIQSVE
FT                   KPIRDLEIKTFLSEEMDKNNAYLTVQAGAGGTEACDWASMLLRMYRRWAEKHGYEVEVI
FT                   DINPDDVAGIKSATLLIKGPYAYGYLKGESGVHRLVRISPFDANARRHTSFASVSVVPQ
FT                   IDEKINIEIREEDIQMETFRASGAGGQYVNKTDTAVRIRHIPTGITVSCQQERSQFQNR
FT                   LKALELLKAKLYQLELQKLEEKKKALEGEKTDIGWGYQIRSYVFQPYQMVKDLRTGLEV
FT                   GNVDAVMDGDIDSFIEEYLRWKAKEKVKV"
FT   CDS_pept        559974..561005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0594"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69056"
FT                   /db_xref="GOA:D3DGV4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV4"
FT                   /protein_id="BAI69056.1"
FT                   /translation="MFVDKVKIHVKAGDGGDGAVAFLREKYKPFGGPAGGDGGKGGDVI
FT                   LLATSRKHTLYDFKHKRHFRAKSGEKGRGKNQHGKDGEDLVLEVPLGTVVIDASSGKVL
FT                   CDLTEEGQRCVVAKGGRGGRGNARFATPTNQAPRYAEKGEKGEEKWIVLELKLIADIGI
FT                   IGLPNAGKSTLISKLTKAKPKIADYPFTTLSPVLGVMQLEDGRRIVLADIPGLIEDASA
FT                   GKGLGLEFLRHIERTKLLLHLIDVSDLRQTDPVDAFKKVNAEMEKYHPKLLEKRQIVVG
FT                   TKIDMLSDKNTLQKLEEEFSKMGYPFVAISSHTGEGLEELKEIIIKEMEVETVDKSYTK
FT                   PLQ"
FT   CDS_pept        561046..561348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0595"
FT                   /product="truncated transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69057"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV5"
FT                   /protein_id="BAI69057.1"
FT                   /translation="MRGLSWTSYKLWQIVKVALAIPVLGKSLSRDLSPLRGIIVSGDWD
FT                   RVARRLAPVSWDRGYGMDEYRQLGTCPYLKEAGYKYPSPKCGVLYTLDNQVLTCP"
FT   CDS_pept        561339..561818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0596"
FT                   /product="peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69058"
FT                   /db_xref="GOA:D3DGV6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV6"
FT                   /protein_id="BAI69058.1"
FT                   /translation="MPLKVGERAGNFELSSYEGKRYSLYETPGYVLLVFYKVTCPTCQL
FT                   TLPFVEKMYKLYGDAITFYGIVQDSDKDAKEFANKYGLTFPQLVDYPTYQVSQKYGVEV
FT                   VPTLYLLNPEKTIEFVSSSFVKADLDKLNSRLSAVAGKEEVDIFAGTHVPVFKPG"
FT   CDS_pept        561860..562531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0597"
FT                   /product="alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69059"
FT                   /db_xref="GOA:D3DGV7"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV7"
FT                   /protein_id="BAI69059.1"
FT                   /translation="MSCEKLREVEERLQKACERAGRKREEVVLLGASKSVPAQRIREFY
FT                   ACGLSTFGENRVQEFLKKYQALEDIAIDWHFIGRLQSNKVKYILGKVSLIHSLDRDSLA
FT                   QEINKRANVVQNVLIEVNVAGEKTKGGIVPENLLAFYQHLLSYKNLRVLGLMCIPPYTE
FT                   DPEKARPYFAKLRELKEKLESEFLVKLPHLSMGMSTDFEVAIEEGATIVRIGTLLFGER
FT                   R"
FT   CDS_pept        562547..563959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="HTH_0598"
FT                   /product="glutamyl-and glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69060"
FT                   /db_xref="GOA:D3DGV8"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR020752"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV8"
FT                   /protein_id="BAI69060.1"
FT                   /translation="MVITRFAPSPTGYLHLGNARTAIFSYLFARHHRGKFILRIEDTDL
FT                   ERSTKEFEAMLLEDLKWLGLDWDEFYRQSERFDIYREYAQRLIELGHAYPCFCTPEELS
FT                   IERQEAEKKGIPYRYSGKCRVLDKKQVEELKESGKSYTIRFKVPYGEYVVFEDLIKGHI
FT                   AINTDDFGDFVIIRSDGTPTYNFVVVIDDALMGITHVIRGEDHIPNTPKQILIYRALGF
FT                   DVPKFAHLPVILGEDRSKLSKRHGAVSVRNYREEGYLPQALFNYLCLLGWSSPQEGKEI
FT                   YSKEELIEIFDLKDINTSPAVFSKEKLRWMNGVYIREVLSLEELIDGITPFLKQAGYDV
FT                   SDRDYLKRVLEKTRDSFETFKEAGDRLKPFFVDDFDISQDAWSELENARVYDILSVFLE
FT                   KIKDRQLNAQSVKEMAREIQKELNVKAKDVWHSLRIALTGELEGVGVDILCDILPKEKI
FT                   VLRVERLLKKIA"
FT   CDS_pept        563956..565002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="HTH_0599"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69061"
FT                   /db_xref="GOA:D3DGV9"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGV9"
FT                   /protein_id="BAI69061.1"
FT                   /translation="MKFFVAGGGTGGHFFPALALIECMLERGLNVEFVGSQRGIEYRFK
FT                   DSIPCKAHFLKSHPFVGKGPLEKAKAVYYALTEGLKLLRHTSNAKGVVFGGYASLPLGL
FT                   ALSLRRKGLYLHEQNSVPSTTNTLLSKFSEKVFITFEHSRRFFPQDKVIKTGLPVRKRL
FT                   LQNFIKEDIKESFGFDKGKPVLLVMGGSQGASFLNQLATEIFSSLPLQGIHITGERDKD
FT                   KVESFYKERKLPVKVFAFSEDMSHIYGASDLAISRAGASSITELSLFGIPSLFIPFPFS
FT                   ARDHQFYNAKEIEDLGGGLVIKQEDATLQKVINGIELMLSQRDNFSRNIKRFANPYACQ
FT                   DILRLLVA"
FT   CDS_pept        565061..565951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="HTH_0600"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69062"
FT                   /db_xref="GOA:D3DGW0"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW0"
FT                   /protein_id="BAI69062.1"
FT                   /translation="MQVRKAVLPVAGWGTRFLPATKAMPKEMFPIIDKPVIQFIVEECI
FT                   SADIENIIFVTGRHKRPIEHHFDINTDLEKHLEQCGKMDLLRNIMEISRLINPIYVRQK
FT                   EQLGLGHAVLVAEPVVGYEPFVVALGDIIIKDERNVLERMIEVYNRFGKSVIAVFEVDL
FT                   KDVSKYGIVDGRLIERDIYIVDHLIEKPKPEEAPSHLAIVGRYLFTPRIFEKLKITPPG
FT                   KGGEIQLTDAIRLLIEDEAVYAIKIDAKVYDTGTPLGYIQTVLDFALQRDDIRDDLISY
FT                   LRQLLSNNIPQIDTV"
FT   CDS_pept        complement(565917..568508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0601"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69063"
FT                   /db_xref="GOA:D3DGW1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW1"
FT                   /protein_id="BAI69063.1"
FT                   /translation="MFFLLLLISPLIVTGKVFIMSNYPLPGNNLEKVVNEKNYLQMVEV
FT                   IKNIEGVKDVFTMQEGGDVYVYVERYPILKKVVIKGNVALWRDTIMSHLGLYEGMPLKD
FT                   INKESIEERLRRLYRDEGFLDAKVGVTLDLTEDGYVYLYIGIDEGDIYFTAGGRYEGTS
FT                   FKEDELNKALGLVKGQIARESEFEDKVFTLQDFYINRGYLDSFVYFKGIKKEELKKPFL
FT                   NVLFPTDERITRKPLRMVGSLVDGFSNFIRHPVGVFEALTGRAKVAYPTFSIIEGSKYK
FT                   IEFEGAKYFDSNYLLDISQLKEKGVDPFSLEEAKEILESAYKKKGFFDVSISYKAQGSY
FT                   VVFSIAEGERYTALLEGEEFPYDEDVIKSILDKEVQKLKREKYTLAEGSYSLKVDRDKK
FT                   IVYVELNINKGKRQILSRFLYKGNDREIAKIFREYNDKLPAVYNTDLIEALNIDIKNYL
FT                   LRKGYMEGDFSIDVSLQEDEESIYYTYIYTVKEGPRYKLGEDLYYGYHHTSSRELSYMT
FT                   VRREFYSESDTNRTLSNMITSDIFSGVKIDTFLDKDKKEVHRLIQLSEDKRGLYDLSLG
FT                   YNTEEKIVIDTFLGWKNLLGIGWNTGLRYRKTGKRELYNLELSDNFLFTRKLWFKASIF
FT                   RNYEEHRSYTLTSKGFTSSLGYRLTNNTSVGPIVSRTTNLALGERIDISKYGIFLLREY
FT                   KDDIFSPKRVHYDSVSITRATGDREYTKFELSTFYLIPLRKGLKLSFKVAGGYVGRSAP
FT                   IFERFFLGGLRDLRGYNFESVGQPNGGRYYTFGRIELEFPIKGPFVGIIFGDAGNVGDK
FT                   LSQTIKNPKKDAGISAGIKTPVGPIRFDVAIPLEKSAPRRIRLYLSVGYYY"
FT   CDS_pept        568530..569648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0602"
FT                   /product="aminotransferase, AspC family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69064"
FT                   /db_xref="GOA:D3DGW2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW2"
FT                   /protein_id="BAI69064.1"
FT                   /translation="MERISKISPFMVMEILKEASNIDHVIHMEIGEPDLDPPPSVIESL
FT                   ERAIKDRRYFYTPSLGIGELREKIAEHYYKKYRVDISPHRVVITTGTSGAFLVAYSILM
FT                   SAGEKVVLADPSYPCYKNFAHLLDINPVFLPVDESTNYIISVDMLKEHRDIKALHISSP
FT                   SNPTGSVYGKEDLASLVEYCQERDIYFISDEVYQGLVYDREEHTALEFSDGAIVISGFS
FT                   KWFCMPGFRIGWMILPEELIPKAERVIQNVFISAPTLSQYAALGAFDYEYLEKVKQTFK
FT                   KRRDILYEGLKDLFEVPVKPEGAFYIWANIDRYSEDSETFCREVLKNAKVAITPGTDFG
FT                   KNKTENFVRFSYTKDEEALREGLRRIKNYLIK"
FT   CDS_pept        complement(569633..570289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0603"
FT                   /product="peptidoglycan associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69065"
FT                   /db_xref="GOA:D3DGW3"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW3"
FT                   /protein_id="BAI69065.1"
FT                   /translation="MKRSLFLSLALLGSVAFAEQSLDPCGSPKEVYSKYLLDKCYKGYF
FT                   DAIIEAKKKSEEALNKANEALGKANEALNKANDLEGRVSKLEGIVDDHEKRIKALESRE
FT                   IPKGGWQLEEIGAVYFDFDKFNIKKSQAPKLDDIASKIQSDTREVLIVGFADTRGSSKY
FT                   NFNLSMYRAQIVASYLAKKGVDIGRMRIASYGKEVAKLISPKYAEQRVVRIYFIK"
FT   CDS_pept        complement(570359..570685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG'"
FT                   /locus_tag="HTH_0604"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69066"
FT                   /db_xref="GOA:D3DGW4"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW4"
FT                   /protein_id="BAI69066.1"
FT                   /translation="MEVIGIEDFLKLDIRLAKIVDAQRVEGSEKLLKLKVSLGGEERVV
FT                   VAGIAKHYKPDELIGKKILLLANLKPRKILGIESQGMVLALSDGERLSLIVPDREMEEG
FT                   TRVS"
FT   CDS_pept        complement(570710..571561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69067"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW5"
FT                   /protein_id="BAI69067.1"
FT                   /translation="MKRIITAATILLFSCGGGGGGGGTTPPASSVSLYFTDDMSVYPSI
FT                   LVTVYEVNLCSDQQCQQKVNLFSSQQGLEVDLAKLNGILQYITTTSIPQGTYNRLEVVM
FT                   DKNLTITDPSNQTHPAVFSPMQEKPNKPNTVQCDTQKCYIRFNGTVNPFATGKLIVDFV
FT                   LKEFEVNTLTSPWLVTEVKMKPLTPEEMRGISYEREIHLRVQSVNAQSNSFTGTWMGKT
FT                   FTVNISPNIRECEIYKIKYPPNTCVNQIAPSMCLEVKVQEDPATSTTLTAIKIETDKKC
FT                   MN"
FT   CDS_pept        complement(571582..573066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0606"
FT                   /product="glycosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69068"
FT                   /db_xref="GOA:D3DGW6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW6"
FT                   /protein_id="BAI69068.1"
FT                   /translation="MLYLLLLIVAANYYLNLGLSQVWMPNESFYAEASKNMMETGDFLT
FT                   PYYNGNVRIEKPPLTYWIVSLGYYLFGINEWGLRFFHATLGLLLGIITFLLSYEQSKNY
FT                   KVSLLSALILLTSFQFFANARYASPEIPFTFFIALSIYFWLKAYKKNHIPLLLLAFICS
FT                   TLAILTKGPAGFVIPAGVVFFYLLVSDPKELLKKRYYLLTLLLIPPSFWWHIFEFFSHK
FT                   KEFLEVFYVENLKRVYAGNDPFYFYFLDTAVSFMPYSFLVFFALLWTFIKKKKELTIFV
FT                   VWLLLVFLIFSFIKSKIPVYVLPAYPAMAILTANFVLSSDWKSIIKYSSTFITLLISSA
FT                   ILLTTFYFQLETAYAVLALLPLPFLLRNYAIAPLVAGIAFLIFANTGLLHYLESFRHYK
FT                   EVGNFIKNLDPSNTLKTYQVGYFHHNLPFYADRTIIRDRYPEKPSIVIFKIGSFEGCKP
FT                   TKLWKLYTSSESRFITFLLDTKRGKRLEEFGVCLYN"
FT   CDS_pept        complement(573081..574295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="HTH_0607"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69069"
FT                   /db_xref="GOA:D3DGW7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW7"
FT                   /protein_id="BAI69069.1"
FT                   /translation="MIPYEEALSKVLEHTKLIDTERVFINQSLGRVLAEDVMADTDKPP
FT                   FDNSAMDGYAVRYEDIKDASQEKPVKLKVLGEIPAGEETAYKMEKGTAVKIFTGAPIPE
FT                   GADTVIPFELTQEENHYILIKEPLKLGSNVRRKGEEIKEGEVVLKAGTLIRPYEMGIMA
FT                   SVNRVVVSVYRKPRVAVLATGDEIKDVGEPIEKLSQIRSSNSYVLFAQILRSGGEPHYL
FT                   GIVKDNEEEIGKFLKHIDYYDVFITTGGVSMGGKDYVQHLVKEYGIDVKFHRVRIKPAK
FT                   PVLFGTYKDRGLFFGLPGNPVSCTMAFDLLVHPALLKMSGRKDYIPKVFKAILKEDFIR
FT                   RDAERREFVRAFVSFDGEKAYCSYSHKTQSHMLTSYIDMNAYMVVYEGIKEIKKGSLVD
FT                   VIMFP"
FT   CDS_pept        complement(574306..575508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK2"
FT                   /locus_tag="HTH_0608"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69070"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW8"
FT                   /protein_id="BAI69070.1"
FT                   /translation="MANIVVTPMTFAPVYQQFAEIVERKGIGHPDTICDNLAENLSREL
FT                   CRWYLSEFGAIMHHNVDKALLVGGVSNAYFGGGEVIQPIEIYLVGRAILEKNTKRLDIE
FT                   ELVRETAKNWLRNNIKNMDVDKHVKIYTKIRPGSKDLVELFERFQKRGEVPLANDTSFG
FT                   VGFAPFDDLERAVYEAERFLNSEALKKEHPEVGEDIKVMGVRIENKIRLTVALAFVSKY
FT                   IKNINEYFARKEELTRKVKTYIEGLLGREVQVHINTADSKENGSVYITVTGTSAEQGDD
FT                   GQVGRGNRVNGLITPYRPMSLEAAAGKNPISHIGKMYNTVASIITQRVVKEVEGIEEAY
FT                   CYIVSQIGKPINEPQILDVKVRTSRNINTLQEEVKKIAKEELDRMPSIWKGFLEGIYTV
FT                   A"
FT   CDS_pept        complement(575549..576568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="HTH_0609"
FT                   /product="aminomethyltransferase"
FT                   /note="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69071"
FT                   /db_xref="GOA:D3DGW9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGW9"
FT                   /protein_id="BAI69071.1"
FT                   /translation="MKSPLYELHRQLKAKMFEFAGWQMPLYYSSIKEEVKAVRDECGIF
FT                   DVSHMGRILMKGPSALETLDYLTTNHVKKLSPGKVQYSMITNHQGGVVDDITLYMLDQE
FT                   SFMLCINAANRKKVINWLSKYHHVEDISGSTLQLALQGKKSVDVLSALFPVGEIKRYNF
FT                   KVFDGIIVSRTGYTGEDGFEIYASIKEGLGIFKELIKYAKPCGLGARDVLRIEAGLPLY
FT                   GHEISEDITPFEANLDRFVCTDKDFLGKSAMLKREIHRKLFGLELLQRGVPREDYRIYL
FT                   SDMEIGRVSSGTYSPTLDKGIALCFVDISFRKEGLEVELDVRGKRLKALLRNYPFVHR"
FT   CDS_pept        576593..577651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69072"
FT                   /db_xref="GOA:D3DGX0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX0"
FT                   /protein_id="BAI69072.1"
FT                   /translation="MLGKYVLFFYIKLFIVVNAILLGIVSSYALAELLFLFKEKSANIA
FT                   ISYLLNLLPISFFYLLPFSAVITMMILLKHIFSKKLDLIVQSFGVSPLKFLLNIILFLV
FT                   FVSFFNLIMSFDVYPESNKNLYSIEKEFKKRQEVEDLIVRNAWFFKEESGERIYINFQF
FT                   VDIKDGNIAGVFLVKSSKSNILEVIQSDRGSWKGDIILLPIAKVWNIKEGNFVAKGISI
FT                   KLFEIKNAQPIGEKVEHISLHQLLLLYSLGKRVGLNYHLYLSEIIRRFLSSLSPIAIGI
FT                   TVMSYAIKRRSILAGFLSFVPAFFFYWFSFVLTRFFSESVSFNPLYGLFAYIPLVILSL
FT                   KGLYYLGKGFRV"
FT   CDS_pept        complement(577610..578350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="timA"
FT                   /locus_tag="HTH_0611"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69073"
FT                   /db_xref="GOA:D3DGX1"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX1"
FT                   /protein_id="BAI69073.1"
FT                   /translation="MKLISANWKMNMTPSQTKEYLYNFLPLVEDVKDREILLCVPYTSL
FT                   CIASEMLKDKHVKFGAQNVHYEPKGAFTGEISVSMLKDLGVSYVIVGHSERRWLFGESD
FT                   EIINKKLIACLGSGIRPILCVGERQDEREAGLTFKVIETQVKLALSSLEDYTDMIDIAY
FT                   EPVWAIGSGNPATPEDAQKVHRFIKELLESLNKNYKGTTRILYGGSVNIHNASEFMKMP
FT                   DIDGLLVGGASLDPEAFSQIVKSF"
FT   CDS_pept        578463..579635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69074"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX2"
FT                   /protein_id="BAI69074.1"
FT                   /translation="MRKSLLAMAALMGATVLPSQAAVIRVDEDTFANMGLKLQIWAQHL
FT                   GKTTPGGKDYNDFSINGARVYFSGQVNKFVQFGANLDFALYQGSSGRTNHGGTRESRAN
FT                   DAFINLKPMEEFQIMAGVYRLPFSRASLTDSYTYLIPTGYGYSTRGNLFAPFTIGSNVA
FT                   NAYRDTGLTVWGNIADGMLKYQIGIFDGRWDHVHPLGVKDNLAFAGRIQFTPTMLGFKG
FT                   EKGFTLADTYLGKQNVLSIGLGYNTQKWDNGAGDSATGKAWTVDAMWEQKFGDIVPNLQ
FT                   LGYQDRKDMPAGTTSPIAKSKDRAYYVQGQLLYDQVVGLGKPALAIRYEKLDDRTAANK
FT                   DTNRTGVFLNYYIKGQDAKIQLGADVVSLKNKSPNEKNYTDWTLALQTQF"
FT   CDS_pept        complement(579683..580543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="HTH_0613"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69075"
FT                   /db_xref="GOA:D3DGX3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX3"
FT                   /protein_id="BAI69075.1"
FT                   /translation="MTIKDKLKSYAQLVKFEHTIFALPFALASLLILYKSLPSPQKVFW
FT                   VVVALVSARTAGMALNRLIDLPIDQKNPRTKNWVHASGKVKKHDMLAIILVSSMIFLVS
FT                   TAFINLYTFLLSPVVLFLLWLYPYSKRFTNFPHLVLGAVYFLIPLGVDIALNERVSFLS
FT                   ILLGMAMAFWVAGFDVLYSLQDYEFDKRHGIGSLAVKLGIKNAILMARLFHMATLLCLL
FT                   ALGFASPKLSFIYFIGLILLSGFLFYEHSLVKPYDLSKVNKAFFTVNGYISLVFLLVVL
FT                   LDIIF"
FT   CDS_pept        580572..581972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="HTH_0614"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69076"
FT                   /db_xref="GOA:D3DGX4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX4"
FT                   /protein_id="BAI69076.1"
FT                   /translation="MTYLDIEPPHDELAERAVLGAMILDPETIPQVLEYLREEDFYLEH
FT                   HRLLFSLLYKLWEDKGKDWDDIVLREYIKRYGLSDKIDMAFVYALVEEAAKGALLEEAI
FT                   NLVKEKSGLRNLLDLSLNALKGIKEEPDFNRLLEFMLHKVLEISEKQTITHYYHIKEVA
FT                   SKVIEIIEKHRKAERLITGRATGFLDLDVLTTGFHPSDLIIVAARPGMGKSSFMLSMAV
FT                   NMAMEEKVPVVIYSLEMSKEQLTMRALSMLSGVPLQNLRRGFIKEEERNRLISSALELS
FT                   SYNIYIDDTPTLSTTDLRIKTRKLKKERGVEVVFIDYLQLLRSPRRLSSRQEEVAEISR
FT                   NLKALAKELELPVVALAQLSRQVEHRSDKRPQLADLRESGQIEQDADLIIFIHRPEYYK
FT                   KNPPPEEQGIAEIIVAKQRQGPTGIVKVAFIKETASFKPLEYKEAQKVEEYEPDLEEFS
FT                   EEDYDLDF"
FT   CDS_pept        582057..583469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69077"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX5"
FT                   /protein_id="BAI69077.1"
FT                   /translation="MLELILTKEKLTQREKLVFFRSMLKAEMDVLNEYCVNGGIPKRYK
FT                   IELCHLHNIKKVNIARLLSIIEFYDPEFIKVLALTDPRVRTFIGYYLDFLKTNPYGYEA
FT                   LEPQNLFGNWDFIKYKLKILFPELTLDEIDRFKFKRKEFIRYLREKLGEAEELIESKLN
FT                   KATWYESVPYLELEEEMSKEWHPEPIMTEEDWAFIRRHIKGRKNIFIREGQGERFVYVD
FT                   VDIPDEELDKYKKDREGLKKLLMQKYNIDESGAEQILRKAGWESDTYHIIPPIHTDVVL
FT                   NYGELEEAVKKELEEEDRGMSYYDLANFIRYLGGLELEQLNYYELIYDKVEEEVQDIID
FT                   TIIRTQRRILGKMFGIFYTVDPLMAEAIITINPARMDFLKGLAVKETVRGKEFHLYSNP
FT                   TAWRIVKERIVSRFPEVSQEDIEKFKGRRDEFVKYLAEKTHKSQQTIENALEECGWTKS
FT                   EEIPAFLRQIGP"
FT   CDS_pept        complement(583449..584348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="HTH_0616"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69078"
FT                   /db_xref="GOA:D3DGX6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX6"
FT                   /protein_id="BAI69078.1"
FT                   /translation="MKIGELLKKGTFSISFEFFPPKTEEGERELFDTIKSLECLSPTFV
FT                   SVTYGAGGSTRDRTKRVVERIHQQTHMTVMAHLTCIAHSREEIISILREYKEIGIENIL
FT                   ALRGDLPANMPNFKPPDGACKHANELVRLIRSSFGEHFSVGVASYPEGHPESPNMEWEI
FT                   RYFKKKVMEGADFSITQMFFINDYYYRFIDMCYKEGIDIPIIPGIMPITNFRQISKFAS
FT                   MCGATIPDDLIKRLEPHMDDQEETTKIGVEFAIKQCEDLLKNGVPGLHFYTLNKSRATL
FT                   EIYQAIKDKVLALRSYLP"
FT   CDS_pept        complement(584311..584658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69079"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX7"
FT                   /protein_id="BAI69079.1"
FT                   /translation="MQDTLKIFYRVITDYTDIRWAKTRDDLISKIIKVLRAFGEGKTPE
FT                   EVIKEKALSTEVEGSLNYLYDFVQGHREELDRLINALSLFLKSPAPCKMRIIKLTEVFV
FT                   EDRRAAQEGNL"
FT   CDS_pept        complement(584659..584958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0618"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69080"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX8"
FT                   /protein_id="BAI69080.1"
FT                   /translation="MALFVMLTTLTDEGMKTLKHRPERIKEVDREVMERFGVKLIAQYA
FT                   VMGPYDFVNILEAPDNDTVVKMAIELGSRGTIRTLTMPAIDVDQLIKDLQELSK"
FT   CDS_pept        585089..586498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0619"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69081"
FT                   /db_xref="GOA:D3DGX9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGX9"
FT                   /protein_id="BAI69081.1"
FT                   /translation="MDVLGFYPMWYVPTVGSAFTIAIIATIHVMASHTSVGASILLAYL
FT                   ATKAYRENQPQIYDYIKKYLLGLLIFSYVSGSITGPGIWFSATVANPRGISALIHNFVW
FT                   VWAAEWVWFVAEVTLVYILFYTLGRIDQRSWLRLAWTFAIGSWATMYIIVGILSFMLSP
FT                   GHEKWFTTGNILDAFYNKNYFPHLLERTSFMFAIAGTVGLAIAGLMRKDISEKTYKEIV
FT                   KTLSYWGMGGVVFGLVFFIWYISTLPNRSDVILENVVPIYLKLPIMAIILLVLAHFFLT
FT                   AVRPTMARFWVAYPLYILIFFMGVYPEEKIRETLRKPYVAGEFMWVNQIVARDVPAKGI
FT                   KSEVPLIDQKGLLKLNAFVPEGLKNLTPQNQIMAGKTVAVLACSGCHNVTGSTGLRPFG
FT                   QKFAGMTDPNAVYSFLTSYLRDNHPPYMPKLVGTDEEIRALSAYIADMISKGGSVSAKI
FT                   EVPASSSEAKK"
FT   CDS_pept        586512..587807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69082"
FT                   /db_xref="GOA:D3DGY0"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY0"
FT                   /protein_id="BAI69082.1"
FT                   /translation="MQEVVRWFLLAVLSFMIVGGKLALAVDTSAMLKAMADPAGAPFFP
FT                   VVMQVLQVLTWALHILFVYTSIGGLFFAIYGFTRRDENWQKLSRATIELSKVSVSLAIV
FT                   LGVAPLLFYQVIYDPLWYSSANLSAWWYILFIVFLLIGYYFIWGAYLTKDKPTISMFMS
FT                   ILGIIFLLLVGFIIHVVNYQSLYPEKWVEWYTSGGTTMNTSGWNIYAFNIFRYLSFLVF
FT                   PSVAVTGIFLMLYNWYFRSREDMDKEYLDWAGKVGARFALYAGGGWIVAQVLYIFTIPA
FT                   DWGAKGSIFTWLTLLGLLLVIGVVFAAQKNPAKMAIPSLISGVVALLLIAIFREYLRVA
FT                   STARFGYSVYDYKMNLEFLSPLLFFGTLLTGLVLYAYAWWMAYRAGRTPKGKVYEASET
FT                   EHHLGDASVFVVILWAIVFIGVGLIVIARNYA"
FT   CDS_pept        587946..589268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0621"
FT                   /product="ATPase, PP-loop superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69083"
FT                   /db_xref="GOA:D3DGY1"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY1"
FT                   /protein_id="BAI69083.1"
FT                   /translation="MEFRLDGIVHINYGKCGIGKINLELKPLGKCSRCKKNEAIINLAY
FT                   ARQRLCKDCFNDFFVNRVRRVVEEFRMFKPGERVAVAVSGGKDSVALLHALKKAFPEQD
FT                   IYAFYINLGIKYYSDHLEKKVIELAEMVGVPIEIYNLKEKEGYTIDDFLLTKYKNKMCS
FT                   VCGLIKRNIFTTLAVRVNADTVATGHNLDDTVSTMMSLFFAGDFEGIARLKPVLKPLIK
FT                   GQPRKIKPLITTPEIEDLYYVALNELPVQECGCPHGEFTPIKGMKKWLDEMEKEQPDIK
FT                   FRLLSVFRRKFIPLVDRGLGEEGVEEVRACTVCGMPSSSEICSKCRRVMELMEIKERRG
FT                   EIKMEITFEELERLREKERVVLLDVRDRKEYEVYTLEGAINIPADEIQKRWKELLKYKR
FT                   THKVVVFCNAGRSSYAVAVKLRNLGFDAYSLKGGIISHIQP"
FT   CDS_pept        complement(589351..590184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0622"
FT                   /product="lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69084"
FT                   /db_xref="GOA:D3DGY2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY2"
FT                   /protein_id="BAI69084.1"
FT                   /translation="MRRGIGAVLICSSLFSCTQAVKQAVMPRSGDKIQLVQKGSFSFSE
FT                   EEERFIVKEAKNLNIPIPDREEIKRYISYFLQNKPYLEKTLQRAEYYLPIIKPIVEKSG
FT                   LPSELSLLPVIESGFNPLAVSRSGAAGLWQFIPSTARRYGLRVDEHVDERFDVIKSTEA
FT                   AVRYLKDLYSMFGNWELALAGYNCGENCVKYRTAGVDFWITKDMLPEETRNYVPAFFAV
FT                   LLITRDPVKYGLFSEGIKTLKKESQSAHAELSKVERSQRERIITLENGAKIIIKE"
FT   CDS_pept        590220..590558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="HTH_0623"
FT                   /product="protein export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69085"
FT                   /db_xref="GOA:D3DGY3"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY3"
FT                   /protein_id="BAI69085.1"
FT                   /translation="MYYFLLVVFVFIAFLLIVVVLLQRSRGDVGTAFGGMGQGVFGPGG
FT                   VDTILTKITYWLGFLFMFIAILLALTHPSKRGSLLKDEGARAPQKTQQSIPERQGAPSG
FT                   TPPESKGR"
FT   CDS_pept        590464..591279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="HTH_0624"
FT                   /product="methyltransferase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69086"
FT                   /db_xref="GOA:D3DGY4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY4"
FT                   /protein_id="BAI69086.1"
FT                   /translation="MKVQELLKRPSKVSLRDRELLLAHLLKVKVGEVYLLLDRHVSKEM
FT                   EEEYMRSLSLLEEGYPLQYLLGEWDFYGRTFRVEEGVLIPRPETELLVEKVLEKVPPNK
FT                   EAVGFEIGVGTGCISITLLLERPKLIMYADDLQEKAVHLAETNARLHKVEDRLFLKVGD
FT                   MFEPVKGMVFDFVISNPPYIPQKEWAGLPKGVKLEGKVSLIGGEKGYEFYERFAKEVGK
FT                   FLKEDGFFALEIGHDQGKILEDIFSQEGFFAQVYKDYAGQDRVILGWKR"
FT   CDS_pept        591267..592532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="HTH_0625"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69087"
FT                   /db_xref="GOA:D3DGY5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY5"
FT                   /protein_id="BAI69087.1"
FT                   /translation="MEAIGFSLGVLFFIILEGIFAGAEIALISTDRSKVLALYRKTGYG
FT                   FLRDFHENPEEYITLSMLGYTISIVFASTFYTLMVITLSDYLPYIKGYEVLFSLTLVIF
FT                   TLLFGEILPKSVFQKYSDKLLIPSLWYLSKIRVITFPVLVLSRKTSRYLTEFFRKRYSE
FT                   RISKIDIIKLLEEIELQESKIKIAVKLLTLRESTASEIVKPIYEVVMIDEFSTVGHALR
FT                   RMKESGFTKLPVYKQRVDDITGYVDMFDIMDAPPSSLIREFVKPVCLFSEFTPLQDVLE
FT                   TFRGGSSRMGLVVDERGIILGIVTFDDVIREILGQIGDSFAQPEEPIKEIEKDKWIVDG
FT                   MFDKHEFEKIAGVKFPEGPFLTLGGFIIYHLRRIPKKGEVVLCCGLRFLVLQSDRRKVK
FT                   KLMVERHVQEQKAQGHTERAKT"
FT   CDS_pept        592483..593160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="HTH_0626"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69088"
FT                   /db_xref="GOA:D3DGY6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY6"
FT                   /protein_id="BAI69088.1"
FT                   /translation="MYKSKRLKDIPKELRPREKIKSLGSQSLSDEELLALVLGSGTKEE
FT                   DVLSLSRRIIKLGWERLKSMSVNELIKEIKGIGEAKACQIKALIELSRRMYEPHAHTVI
FT                   NSPEDVYNLLKDKMDNRREHLWALYLTPSNTLIEYDLVAVGRLNSVFADPKDILYGAVR
FT                   SVCHSIILAHTHPGGEPKPSKADIDFTQRVKKACEILGFELLDHIIITKKGYFSMREGG
FT                   VVS"
FT   misc_feature    593157..595533
FT                   /locus_tag="HTH_0627"
FT                   /note="phosphoketolase"
FT                   /note="pseudo gene. This gene contains a frameshift
FT                   mutation."
FT   CDS_pept        595533..596609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="HTH_0628"
FT                   /product="acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69089"
FT                   /db_xref="GOA:D3DGY7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY7"
FT                   /protein_id="BAI69089.1"
FT                   /translation="MKYTLALNYGSSTLKYALFGDLKRLEGGTLKMGDVQQILLSILKT
FT                   FKRIDLTVHRVVHGMDLDSPMLIDGASFEVLKKLVAFDPLHNAFALTGIELCMKELPNV
FT                   PHYVVFDTSFFKVLPITSKAYAVPFSLFEEGIKRYGFHGISYSYLLKEASKLLRKSISS
FT                   VNLIMLHLGSGASICAVQSGKPVDTSMGMTPLEGLVMSTRAGDLDPGVVLHLLRKGKSL
FT                   EEVERMIYKEWGIKGMTGTSDMRQVIEEYTRGNESAKLAIHLYVYRIKKYIGAYYAVLP
FT                   KLDALVFSGGVGENSPLVRKLVCRGLEKLGIIIDERINQKGQLPLCISRRDSEVKVLVI
FT                   RTDEELEMVRQLRRALKG"
FT   CDS_pept        596615..597484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="HTH_0629"
FT                   /product="methylenetetrahydrofolate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69090"
FT                   /db_xref="GOA:D3DGY8"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY8"
FT                   /protein_id="BAI69090.1"
FT                   /translation="MHILLDGKSLSESIRDQIKTYVERITSRGYREPSLAVVLVGDDPA
FT                   SHIYVKNKRKACERVGIKSLFYHLPQNTKVPELLDLIASLNSDESVDGILVQLPLPQHI
FT                   PQEEVILSISPKKDVDGFHPENMGKLVARIEGGFIPCTPLGIDLLLKHYNIDLKGKNVV
FT                   IVGAGFIVGRPLALLMLWRDATVCVCHIHTKDITQYTKKADILISATGVPHLIKRDMVK
FT                   EGAVVVDVGISKVGEKVLGDVDFERVKDKVYAITPVPGGVGPMTVTALLLNTLQAYRQN
FT                   MNLKDGDL"
FT   CDS_pept        597471..598118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0630"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69091"
FT                   /db_xref="GOA:D3DGY9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGY9"
FT                   /protein_id="BAI69091.1"
FT                   /translation="MEIFDKYALLYDEWYERPFGKSAYKLELECLKSLYNQKGLSLEIG
FT                   VGSGRFAQALGIKYGVDTSKGLLRMAHKRGVRPILAKAEELPFKDSVFDSALIVVSLCF
FT                   FEDPLASLKEAYRVLKEGSFLLLGLVLSESPWAEFYREKAKKGHPIYSYAKFYSYPQLL
FT                   SLIQSAGFKKDKAYTTLFEEPQDKYPVKNRRIVEGFSPEGGFFCLRALKLSF"
FT   CDS_pept        complement(598107..598553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="HTH_0631"
FT                   /product="(3R)-hydroxymyristoyl-(acyl-carrier-protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69092"
FT                   /db_xref="GOA:D3DGZ0"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ0"
FT                   /protein_id="BAI69092.1"
FT                   /translation="MDIREIMEVLPHRYPILLVDKILEIQIGKRIVGLKNVSINEPYFQ
FT                   GHFPGFPLMPGVYILEAMAQVGGILMIKSLGLEIGKYAIVFAGIDEARFKKPIYPGDQL
FT                   IMELEVVSLKRTLSKMKGKATVDGQVVAEAVLYAAARELKELKR"
FT   CDS_pept        598642..599109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0632"
FT                   /product="cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69093"
FT                   /db_xref="GOA:D3DGZ1"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ1"
FT                   /protein_id="BAI69093.1"
FT                   /translation="MKKVLLSGVLSIALLASCQKKAEETAPAEQPAQQPAQEQPTQPSQ
FT                   PAGEQKQPSGEQKPAEQKPAEQKSQGPAKDMTALAQQKGCFACHDINAKKVGPAYKDVA
FT                   KKFAGQPGAVDELAKRIKNGGVGTWGQVPMPPQNVTDEEAKELAQWILSLK"
FT   CDS_pept        599088..599342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69094"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ2"
FT                   /protein_id="BAI69094.1"
FT                   /translation="MDPIPEVKGSLRTFIELHFKKQVEVSQSYLRDTLLFFLFAEYFGL
FT                   DNPLGIYALDLYPYLMEEFHLWHKSLGIERSSLDFIPCC"
FT   CDS_pept        599333..600139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0634"
FT                   /product="arsenite-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69095"
FT                   /db_xref="GOA:D3DGZ3"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ3"
FT                   /protein_id="BAI69095.1"
FT                   /translation="MLLRVIFFGGKGGVGKSTLACATALRLSEKGKTLLVSIDPAHSLS
FT                   GILKVKVGDDLVRINEYLFAVELSAERLVEDYVNNVLSAIGEMMPSLKSGLKEYARHVK
FT                   HSPTALETAVLDGIANYLEADFQFVVVDSAPTGQMVRIFQTAKMVEGWFSFLEKLAKER
FT                   QKLETFMGRSDKVFDLIKKRREKLERLVRVLREKAIIFAVANEETLSIEEAFDLEKYLK
FT                   EFKVYRVMNKWKSAEGDFLKVGYLQAPYGIERLSLLDVEELLKVIV"
FT   CDS_pept        600151..601542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potE"
FT                   /locus_tag="HTH_0635"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69096"
FT                   /db_xref="GOA:D3DGZ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ4"
FT                   /protein_id="BAI69096.1"
FT                   /translation="MLWKEIFRKKCYAVDEGRFPRKLGLLDLTFLGVGAIIGAGIFVIT
FT                   GQASALYAGPGIVLSFLLGAVAIGISALVYAELSSAYPISGSAYSYTYATIGEIVAWLV
FT                   GWNLLVEYGVATAAVATGWSGYLRTFLEQNFGFTLPHILTGAYDPSKGTLMDLFAFLGV
FT                   VAVFFLLTLGIKESATVNTLIVVLKLLTLITFLLFGIRHIDFSNLENFLPYGWIGVWHA
FT                   ASLIIFAYLGFDAVSTVAEETKHPTKNVPLGLLLSLGISTLLYMSVSFILVGMVNYKEL
FT                   NVPDALAFAMYKVGNPHVANLIATGAVITITSVMLVMGLGFTRIIYALSRDGLLPSGLS
FT                   RVHPKFKTPYVSTLIGGVILSLLAGFIPLKVLAELVNIGTLFAYFMVGIGVIVLRRSGE
FT                   ITATFRVPYAKILLPINLLLLLFIMMGLPKETWMRFVVWNALGLAIYFLYGYRKSRAYE
FT                   RSYEA"
FT   CDS_pept        601539..602069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuc"
FT                   /locus_tag="HTH_0636"
FT                   /product="thermonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69097"
FT                   /db_xref="GOA:D3DGZ5"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ5"
FT                   /protein_id="BAI69097.1"
FT                   /translation="MKKVFILLLLFLCSCRSEEGAKLTVNAKNVPCKITRVVDGDTFRC
FT                   RIDAEEITVRLIGVDTPESKENPKAKRDADRTGMSLEEITRMGREAYQFTKSLIPVGTT
FT                   VYLETDVQLTDRYGRVLAYVWLPDGRMLNEVLLKEGYAQVYTIPPNVKYQDLFLSAQRK
FT                   AREGKRGFWKQWF"
FT   CDS_pept        602139..603893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="HTH_0637"
FT                   /product="acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69098"
FT                   /db_xref="GOA:D3DGZ6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ6"
FT                   /protein_id="BAI69098.1"
FT                   /translation="MARKGADIVIETLKEEGVEYIFGHPGGAIMEVYDALYRDGSIKHI
FT                   LTRHEQGAGHMAEGYAKATGKVGVAMSTSGPGATNLVTAIADAYMDSVPVVFITGQVPT
FT                   HLIGNDAFQEVDIVGITRPITKHNFLVKRIEDLPMILRQAFYIAKTGRPGPVLVDIPKD
FT                   ITQKISDVEIPSLEEVKSSLPGYKPHTEGNPQQIKKAARLIAEAKRPVLYVGGGAVQAE
FT                   AQKELVELAELMKVPVTTTNMGKGAFPESHPLALHMLGMHGTYYANMAVYNCDLLIAVG
FT                   ARFDDRVTGKVEEFAPQASIIHIDIDPASISKNIVVDVPIVGDVKVVLRKLIEEIKKEG
FT                   AKLLYPEERQKWLEQIEKWKKLHPLTYRKSDKVIKPQYVIEEIWKVTKGDAIIATGVGQ
FT                   HQMWAAMFYRYSFPRQFINSGGLGTMGFGLPAGIGAKIGRPEKEVFVIDGDGSFMMTMQ
FT                   ELITAVHYRVPVKIAIINNGYLGMVRQWQELFYEKRYAEVDLSIQPDFVKLAEACGAVG
FT                   FRAEKPSEVREVLEEAMKVQDKPVLLDFHVDREENVLPMVPAGKSYRDMILEDGKKGVE
FT                   ADTMYLVG"
FT   CDS_pept        603906..604475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="HTH_0638"
FT                   /product="acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69099"
FT                   /db_xref="GOA:D3DGZ7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ7"
FT                   /protein_id="BAI69099.1"
FT                   /translation="MSDITAVKAPALREIKKGRVRKHIITLLVRNELGVLARIATLIAG
FT                   KGYNIEGLSVGETHEKGLSRMTIEVIGDDVVIDQVVKQLRKLIDTIKVRDLTDIPHIER
FT                   ELALIKVHTATPRARDEVLRLTEIFRGKIVDVSQSTYTVEITGTEDKINAFIELVKPFG
FT                   IMEMARTGKVALKREMASTEEEQLWK"
FT   CDS_pept        604466..605932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="HTH_0639"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69100"
FT                   /db_xref="GOA:D3DGZ8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ8"
FT                   /protein_id="BAI69100.1"
FT                   /translation="MEVSSYEKSYQEIKDTPLAIFVFEEDFSNLKYADAFAEKLNKVLS
FT                   AENFKGKEDTLIKVPLLEDDAVRTFYVVGLGKKDKASFDDYRRASAILIKRLKKDKVPF
FT                   AHIYAGEIIDYKKSKAITEGLILGHYSFDKYKSKKEEESFSVERVSIYRGYEEGIKVGR
FT                   VLAQAQNYARDLVNEPGNVINPITLAEIAQNLAREYGLECKVYDEKQIQEMGMHALWSV
FT                   GKGSATPPRFIHLTYRPQGEPKDRIAIVGKGLTFDSGGLNIKTGDYMRTMKMDKSGACA
FT                   VLGIMKALAELKPQIEVHGIIGAAENMPSGSAYRPDDIIKTMSGKTIEVDNTDAEGRIT
FT                   LADALWYASSLKPSHIIDMATLTGACIVALGEYTAGLFTNDDNFGDRLLEMSRETGERL
FT                   WKLPMDDKKLREKLKKSDADIVNTAGRYGGAITAAMFLEEFVGEGIKWVHLDIAGPAYF
FT                   KEEFGYYSKGATGFGVRTCLEYILSLDKGT"
FT   tRNA            605923..605994
FT                   /locus_tag="HTH_t10"
FT                   /product="tRNA-Ala"
FT   CDS_pept        complement(605995..606804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="HTH_0640"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69101"
FT                   /db_xref="GOA:D3DGZ9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D3DGZ9"
FT                   /protein_id="BAI69101.1"
FT                   /translation="MEEAIREFLREDIGHGDITTEGIFRGERVKAVLIAKEGGCLAGMP
FT                   FATKVFEILGGVQTFSTKKDGETFEAGERLLILEGSAESILKGERLALNILQSLSGIAT
FT                   LTRTVVEKLKGTGIELLDTRKTTPGFRYFEKYAVRVGGGKNHRFGLYDMVLIKDNHKRV
FT                   AGGIKEAVKRVKQVLGPAYKIEVEVESIEELYEALECEVDMVMLDNFTPDDVKRAVEII
FT                   KGKVKVEVSGNITPENIKEYAIEGVNYISCGFITHSARWIDMSLRVL"
FT   CDS_pept        complement(606806..607297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69102"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH00"
FT                   /protein_id="BAI69102.1"
FT                   /translation="MRTLSKEELKRLYDEDFPLWAEINLQLLKEKAYDLVDWENLLEEI
FT                   EDMANRHLDACISQLARILEHLYKWDNFRNLAGGECAGKDWIKSIREARDEIKAMFKEY
FT                   PSLKNKLPLELERAWIRAQVKLRKWLLKNDYEPDEFNIPEKCPYTYEEAINRDLKKELK
FT                   "
FT   CDS_pept        607380..608834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="HTH_0642"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69103"
FT                   /db_xref="GOA:D3DH01"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH01"
FT                   /protein_id="BAI69103.1"
FT                   /translation="MKVVMIAVESAPYIKVGGLGDVVHSLSKTLVKMGHGVSVIMPLHK
FT                   RVRADLKKVADGLRVYLDHEWKSFSLYEDTYEGVKYLFVDYPPYYRRDHVYAPPKGDYE
FT                   DNALRFGFFSLAGLEVIRQTGIAPDVIHAHDWHTAMVGLYKHLYYQDLNRVAFVLTIHN
FT                   GMHQGIFDSRFLPNLSLPWEVFHPFGGIEFYGKINFLKAGINFCDVLTTVSPSYAEELK
FT                   QYAYGLEGVIREKKYFFGVLNGIDYDIWDPEKDRYIKAYYSIRNFKKGKQQNKKHLKEV
FT                   FGLGNREDMPLVGMVSRLTSQKGFDIIKGVIDEAVALGFEFVFLGSGEEVYQNMLIEFM
FT                   KKYPKSVRVRIEYNEELAHKIYAGSDIFLMPSLFEPCGISQMIAMRYGTVPVVRKVGGL
FT                   KDTVIDIAENPEEGTGFVFEEYKPEELLHAMLKAAVYYQMEKCDASKRWSELIKRCMSM
FT                   DFSWQKSAREYEGIYSSAILLRRYDN"
FT   CDS_pept        608824..609297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0643"
FT                   /product="glycerol-3-phosphate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69104"
FT                   /db_xref="GOA:D3DH02"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH02"
FT                   /protein_id="BAI69104.1"
FT                   /translation="MIIELEELLRVLKEEREKGKRVVFTNGCFDILHAGHAYYLKKARE
FT                   LGDILVVGLNSDASVRRIKGEKRPIMPQEMRAYLLDSLKGVDYVVIFEEDTPERLIELI
FT                   KPDVLVKGSDWDLKDIVGADMVLSYGGKVERISFEFNISTSAIIERIINAYRC"
FT   CDS_pept        complement(609316..609630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0644"
FT                   /product="DNA polymerase beta-like region"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69105"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH03"
FT                   /protein_id="BAI69105.1"
FT                   /translation="MEVRELGLSKETIEKLIDTFRKEAKIEKAILYGSRAKGNFTKGSD
FT                   IDITIVAPEMTFPEYLHLLSKIDELDIPQKIDLTKYELLDENIKAHIKRVGKEIYIRKQ
FT                   "
FT   CDS_pept        complement(609639..609980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0645"
FT                   /product="nucleotidyltransferase substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69106"
FT                   /db_xref="GOA:D3DH04"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH04"
FT                   /protein_id="BAI69106.1"
FT                   /translation="MNEELRWQQRFENYKKAFIQFQTAVRQYKERGLNDLEKQGLIQTF
FT                   EYTFELAWNLLRDYFIYQGIPEIRGSRDAIRLGLKYGIIENGEIWFQMISARNLTVHTY
FT                   NEKIIEELL"
FT   CDS_pept        complement(610006..610581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69107"
FT                   /db_xref="GOA:D3DH05"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH05"
FT                   /protein_id="BAI69107.1"
FT                   /translation="MSFKGKVIVLRRLVVGDEDLLVKVYGWGGLMNMLVKDGALTSSRY
FT                   VSIFEPFNVLELSYRQVGEIILPLDVSKVRYLSYLALESYERYMWMCHLGNFFLRWVRY
FT                   YDQQLFDLFLLYLSAKVRNTKVFLIRFKLEVLKAMGLYKEELFEEDLRRAVRDIKRGSR
FT                   LFLERMRLNQQLAEKIERAIEDQLKESL"
FT   CDS_pept        610619..611485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="HTH_0647"
FT                   /product="panthothenate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69108"
FT                   /db_xref="GOA:D3DH06"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH06"
FT                   /protein_id="BAI69108.1"
FT                   /translation="MPTLFRKVKDVKSYLKSLRSSGGNNLSVGFVPTMGYLHEGHMELI
FT                   KKCKLQNDITVVSIYVNPLQFGEGEDYQKYPRDLERDLAMCQEAGVDVVFAPTDEEVYP
FT                   QVPKTKIHVEGISHVLEGAFRPNHFSGVALIVLKLFNIIQPDRAYFGEKDFQQLKLIQR
FT                   LVNDLSYPVEIVPVPTVRDKDGLALSSRNTYLKEQERESALSIYRSFLIAQKLFRAGNT
FT                   KAQDIKEAVRDYISRHPHVKRIDYVEIVDEDFNIKEEVSEGDRVLVAVWIGDTRLIDNW
FT                   RLSYEEV"
FT   CDS_pept        611472..611936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="HTH_0648"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69109"
FT                   /db_xref="GOA:D3DH07"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH07"
FT                   /protein_id="BAI69109.1"
FT                   /translation="MKRYEGLLKAEGINFGIVASRFNHLLVDRLVEGAIDCILRHGGSE
FT                   ENIHIARVPGSWEIPLIVKNMALKEQVDAIIALGVLIRGDTPHFEYIASEVSKGLATVS
FT                   LETGKPVSFGIITADSLEQAIERAGTKQGNKGWEAALSAIEMVNLLRSLR"
FT   CDS_pept        611933..612337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="HTH_0649"
FT                   /product="transcription antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69110"
FT                   /db_xref="GOA:D3DH08"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH08"
FT                   /protein_id="BAI69110.1"
FT                   /translation="MIYKQKARKDAFLILYQWDIKADKLEDITEEYIKSNLIKHSERRR
FT                   YIRKLVRTYMQKASEIDSLISELSQEWDIDRMGYIERNILRVALAEILFVGVKKLKPVI
FT                   MDYVKLTLKYAGKEPAKFVNGVLGRAAPKS"
FT   CDS_pept        complement(612327..613025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="HTH_0650"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)
FT                   methylideneamino] imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69111"
FT                   /db_xref="GOA:D3DH09"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH09"
FT                   /protein_id="BAI69111.1"
FT                   /translation="MELKSFIIPAIDLKEGRVVRLMRGDFGKLKDYGLKPEDVAKAFDD
FT                   AGFKRLHVVDLEGSLEGRLKNLESIRKIRKAFSGQVQVGGGVRSLEVCRGLFQEGIDLF
FT                   VVGTVAIKEPEVFKAMVEEFPQRVILSVDARAGKVAVGGWKEETSLSPQELALRYEPLP
FT                   IWGYLYTNIERDGSLEGVDTSIYESFKRLVKKPLIASGGVSSLEDVKRLYGVVDGVVVG
FT                   KAIYEGRIKI"
FT   CDS_pept        complement(613030..613419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69112"
FT                   /db_xref="GOA:D3DH10"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH10"
FT                   /protein_id="BAI69112.1"
FT                   /translation="MRSLKRAFDELYRGKEPSDAIDYLTLLKIERHRRRRLIKLLALES
FT                   LGFLALTFLMAYEFLKPQEYATMGFEGVQVRVIKDVSLLDLSRDLRLFGLKMEGPYEGD
FT                   IFLIKGDEKKIRELLKKREELKEVK"
FT   CDS_pept        complement(613394..613975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="HTH_0652"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69113"
FT                   /db_xref="GOA:D3DH11"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH11"
FT                   /protein_id="BAI69113.1"
FT                   /translation="MRGIHIHYGRGLKILPMRDEELIKEIAKGNEKALKELMNLYRSRL
FT                   FFYAYGILQNYEDAEEAVSETFYQVWRSAKSFRGGAKVSTWLFGITRNVSRNMLRKRIR
FT                   EPKTLEIMEQDALLDDTHLEDEDIQLIKEALERLSPAHREVLHLAFYEDFSYEEIANVL
FT                   GVPLGTVKTRVFHAKRKLLEVINEELKKSL"
FT   CDS_pept        614002..614328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69114"
FT                   /db_xref="GOA:D3DH12"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH12"
FT                   /protein_id="BAI69114.1"
FT                   /translation="MRGFTLLELIIVITIMGMLTLVVLPVLQRSLFGERDMLKAFILKN
FT                   LSIAMKEGKVIELYGDGKKIVSSEGEKIDLPYRGRCRIYPSGELRRCYFGKGGEDVYYT
FT                   VFDL"
FT   CDS_pept        614300..616204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69115"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH13"
FT                   /protein_id="BAI69115.1"
FT                   /translation="MFITQFLTSEIEARRTKNLEYLKKVSPHFYQFMNLKGEVKAQAIY
FT                   HLGRWDLLVNGVSLYGGDARLNTRRQFEEYLKTPNEFSPPFYVFWFPEDTVDGKLSHEL
FT                   TKLLAPARSADRCKQRKTVGTVIAFGVGLGFHIELLTEHYDIKQLILVETDVELIKPTL
FT                   YTLDWEKLLSVYNGKEKIISFYLHKDPDLLAVGLLDHLTTYYNPTLLTSFHIYIHRNDP
FT                   VLIEGAKKFWASNKSPIAGFGYFQDELWSLEYTLENIKRELPLYQGKKKVPSDSTAFVI
FT                   GAGPSLEYAIDFIKKNQDRAVIFSCGSSIGTLYEEGIKPDFHVEIERTKFTYDALLLSA
FT                   SRDYLKELTIIFNNPMYPQVSELFKESLMFVKPNDTGGSLFPTDYPPVGYSNPTVVNAG
FT                   LSLALHMGFRRVYLFGADMGYKDPRRHHARGNVALKKGTEFYKEVEAQEHELDGNFGGK
FT                   VYTNSMLLWARSMIQDLLKLYKDAEVFNTSDGAKIEGTIPARIEEIVLSQFKKSEAIKL
FT                   IKQDFSRDYLKALNLERKLSLLISHAEEYVNFVRERAKSISKPEDFFSFVSEAGLYQYR
FT                   FYGSPFIYMFRPPFYNFSYALLSGICRMEQDQALEAGKTALKLYIDFLHECIKLIRKV"
FT   CDS_pept        616215..618167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0655"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69116"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH14"
FT                   /protein_id="BAI69116.1"
FT                   /translation="MIDKQVLINLMRKRKDRNLQAIQRYAPHLMDLVNRKGKIPCGIYI
FT                   GDNGQIDLMMEGRRVYNMDPRLVAQMQFENFKKQRENLFVIPSVSSGRGHIDDIYKEKM
FT                   VELFGQKPDPEKLKKVVEGELKEGQKLGALLSVGLGFGYHLELLTKAYDIRYLLVVEKD
FT                   PEVFKTSLYTADWEFILRHYSENARVFLLFVGDDPAELSKHMVYALGNALNTPMLYFTP
FT                   IFIHLFGPFYEQVGRHFSERINELVMGWGFVQDELWSLEYTLENIKRELPLYQGKKKVP
FT                   SDSTAFVIGAGPSLEYAIDFIKKNQDRAVIFSCGSSIGTLYEEGIKPDFHVEIERTKFT
FT                   YDALLLSASRDYLKELTIIFNNPMYPQVSELFKESLMFVKPNDTGGSLFPTDYPPVGYS
FT                   NPTVVNAGLSLALHMGFRRVYLFGADMGYKDPRRHHARGNVALKKGTEFYKEVEAQEHE
FT                   LDGNFGGKVYTNSMLLWARSMIQDLLKLYKDAEVFNTSDGAKIEGTIPARIEEIVLSQF
FT                   KKSEAIKLIKQDFSRKYAREDYIRHRLEDFLEDMQEFEALVGRLFSANLPARGELVDSL
FT                   NFLYGWLYSQSKTGMLFKILRGGFMQVEHLYLFLSHQEDKHQEECQSIIKSYLLEALEK
FT                   TRALIEPFLVSKTLT"
FT   CDS_pept        618261..619262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69117"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH15"
FT                   /protein_id="BAI69117.1"
FT                   /translation="MRADKKLAAATLASLALFGAQKAVQAKAVMVPFIAVGNGWQTIVS
FT                   YATDTQLSTNTLHIAYNIKPAVSYGQCLHADGFVPTSTNDLTSFFIDGTTNTPPTIYGD
FT                   TIGGTYAPVAGANTYFGFMAVATEDAAGNVSAGAAELAVDTISFNAGLRFLYAQRSIDL
FT                   NHLGAANAVNLSNTGLTTLQTTKFMTFAPADANPMVYAVGVSTADNVFGVPYNVPIALN
FT                   KVNNNWWNRSEQTFSDGIGLFDYCVTLWPVCAPSSAPTAGFISNLNCQTGTIFAQAGGW
FT                   FHLVNDATNVVTALATIPGVNTAPNVIVFKVESNPAYGYAVTPLHPMPYTTE"
FT   CDS_pept        619323..621089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0657"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69118"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH16"
FT                   /protein_id="BAI69118.1"
FT                   /translation="MKRLFLFLLLVTFVFSCAKRENYVIKTRDFKELNVPFDIPFEHLV
FT                   PIKELNSKSSYAFLYYGADGKVHYYKDGKDTVLNAPLVEKFKGGVFAYLDYKIDGNTLY
FT                   VAQWVRYLGEPRTKKVILIKTDMDGKNPSYTLVSSTNESIGKPMIETDGKGNVLLVWSD
FT                   ESNGYGVAYALSNDGGKTFPPETIIRPANIASNLDVYLPYYDPKNGFSVIYTTDKEIRA
FT                   RRLKDNAEVVLFKFEEGYQYTPYVEKGNGELYIFAWRLPKNNPADVYGTYKLTFLAFKD
FT                   PFEKPVAKLEKDYQRVYTYIQPAVLKGDKPLFFSVNLPPKGEDVYKADGEQLSKRINLV
FT                   YSWNGEDLKKAVEDKANDYLYAQLFSSVATSDEGALEVFRDSRYLIPQLWAVYVKDGKT
FT                   RAFGPLEEPWVETSFMSKTLYLGDGIFRVYYLVRDDKKNVWFLRARDIKAEALSNPYKL
FT                   PSRREKQEKLEEALKKFSECQIKNDLDCVYSFFDPVGQRQYPIEAFKRNAEVLKITFKD
FT                   YKCRGKVVGDTNIAVSYCTYTYTLPPVIGTVPVPENKRQITDKDVRNYWVFIKGQWRWA
FT                   IETMPGRTAIQW"
FT   CDS_pept        621044..621418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69119"
FT                   /db_xref="GOA:D3DH17"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH17"
FT                   /protein_id="BAI69119.1"
FT                   /translation="MGYRNNAWAHRHSVVRGFTLVEVVIAFTIAVLAIAFIQQSLSLIA
FT                   KRLYVMKKQERDLQTVAQVQEIFTAQVQGSAKVLESKNVDGKNCNLMEYKSFNYYACWQ
FT                   DFGIQRIYLINGYDFLILPR"
FT   CDS_pept        621415..622209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69120"
FT                   /db_xref="GOA:D3DH18"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH18"
FT                   /protein_id="BAI69120.1"
FT                   /translation="MRGSVFIYVLWLLTLISGLVFFTLYQLRYSYSRSSHFVENWTFLY
FT                   ESRALAFVGVNLALKDPSLLRLKSPLPYYIGNRKYRIYVSAEEAKISLPLANKEILRSL
FT                   MQNIGMEEKRADELSESIMAFLGRGTEYYDAPAPHENIHTITELLYVKGMDEQTYRKLQ
FT                   QYLTPVATLTNINYAPKEVLLALGLTDSEVRSVEEQIKVAGYVDFNWLQALLGPSRSYI
FT                   ALRFVYVPIPLYYRVKVVKYEPSYDEMDFIVSGGAVLDAWQE"
FT   CDS_pept        622193..622681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69121"
FT                   /db_xref="GOA:D3DH19"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH19"
FT                   /protein_id="BAI69121.1"
FT                   /translation="MRGKSKGFTLIELLIAVVISTLVVLALGSVYRAVQDVRKRFIDYE
FT                   QSRKFYDLVYLLQKQLMSCRDLRLENGTLSYYTTFGMSAPYVMVMLRLEDQKIYYSESN
FT                   PYDASVVYLKREWRVPYRLKLSLRADGKALSISYGADELELYINYNAVPTSNIFLKPF"
FT   CDS_pept        622701..623642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0661"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69122"
FT                   /db_xref="GOA:D3DH20"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH20"
FT                   /protein_id="BAI69122.1"
FT                   /translation="MPTAEKALYYSLKDYLKERYGRRVQKITVALPFTCPNIDGTKARG
FT                   GCTYCFSGTRPAHLDAYIPLRDQIEDGIRRAKERYGKNILFFVYYQSYSNTYGEYEYLK
FT                   SVYDTALEFEEVVGIDVGTRPDCAPEWVLELLESYTRMGLEVWVEYGLQSANFKTLRLI
FT                   NRAHGVSDFVDAVLRTKRRNLKVCAHIILGLPHEDEEDMLETGKLLASLPIDGVKIHPL
FT                   HVIKNTKMAEQYLRGEFEVLSLEEYAKRAVDVLEILPPHVVVHRLTGEVEPERLIAPDY
FT                   CTYAKKQEVINAIVEELIRRKTHQGAKIPFNR"
FT   CDS_pept        623639..624838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0662"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69123"
FT                   /db_xref="GOA:D3DH21"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH21"
FT                   /protein_id="BAI69123.1"
FT                   /translation="MKKEHWALVSLSVNLLQSGAKLLAGVFTGSLSMLGESFHSLSDSF
FT                   ASLVAYLTLRFSDRKSQKFPYGLYKLENIGSISIAIFLFIASYEILQRAFQREVIIKEE
FT                   YLALGIGVVLFSLFSSLTLSFLERRAGKRLNSPVLVADSYHTLTDTFGSSLVLMSFLSS
FT                   YMGYQVDRYFAMGVSALIAYTALSIVKREVSVLLDISVDEKTLDHIRQVILSFEEVLEI
FT                   RHLFVRSSGGKLFADITLMVAGRDFLRIHSLVDKIEESLRKEIPELEMVFIHYEPAQSS
FT                   KASLGVLIDNEGNVSESFEKAEAVMVFGDKEKPKLIKDLPQREEDMAKALMEMGISIII
FT                   CGQHPESSRAKWVISKYGGFVWETHQKNPYLALSEVAYNFTDVKTADKERQDNRPFPEA
FT                   "
FT   CDS_pept        624783..626057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="HTH_0663"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69124"
FT                   /db_xref="GOA:D3DH22"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH22"
FT                   /protein_id="BAI69124.1"
FT                   /translation="MSKLLIKRGRIIDPSQKLDTVGDILIEKGRIKTVGENLFELETQI
FT                   IDAKGLVVCPAFVDLHAHLRDPGETYKEDIESASRCAVAGGFTTVVCMPNTKPPVDSPH
FT                   VAQYIIDKARRVGLCQVIPSGTLTKGREGKELSDFYALKQAGCLTLTDDGSPLMDARLM
FT                   QRALELAGQLGLLVMNHCEDDSLAYGHINEGYVSSLLGVSSRPAEAEDILVARDLILSY
FT                   KTGSPIHIQHLSSALSVELIRYFKEKGARVSCEVNPYHLLFSERELLKSGANAKVNPPL
FT                   RREEDRLALLEAVKDGTIDCIATDHAPHAGWEKGQIEKAKAGMIGLQTALPLALELVRQ
FT                   GHISLMRMIDLMSCKPASILGLEGCATLKVGSKANITIFDPEKVWTLNESTNLSRSRNT
FT                   PLWNRELRGKVVYTIFEGKVVYRDV"
FT   CDS_pept        626050..626898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="HTH_0664"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69125"
FT                   /db_xref="GOA:D3DH23"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH23"
FT                   /protein_id="BAI69125.1"
FT                   /translation="MFERVCIVGVGFMGGSFALALKERYPQCQIFGIDINHSAISKALE
FT                   LKTIDGGSTQIKDTLRFDPQLVVIATPVGTFEEIAKALAQLDIKCVITDLGSVKGRIVY
FT                   MMEEHLGGNFVGGHPIAGTEKSGVENSLKDLFKGKRCVITPTEKTSPQAKKMVKDLWQS
FT                   LDALVEEMDPYLHDYIFGAVSHMPHAVAFALIDAIARLSKDGVNLFEYPGGGFKDFTRI
FT                   ASSDPIMWRDIFLENAENIVKAIEVFQESLDTLKSLIVSGKAYEITQYLSKAKELRDRI
FT                   V"
FT   tRNA            complement(626902..626974)
FT                   /locus_tag="HTH_t11"
FT                   /product="tRNA-Ala"
FT   CDS_pept        complement(627149..628126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="HTH_0665"
FT                   /product="peptide ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69126"
FT                   /db_xref="GOA:D3DH24"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH24"
FT                   /protein_id="BAI69126.1"
FT                   /translation="MFTFLLVRLGQAVITLLGVTFLSFLIIKMAPGDYLDQLRLNPQIS
FT                   PETIETLKKQYGLDKPVMVQYIKWLKSAVMFDLGYSFQYHAPVIKLIKERVGNTLLLTL
FT                   TSAVLSWFLAVLLGLLAGFKEGTFTDKLIKAYAYTFMSFPSFFLAFLLLLIASKTGALP
FT                   VGGMRSAGFESMTTFEKLLDIAKHMVVPVLTLTLVSTAGMLRLVRSSVIEVLHSPITTF
FT                   LRAKGVPQRVIVKHVLKNAMNPFTTLIGYEIAGLLSGAALIEIIVGWPGLGLLMLDAVL
FT                   SQDLFLVMGGLYIGTIMLLLGNLIADILLALIDPRIREREIIGR"
FT   CDS_pept        complement(628126..628503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69127"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH25"
FT                   /protein_id="BAI69127.1"
FT                   /translation="MQDSKKEKILKKYYREVKMEDLRRAFFDKLSSVPPTMEYVRNLIL
FT                   DVKLFFRMLSDPNFDLREETRRDFVAVLLYFIESRDAIPDWIPMLGLWDDYKLARYVKQ
FT                   KHSQEIERYFAQVRHFVANYF"
FT   CDS_pept        628533..629972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0667"
FT                   /product="undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69128"
FT                   /db_xref="GOA:D3DH26"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017472"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH26"
FT                   /protein_id="BAI69128.1"
FT                   /translation="MDKRWQALTLLIALLTADLVAYYTSLALAYLTRTALNPLLYMYAE
FT                   FNFPLSHFFKMWWIPVIFVFFNFYEGLYQKRFPLPEELRRMVKATFFGLFTLFFLVGLT
FT                   KKSEQFSRLMLLILGLYMPLMLLLLRPLSKKLLFERGIGLRRFAVVGTDDMVKKAASFL
FT                   EADGYMGYSLLGFFSDKDALKSVILNGRIFRVKKLRRLKTLAEKGFVDCLVVSTGHFEE
FT                   EELASFVYRYHGKVQELILVPPLKGLSLINSHPLPVYMLDVFMLSFKDNLKTFPNLHIK
FT                   RAFDLVLSFTLLPLVLFLALIFSALIKLETGGPVFFSHTRVGQGGRLIKVYKFRTMHKN
FT                   AQERLNKLLEERQDLREEWERYRKLKDDPRITRVGRFLRKTSLDELPQIFNVIRGDMSL
FT                   VGPRPVTQEELEKYYGEFAQVYMMVKPGITGYWQVSGRSEVDYNVRVAMDTFYVVNWSL
FT                   WLDIYILAKTLWVVLKGKGAY"
FT   CDS_pept        630010..630393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="HTH_0668"
FT                   /product="aspartate 1-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69129"
FT                   /db_xref="GOA:D3DH27"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH27"
FT                   /protein_id="BAI69129.1"
FT                   /translation="MQRFVLKSKIHRLKITGKELHYEGSLSLDSALMESANLVPFEKID
FT                   VYNVNNGARFSTYVIPAPTGSGEVRLNGAASRLGEVGDIIIIASYALMEERELDSFKPV
FT                   LVYVNEENRILEIKRDMVVVHDW"
FT   CDS_pept        630383..630994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH28"
FT                   /protein_id="BAI69130.1"
FT                   /translation="MIGRVFRIFREKGGILKALDLWDWYENLDPKKQKVVKYYFSLKSI
FT                   KNLRFPYKAKHFDSGHIEQTPYTKRTFLGSIAQMALLEGDIKSAEWLYLEALKMEGTPI
FT                   EAHMILNDLLLLAQKEKDFEKMETYARWDVEMFEDYKETLKDKNGGSLPHINSFDVLLY
FT                   LLERKGRYEEALKLISFMEKESVPYYQEAKERIVQKALSS"
FT   CDS_pept        complement(630957..631832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0670"
FT                   /product="transcriptional regulator, NagC/XylR family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69131"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH29"
FT                   /protein_id="BAI69131.1"
FT                   /translation="MRKGVDIGGTFIKVLWEDGRRQKFYVKDISRDGEKFIKTIVSVVK
FT                   EGEPEAVGIAVAGFTSLEGVVYKSPNIPALDGLNLKEIITSEGIKCIVGNDVSFGAFGE
FT                   WYYDHRESKSLLFIAIGTGLGAGFVINGEPYLGACGSSLELGHHIIKVGGELCNCGRAG
FT                   CWEAYCSSYGFERIYKSISQEYLRDYQVVEKAKQGDQTALSAVEVFKEYLIAGLVNAVH
FT                   ILNPDVLVLGGGLLDSMREFLGDVKERLLASVEKLPASCLSVAFSSCEEFCMARGALAM
FT                   SLKLFEQSSP"
FT   CDS_pept        complement(631816..632250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69132"
FT                   /db_xref="GOA:D3DH30"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH30"
FT                   /protein_id="BAI69132.1"
FT                   /translation="MALKREDLIIGSFIALAVVYPFFIAFLIWHEDYSNKKRVLESLSP
FT                   LLSFLVGSEDCSERNFERLKVLISPDLLQAYGEEGFKRLCEQSKKEGLKLKKESARLFN
FT                   NQLEFYGIYEGENGSVVLRLKARLEGEGITVREFSYEKGG"
FT   CDS_pept        complement(632241..633182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="HTH_0672"
FT                   /product="Mg2+ and Co2+ transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69133"
FT                   /db_xref="GOA:D3DH31"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH31"
FT                   /protein_id="BAI69133.1"
FT                   /translation="MIFVYANINRGFTGFGIDQIGEIPRDKVVWLDVEKPTEEEIDWLK
FT                   SAVGFEMPPREVFGDIEISSKYKEEADFIYMNFSFVIQQKEDVLVEPVVFFIRGRYFVS
FT                   LRYRDIPTLMIFQKRVMAQDLSFQFPEAIFAQIVNIEVDRIGDRLEILGRRIRNLRKEV
FT                   FAEQSQEIIRDISYYDELNITLRETINEKLRILSHFVKSPKVNAQTKRDIKVALDDLYT
FT                   LLDYTTLYMDRIDSIQSSLLGLISIRQNEGVKVFTVLATIFLPATLIASIFGMNFKHMP
FT                   ELEWKYGYVYSLLLMIAVTASLLYWVRRKGWL"
FT   CDS_pept        complement(633205..634452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0673"
FT                   /product="glycosyltransferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69134"
FT                   /db_xref="GOA:D3DH32"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH32"
FT                   /protein_id="BAI69134.1"
FT                   /translation="MVRVFWALLLSFYFFIFGSWVLSFTSLDEGRNASAILNMLKSHNF
FT                   LVPYYNCQPRFEKPPMLYWVVVLFSGLLGFNELIARMVSGLSALGTAIMAYLIAKRYTD
FT                   EKTAKKSFLVLLTLPHLWIESRALTPEMLNTFFMMVSLYLFLSERILLGWLFLSLAFLT
FT                   KGPVGVFLTLLVYLLWRKDLKVFSWRGLAIFLAVGGSWYFYMFYEFGYDYFFRFFVYEN
FT                   VMRYTGQRLTHPSPFYYYLLVVFATTIFYIPMYLKVIKNFKRELLPYLTWFLAVIVFFS
FT                   LAKNKLHHYILFAYPPMSVILASTIEERYIKKVLLLSAGVLLLIVLALGFYEGLRFTPK
FT                   AYPFLESQEAPAYFYKSEDSALVFYSKRCIPREENTQKLSGLVITKEKYTKELPECSLL
FT                   TEGIEFDGKYVLLRCP"
FT   CDS_pept        complement(634557..635114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="HTH_0674"
FT                   /product="septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69135"
FT                   /db_xref="GOA:D3DH33"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH33"
FT                   /protein_id="BAI69135.1"
FT                   /translation="MRLLILASESKRRVDILRMLGFKFLVIPSRVREDKQVVSPLLTAR
FT                   SLAFKKSFTVWREYKYATVIGADTLVVLGNRALGKPKNQEEAKRMLTALSGRWHKVITA
FT                   VSVISPRRRVLFHDIALVKFRHIEKEEIEDYIKTQEPMDKAGAYAVQGFGATFIEKICG
FT                   DYYTVMGLPASKTYKVLKDVLD"
FT   CDS_pept        complement(635127..636620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="HTH_0675"
FT                   /product="protein-export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69136"
FT                   /db_xref="GOA:D3DH34"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH34"
FT                   /protein_id="BAI69136.1"
FT                   /translation="MKNIYLNLSLLLALVALSVGISLFKPVNLGLDLKGGISMLLEPDM
FT                   DYALTQEYERYAKDIERKLRDAGINVLDVTSDKSGIKVEVLDKKDIDSISQMVSKDFPR
FT                   FEVVSREKGQVLIKLKDDEIKKLKDSIAGQTVEVLRRRIDELGVVQPVITKVSGDRVLV
FT                   ELPGVLDIDKAKSIIGKTALLELKLVVGSGPKEVLEQKLNKDTELLPSRNPQEWFLVEK
FT                   LPVITGADLKTAYTSTDEFGAPAVTFELTDRGARAFGDATEKNIGRRLAIVLDKKVMSA
FT                   PVIRSRITDRGQITGQFTPEEAKELAIVLRAGALPTNVKFLQETVVGPSLGRDAINQSI
FT                   KAGIVGFILLVALLLGRYKVAGITANLAILLNALFLWAGLVLLGATLTLPGIAGILLNM
FT                   GIAVDSNVLIFERVKEELRSGSSPKKAVELGYRRSLSVVWDTHITLLIAALILFQFGSG
FT                   PVKGFATTLTIGSIASFVSNVYFTKFFLDVLTKIGALKI"
FT   CDS_pept        complement(636630..637742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="HTH_0676"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69137"
FT                   /db_xref="GOA:D3DH35"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH35"
FT                   /protein_id="BAI69137.1"
FT                   /translation="MRLLYFHTLKISLKGVVGFYKKFMYNLPTHRMKTIWFHTASVGEF
FT                   NTAKPLLKKLIKDYRIVLTYFSPRAKDYIKRHPEYYHSLERLPLDTPFTVRSFERKIEA
FT                   HAIFIMEREFWPSFILFTKAKKVLLNAYAKGGLYERFISRKFDLIITKSDKDRERYESY
FT                   GCKKVVSCGNLKFLFEERQIKEMKKGDFKLFVAGSTHNGEEKILIEAFGELKKRHPDLR
FT                   LLIAPRHISRSQEIANKVKGFRCFLRSRQRGEEWDILILDTLGELFDVYALADVAFVGG
FT                   TLVPVGGHNLLEPAYHGKPVLFGPFTQKVRDMAEYLLQKGAGFVVSRAEDIIRVVDGIL
FT                   SKRISYNRVDISQESERIMSCYYSNIRDML"
FT   misc_feature    637745..640431
FT                   /locus_tag="HTH_0677"
FT                   /note="cation transporting ATPase"
FT                   /note="pseudo gene. This gene contains a frameshift
FT                   mutation."
FT   CDS_pept        640525..640923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0678"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69138"
FT                   /db_xref="GOA:D3DH36"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH36"
FT                   /protein_id="BAI69138.1"
FT                   /translation="MRKVFLLMVFTFLWAHAEEELTFRQVMQVVNSATLRMLEGFLMNN
FT                   DELIIRGAQEIAHHPMPKGGPLAYIDPSKREEFAKAMPTFERQVHDSAEEVLRLIKEKR
FT                   RDEAYEKFNYMVKGCMGCHSLFRDYGKR"
FT   CDS_pept        640920..641180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69139"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH37"
FT                   /protein_id="BAI69139.1"
FT                   /translation="MSKERLLEELKKVIDPHTGMDIVSMGLVKSLDEREGKVRITIKPT
FT                   SPFCPVGEYLLKAVRDIITSIGYEADVKLEDYAFGEDAHED"
FT   CDS_pept        641170..641637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69140"
FT                   /db_xref="InterPro:IPR015077"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR038062"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH38"
FT                   /protein_id="BAI69140.1"
FT                   /translation="MRIDVRDLEPPQPMIRVVQALEKLQEGEVLEVLGSRPFTHLLPRL
FT                   SEMGYEYQLEETEEGYLLKVWHSGKAKEEKLSFEEPEFEINEDTNVGKLLERFPQALEI
FT                   LIRYGFTPLKNPILRKILPYTVSLKQAKKIRRMSDEKFQEMLRELKKLTER"
FT   CDS_pept        641634..642761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69141"
FT                   /db_xref="GOA:D3DH39"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH39"
FT                   /protein_id="BAI69141.1"
FT                   /translation="MIRPASFIKTTPLYILIFFLLLLASLLQKTLGKNYTDTLIFFAFP
FT                   GLISGTLFQIYPTLQGHPFRGEPLIYVHLAVWFINLLFYFLKGSVNPYAYLLLSSIHTV
FT                   LVLLNTRKIKDSVVLFFLTGSLFYLLAGVLIKENPIFVKHLITVGYFMPIIVGSYYVFV
FT                   PMLQIEELTKRGLIWLNFLLQVASSVLVPLFWYISDYTLLSYSGTLLLLSVGTLSYSVY
FT                   HMLSQRKSPLKGLDVSVQFFILGLFMCWFFLLVGVLTAGSGNFGFFQLHSDGMLYGFLT
FT                   AISVGASYHIIPFLLWWRRYAPRMGKEKVPTLKEVLNISVVKKLLILLPPLTTGLFFGD
FT                   MVNPYVEKAFSLALFLLLGYYTVKIFPLVLKTLKS"
FT   CDS_pept        complement(642758..643153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0682"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69142"
FT                   /db_xref="GOA:D3DH40"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH40"
FT                   /protein_id="BAI69142.1"
FT                   /translation="MAKTLGLHILADLYGVNPDLIDKVEDIRHLLESAVKVAGLTKISS
FT                   HYYQFHPHGATGVVLLAESHLSIHTWPEHGLATVDVYTCGDPNKAYRCMDYIVSSLEPT
FT                   RVDKQVFERGIVGESEDLEFRSTLLKV"
FT   CDS_pept        643248..643709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0683"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69143"
FT                   /db_xref="GOA:D3DH41"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH41"
FT                   /protein_id="BAI69143.1"
FT                   /translation="MEKSRRKTKIRPTSSVVKQAVFNILGNINGCLFIDLFAGTGQMGF
FT                   EAEERGAKVIFVEKNLKLAKEIIKKTKSKVVISDALKFLMSFEDRADVIFADPPYDYEN
FT                   YEKLIELSLKVLNKGGIFILEHSKKVDFNSSKKKVYGDTVLSVWRREDD"
FT   CDS_pept        643702..644190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0684"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69144"
FT                   /db_xref="GOA:D3DH42"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH42"
FT                   /protein_id="BAI69144.1"
FT                   /translation="MTKVVYPGTFDPPHLGHLDIVKRSCEIFDRVMVAVAKNPRRNLLF
FT                   SMEERVDMFKKMVECLGDKVEVKGFDGLLVDFMAQEGVRLIVRGVRLFTDFEYELQIAM
FT                   NNYKLAKVETIFMMPSQDYIHISSTIVRDIASYCGNISGLVHPYVEKRLREKFNCHQP"
FT   CDS_pept        complement(644171..645271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69145"
FT                   /db_xref="GOA:D3DH43"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH43"
FT                   /protein_id="BAI69145.1"
FT                   /translation="MIFVYLLVFLLVALLFWDFWKKRVSFYKSLGAEEIQIKFLLNPVG
FT                   KIDLDGIRMDIFTEGAKSNQRLTLRAKTNLTGFLKLYKRSIWNRLFSQEIFGGLGAEYE
FT                   DERWFNRVINYKNFRELVEKLFQEGQVNEVRIEKDKLSLSWKIRNHPREGDREKVLKAL
FT                   PIMKEFLSLLSKLPDATHYREHVRSWMSIKLPVVITVVLCAVGIVGGFYRYDPVCSLEI
FT                   FGVGFKLLLPSAFLYALVGMLLAGSFRLGFRVLVYSLTAWLLAIPFISLFFLMYINGKL
FT                   DRSLPEVKTDKVVEKYTSTGKGGSVKYRIVLAHLHSQKDWCDHLQVSKKFYERVQVGDT
FT                   VEYITKRGFLGVEWYYQKLSIKVDGN"
FT   CDS_pept        complement(645273..646256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0686"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69146"
FT                   /db_xref="GOA:D3DH44"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH44"
FT                   /protein_id="BAI69146.1"
FT                   /translation="MKLRSKLHLLYFFVSMLVSLGAINTVMLYEINRFVEQNIYSQAYM
FT                   HYMAYVLSGGSYKGDENFRVSENYQEKHLSYVFKDPRYIDRNIYVNINPEYADSSVKEL
FT                   FRRILAVEFFVVFLLALLYQALTEGLFRKIEEQEEWTKSLVASVAHKFGNFLSVQKVNL
FT                   ALLKAKMKDEEVLKRLERSLIRVERDMNLILNVLREERHIKREWVRLDSLILETLNYLE
FT                   EEAKGKRMMVRLKEAYIYADETDLRDILYNIISNGIKHSKSFLHIKMCKTNKTVSLIFR
FT                   NDISNSAGKGLGVGATLLERVVKRQKGTLRTRIKKHYTVLLKLRSR"
FT   CDS_pept        complement(646246..646896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0687"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69147"
FT                   /db_xref="GOA:D3DH45"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH45"
FT                   /protein_id="BAI69147.1"
FT                   /translation="MKVLLVEDDKLLGESLKEYLEREGMHIDHVSDPREVPNLLTVSSY
FT                   DIIVLDLMMPHISGEELLLKIRQGDKKTPVLVLTAKSRLDDKEKCFLAGADDYITKPFE
FT                   PKELLLRLKALYRRKLGGNVIVNLGGVEVDLERELVSVDGKVINLTRKDWLILKCLVEN
FT                   RGRFVSSEEILNYVWGDAPVGDEVVRAHIKNLRKLLPEGFITTMKGRGYKIEA"
FT   CDS_pept        complement(646907..647635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0688"
FT                   /product="divalent heavy-metal cations transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69148"
FT                   /db_xref="GOA:D3DH46"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH46"
FT                   /protein_id="BAI69148.1"
FT                   /translation="MSNIWFSSLLLLLGTSAGSLMAVMFKKVPMSVNLNLSFAGGVMLV
FT                   ASFTSLIIPGIQKGGFAQTSLGILMGFALIGIIEHLFPHQHVIKGAEGAIKSQKLKKLY
FT                   LIVAGVAIHNIPEGFGVGVSSAYSLETGTATAIAIAIQDIPEGLIVTLALMVANDRIMV
FT                   PIVTGVLSGIVESLFCLLGFYTFDTFRNFLALGLGIGGGAMIYITVKEVFPEVYSEGSH
FT                   TVSTLGFLAGFLLMLFLDTI"
FT   CDS_pept        complement(647640..648182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0689"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69149"
FT                   /db_xref="GOA:D3DH47"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH47"
FT                   /protein_id="BAI69149.1"
FT                   /translation="MLKDRLKAMIIKKCLKVAQEPIFRLSSGKLSRYYIDLKQITLDPE
FT                   GAYMVGKLVYDAIKPLHPQGAGGMTLGADPIAYAVAFVSYMDGNPIKPFVVRKEKKEHG
FT                   LGRQVEGLLKSGDKVVVLEDVVTTASSSLKAVKACREANLEVLGVFAIVDREEGGRENI
FT                   RREGIELYSIFRLSELL"
FT   CDS_pept        complement(648175..648678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="HTH_0690"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69150"
FT                   /db_xref="GOA:D3DH48"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH48"
FT                   /protein_id="BAI69150.1"
FT                   /translation="MVIRGKVWKFGDNVDTDQIIPARYLNTSDPYELAQHVMEDSEHTN
FT                   FAKDHQKGDIIVAGKNFGSGSSREHAPIAIKYAGVPVVIAKSFARIFFRNAINIGLPIV
FT                   EAPQAVDEINHGDEVEVDLEKGIIKNITTGKEYQATRFPQELQAILKAGGLMEYAKQKL
FT                   KGNA"
FT   CDS_pept        complement(648698..649243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="HTH_0691"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69151"
FT                   /db_xref="GOA:D3DH49"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH49"
FT                   /protein_id="BAI69151.1"
FT                   /translation="MMEDIFKSAEEDMKKAVNHFKNEIGGLRTGRASTALVEELKVEYY
FT                   GSKVPIKQLGSISVPEANQIVLQLWDSNAVPNVEKVIMEELGLNPQRQGNTLRIILPPL
FT                   TEERRKELVRLLHKMAEEARVAIRNIRRDAKEMIEELEGVSEDEIKRALDRLQKLTDRY
FT                   IDQINHLVETKEKEIMEL"
FT   CDS_pept        complement(649258..649980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="HTH_0692"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69152"
FT                   /db_xref="GOA:D3DH50"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH50"
FT                   /protein_id="BAI69152.1"
FT                   /translation="MDAEKPEYQRVLIKLSGEAFAGDEDYGISPDFLEYISREIKSLYQ
FT                   HGVQIAIVIGGGNIFRGVEGLEIGIDRATGDYMGMLATVINALALQSALERVAQIPTRV
FT                   LSAIEMRQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFSTDTASALRAAEISAQLLIK
FT                   ATKVDGIYTEDPLKNPKAEFIEEITYLEAITRDIRVMDHTAMTMCMENKIPILVLNIKK
FT                   PGNLLKAVMGQKVGSLVK"
FT   CDS_pept        complement(649980..650843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="HTH_0693"
FT                   /product="translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69153"
FT                   /db_xref="GOA:D3DH51"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH51"
FT                   /protein_id="BAI69153.1"
FT                   /translation="MISAEMVKTLREMTGAGMLECKKALEEAGGDLEKAKEILRIRGLA
FT                   KAEKKAGRETKEGIVQTYISEDRKVGVIIELNCETDFVARNEHFSELALNIAKHIAQIP
FT                   ENANKEGTGEDVLKQPYFQDPSQTLEDVIKSAIAKIGENIQLRRFTRFDTDGFLHAYVH
FT                   GIGRVGVLIDYQAEAINPQVLRVIQDIAMQIAAMKAEFVDVSSIPAEVIQREKRILSEQ
FT                   ARQEGKPENIIDKVVEGRIKKFYQEKVLLEQPFIKDDKKTVGQYLRESAPGVVIKRFVR
FT                   YELGGA"
FT   CDS_pept        complement(650857..651687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="HTH_0694"
FT                   /product="ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69154"
FT                   /db_xref="GOA:D3DH52"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH52"
FT                   /protein_id="BAI69154.1"
FT                   /translation="MAVISMRDLLEAGVHFGHSKGRWNPKMAPFLYGVRNGIHIIDLNK
FT                   TVVYLEQAYNFVADRIAEGAEILFVGTKKQAKDVIKEEAERAGVPYINERWVGGLLTNF
FT                   RTVKKSMLKLKTLERMEAEGVFEVLPKKEVRMMRRKMEHLRKLYAGILNLERVPDMVWI
FT                   VDTVREHIAVQEARKLGVTIVAIADSNCDPDVIDYPVPGNDDAIKSIKLLTAKIADAVI
FT                   EGKQRRERLGEEVPAEAVKRKVVTVEEEEKALFEKAMEMSEKYEYIDKGAEEIE"
FT   CDS_pept        complement(651772..652605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0695"
FT                   /product="33 kDa chaperonin"
FT                   /note="heat shock protein 33 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69155"
FT                   /db_xref="GOA:D3DH53"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH53"
FT                   /protein_id="BAI69155.1"
FT                   /translation="MLYKDLNEKTREELKDYFQERDYMVIAVPKLELMRVYALRASKSV
FT                   ETARRIHALDEERTKILGEALLSVLLLTSSIKHATKQKVLLKLSLQDGVVVAEADGMGR
FT                   VRGFIEGQVKRPWEGTLTVIKELRLGTPYTSIVPVVSDSMKENLAYYFEQSEQVKTTVD
FT                   LSVLLDAEGKVLVASGYLLQVMGDAFSNIDISLEKLLMRGSRPEDIARLILKDKEPRLV
FT                   GLKEVEYYCPCNEEIARSSLSLLEESQLEEILSEGPAEVVCKFCGRIYRFTKDML"
FT   CDS_pept        652675..653532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaA"
FT                   /locus_tag="HTH_0696"
FT                   /product="heme O oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69156"
FT                   /db_xref="GOA:D3DH54"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH54"
FT                   /protein_id="BAI69156.1"
FT                   /translation="MLRAFLILAIVFTYVAMVWGGLVRSSDSGLACPSWPLCYGSFEPP
FT                   KDTAAKLEMGHRTVSSLAGIFTLLSFVYVWKKTRGLPKLTSTIALAFTFSAALTGMKMI
FT                   KAETPHLKYLSHMLLESVHIYESMIILGFLILTYRLIYKRSMEEGVPLYAYIFALITMI
FT                   TGVLVRYTGSGEACGHEWPTCNGSLIPDFTSWKVTLQFLHRNLAYTTWLAFLLALVSSF
FT                   NRTTLLSFVFVNLQFVFAISMVLTGFFLPLSFMDTAMGFFFFAWLTYNVQIKPTINLKV
FT                   KEVW"
FT   CDS_pept        653526..654407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="HTH_0697"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="cytochrome c oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69157"
FT                   /db_xref="GOA:D3DH55"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH55"
FT                   /protein_id="BAI69157.1"
FT                   /translation="MVAKAVATYTNVVRDYILLTKPGIVMLVLITALTGMYLAKRGFPD
FT                   SWLIFWSLLGTGLASAGSAVLNQFFDRDIDAVMSRTKNRPIPSGSVSSVNALLFGVILL
FT                   TLSLYIMLAFVNPVATFFTVMASFFYVVVYTLALKRRSPLATEIGGISGALPPVIGYTS
FT                   VTGQFGIEPLILFLIMFVWQPPHFWVLAVKYAEDYRKAGVPTLPVVKGIFQTKVRTLLY
FT                   TAALFPISLLPTLYGITGKIYFFTAFALSLVYLILTLRFFFSKSSRGMSLFFYSIIYLA
FT                   LLFSVMVFDMVR"
FT   CDS_pept        654414..655703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69158"
FT                   /db_xref="GOA:D3DH56"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH56"
FT                   /protein_id="BAI69158.1"
FT                   /translation="MEKRWFLLSVVSLGLGGFLAFVVAMARTPGVYQYFPPGYFYYALI
FT                   GHVDLAIVIFLLSFTLLVWNRVYRADTRIAFYLSLLGFLGVALSAFLGKGTAVSNNYLP
FT                   TIVHPIFFGGIILFFCGFTLGAFSVLKSSIRDIISPDPVKNAVSVSVMLGILMMLAVIP
FT                   SYLRAGDPSNVYIFYERLFWAPGHIHQFLNGAMLLYAWYYLLALLGSEKRLNFLRFINL
FT                   SFLIFGFLLFLVPVLYADPISMPAKIFTEVSYAVGLGIPMFLHAFNVIKGFKPDVKNPF
FT                   SSALLLSLSLYFLGVLIAYAGIKADLRVPAHYHGTVTSLTLALMVISYKLVQEYGYTQR
FT                   LSALSRVQPYLYGVGMILFILGLYFAGRGGAPRKTYGTGYTQDPVVLFSLVIMGIGTLM
FT                   AVIGGVMFVLYILRLLLRGQVYHGLQEDKG"
FT   CDS_pept        complement(655791..656240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0699"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69159"
FT                   /db_xref="GOA:D3DH57"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH57"
FT                   /protein_id="BAI69159.1"
FT                   /translation="MEKFIELCLNLARRAYERGETPVGCVVVKDGKVIAKAHNRVEELK
FT                   DPTAHAEMLALREASESMGGKYLYGCEIYVSLEPCVMCTYAMILKRVERLIFLAQDYRH
FT                   GGVMSMYSLLDDMRFHHRVRWEYMPVEEAQKLLRDFFRNLRLRQR"
FT   CDS_pept        656327..656536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69160"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH58"
FT                   /protein_id="BAI69160.1"
FT                   /translation="MKNLYTREELAGKGIYIQSDLPDSIEITDQAIVVKKGSHTVEIPL
FT                   NSLRAKALLDRLSYKGELVQEIYL"
FT   CDS_pept        656541..657368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA2"
FT                   /locus_tag="HTH_0701"
FT                   /product="lipoyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69161"
FT                   /db_xref="GOA:D3DH59"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH59"
FT                   /protein_id="BAI69161.1"
FT                   /translation="MSKPKLIFSETHAVKKLLRGLKLNTVCEESHCPNISECFGAKTAT
FT                   FMILGDVCTRGCTFCNVSKGKPGYLDQEEPYRLLDAVKKLGLKYVVITSVTRDDLPDGG
FT                   AEQFARCIRVLKDHLKDVKVEVLVPDFKGSVRALERVLSEGPDVLNHNIETVPRLYSKV
FT                   RKGANYSRSLHILKKAKELSPSIFTKSAIILGFGEKKEEVISVMRDLREVHCDFLTIGQ
FT                   YYQPSLNHHPVVKYYTREEFEELRHIALSLGFRYVASGPNVRSSYRAFEAIGE"
FT   CDS_pept        complement(657355..658725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0702"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69162"
FT                   /db_xref="GOA:D3DH60"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH60"
FT                   /protein_id="BAI69162.1"
FT                   /translation="MKALIMAGGSGTRLWPLSREKYPKQFLKIFEEKSLLRLTYERLLR
FT                   LLDHRDIIIATSKEYEYHVRNDLYPYDGYSLILEPERKNTGPTVLLGLLFALEKLSSSE
FT                   DEVFFVIPSDHYIQPEERYLDYLRFAQKVAKMGYVVAFGIKPSHPDTNFGYIKLGEKLL
FT                   SEGEAVAYNMERFVEKPSYQLAQDFLRDGSYMWNSGNFAFTIKVGLEEIKINASHMWEL
FT                   SGESFGVMIENYSKLPEIAFDYMQMEKTKRGAVIPMDIVWSDVGSFEGLYRVLPSNHKG
FT                   NVHVGDTLCLDSENTLAYSTDRLVALIGVRDVAVVEERDAVLVLSRDASHKVKDLVNHL
FT                   ISMGRREAKYHVELHERWGKRLLLDEGNAYKIYKLTIYPNREIGPHMHMHSTRTWMVLK
FT                   GTLLFNSKGEESFVSVGDSRFVNKATPYLIRNSGFIPAELIEVRVGEYLEDDDVIPQ"
FT   CDS_pept        658744..659088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0703"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69163"
FT                   /db_xref="GOA:D3DH61"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH61"
FT                   /protein_id="BAI69163.1"
FT                   /translation="MPWTVIVKREFQAAHFLTDYHGAPEPLHGHTWKVEVYIRADSLDS
FT                   GGMGFDFVEIDGFLKEILPDYTLLNDIFDFSPSAENVAKWLYHKVKDRYPTVQKVVVWE
FT                   TQYCGAEYWE"
FT   CDS_pept        659104..659517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69164"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH62"
FT                   /protein_id="BAI69164.1"
FT                   /translation="MPIEESYKRACLEKLKKVEEYIKNFLQEILSQVDEEDLEYGVSQE
FT                   ATLSGLGELWEEGVEKNNYMEVVFTEIMEHHDGAYLKATFRNSTEDASAERYISVWSSG
FT                   RVEMSYALFLSLNSVSARVERVKGDTFRFFFKK"
FT   CDS_pept        659518..660630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="HTH_0705"
FT                   /product="lipid A disaccharide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69165"
FT                   /db_xref="GOA:D3DH63"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH63"
FT                   /protein_id="BAI69165.1"
FT                   /translation="MRVFFSLGERSASNYIYHIFKDVKGIEAWGITDERLESIGFKSVA
FT                   KIEDLSVVGIMEALPKIPFVLKLYRKIENLLPYMDVLVLCDAPAFNLPLLKRAKGKVKK
FT                   VVYFISPQVWAWKEGRAKLIAEYADHLVVILPFEVNFYERYKRESLKIHYVGHPLLDIA
FT                   KPSQSKEDFLKFLGIERFVGLFPGSRWNEIKRHSHYLRRVFLELVRRYQLFGVIPTFES
FT                   FREYLEDVFKDLPVRIITHRDTPSPSYDTMAYSVISLVASGTAELEASLLLNPHIVFYR
FT                   VHPLTYLMGKGLVKVKWVSLTNLVLGREAVPEIIQRDWKHLYRASEELLKFEHLKESMT
FT                   QDFIKLRHLLGDEGVINRLRSLFLSIFQEV"
FT   CDS_pept        complement(660592..661548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluA"
FT                   /locus_tag="HTH_0706"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69166"
FT                   /db_xref="GOA:D3DH64"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH64"
FT                   /protein_id="BAI69166.1"
FT                   /translation="MEVLDFVVDQEAQGKRLDLFLTEAYGEFSRSYVQKLIEDGFVLVD
FT                   DKEIKKPSRRLKAGQKITFYIPQVEPLEVLPEDIPFDVVYEDEDILVLIKPCGLVVHPS
FT                   PGYSSGTLVNALLFRIKELSGIGGKERPGIVHRLDKNTAGLMVVAKSDKAHRSLVEEFM
FT                   QRRVLKRYHALVSGLLREDSGTVEKSIGRHPVDRKKFSVVEDGKPAKTEYEVIKRFEKH
FT                   RITFLDVRIHTGRTHQIRVHLSFIGHPVLGDKTYGFKTSSVDRKILNLMGECHMLVSYQ
FT                   LGFYHPITKKWMDFQIEDPKPFRDVLNFLEDAEKQAS"
FT   CDS_pept        complement(661535..661708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69167"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH65"
FT                   /protein_id="BAI69167.1"
FT                   /translation="MEEVVIKINGKDIRLKDFPKRVTHNVVVGLVKSLNLEEEPREIVI
FT                   HVRINQENSGGP"
FT   CDS_pept        complement(661719..664610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="HTH_0708"
FT                   /product="ATP-dependent dsDNA exonuclease C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69168"
FT                   /db_xref="GOA:D3DH66"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH66"
FT                   /protein_id="BAI69168.1"
FT                   /translation="MKPILLKLENFTTYKKLQEIDFSDLNFFIIQGRTGAGKTSIIDAM
FT                   CYALYGKVPRYKGTSIHEHLLSKGQKRMRVYFEFSVKGKRYAVDRQYEPSKPPMVRFYE
FT                   GSRLLNLKVREVEDYVSKLLGMDYETFTKVLVLPQGQFDRFLKPQRPAERREILNRLLG
FT                   YDEIFERISSIIKETLKELEREKGILEAEYESLKSINQTMLEQKEKELKRKQEEFKSIR
FT                   DQKERLSDELQKAIEKERLENELSQKTFQLSQLLNKHGEINQKKEKLEKAKRVIIYWPL
FT                   VREYESILNQKDRIIKEKKELQHELIKYSEEIKSVQEEYEKIEEKYKKLDKMREKINHL
FT                   EIKKEKLNNLESIKRKIYETNMEISKSEEELQNISNSLTDLNEKLQQQNNYLSDLEEKL
FT                   KNLEGIEAKYAKAQQLKPMYDSIPKIDEYIKRIDKDIQQKEIELSEVQSKIRQLEDKLF
FT                   EEYIHQIRLKLSPGDTCPVCGNKVENVYMVSLEMRTSVENVKEEIQNLRQKEHKLVELL
FT                   SEKRTQKNSLIQKKEEIISYTKLDFQEFQKRYRTLEENYKTFLSLREKEKACREKLQKL
FT                   KEEKSSKEVELSKLETSIKHSQRLLAQLQEEEERLLKEIGEPVIDPARSVRRLEDELKN
FT                   LKEEINSIQKRYEEVSRYLKELSADFERIKVQMEGKERQEEELKERLNQLACELYPAFQ
FT                   EFGDLETLKSFYLPEDEIQKLDKEINNYERDMESLKRDISLLQERIAGYPKHISKEDLE
FT                   RKVKGLEQIMYKINEEIGFLSRELVDIKHKIQRREHIEKQLQNISRELWKYETLQRDMR
FT                   SENFPEFVSRQMLQTITDRASFYLLKFSSGTYEFKLNEGDLLVIDRSSGHERSVFTLSG
FT                   GETFLASLSLAFAVSDIVSHNAPLESIFIDEGFGSLDRETRESLGEFFELIKLNAGRMV
FT                   GIISHLEDLAEKFDQRVLVEKHGDYSVVKVKVM"
FT   CDS_pept        complement(664591..665730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="HTH_0709"
FT                   /product="ATP-dependent dsDNA exonuclease D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69169"
FT                   /db_xref="GOA:D3DH67"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH67"
FT                   /protein_id="BAI69169.1"
FT                   /translation="MRLLHISDLHAGKTLGRTNRNEDLHYALEQVISICHEEKVDVLLI
FT                   AGDIYDKSHPDHESHNLIMDFLTRIHTTGIHTVLIAGNHDSYDFIKSYKNLGRVANIHA
FT                   FDRPCKNPKDCIIKLGNITIACLPYPSERVITHIEEHTQRSYTEKVANYLKALAKEVED
FT                   AQQSVLLAHIMIEKAKVSGTERQASIGEFYAIKPEHIPTAFNYVALGHVHRHQQIISSR
FT                   IYYSGSLYQIDFSEKGMEKYVNLVLLEEQEVRPIKLDLKRELYEVRIGVKDNFNAVLSH
FT                   LKGLKGLVKVVLETDMRDSTISIKKKNLEDVLGERLVRFEIEPIAENNAEESYKSEKLD
FT                   LVSAYETYYRKTYRCQLPEDIKKEFINILGKAEHEAHTA"
FT   CDS_pept        complement(665727..666473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69170"
FT                   /db_xref="GOA:D3DH68"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH68"
FT                   /protein_id="BAI69170.1"
FT                   /translation="MNSKELRLIEELKIKQGDTWRVLKIMSEFVRGFDELSNVGPAVTF
FT                   FGSSRLGEEDKYYKFAYRTAFRLGQMGFCIITGGGPGVMEAANRGAYDAGALSVGLNIE
FT                   IPKEQVPNRYQNKSLQFDYFFVRKVMLIKYSFAYVIFPGGFGTLDELFEALTLIQTGKS
FT                   HRFPVILFGSKYWGPLLDFMREVMVPHRTISQEDTKLLTLVDDPEAVISQVLSEVERQY
FT                   AYLMEEEPMNPLVEKLENILKRSSLR"
FT   CDS_pept        complement(666463..666705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0711"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69171"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH69"
FT                   /protein_id="BAI69171.1"
FT                   /translation="MRWISFVLLVFLGVSLLEPVCHQAYAKAQHKKVSIHKKKHKAKHK
FT                   IKRKKVVVKPSRNINSPQEGQLLKLEGMVKDINEQ"
FT   CDS_pept        666857..667222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HTH_0712"
FT                   /product="ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69172"
FT                   /db_xref="GOA:D3DH70"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH70"
FT                   /protein_id="BAI69172.1"
FT                   /translation="MIQRQSYANVADNSGAKRVQIIGIPYAPRKYATLGDVVTVTVKDA
FT                   APNSSAKKGKVYRAVVVRTKKEVRRPDGSYIKFDDNAVVLLNQYGEPLGTRILGPIARE
FT                   VRNRGFTKLASLAPEVV"
FT   CDS_pept        667224..667580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HTH_0713"
FT                   /product="ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69173"
FT                   /db_xref="GOA:D3DH71"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH71"
FT                   /protein_id="BAI69173.1"
FT                   /translation="MASKIKKGDTVVVLRGRERGKTGEVIKVLRDENKVIVKDVNIVKK
FT                   HVKGIPNVREGGIYEMEAPLHISNVMLLCPKCNKPTRVGFRIERDGDTLKKYRYCKKCH
FT                   QNIDLVRTKERVKV"
FT   CDS_pept        667577..668140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HTH_0714"
FT                   /product="ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69174"
FT                   /db_xref="GOA:D3DH72"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH72"
FT                   /protein_id="BAI69174.1"
FT                   /translation="MSVETKYVPRLYIKYRDEVVPKLINRFGYKNPMEVPKIIKIVVNM
FT                   GVGEAVQDIKHLERAIEDIKLITGQHPTVRRAKKSEAGFKLRKGMPVGLKVTLRKERMW
FT                   DFLDKLISIALPRVKDFKGLNPRSFDGRGNYAFGVSEQIVFPEIDYEKVDAIRGMDIIV
FT                   HTSAKTDEEALWLLSLLGLPIRSS"
FT   CDS_pept        668152..668340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HTH_0715"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69175"
FT                   /db_xref="GOA:D3DH73"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH73"
FT                   /protein_id="BAI69175.1"
FT                   /translation="MARKAKVAKDIKHFPKYQVRQKNRCPLCGRPRGFIRYFGMCRLCF
FT                   RELALKGELPGVRKASW"
FT   CDS_pept        668353..668763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HTH_0716"
FT                   /product="ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69176"
FT                   /db_xref="GOA:D3DH74"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH74"
FT                   /protein_id="BAI69176.1"
FT                   /translation="MDTIADMFSAIKNAISRRKDYVDVPSSKIKEAILELLKKEGYIRD
FT                   WERLEGEGYKKGTQYTLRIHLKYLDSRKQESAIKGMVKVSKPGRRIYVPKHSMPYVQKG
FT                   LGVAILSTDAGVLTDHQARKIGKGGEVIAYIW"
FT   CDS_pept        668773..669318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HTH_0717"
FT                   /product="ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69177"
FT                   /db_xref="GOA:D3DH75"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH75"
FT                   /protein_id="BAI69177.1"
FT                   /translation="MSRIGKKPIEIPKNVKVSLQDGVITVEGPKGKLSMKHHPDMKVYL
FT                   EESFIKVERPSDDPFHRAMHGTTAALIRNMIKGVTEGYTVVLEVFGLGYRAAVKGTNLE
FT                   LNLGLSHPVVFPIPPDVKIEVKENKIYVSGIDKQRVGQVAAQIRAFREPDAYKGKGIRY
FT                   EGEVLKLKPGKAAGKGKK"
FT   CDS_pept        669329..669700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HTH_0718"
FT                   /product="ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69178"
FT                   /db_xref="GOA:D3DH76"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH76"
FT                   /protein_id="BAI69178.1"
FT                   /translation="MAKLSSHARRERRHKRIRKKVFGTPERPRLCVYRSLHSFYAQIVD
FT                   DTKAHTIVSASTIDPEFTKLTGKRGGKSIEDVRKLAEILVQKAKEKGISKVVFDRGGFL
FT                   YHGKIKAFADRCRELGLEF"
FT   CDS_pept        669713..670285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HTH_0719"
FT                   /product="ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69179"
FT                   /db_xref="GOA:D3DH77"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH77"
FT                   /protein_id="BAI69179.1"
FT                   /translation="MGGVDLGRLIDERRKMQGIVGMEDDLQIEERLIYAKRTTRVTKGG
FT                   KRFSFGALVIVGDKRGFVGFGLGKAREVPIAIAKAIEDGKKHLIKVPIINGTVPHDVIG
FT                   EYGPTQIKVIPARRGTGIVAGGAAKPIFELAGYTDVLTKLQGSTNPNNVVRAVFDALLK
FT                   LRSLEDVSRERGIDLEELQRRYHIYAR"
FT   CDS_pept        670290..670478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HTH_0720"
FT                   /product="ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69180"
FT                   /db_xref="GOA:D3DH78"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH78"
FT                   /protein_id="BAI69180.1"
FT                   /translation="MIKVTLLRGLAGKPEDHIKAVKSLGLKKVGQSRMLPDSPVVWGNI
FT                   KKASYLIRVERVEGGQA"
FT   CDS_pept        670475..670924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HTH_0721"
FT                   /product="ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0721"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69181"
FT                   /db_xref="GOA:D3DH79"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH79"
FT                   /protein_id="BAI69181.1"
FT                   /translation="MKLHELAPNEGATKEKKRVGRGIGSGLGKTCGKGHKGQKTRSGDR
FT                   NLPSWFEGGQTPLHKRIPKRGFRSVNRVVYSVVNVKTLDKYFSEGQEITPELLYEKGLV
FT                   KKGMPVKVLGDGELSKRLSVKAHAFSSSAKEKIEAAGGSCEVLKW"
FT   CDS_pept        670918..672216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HTH_0722"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69182"
FT                   /db_xref="GOA:D3DH80"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH80"
FT                   /protein_id="BAI69182.1"
FT                   /translation="MVEYIKQLLALEDFRKRFLYTLLMFAIYRLGSHIPLPGIDTTALE
FT                   DFFKSFQGTIFYLYDIFSGGNLGRMTLFALGVMPYISASIMMQLLTVAVPELQRLAKEE
FT                   GDYGRYKINQYTRYLTVFVAFVQSLGVSLWLQNQVSPRGFPIVPDSGIVFTLTTVIALV
FT                   SSTMFLVWVGDRITEKGIGNGMSLLIFAGIVANFPNASIRVLEMLKNGDLSPFAFVGAI
FT                   IFVIAVIVGIVFMQEAERRIPVQYPRRQIGRQEVAGGSTYLPIKINPAGVIPIIFAQSL
FT                   LIIPSTVIGFINHPIARLLHDAFNPTTLFYNFLYVLLIVFFTYFYTAVLINPVDVADNL
FT                   KKGGAFVPGVRPGQDTQKLLETIVNRLAFIGSIFLSVVAIIPIFISLWLKVPFYFGGTT
FT                   ALIVVGVALDTLNKLEAQMIQKKYAGYMRRRVR"
FT   CDS_pept        672213..672854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0723"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69183"
FT                   /db_xref="GOA:D3DH81"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH81"
FT                   /protein_id="BAI69183.1"
FT                   /translation="MILVFLGPPGAGKGTQAKMLSEELGFKHISTGDMLREAVKNATPL
FT                   GLKAKEYMDRGDLVPDDIVIAMVEQVVLKEKKVILDGFPRTIAQATSLDSMLKKHGREV
FT                   SKVILFEIDDEVIVDRLTGRRICPNCGAVYHLKFSPPKEDQICDICGTKLIQRQDDTEE
FT                   VIRRRLEVYRRQTAELIDFYKRQNKLISLDAQKSIEELYKDLKKAVEDEY"
FT   CDS_pept        672844..673629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="HTH_0724"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69184"
FT                   /db_xref="GOA:D3DH82"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH82"
FT                   /protein_id="BAI69184.1"
FT                   /translation="MNIELYSFKEIEKIKKACQVVVEVLEAIAEHIKPGISTYDIDMIA
FT                   KEETKKRGARPAFLNYKPPFSKVSYPASICVSVNSAIVHGLPKKDQIIKEGDLVSLDFG
FT                   AIIDGYAGDSAITVPVGKIGQKEETLLRATKEALKEAVKVCVPGNWVSDITRAIHNTAE
FT                   RYGVFPVRGLGGHGIGKRVHEDPFIPNNLKDMEKRDVKLRQGMVIAIEPMFAIGTEETA
FT                   LDGDGWTVHTADKSPSAHFEYTVAITKDGPVVLTEFSHG"
FT   CDS_pept        673622..673861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="HTH_0725"
FT                   /product="translation initiation factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0725"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69185"
FT                   /db_xref="GOA:D3DH83"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH83"
FT                   /protein_id="BAI69185.1"
FT                   /translation="MGKKKDQEQYKEKGIVLEGTVTEALPNAMFRVKLDTGHEVLAHVS
FT                   GKMRVHFIRILPGDRVKVELSPYDLTRGRIVYRA"
FT   CDS_pept        673876..673992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HTH_0726"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0726"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69186"
FT                   /db_xref="GOA:D3DH84"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH84"
FT                   /protein_id="BAI69186.1"
FT                   /translation="MKVKPSVKPMCAKCKIIRRKGRVMVICENPKHKQRQGS"
FT   CDS_pept        674004..674384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HTH_0727"
FT                   /product="ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0727"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69187"
FT                   /db_xref="GOA:D3DH85"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH85"
FT                   /protein_id="BAI69187.1"
FT                   /translation="MARIAGVDLPDHKKLEVALTYLYGIGWSRSREICQKTGIPCTKRL
FT                   GELTPDELNTIRRYIEQNYKVEGDLRREVQMNIKRLMDMGSYRGIRHSRGLPVRGQQTR
FT                   TNSRTRKGKRKTVGGTKKKIAK"
FT   CDS_pept        674395..674784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HTH_0728"
FT                   /product="ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0728"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69188"
FT                   /db_xref="GOA:D3DH86"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH86"
FT                   /protein_id="BAI69188.1"
FT                   /translation="MAKKKGQAKKQKRTVTQGIVNILSTFNNTIINITDPQGNTLTWES
FT                   GGTVGFKGTRKSTPYAAQLAAQKAARRAIQEYGLQEVEVRIKGAGAGRESALRAIYASG
FT                   LKIKLIRDVTPIPHNGCRPPSKRRV"
FT   CDS_pept        674786..675415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HTH_0729"
FT                   /product="ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0729"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69189"
FT                   /db_xref="GOA:D3DH87"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH87"
FT                   /protein_id="BAI69189.1"
FT                   /translation="MSRYIGPWSKVDRRFGAVLSNRKSAGKVLSRRNFPPGQHGRVKGR
FT                   KRKLTEFGLRLMEKQKLKFLYGGLREKQFRRYFEEASKAKGNTGQVLLQLLERRLDNVV
FT                   YRLGMAVTRRQARQMIAHGHILVNGKKVDIPSYRVQVGDIIELKPASRDVPQFIENIQS
FT                   IDPRSIPPWLELDKENFRGKVIDLPKEVELEVPVNVQYVIEFYSRV"
FT   CDS_pept        675428..676378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HTH_0730"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69190"
FT                   /db_xref="GOA:D3DH88"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH88"
FT                   /protein_id="BAI69190.1"
FT                   /translation="MQREFLFPSKVYWEERGKTYGRFVVEPLERGFGITLGNSLRRTLL
FT                   SSIQGTAITAVKIYGIYHEFSPIEGVQEDVLEVIANLKKIRFNLKSSDVETLYLKKKGE
FT                   GTVTAKDITCPPNVDIINPDQKIATITDPNKELNMEIRIERGFGYMTTEEMEVIGEVGW
FT                   ILVDADFSPVRQVSFRVEKTRVEKRSDYDRLIMEIYTNGTKTPEEVVKEAISILVKYFS
FT                   SLEHISYELPVVEEPVIVDEFAEKLSLPVEELDVSQRALNSIKRMGINTIGDLVRLSEE
FT                   DLKGTKNVGRKAINEIKEALKQMGLYLGMDIESRR"
FT   CDS_pept        676382..676738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HTH_0731"
FT                   /product="ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0731"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69191"
FT                   /db_xref="GOA:D3DH89"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH89"
FT                   /protein_id="BAI69191.1"
FT                   /translation="MRHRVKKKHFDRTKEQRMALYRSLLLALIREERIETSLQRAKAVR
FT                   SMAERLITLAKKGDLASRRRALAILPNRSAIKKLFEDIAPRYEGRNGGYTRILKLPSRR
FT                   IGDGCELAILELVE"
FT   CDS_pept        676735..676974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0732"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69192"
FT                   /db_xref="GOA:D3DH90"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH90"
FT                   /protein_id="BAI69192.1"
FT                   /translation="MIKGILSLILNLLILLIIFHAVASWFPSLRGSKLYQRVDGIVSPM
FT                   LEPIRSVVKPINGLDFSPMILLFLLYLIKHLFRL"
FT   CDS_pept        676974..677759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0733"
FT                   /product="hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0733"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69193"
FT                   /db_xref="GOA:D3DH91"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH91"
FT                   /protein_id="BAI69193.1"
FT                   /translation="MPRQRLDKKLVELGFAPTREKAQALIMAGMVTVDGLLVDKPGFLV
FT                   KEGQKIDVKEPVRYVSRGGYKLEHALEGFGIDVRGFVALDVGSSTGGFTDCLLQRGVIK
FT                   VYAVDVGRAQMDIKLRQDPRVILYEETDARSLTESHVPEKADIITVDVSFISVTKVLPH
FT                   VVKFLKEGGILLVLVKPQFELTPDKVKKGIVRSSEDKFQAVLKVCQKLKDLGFQIGGVL
FT                   KAKPRGSKGNEEFFLLAGKKLTPVENIEKAVKDAIKEPL"
FT   CDS_pept        677737..678141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0734"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69194"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH92"
FT                   /protein_id="BAI69194.1"
FT                   /translation="MPLKSLFEENKLIGKRGVYPLTAENLLRTGLALCTLLKIEKQREK
FT                   PAMCISELNFLSMALSVGFMVGGGEVYAFEKEADVCVRYEKVGNIDVLVFSGLEPLDFK
FT                   KLESILFSRYNMPRKEGEEIGNIWIGREKL"
FT   CDS_pept        678117..678365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0735"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69195"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH93"
FT                   /protein_id="BAI69195.1"
FT                   /translation="MDRKGEALKLSRDMQKKILDFGTEIDEYYRKFRELRVLTDDLSFQ
FT                   GALINVEHAFFMVVQSLNILKEQLKLLEVASKKGEIY"
FT   CDS_pept        678365..680062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0736"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69196"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH94"
FT                   /protein_id="BAI69196.1"
FT                   /translation="MGIKFLMLDEERKYFSLVSDIFDVTGHKLLVALDEQKAKELLNAT
FT                   SFDVFLADIKHFNFWVSIIKEGKYALPIFFLEDYEDAQKLKALGFTDLNFVPLPFNPLD
FT                   LLTKAVWLNKEEYDPNMLSSIGPVNLLVQLLRRSASSIITLNSGTKKCGIFMKEGRVLG
FT                   STCQMETLKEVLAYQEVKIELFPYTGEDYLEESFTGNEEFFSGIFSAFSPSLQEREEFV
FT                   AIPKVANLAEPIELYRGLFWVGVCDSKSLTHLNCYLRIYEKGDVKIPILINAGTSRDYA
FT                   QIRIKIEQILSTVEIIKALFLLGSGPYEHANVLSMLQNNPKLQVITSLSVAKELNQLGV
FT                   PMSRIRLVESLQDMKLKLSTGDTLRIIPTPFAPERGSFMVYEEESGFLFTSQLFSSLCT
FT                   PDEFSLFEDPKVEDVMLYASLRMPCSRVVYKALDTLKDLRISKVFPIYGNPINQEALGE
FT                   IIKSLRTADMGIDLPSTADESFYLQAINRVIAKLKENMEEDEFSSLKAELEKYVYLEND
FT                   AVKEAFVSYSALPEILVVSMQYAGINPRFIKQALKELFYQGVVSFTIL"
FT   CDS_pept        complement(680049..680735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="HTH_0737"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0737"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69197"
FT                   /db_xref="GOA:D3DH95"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH95"
FT                   /protein_id="BAI69197.1"
FT                   /translation="MEKRGKSWLTELIAVVVIVLLLRAFVVQAYNIPSGSMKPTLLVGD
FT                   FILVNKLVYRFSEPQRGDIIVFKWPVDPRIDFIKRIIGVPGDVVQVKDYQVYVNGKPLP
FT                   IKLIGEEYEAGNRKLIYEETLPNGVKHKIALYENPIIPRRDVPATVVPPNSYFVMGDNR
FT                   DNSEDSRYWGFVPRENIEGKAFVIYFSGDIPPLESTDVNIFTGFRQLFLAVLHPRLDRI
FT                   GKPIIW"
FT   CDS_pept        complement(680696..681778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0738"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0738"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69198"
FT                   /db_xref="GOA:D3DH96"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH96"
FT                   /protein_id="BAI69198.1"
FT                   /translation="MECILRYNLEELKESLSKMGMPKYRAVQVLGWVYKKFQTDFDAMT
FT                   DISKEDRKLLKENYRVHTLELTDEVHAEDSVKYLFKTLDGHTIESVLIRERDHLTLCVS
FT                   SQIGCAVGCKFCATAIDGLTRNLRTDEIIDQLLQIQKKILPQRIRNVVFMGMGEPLANY
FT                   ENVRKAVEVMVSPWGIDLSKRRISVSTSGLIAQIKRMSEDPIMREVNLAVSLNAPSQKL
FT                   RELIMPISKTNNLSELMQVLKEYPYPKGRRIMLEYVLIKGLNDKKEDALSLAQLIGKYK
FT                   NKFKVNLIPYNPDPELPYERPSIEEVYEFQKVLWQTGISTFVRLSKGINIFGACGQLRQ
FT                   RDVVKWKEWKKGERAGLQSL"
FT   CDS_pept        681810..682097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD1"
FT                   /locus_tag="HTH_0739"
FT                   /product="molybdopterin converting factor small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0739"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69199"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH97"
FT                   /protein_id="BAI69199.1"
FT                   /translation="MAVVVRIPTPLRRVANGQGEVQVEAKTVRDAIEKLEEMFPGFKER
FT                   LVDENGELRRFVNLYLNDEDIRFLKGIDSELKDGDVLSIVPAIAGGLSDI"
FT   CDS_pept        complement(682083..682517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69200"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH98"
FT                   /protein_id="BAI69200.1"
FT                   /translation="MKDADIIKELIRRNKIRKEDVETFLREKNKDESILLFLVRKGIMS
FT                   EDEALEFSQDLLMSQEDVKTKDILIDEGVLLEDRYLLYRVKDSTYAVPYSHIRTLELKG
FT                   KTVVIYTGGIERITIPLKDEETARSLFDQILLNIERLYIR"
FT   CDS_pept        complement(682514..683101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smtA"
FT                   /locus_tag="HTH_0741"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0741"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69201"
FT                   /db_xref="GOA:D3DH99"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DH99"
FT                   /protein_id="BAI69201.1"
FT                   /translation="MAHKFDPSKLEKLDDPSRLELFDPKRVLKEFGLKRGMSVLDVGTG
FT                   AGFYLPYLSEAVGEEGKVYAVDVEPSAVEYAKRKVESMGLKNVYVLKSEENSIPLADDS
FT                   IDFIFMAFVFHELSNPVEFLKELRRVSKRYTYLAIIDWKKEERDKGPPAQEVYSEWEVG
FT                   LILEEAGVKVGRIVDLGRYAYGVYALFTKEMV"
FT   CDS_pept        complement(683114..685105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="HTH_0742"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0742"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69202"
FT                   /db_xref="GOA:D3DHA0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA0"
FT                   /protein_id="BAI69202.1"
FT                   /translation="MKVQEGFVLQTSLKPAGDQPKAIEELLNNLERGVKEQVLLGATGT
FT                   GKTFTLANLIAQYNKPTLVIAHNKVLAAQLYREFKELFPNNAVEYFISYYDYYQPEAYI
FT                   PEKDLYIEKDASINQVLERYRHSATISVLERRDVIVVASVSCIYGLGSPHHYYSMRIKL
FT                   RVGERISTSKLLRKLVELGYQRNDYTYKRATFSVRANALEVIPSDAEDRIVRIEFWDDE
FT                   IERITLIDALNRHTIGELEEFTIFPSSHYIAPRSTVEDALLQIERDLIERVKWFKNQGK
FT                   ELEARRLYQRTMYDLEMIREIGHCKGIENYSRYFDGRKPGEPPFTLLDYFPKDFLLIID
FT                   ESHVTVPQIRAMYNGDRSRKEKLVEYGWRLPSALDNRPLKFEEFLERINQVIYVSATPG
FT                   DWEIQRSRGIIVEQIVRPTGLLDPEVEVRPTRGQLEDLLREIQIRKKRNERAIVLTTTK
FT                   RLAEEVADYLTERGVSAKYMHSDLDAIERARIIKDLREGSIDVIVGVNLLREGLDLPEV
FT                   SLVAILDADKEGFLRSYTSLIQIIGRAARNINGKAILYADRMTESMKRAIEETRRRREK
FT                   QRKHNHLHGITPRSIVKPVKDLLSIEELDYVKVPSEIPKGIKSEEDIIRRIEKLEREML
FT                   ECAKKWEFEKAAKLRDEIKKLRELLNLL"
FT   CDS_pept        685122..686084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0743"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0743"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69203"
FT                   /db_xref="GOA:D3DHA1"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA1"
FT                   /protein_id="BAI69203.1"
FT                   /translation="MLALKLDSYLLKAGIELSHRSKENILRELTAWLNPSALGSGLVIT
FT                   QDGSYTLVSSAYGEPYHSISAGAIRECLLKFVEPSTVLERSKVKSEVKLLDIGFGLGYN
FT                   LAVAIKHLRDINPKVRIEIRSFEKELLQDIPLLPEPYRQYHKLLLDGLPELEKDGISFK
FT                   LLIGDARQKIKEVEGFGADAVFHDGFSPYRNPELWSYDFLKEIKQAMAEDGFWVSYTSS
FT                   LPVRKALRMLSFGIANSRSVGRKRSGTVASLSLKESLGPGEIEKLNSSPYAIPLRDENL
FT                   KMEPLEILIDYRVRVELLKVAQGGIEPPTPRFSAGCSTN"
FT   tRNA            complement(686023..686095)
FT                   /locus_tag="HTH_t12"
FT                   /product="tRNA-Phe"
FT   CDS_pept        686211..686840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HTH_0744"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0744"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69204"
FT                   /db_xref="GOA:D3DHA2"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA2"
FT                   /protein_id="BAI69204.1"
FT                   /translation="MQKEELVVEVIRRLEKVYPNKLELNFKNPFELLIAVILAAQTTDA
FT                   KVNHVTERLFKKYKTPEDYLRVPLEELQEDISSINYYRNKAKYIKGACKMIIEDYGGEV
FT                   PKSIEELTRLPGVGRKTANMILYNAFGINEGIAVDTHTARVSKRLGLTEEEKPDKIEQE
FT                   LMQITPKEEWGKLSNLLILHGRYICTAKNPKHKECVLYDLCPSRES"
FT   CDS_pept        686837..687586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="HTH_0745"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0745"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69205"
FT                   /db_xref="GOA:D3DHA3"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA3"
FT                   /protein_id="BAI69205.1"
FT                   /translation="MRLKKRYGQHILLSKGVIKAIVERLSIQEGDILLEIGPGTGNLTR
FT                   ELLNTPLKKLYLIEIDSQMVHELKKIEDDRVEIFLADATQFDICSLGGELKLVGNLPYN
FT                   VASLIVENTVIHRKCIPFALFMLQKEVAQKLLKGPSWLSTFVRTFYDLNYVMSVPARFF
FT                   FPKPKVQSALLEFVRKPDGEMIEDEKDYKRFLTKLYSMRRKAIKSKIEEDILKMANIDP
FT                   LKRVEELSVAHVLLLYNLSKTHEVDKK"
FT   CDS_pept        687583..688425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="HTH_0746"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0746"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69206"
FT                   /db_xref="GOA:D3DHA4"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA4"
FT                   /protein_id="BAI69206.1"
FT                   /translation="MMDVFFIERDPYAPLRHCYPVSKILYEGKSEYQEIMVIESPHFGR
FT                   VLILDGVAQCDEKFEFIYHEFISHIPLYAHPNPENVLIIGGGDGGALREVLKHKEVKRA
FT                   VLVDIDKQVIEVSKSFFPTMSVAFEDPRAIVVNEDGYKYVQDYEQEFDVIIVDSTDPVG
FT                   FAHVLTTEEFFRYVFRALKEDGVYVGQTESIHYHPDIVRRVQKSLKKVFPIVDLYTAVI
FT                   PGYAGYWWSFSIASKKHPVRNPSREVSVQTKLYSADMHRHAFLPESFYQKLISGEYQV"
FT   CDS_pept        688422..689894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="HTH_0747"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HTH_0747"
FT                   /db_xref="EnsemblGenomes-Tr:BAI69207"
FT                   /db_xref="GOA:D3DHA5"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D3DHA5"
FT                   /protein_id="BAI69207.1"
FT                   /translation="MKFYITTPIYYVNDVPHIGHAYTTVAADVLARFYRQRGYSVFFLT
FT                   GTDEHGLKIQKSAQERGISPKELADQNAENFKKLWKFMNISYDRFIRTTDEEHIKFVQE
FT                   VFVKSYENGDIYKGEYEGWYCVGCEEFKPESELLEGNICPVHLKPCEYVKEPSYFFRLS
FT                   KYEEELIRLYEWHKDFIMPEYRRNEVISFVKQGLKDLSITRPSVRVKWGIEVPFDREQT
FT                   IYVWFDALFNYISALYDRPHYWPADLHLVGKDILRFHAVYWPAFLMSVGYQVPKSIFAH
FT                   GWWKVEGKKMSKSLGNVIDPYKMVQDYGLDEVRYFLLREVPFGQDGDITQEGLKNRLVG
FT                   ELSNQIGNLFSRVSSMVIRYTEGKASGEKDRSYEAFCGEVIKDHHHRMEKVDFYNALEA
FT                   VLKLSNFLNKYVDEKAPWSLAKSDEKKLKDVLYTLTDGLFVLAYLLYPFMPSKMELVFE
FT                   SFGIETLPEKIVPYSFGSYSVREKLLLFPRRI"
FT   CDS_p