(data stored in ACNUC7421 zone)

EMBL: AP011115

ID   AP011115; SV 1; linear; genomic DNA; STD; PRO; 7913450 BP.
XX
AC   AP011115;
XX
PR   Project:PRJDA34839;
XX
DT   03-APR-2009 (Rel. 100, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 3)
XX
DE   Rhodococcus opacus B4 DNA, complete genome.
XX
KW   .
XX
OS   Rhodococcus opacus B4
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus.
XX
RN   [1]
RP   1-7913450
RA   Sekine M., Hosoyama A., Kosugi H., Yamada R., Matsuo Y., Tsukatani N.,
RA   Fujisawa T., Takarada H., Omata S., Kishi E., Shimizu A., Koga C.,
RA   Saito S., Nakazawa H., Sekigawa T., Nishiko R., Takeyama M., Tanikawa S.,
RA   Tago S., Fujita N., Kato J., Na K., Ohtake H., Nagayasu K., Harayama S.;
RT   ;
RL   Submitted (30-MAR-2009) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Takarada H., Sekine M., Hosoyama A., Yamada R., Fujisawa T., Omata S.,
RA   Shimizu A., Tsukatani N., Tanikawa S., Fujita N., Harayama S.;
RT   "Comparison of the complete genome sequences of Rhodococcus erythropolis
RT   PR4 and Rhodococcus opacus B4";
RL   Unpublished.
XX
DR   MD5; 40f4d9045105b02d8d934fc32f5ab297.
DR   BioSample; SAMD00060964.
DR   EnsemblGenomes-Gn; EBG00001224441.
DR   EnsemblGenomes-Gn; EBG00001224442.
DR   EnsemblGenomes-Gn; EBG00001224443.
DR   EnsemblGenomes-Gn; EBG00001224444.
DR   EnsemblGenomes-Gn; EBG00001224445.
DR   EnsemblGenomes-Gn; EBG00001224446.
DR   EnsemblGenomes-Gn; EBG00001224447.
DR   EnsemblGenomes-Gn; EBG00001224448.
DR   EnsemblGenomes-Gn; EBG00001224449.
DR   EnsemblGenomes-Gn; EBG00001224450.
DR   EnsemblGenomes-Gn; EBG00001224451.
DR   EnsemblGenomes-Gn; EBG00001224452.
DR   EnsemblGenomes-Gn; EBG00001224453.
DR   EnsemblGenomes-Gn; EBG00001224454.
DR   EnsemblGenomes-Gn; EBG00001224455.
DR   EnsemblGenomes-Gn; EBG00001224456.
DR   EnsemblGenomes-Gn; EBG00001224457.
DR   EnsemblGenomes-Gn; EBG00001224458.
DR   EnsemblGenomes-Gn; EBG00001224459.
DR   EnsemblGenomes-Gn; EBG00001224460.
DR   EnsemblGenomes-Gn; EBG00001224461.
DR   EnsemblGenomes-Gn; EBG00001224462.
DR   EnsemblGenomes-Gn; EBG00001224463.
DR   EnsemblGenomes-Gn; EBG00001224464.
DR   EnsemblGenomes-Gn; EBG00001224465.
DR   EnsemblGenomes-Gn; EBG00001224466.
DR   EnsemblGenomes-Gn; EBG00001224467.
DR   EnsemblGenomes-Gn; EBG00001224468.
DR   EnsemblGenomes-Gn; EBG00001224469.
DR   EnsemblGenomes-Gn; EBG00001224470.
DR   EnsemblGenomes-Gn; EBG00001224471.
DR   EnsemblGenomes-Gn; EBG00001224472.
DR   EnsemblGenomes-Gn; EBG00001224473.
DR   EnsemblGenomes-Gn; EBG00001224474.
DR   EnsemblGenomes-Gn; EBG00001224475.
DR   EnsemblGenomes-Gn; EBG00001224476.
DR   EnsemblGenomes-Gn; EBG00001224477.
DR   EnsemblGenomes-Gn; EBG00001224478.
DR   EnsemblGenomes-Gn; EBG00001224479.
DR   EnsemblGenomes-Gn; EBG00001224480.
DR   EnsemblGenomes-Gn; EBG00001224481.
DR   EnsemblGenomes-Gn; EBG00001224482.
DR   EnsemblGenomes-Gn; EBG00001224483.
DR   EnsemblGenomes-Gn; EBG00001224484.
DR   EnsemblGenomes-Gn; EBG00001224485.
DR   EnsemblGenomes-Gn; EBG00001224486.
DR   EnsemblGenomes-Gn; EBG00001224487.
DR   EnsemblGenomes-Gn; EBG00001224488.
DR   EnsemblGenomes-Gn; EBG00001224489.
DR   EnsemblGenomes-Gn; EBG00001224490.
DR   EnsemblGenomes-Gn; EBG00001224491.
DR   EnsemblGenomes-Gn; EBG00001224492.
DR   EnsemblGenomes-Gn; EBG00001224493.
DR   EnsemblGenomes-Gn; EBG00001224494.
DR   EnsemblGenomes-Gn; EBG00001224495.
DR   EnsemblGenomes-Gn; EBG00001224496.
DR   EnsemblGenomes-Gn; EBG00001224497.
DR   EnsemblGenomes-Gn; EBG00001224498.
DR   EnsemblGenomes-Gn; EBG00001224499.
DR   EnsemblGenomes-Gn; EBG00001224500.
DR   EnsemblGenomes-Gn; EBG00001224501.
DR   EnsemblGenomes-Gn; EBG00001224502.
DR   EnsemblGenomes-Gn; EBG00001224503.
DR   EnsemblGenomes-Gn; EBG00001224504.
DR   EnsemblGenomes-Gn; EBG00001224505.
DR   EnsemblGenomes-Gn; EBG00001224506.
DR   EnsemblGenomes-Gn; EBG00001224507.
DR   EnsemblGenomes-Gn; EBG00001224508.
DR   EnsemblGenomes-Gn; EBG00001224509.
DR   EnsemblGenomes-Gn; EBG00001224510.
DR   EnsemblGenomes-Gn; EBG00001224511.
DR   EnsemblGenomes-Gn; EBG00001224512.
DR   EnsemblGenomes-Gn; EBG00001224513.
DR   EnsemblGenomes-Gn; EBG00001224514.
DR   EnsemblGenomes-Gn; EBG00001224515.
DR   EnsemblGenomes-Gn; ROP_r0010.
DR   EnsemblGenomes-Gn; ROP_r0020.
DR   EnsemblGenomes-Gn; ROP_r0030.
DR   EnsemblGenomes-Gn; ROP_r0040.
DR   EnsemblGenomes-Gn; ROP_r0050.
DR   EnsemblGenomes-Gn; ROP_r0060.
DR   EnsemblGenomes-Gn; ROP_r0070.
DR   EnsemblGenomes-Gn; ROP_r0080.
DR   EnsemblGenomes-Gn; ROP_r0090.
DR   EnsemblGenomes-Gn; ROP_r0100.
DR   EnsemblGenomes-Gn; ROP_r0110.
DR   EnsemblGenomes-Gn; ROP_r0120.
DR   EnsemblGenomes-Gn; ROP_rnp0010.
DR   EnsemblGenomes-Gn; ROP_t0010.
DR   EnsemblGenomes-Gn; ROP_t0020.
DR   EnsemblGenomes-Gn; ROP_t0030.
DR   EnsemblGenomes-Gn; ROP_t0040.
DR   EnsemblGenomes-Gn; ROP_t0050.
DR   EnsemblGenomes-Gn; ROP_t0060.
DR   EnsemblGenomes-Gn; ROP_t0070.
DR   EnsemblGenomes-Gn; ROP_t0080.
DR   EnsemblGenomes-Gn; ROP_t0090.
DR   EnsemblGenomes-Gn; ROP_t0100.
DR   EnsemblGenomes-Gn; ROP_t0110.
DR   EnsemblGenomes-Gn; ROP_t0120.
DR   EnsemblGenomes-Gn; ROP_t0130.
DR   EnsemblGenomes-Gn; ROP_t0140.
DR   EnsemblGenomes-Gn; ROP_t0150.
DR   EnsemblGenomes-Gn; ROP_t0160.
DR   EnsemblGenomes-Gn; ROP_t0170.
DR   EnsemblGenomes-Gn; ROP_t0180.
DR   EnsemblGenomes-Gn; ROP_t0190.
DR   EnsemblGenomes-Gn; ROP_t0200.
DR   EnsemblGenomes-Gn; ROP_t0210.
DR   EnsemblGenomes-Gn; ROP_t0220.
DR   EnsemblGenomes-Gn; ROP_t0230.
DR   EnsemblGenomes-Gn; ROP_t0240.
DR   EnsemblGenomes-Gn; ROP_t0250.
DR   EnsemblGenomes-Gn; ROP_t0260.
DR   EnsemblGenomes-Gn; ROP_t0270.
DR   EnsemblGenomes-Gn; ROP_t0280.
DR   EnsemblGenomes-Gn; ROP_t0290.
DR   EnsemblGenomes-Gn; ROP_t0300.
DR   EnsemblGenomes-Gn; ROP_t0310.
DR   EnsemblGenomes-Gn; ROP_t0320.
DR   EnsemblGenomes-Gn; ROP_t0330.
DR   EnsemblGenomes-Gn; ROP_t0340.
DR   EnsemblGenomes-Gn; ROP_t0350.
DR   EnsemblGenomes-Gn; ROP_t0360.
DR   EnsemblGenomes-Gn; ROP_t0370.
DR   EnsemblGenomes-Gn; ROP_t0380.
DR   EnsemblGenomes-Gn; ROP_t0390.
DR   EnsemblGenomes-Gn; ROP_t0400.
DR   EnsemblGenomes-Gn; ROP_t0410.
DR   EnsemblGenomes-Gn; ROP_t0420.
DR   EnsemblGenomes-Gn; ROP_t0430.
DR   EnsemblGenomes-Gn; ROP_t0440.
DR   EnsemblGenomes-Gn; ROP_t0450.
DR   EnsemblGenomes-Gn; ROP_t0460.
DR   EnsemblGenomes-Gn; ROP_t0470.
DR   EnsemblGenomes-Gn; ROP_t0480.
DR   EnsemblGenomes-Gn; ROP_t0490.
DR   EnsemblGenomes-Tr; EBT00001793214.
DR   EnsemblGenomes-Tr; EBT00001793215.
DR   EnsemblGenomes-Tr; EBT00001793216.
DR   EnsemblGenomes-Tr; EBT00001793217.
DR   EnsemblGenomes-Tr; EBT00001793218.
DR   EnsemblGenomes-Tr; EBT00001793219.
DR   EnsemblGenomes-Tr; EBT00001793220.
DR   EnsemblGenomes-Tr; EBT00001793221.
DR   EnsemblGenomes-Tr; EBT00001793222.
DR   EnsemblGenomes-Tr; EBT00001793223.
DR   EnsemblGenomes-Tr; EBT00001793224.
DR   EnsemblGenomes-Tr; EBT00001793225.
DR   EnsemblGenomes-Tr; EBT00001793226.
DR   EnsemblGenomes-Tr; EBT00001793227.
DR   EnsemblGenomes-Tr; EBT00001793228.
DR   EnsemblGenomes-Tr; EBT00001793229.
DR   EnsemblGenomes-Tr; EBT00001793230.
DR   EnsemblGenomes-Tr; EBT00001793231.
DR   EnsemblGenomes-Tr; EBT00001793232.
DR   EnsemblGenomes-Tr; EBT00001793233.
DR   EnsemblGenomes-Tr; EBT00001793234.
DR   EnsemblGenomes-Tr; EBT00001793235.
DR   EnsemblGenomes-Tr; EBT00001793236.
DR   EnsemblGenomes-Tr; EBT00001793237.
DR   EnsemblGenomes-Tr; EBT00001793238.
DR   EnsemblGenomes-Tr; EBT00001793239.
DR   EnsemblGenomes-Tr; EBT00001793240.
DR   EnsemblGenomes-Tr; EBT00001793241.
DR   EnsemblGenomes-Tr; EBT00001793242.
DR   EnsemblGenomes-Tr; EBT00001793243.
DR   EnsemblGenomes-Tr; EBT00001793244.
DR   EnsemblGenomes-Tr; EBT00001793245.
DR   EnsemblGenomes-Tr; EBT00001793246.
DR   EnsemblGenomes-Tr; EBT00001793247.
DR   EnsemblGenomes-Tr; EBT00001793248.
DR   EnsemblGenomes-Tr; EBT00001793249.
DR   EnsemblGenomes-Tr; EBT00001793250.
DR   EnsemblGenomes-Tr; EBT00001793251.
DR   EnsemblGenomes-Tr; EBT00001793252.
DR   EnsemblGenomes-Tr; EBT00001793253.
DR   EnsemblGenomes-Tr; EBT00001793254.
DR   EnsemblGenomes-Tr; EBT00001793255.
DR   EnsemblGenomes-Tr; EBT00001793256.
DR   EnsemblGenomes-Tr; EBT00001793257.
DR   EnsemblGenomes-Tr; EBT00001793258.
DR   EnsemblGenomes-Tr; EBT00001793259.
DR   EnsemblGenomes-Tr; EBT00001793260.
DR   EnsemblGenomes-Tr; EBT00001793261.
DR   EnsemblGenomes-Tr; EBT00001793262.
DR   EnsemblGenomes-Tr; EBT00001793263.
DR   EnsemblGenomes-Tr; EBT00001793264.
DR   EnsemblGenomes-Tr; EBT00001793265.
DR   EnsemblGenomes-Tr; EBT00001793266.
DR   EnsemblGenomes-Tr; EBT00001793267.
DR   EnsemblGenomes-Tr; EBT00001793268.
DR   EnsemblGenomes-Tr; EBT00001793269.
DR   EnsemblGenomes-Tr; EBT00001793270.
DR   EnsemblGenomes-Tr; EBT00001793271.
DR   EnsemblGenomes-Tr; EBT00001793272.
DR   EnsemblGenomes-Tr; EBT00001793273.
DR   EnsemblGenomes-Tr; EBT00001793274.
DR   EnsemblGenomes-Tr; EBT00001793275.
DR   EnsemblGenomes-Tr; EBT00001793276.
DR   EnsemblGenomes-Tr; EBT00001793277.
DR   EnsemblGenomes-Tr; EBT00001793278.
DR   EnsemblGenomes-Tr; EBT00001793279.
DR   EnsemblGenomes-Tr; EBT00001793280.
DR   EnsemblGenomes-Tr; EBT00001793281.
DR   EnsemblGenomes-Tr; EBT00001793282.
DR   EnsemblGenomes-Tr; EBT00001793283.
DR   EnsemblGenomes-Tr; EBT00001793284.
DR   EnsemblGenomes-Tr; EBT00001793285.
DR   EnsemblGenomes-Tr; EBT00001793286.
DR   EnsemblGenomes-Tr; EBT00001793287.
DR   EnsemblGenomes-Tr; EBT00001793288.
DR   EnsemblGenomes-Tr; ROP_r0010-1.
DR   EnsemblGenomes-Tr; ROP_r0020-1.
DR   EnsemblGenomes-Tr; ROP_r0030-1.
DR   EnsemblGenomes-Tr; ROP_r0040-1.
DR   EnsemblGenomes-Tr; ROP_r0050-1.
DR   EnsemblGenomes-Tr; ROP_r0060-1.
DR   EnsemblGenomes-Tr; ROP_r0070-1.
DR   EnsemblGenomes-Tr; ROP_r0080-1.
DR   EnsemblGenomes-Tr; ROP_r0090-1.
DR   EnsemblGenomes-Tr; ROP_r0100-1.
DR   EnsemblGenomes-Tr; ROP_r0110-1.
DR   EnsemblGenomes-Tr; ROP_r0120-1.
DR   EnsemblGenomes-Tr; ROP_rnp0010-1.
DR   EnsemblGenomes-Tr; ROP_t0010-1.
DR   EnsemblGenomes-Tr; ROP_t0020-1.
DR   EnsemblGenomes-Tr; ROP_t0030-1.
DR   EnsemblGenomes-Tr; ROP_t0040-1.
DR   EnsemblGenomes-Tr; ROP_t0050-1.
DR   EnsemblGenomes-Tr; ROP_t0060-1.
DR   EnsemblGenomes-Tr; ROP_t0070-1.
DR   EnsemblGenomes-Tr; ROP_t0080-1.
DR   EnsemblGenomes-Tr; ROP_t0090-1.
DR   EnsemblGenomes-Tr; ROP_t0100-1.
DR   EnsemblGenomes-Tr; ROP_t0110-1.
DR   EnsemblGenomes-Tr; ROP_t0120-1.
DR   EnsemblGenomes-Tr; ROP_t0130-1.
DR   EnsemblGenomes-Tr; ROP_t0140-1.
DR   EnsemblGenomes-Tr; ROP_t0150-1.
DR   EnsemblGenomes-Tr; ROP_t0160-1.
DR   EnsemblGenomes-Tr; ROP_t0170-1.
DR   EnsemblGenomes-Tr; ROP_t0180-1.
DR   EnsemblGenomes-Tr; ROP_t0190-1.
DR   EnsemblGenomes-Tr; ROP_t0200-1.
DR   EnsemblGenomes-Tr; ROP_t0210-1.
DR   EnsemblGenomes-Tr; ROP_t0220-1.
DR   EnsemblGenomes-Tr; ROP_t0230-1.
DR   EnsemblGenomes-Tr; ROP_t0240-1.
DR   EnsemblGenomes-Tr; ROP_t0250-1.
DR   EnsemblGenomes-Tr; ROP_t0260-1.
DR   EnsemblGenomes-Tr; ROP_t0270-1.
DR   EnsemblGenomes-Tr; ROP_t0280-1.
DR   EnsemblGenomes-Tr; ROP_t0290-1.
DR   EnsemblGenomes-Tr; ROP_t0300-1.
DR   EnsemblGenomes-Tr; ROP_t0310-1.
DR   EnsemblGenomes-Tr; ROP_t0320-1.
DR   EnsemblGenomes-Tr; ROP_t0330-1.
DR   EnsemblGenomes-Tr; ROP_t0340-1.
DR   EnsemblGenomes-Tr; ROP_t0350-1.
DR   EnsemblGenomes-Tr; ROP_t0360-1.
DR   EnsemblGenomes-Tr; ROP_t0370-1.
DR   EnsemblGenomes-Tr; ROP_t0380-1.
DR   EnsemblGenomes-Tr; ROP_t0390-1.
DR   EnsemblGenomes-Tr; ROP_t0400-1.
DR   EnsemblGenomes-Tr; ROP_t0410-1.
DR   EnsemblGenomes-Tr; ROP_t0420-1.
DR   EnsemblGenomes-Tr; ROP_t0430-1.
DR   EnsemblGenomes-Tr; ROP_t0440-1.
DR   EnsemblGenomes-Tr; ROP_t0450-1.
DR   EnsemblGenomes-Tr; ROP_t0460-1.
DR   EnsemblGenomes-Tr; ROP_t0470-1.
DR   EnsemblGenomes-Tr; ROP_t0480-1.
DR   EnsemblGenomes-Tr; ROP_t0490-1.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP011115.
DR   SILVA-SSU; AP011115.
XX
CC   Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of
CC   Molecular Biotechnology, Hiroshima University.
CC   Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
CC   bacterium (Kyung-su Na et al 2005). The complete genome analysis
CC   of R. opacus B-4 was carried out by NITE. The genome analysis
CC   indicated that this strain has one linear chromosome, two linear
CC   plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
CC   pKNR02.
CC   This work was supported by New Energy and Industrial Technology
CC   Development Organization (NEDO).
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps and the
CC   genomic and proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial genomic DNA clones used for the sequencing project
CC   are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7913450
FT                   /organism="Rhodococcus opacus B4"
FT                   /strain="B4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:632772"
FT   CDS_pept        899..1303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48248"
FT                   /db_xref="GOA:C1ARZ9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ9"
FT                   /protein_id="BAH48248.1"
FT                   /translation="MPAHRQAPPLPQGTSRTPAKTKKVLEASLRQTTLLGHEKIGTNHL
FT                   LLALLDDPASTGTQILTDLASLPISEMHEHLRRELAQQPTPGPAHRIPIRLSNDKYTRA
FT                   HAAAHTAGQNLETSGPRPHHRRPRTTRIAG"
FT   CDS_pept        1300..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48249"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS00"
FT                   /protein_id="BAH48249.1"
FT                   /translation="MTQKIDMVDPRHGRREMSAHALRIPRRRPLSDTLAEAFPELHRAA
FT                   LPDQTLFYGNHVHFGIPSGTLTPPSFRLPCGRRRERRVSG"
FT   CDS_pept        complement(1496..1861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48250"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS01"
FT                   /protein_id="BAH48250.1"
FT                   /translation="MADGSHYTYRVTWSEPDSEFVGIVAEFPSLSWLAETQNEALDGIV
FT                   AVVRDVLEDMASTGEQPPVPIADRSYSGIFTVRTSPRVHRTLAVEAEEQGVSLNLLVNQ
FT                   KLSAPVGGRTGAETKAG"
FT   CDS_pept        2534..3160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48251"
FT                   /db_xref="GOA:C1AS02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS02"
FT                   /protein_id="BAH48251.1"
FT                   /translation="MDLIRPLQTVTPTLDGDVLSALAAASEATFTTGQLHRVLHHHSEE
FT                   GIRKVLQRLSKQGTVLSSRVGNAFVYQLNREHLAFPHVVGLADLSGEFLRRLEARLAGW
FT                   EIPPVYAAVFGSAARGTMTIDSDIDIFLVRPDDVAEEEWDEQVAELMAEVTRWTGNDAR
FT                   DLQFAQSEIAGRGTDEPVLRDVVKEGLTVAGSRAGFTRLLRRGNR"
FT   CDS_pept        3160..3567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48252"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS03"
FT                   /protein_id="BAH48252.1"
FT                   /translation="MGRTRPCDQAVRRGRLKKAEQFFHLAEIGRDFADEPDGVDDAVVT
FT                   LWVHAGIAASDVICCARLGKHAQGEDHKDAVTVLGSVDPTTAKHLSVLLGLKTRSGYTD
FT                   MPTSRTESKRAERAAEALIEAARRAHAQAGT"
FT   CDS_pept        complement(5167..6435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00060"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48253"
FT                   /db_xref="GOA:C1AS04"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS04"
FT                   /protein_id="BAH48253.1"
FT                   /translation="MADTSALPQTTPTLDRGGLRRVLTVLCLTEITSWGILYYAFPVLS
FT                   VSISADTGWSLPVIVAAFSLSQLAAALTGIPVGRIIDRIGPRAVMTAGSVLAVPSLLVV
FT                   AAAPNLPIFYAGWIAAGIAMGAVLYPPAFAALTRWYGDGYVKALMILTLAAGLASTVFA
FT                   PLTAALVDLYDWRATYLALAAILAVVTVPGHLLGLRGRWPHPLVPTGTHPVDHRDASRS
FT                   WAFLALVIALSLGAFAAFAGVFNLVPLLIEQGFSPSLAALTLGLGGAGQVLGRIGYLPL
FT                   AARTTARTRIVMILAATAVTTALLGIVSTMVALIAVAIGAGLVRGIFTLIQATAITDRW
FT                   GATHYGRLNGLMSAPVVIVMALAPWAGTALSAWTGSYAHAYLILAGAAVLAAMVATASI
FT                   PRVGERGRGRRVLNPARELPEVT"
FT   CDS_pept        complement(6440..7825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00070"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48254"
FT                   /db_xref="GOA:C1AS05"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS05"
FT                   /protein_id="BAH48254.1"
FT                   /translation="MNVDGRIFEMNTLPVVVVGAGPVGLAAAAQLRERGLTALVFERGE
FT                   SAGAAIAEWNHVRLFSRWGELIDPAARRLLDATGWIAPDDDAYPTGQDWTRDYLVPLAN
FT                   ALGDDIVQLNTEVVGVARRGRDRVVDAGRDTEPLSVHLRRADGTEDRITAQAVIDASGT
FT                   WTTPNPLGGEGLPALGERDAVDVIEYRVPNLADEAVRARYAGKHIVIAGSGHSAMTAIV
FT                   ALADLEKQTPGTRISWVLRRGDVGSTFGGGDDDQLPARGALGLRAKAALDAGLLTVVPG
FT                   FRTATIEPADDDDRVVLVSDTGARIDDVDRVVVLTGFRPDLSWLSEIRLGLDPVLQAPT
FT                   QLAPLIDPNVHSCGTVYPHGVAELSHPEPNVFLAGMKSYGRAPTFLAMTGYEQVRSIAA
FT                   TLDGDHDAAARVELTLPETGVCGGAGVFDDPDTPADAVDAPAGCCPAPDLALISLTTTR
FT                   AGG"
FT   CDS_pept        7856..8770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00080"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48255"
FT                   /db_xref="GOA:C1AS06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS06"
FT                   /protein_id="BAH48255.1"
FT                   /translation="MSMNATIDVYRYSEPMTSLDMPDVRTAAVDSVDALAPDDAATYAG
FT                   WFACLADPTRVRLLHQVASHPAGITVGELAEALGIGQPTVSHHVRKLADVGFVTAEKNG
FT                   TSTVVVVNPSCCTGLPHAADAVMGVLTPRPCCPDDLPDDVTVRPMREQDWEAVRRIYGE
FT                   GIATRTATFTTEVPTRETLDAQWLPRHRWVAEIDDVVVGWAALTPTSGRDCYQGVAENS
FT                   IYVADGMRGRGVGKALLRTQVIAADEAGIWTLQTSIFPENRASIALHHSAGFRTIGVRE
FT                   RIAQLDGIWRDTVFLERRSALTV"
FT   CDS_pept        8841..9614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00090"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48256"
FT                   /db_xref="GOA:C1AS07"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS07"
FT                   /protein_id="BAH48256.1"
FT                   /translation="MSTYRISQLAELSAVPATTLRFYETAGLLPAARTASGYRVYDDAA
FT                   VDRLEFISSAKHLGLPLEEIRELLEVWEQGVCAHVRQRMLPMITDRITDADRRIAELSA
FT                   FSAHLTRVRTELSQPPPAGACGPDCGCLSTAPAAPVAVAFTRTRPDPVPKSDGRPEMPV
FT                   ACTLGGDEQGERIQQWRQVLDSATGREDIDGGLRLRFPADPDLVADVARLAAAEQGCCA
FT                   FFDFTMQLTPDALVLSVRAPGAAEPLVTELFGVRA"
FT   CDS_pept        9611..9928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00100"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48257"
FT                   /db_xref="GOA:C1AS08"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS08"
FT                   /protein_id="BAH48257.1"
FT                   /translation="MTATGRPGAARWKAVGVGGAAVGACAVCCAGPILSVLGGLTAAFA
FT                   LGALWVPALAVVALVAAVALGWTLRRRRSAPASCPPAPAADLPMPTIPGALEERTAPEP
FT                   R"
FT   CDS_pept        10019..11014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00110"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48258"
FT                   /db_xref="GOA:C1AS09"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS09"
FT                   /protein_id="BAH48258.1"
FT                   /translation="MTQPQGVVARMEHHQVAIYLAAMVAGAGIGWAAPAAGPGLEHAIN
FT                   PVLGALLFVTFLQVPVAELLRSLRDGRFLTAILAVNFVVVPLVVAAMFTFLPADQAVRI
FT                   GVLLVLLCPCVDYVIVFSGLAGGSSRRLLAATPLLLLTQMLLLPVFLVLFLGSDLSDIV
FT                   EVGPFVTAFIVLIVIPLALAWATQFWASRAESGRRTSEAATSLMVPLMAATLLVVVASQ
FT                   VPKLEGRVADVAAVVPFYVVFLVVMAFAGMLVARLFRLDPPSGRAVVFSGATRNSLVVL
FT                   PLALALPDQLAVAAVVVVTQTLVEVVGMVVYVRLVPRLLPAATDTSPAPA"
FT   CDS_pept        11115..11645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48259"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS10"
FT                   /protein_id="BAH48259.1"
FT                   /translation="MPEKQPVDRAEIAADLDRARRTLHELLDHATAADFERRSNGTRWT
FT                   NEQLLFHMVFGYMVVRRLLVLVRVFSRLPDRVGRGFARALDATTPVFHQINYLGSCAAA
FT                   TVFDRRRMGRHCDRVIAKLQRSLAKESETNLRRSMAFPVRWDPFFDEVMTAEQVYRYPG
FT                   KHFDFHRDQLTLG"
FT   CDS_pept        complement(11665..12669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00130"
FT                   /product="alkylmercury lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48260"
FT                   /db_xref="GOA:C1AS11"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS11"
FT                   /protein_id="BAH48260.1"
FT                   /translation="MRLEILQVPGCPHVALLEQRLENVLAGQQSEVEISHRVIDDPAVA
FT                   ADAGMTGSPTLLVDGADPFAAPGLVPSVSCRLYPAEGGGVGGAPSVAALRQALHAAAAD
FT                   TADEPADGRGGCCSAGTAAESPLAGLGGWRDAARPRTPAERAIHYAILRAFADRGAPPE
FT                   HAELDSVAAEFGEPGRRVLARLHTADVIRLDPAGRIASAYPFSTSPTPHRVRIGGGAGV
FT                   YAMCAVDALGMSAMLAAEVVIESADPVTGEHITVTVHGESAVATPATVVVFVGADAGHG
FT                   PSADTCCTTLNFFTDRGTARSGADEHPQVGGIVVDLADATRLGATIFGGALTT"
FT   CDS_pept        complement(12666..13097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00140"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48261"
FT                   /db_xref="GOA:C1AS12"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS12"
FT                   /protein_id="BAH48261.1"
FT                   /translation="MGYGVENGGMRSSEVAARTGVNVQTLRYYERRGLLTPPPRSPAGY
FT                   RAYPADAVAVVRFVKRAQGHGFSLDEIEDLLHLAEGGPDDCNTARELAEAKLAQLAEKI
FT                   ADLQRMQRSLSDLVATCERPRTDRCCPLLHTLHTEGDDR"
FT   CDS_pept        13196..13588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="ROP_00150"
FT                   /product="putative arsenic resistance operon repressor
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48262"
FT                   /db_xref="GOA:C1AS13"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS13"
FT                   /protein_id="BAH48262.1"
FT                   /translation="MSKQEVSESGACCSPLAREPLTEDWAGDLARMFKALGDPVRLRLL
FT                   SLIASHAGGEACVCDISATIDLSQPTISHHLKVLRAAGLLDCERRGTWVYYWVIPSALQ
FT                   QLSAVLLTESGPVVPSETCTSTEVPA"
FT   CDS_pept        13585..14700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="ROP_00160"
FT                   /product="putative arsenite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48263"
FT                   /db_xref="GOA:C1AS14"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS14"
FT                   /protein_id="BAH48263.1"
FT                   /translation="MSEETTTDHPAVVGKLSTLDRFLPVWIGVAMVGGLLLGRMIPGLG
FT                   DALSAVEIDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLIGSLVLNWVLGPAL
FT                   MFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVAINSVFQVIM
FT                   FAVLGWFYLSVLPGWLGLEQTTIDTSPWQIAKSVLIFLGIPLLAGYLTRRFGEKAKGRT
FT                   WYETKFIPKIGPWALYGLLFTIVILFALQGDRITSQPWDVVRIAVPLLAYFAIMWGGGY
FT                   ALGATMGLGYERTTTLAFTAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVG
FT                   LVYVSLALRTRFTHSAGFTDTPASASVTKES"
FT   CDS_pept        14700..15383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00170"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48264"
FT                   /db_xref="GOA:C1AS15"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS15"
FT                   /protein_id="BAH48264.1"
FT                   /translation="MSENPLDEELRSQVHRAQPELLMPQAVLSRTAEDLAAKYTGVFSP
FT                   QTVERYVFESYTALRRTARVHTHLTTLAGRFAADRLTALAQSRGAAPKDVPEVLFVCVH
FT                   NAGRSQMAAALLDHHAQGRVHVRSAGSAPIHAINPTVAEAMTELGLDLGAEYPKPLTDD
FT                   VVAAADVVVSMGCGDACAVYPGKRYLDWALDDPEGQPLEAVRVIRDDLDTRVRQLLREL
FT                   TTVPA"
FT   CDS_pept        15442..15852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="ROP_00180"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48265"
FT                   /db_xref="GOA:C1AS16"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS16"
FT                   /protein_id="BAH48265.1"
FT                   /translation="MSTTPSVLFVCVHNAGRSQMAAGFLTHLAGDQIEVRSAGSAPADQ
FT                   VNPAAVEAMAELGIDISAESPKILTVDAVQASDVVITMGCGDTCPVFPGTSYRDWVLED
FT                   PAGQGVDAVRPIRDEIKAKVQALIAELVPATA"
FT   CDS_pept        15870..16289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00190"
FT                   /product="putative arsenate reductase"
FT                   /EC_number="1.20.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48266"
FT                   /db_xref="GOA:C1AS17"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS17"
FT                   /protein_id="BAH48266.1"
FT                   /translation="MSTPSVLFVCVKNGGKSQMAAGLMRKAARDTVEVYSAGTKPGTAV
FT                   NALSAESLLEVGVDITGETPKLIDPQLVRDVDLVVTLGREARVDPVDGTRFENWDTIEP
FT                   SERGIDGIERMRLVRDDITARVNQLAAQLRTTHQS"
FT   CDS_pept        16310..16729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsD"
FT                   /locus_tag="ROP_00200"
FT                   /product="putative arsenic resistance operon repressor
FT                   ArsD"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48267"
FT                   /db_xref="GOA:C1AS18"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS18"
FT                   /protein_id="BAH48267.1"
FT                   /translation="MSTIEIFEPALCCNTGVCGDDVDQALVTFSADMDWVRSQGGDIAR
FT                   FNLASEPLAFAEREPVKGFLQVAGSEGLPLVLVDGVTAQTGRYPDRAQLAKWAGIGTDT
FT                   PYAGAPAGISTLGLTDTTDAGSCCAPTDTGSTSCC"
FT   CDS_pept        16747..18513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsA"
FT                   /locus_tag="ROP_00210"
FT                   /product="arsenite-transporting ATPase"
FT                   /EC_number="3.6.3.16"
FT                   /note="protein synonym:arsenite resistance pump catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48268"
FT                   /db_xref="GOA:C1AS19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS19"
FT                   /protein_id="BAH48268.1"
FT                   /translation="MKFLLAPPRFLFFTGKGGVGKTSIACATAITLARAGKRVLLVSTD
FT                   PASNVGQVFGLTIGNTVTEVLTVPGLSALEIDPEQAADAYRERIIGPVRGLLPEKELAS
FT                   ITEQLSGSCTTEIASFNEFTALLTDHDTLADFDHVLFDTAPTGHTIRLLQLPGSWTDFL
FT                   NEGKGDASCLGPMSGLDKQRSIYEGAVAALADPQRTRLVLVARAQRSPLAEIARTHTEL
FT                   ADIGLTRQHVVINGVLPTPTGGDELAAAIHQREQAALADLPTELAGLPLDLVELKATNM
FT                   VGISALEGLFTTNPDTPQPDSAPAPAVPEAPLSALVDELADDGHGLIMCMGKGGVGKTT
FT                   LAAAIAVALAQRGHQVHLTTTDPAAHLTDTLDGNLAGLTVSRIDPAEATDAYRQRVLAT
FT                   KGAALDEQGRATLAEDLASPCTEEVAVFQAFSRIIHESRRKFVVVDTAPTGHTLLLLDA
FT                   TGSYHREIARQMGDNSNFTTPLMRLQNPQETKVLLVTLAETTPRLEAEGLQTDLQRAGI
FT                   APWAWVVNNSLAAAAPTSPLLRQRAATELEEIGAVTAAHPRFSVVPKLATDPVGVDALT
FT                   AMVGAAQTMPVN"
FT   CDS_pept        complement(18699..20000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="ROP_00220"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48269"
FT                   /db_xref="GOA:C1AS20"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS20"
FT                   /protein_id="BAH48269.1"
FT                   /translation="MMNAPLSRLPLLSRGSWPETARVAEILRKETVGGVLLLIAAAAAL
FT                   IWANTPWSDAYHSLREVTVGPPSLHLNLTLGTWAADGLLAIFFFVVGLELKREFVAGDL
FT                   RDPRRAALPVMAAIGGMIAPALIFVAINLGTGGGALNGWAIPTATDIAFAVAILAVIGT
FT                   HLPAALRTFLLTLAVVDDLLAVTVIAIFYTDDLDFTYLGLALIPLAAFGFAVQKRIRSF
FT                   WILLPLAAATWWLVHESGVHATIAGVLLGFTVPVVRSAAAGGPDAGPGLAEHFEHRIRP
FT                   LSAGFAVPVFAFFAAGVTIGGLDGFVDTLGDRVALGIVAGLVIGKVVGITGMSVLIAKF
FT                   TRAELDEDLSWLDVIAVAMLGGIGFTVSLLIGELAFAGDVLRSDHVKIGVLTGTLTAAL
FT                   LAAILLRLRNRAYRRIADRETADMNHDGIPDIYQ"
FT   CDS_pept        complement(20157..20417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48270"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS21"
FT                   /protein_id="BAH48270.1"
FT                   /translation="MPHAAVRDCARRMMIVQLKYATARSGSDAALAHSDVSAAVGTPGT
FT                   FHEPSMVFFEENLRPGGTNGYTTSWGTNAHGKLAGCPPSAH"
FT   CDS_pept        complement(20443..20883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00240"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48271"
FT                   /db_xref="GOA:C1AS22"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS22"
FT                   /protein_id="BAH48271.1"
FT                   /translation="MTGRVEVSTDRHMQIGEVAERTELSIKTIRHYDEVGLVTPSERSA
FT                   GGFRLYTDADVQRLLVIRRMKPLGFTLDEMRQLLDSLDILDTTGSGHDRVAAQAFVTDC
FT                   HTRAEESCRKLRKQVAYAEELTALLADHAAGETAAAAVVDEP"
FT   CDS_pept        complement(20926..22425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00250"
FT                   /product="putative SulP family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48272"
FT                   /db_xref="GOA:C1AS23"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS23"
FT                   /protein_id="BAH48272.1"
FT                   /translation="MPVQLDLPPEDVSVRAALRSPRRLKTEILAGVVVALALIPEAISF
FT                   SIIAGVDPRVGLFASFTMAVTIAIVGGRPAMISAATGAIALVVAPLSREYGLDYLIAAV
FT                   LLAGVLQIVLSLLGVAKLMRFVPRSVMVGFVNALAILIFTAQLPHLIDVPVLVYPMVAV
FT                   GLLIMVLLPKVTTVVPAPLVAIVLLTAATVLFALNVPNVGDEGELPSSLPSWLIPDVPF
FT                   TMDTLSIIAPYALAMALVGLLESLMTAKLVDDITDTHSDKTREGWGQGIANLVTGLFGG
FT                   MGGCAMIGQTMINVKVSGARTRISTFLAGVFLLILVVGLGDVVALIPMAALVAVMIMVS
FT                   VGTMDWHSIAPKTLRRMPRSETTVMLATVAVTVATHNLAYGVIVGVITAMVLFARRVAH
FT                   LTEVVDIAHPDENTRVYAVRGELFFASSNDLIYQFDYVGDPENVVIDLSDSHIWDASTV
FT                   ATLDAITTKYAAKGKTVTIVGLNAASSERHVRLSGQMGAGH"
FT   CDS_pept        22815..23573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00260"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48273"
FT                   /db_xref="GOA:C1AS24"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS24"
FT                   /protein_id="BAH48273.1"
FT                   /translation="MSTGASIGVLGGMIGLGGAEFRLPVLIGLFGFVALQAVIVNKAMS
FT                   LIVVLTALPARLMSVPYADLVPHWSVVVNLLCGSLVGAWVGATWATKMRSATLYKVLAV
FT                   LLVVIAIALGASHFGELGTLDLGPLSRTIAGLIAGFGIGVVAALMGVAGGELLIPTIVL
FT                   LYGVDIKIAGSLSLAVSLPTMLVAFARYSRDRSFGVLKANGRFVIAMSLGSIIGTVIGG
FT                   LLLGVVPETVLIPLLMLLLLASAVKVWRHH"
FT   CDS_pept        complement(23623..24150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48274"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS25"
FT                   /protein_id="BAH48274.1"
FT                   /translation="MTKKENHHATRDNLRDWRTPLRVDGPTAPQPAVCHLVVGFDRHPA
FT                   SHAALTYAMDLAGRLDAFLHVAHIVDVDDMPVEPDRDDWEQRFADAVEAERTEACTMLA
FT                   TLPGNWTYYSREGNPAQLLTTIAEANDALMIIIGTSRGGVMSLFERFLGESVSSKLVHH
FT                   ARRPVLLVPVAG"
FT   CDS_pept        complement(24162..24527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00280"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48275"
FT                   /db_xref="GOA:C1AS26"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS26"
FT                   /protein_id="BAH48275.1"
FT                   /translation="MVMLWIACAGSAGAIARFVIDGAIKHRKASEFPWATATINVTGSL
FT                   LLGFVTGLILFHGVPREIQLIVGVGFCGGYTTFSTASFETVRLIQRQKYAAGIANAVGT
FT                   LTVTVIAGGAGLALASV"
FT   CDS_pept        complement(24521..25015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00290"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48276"
FT                   /db_xref="GOA:C1AS27"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS27"
FT                   /protein_id="BAH48276.1"
FT                   /translation="MDGRRDPNPTLPVDPDTAPRTPGPLHVRPAAIAAVGAGGLIGAPL
FT                   RYQFGVWFPQAAGGWPVTTFAINIVGAFLLGLLLEALTRLGPDDRWRQRVRLGVGTGVL
FT                   GSFTTYSTLAVDTDLLLRSHQWWEAGSYAAGTVLVGLVATTAGIAVGAQLRSRRTEAER
FT                   W"
FT   CDS_pept        complement(25363..26238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48277"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS28"
FT                   /protein_id="BAH48277.1"
FT                   /translation="MTLHRHIPRFLCTPKRVALAGDWHANTDYAVEAIAHARRRNADVV
FT                   IHLGDFGFNFKPDYLNALDRALAQHHLVLGFVDGNHENFDWLLAQPVAADGLRYLRQRI
FT                   VHLPRGLRWRWGNTRCLAVGGAHSIDTFLRTPQVTWWPQEEITAEQARSITDGGQGVDA
FT                   MFCHDCPAGIAVPGMERDRYGFPAEAVAASEHHRQVLRGIVDGVQPIRLWHGHFHHRYQ
FT                   AVLDGDGYRAVIDGLGRDKDPIDNNMVVVNLAALGNHQAASRDGQIRPEHAILYPEEEG
FT                   EPPTLSAVPG"
FT   CDS_pept        26585..27451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00310"
FT                   /product="putative site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48278"
FT                   /db_xref="GOA:C1AS29"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS29"
FT                   /protein_id="BAH48278.1"
FT                   /translation="MAAENIHIDHAGGAKASRPQLDLVLQRLRGDDVLVITRLDRLGRS
FT                   MLHLITLGADLRERGIGLKVLEQGIDTATAEGRAMFGTLSVLAEFQRELIVANTRDGLA
FT                   AARARGRKGGRPSKLSPDQIELAQRLYDAGDHTVVQIADMLKVPRTTVYGHLDKKARRP
FT                   PHAAPSEPTPPVRSSRICPTCGHEPTTRAEAAHQRADLAVTWLHPDPQHRGTLISRHHC
FT                   RHCEPGQPAFDIACSICGDGPILAGALAEEARHCDLTKPVERWLTAAGWTVAPGLSCPD
FT                   HASRGRR"
FT   CDS_pept        complement(27480..27632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48279"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS30"
FT                   /protein_id="BAH48279.1"
FT                   /translation="MMLHPQGVSKFKIKILSIDEDGHALIESLLASPGTYPFSVQTKFL
FT                   VPADS"
FT   CDS_pept        complement(27845..28666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48280"
FT                   /db_xref="GOA:C1AS31"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS31"
FT                   /protein_id="BAH48280.1"
FT                   /translation="MISAHDAHTTGTLGSGTVVALLLIAAVAAGYLVLAVRRRREARGW
FT                   SIWRSASFLTGIALLALAVTPTLSPYPVGDFRGHMHQHLLLGMYAPLGLVLGAPITLLL
FT                   RSIPPRHGRPIGRVLRSRPAHLLAHPVVALTLSVGGLAALYFTPLYTATTTDEALHLLV
FT                   HTHFLLAGYLFAWVIAGPDPAPHRPSVPVRLVVLGVAIAGHAVISQLMYAGLFVQIPVP
FT                   PDQRQGAGELMYYGGDVAELLLAVALLLTWRPDRHRPARPTDQISAPTAAT"
FT   CDS_pept        complement(28663..29208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48281"
FT                   /db_xref="GOA:C1AS32"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS32"
FT                   /protein_id="BAH48281.1"
FT                   /translation="MVAPQRETTAIPARGIGLPGIILGIGLGGFVDGILLHQLLQWHHM
FT                   LTSTDTDNVGIDTYPADTVHGLEINTVWDGLFHTFTWLAVLIGLGLLYSRVTHSHGRIW
FT                   ASRVLWGWVLVGWGLFNLVEGVIDHHLLGIHHVRGGDHQLWWDLGFLALGAVLVAGGWL
FT                   LQHSAAPAQPSADTTAPR"
FT   CDS_pept        complement(29291..30643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48282"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS33"
FT                   /protein_id="BAH48282.1"
FT                   /translation="MDVSIIETSSLGDRSYLISDGAVGVVVDPQRDIDRVLALARDRGV
FT                   RITHVLETHIHNDYVTGGLELSRTTGAEYVVPTGDDVGYQRRAVSDGDLIDAGPILLQV
FT                   LHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGKEHTEELTHAQYHSVR
FT                   RLADELPPDTEVYPTHGFGSFCAATPATGDSSTVGEQSKTNPALTRDEQSYVDELLAGL
FT                   ADYPAYYAHMGVLNTEGPPPVDLSLPKPVDPDELRRRIEDGEWVVDLRERTAFAAGHLG
FT                   GTLGFELSDSFVTYLGWLYTWGAPLTLIGDNEDQVADARRELVRIGIDDLDGAAVGEIH
FT                   TLVAGTALRSYRVADFAALSEALREKDITVLDVRQRNEYDDSHIDGAINIPLHELADRQ
FT                   STLPNREIWVHCASGYRASVAASMIDRPDRTTVLINDEFDNANDTDLTSTT"
FT   CDS_pept        complement(30731..31504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48283"
FT                   /db_xref="GOA:C1AS34"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS34"
FT                   /protein_id="BAH48283.1"
FT                   /translation="MTLTVALALGAIIGVLLGLLGGGGSILAVPALVFGLGLGLEEAIP
FT                   ISLIVIGVASLVGAIPKIREHQVNWRMAGVFAACGIPATFAGSAVGRLLPQPVVMIGFA
FT                   AVMIVAGIRMLMDRGDTGTACEVGDSGIDWRRCAPRSIPAAALVGFLTGLFGVGGGFLI
FT                   IPALVLMLGLEMPVAIGTSLVIIVANSAAGLISHLSGASIDWAITAAFAGTAIAGSLIA
FT                   SHFGTRVDTDRLQRWFAYLVFVVAAYVLVDTILLR"
FT   CDS_pept        complement(31545..31958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48284"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS35"
FT                   /protein_id="BAH48284.1"
FT                   /translation="MTLALSTTLHTSFADAVDRTRKALADQGFGVLTEIDMKATLKAKL
FT                   GEDMEDYLILGACNPPLAHRAVTVDRQIGLLLPCNVVVRADPNNPGAVLIDAMNPQVMV
FT                   QVADQPGLGGVADDATAALQAAIDSLGAGAAKD"
FT   CDS_pept        complement(32016..32264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48285"
FT                   /db_xref="GOA:C1AS36"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS36"
FT                   /protein_id="BAH48285.1"
FT                   /translation="MTDALHAPRWTIERVVPLLAGTVVLASLALTLVFSSGWLLLTGFV
FT                   GANLLLFGAVGWCPASLLLRRLGVPRRTASCPAPAGR"
FT   CDS_pept        complement(32301..32570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48286"
FT                   /db_xref="GOA:C1AS37"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS37"
FT                   /protein_id="BAH48286.1"
FT                   /translation="MVGDEDSIALVLNRLRRAHGQLAGVISMIEQGRDCKDVVTQLAAV
FT                   SRALDKAGFKIVATGLRECLTGEAPEGKEPMTEAELEKLFLALA"
FT   CDS_pept        complement(32665..34821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48287"
FT                   /db_xref="GOA:C1AS38"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS38"
FT                   /protein_id="BAH48287.1"
FT                   /translation="MTRSTALGGDAPPADTITAGGVLGRMGAAMAGHAKWVFGIWLILL
FT                   VVLGAAAPSVFSSLAGAGWQANGSESVQVRELAQQHFGGNSSAAVQVVVHSDTQTIDGP
FT                   QMQQTLGEVGAVFAGDPRFGAVIAPQPGMSISPDGHTGILIAGANASTDEMVKAVDDHK
FT                   AALTALTGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMVLAFGSLVAAG
FT                   LPLLLTLAGLVASAGGLVLLNEITPISVWAMNFAMMFALALGIDYALFIVARFRDALTN
FT                   GGGPRAAVAETMDTAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIMLAVFFVLVAS
FT                   MTLLPAVLGALGGRVNAGSLPYAKRQQHRSPRFAAWGELLHRHPWPFAIGSLLVLIALA
FT                   APVLGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIIGPAGEGTDAAAAAAA
FT                   TDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDGQMGTIVDALRAGLPDGAVVGGAPAEN
FT                   LDLQQALNDYLPLIVGIILILGFVLLLVALQAPLIAVLGTVVSLLSTAAAFGVAKLIFQ
FT                   DGHGASLLGFTPQGFLDGWGPVFFFAMIFAIAMDYTVFLLATAKEHYERSGDPKVAHVD
FT                   GLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAVLIRLVLLPVLLR
FT                   LTGHAAWWSPAWLRKVLPNISFSH"
FT   CDS_pept        complement(34898..35314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48288"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS39"
FT                   /protein_id="BAH48288.1"
FT                   /translation="MGLRGAVDTCARVYPLGYGGEVLGDTPSGMKELEMREVDLDEFAV
FT                   RWADGVPVVDVRERWEYVDGHVPGALLMPLGQLAARTAEIPAGEVVYVICASGNRSREG
FT                   ARIVEAAGRGAVSVAGGTSGWAAHGRPLDRGDGS"
FT   CDS_pept        complement(35316..36029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00420"
FT                   /product="putative sulfite oxidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48289"
FT                   /db_xref="GOA:C1AS40"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS40"
FT                   /protein_id="BAH48289.1"
FT                   /translation="MLDAAGAHTGDDLHVAFTAPDVSSLADPPQPYGSSIPAAKARSDE
FT                   VLLAWEMNSAPLPRVHGGPVRVVVPGYIGARSGKWVTGITVQPHPSDNYFQATAYRILP
FT                   PDADPDTAGPGDGISLSSVALNCDILEPDDGATVPAGPLTVRGYAFAGDDRGVARVDVS
FT                   LDGGRTWCQADLEPEQSPWSWRLWSLCATVAGPVTITARAWDTTGAMQPESAAALWNPK
FT                   GYANNSWARVHLHAN"
FT   CDS_pept        complement(35873..36397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00430"
FT                   /product="putative sulfite oxidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48290"
FT                   /db_xref="GOA:C1AS41"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS41"
FT                   /protein_id="BAH48290.1"
FT                   /translation="MWGKRDGFVVHDRAPFNAEPSRSALAEGAITAIDTFYSRNHGPVP
FT                   DIERREWRLVVTGLVGQDLTLTFDELTSRFIPRSVVATLQCAGNGGPVSPRSGKSPARI
FT                   RGVRVRPRPRSGGVFGCAMCWMRRAPIPVTTCMWRSPPRMSPLWPTRRSRTAARSRRRR
FT                   RGRMRCCWRGR"
FT   CDS_pept        complement(36522..37019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48291"
FT                   /db_xref="GOA:C1AS42"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS42"
FT                   /protein_id="BAH48291.1"
FT                   /translation="MSGAGNRLITPMLATPGEPPVEMDGWAAEMKYDGFRLLAGVGGAH
FT                   PVLWTRNLNVVTSSYPEVTEALTEAFGGHGRIVFDGEIVALTQGRPSFARLQKRANTLR
FT                   PTTTLRRQVPVTFLPFDVLYRTSELGHPRLVWLLLRDAHFRCASADSGLLDVDWRVPGV
FT                   NG"
FT   CDS_pept        complement(37305..37838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48292"
FT                   /db_xref="GOA:C1AS43"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS43"
FT                   /protein_id="BAH48292.1"
FT                   /translation="MTGTNEDTPMTRRPARRISVLQAITEGIPTSSRWGRVDVTPLQIA
FT                   QQQRSIRATLSIYPPGVTSRERTLMHLRKLGTTWVGLLGYLAVLVVAGIVLGVLGAAMA
FT                   IAVLIALWAGIALATSGVNKDTRCLRIYARPGSVGGEMARLEEIATELDALDTANLDPV
FT                   SYEAEWGRIYRQLA"
FT   CDS_pept        complement(38198..38449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48293"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS44"
FT                   /protein_id="BAH48293.1"
FT                   /translation="MNPADNPPPLASRLHRAEDLLPLAATTPAAESDTARRKKLMFAPG
FT                   LSHDALARRRTVRIDPTTKTPAGDTQIVHLSPSHAEPE"
FT   CDS_pept        39058..39471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00470"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48294"
FT                   /db_xref="GOA:C1AS45"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS45"
FT                   /protein_id="BAH48294.1"
FT                   /translation="MPDHFHHSPDRDWPHRASCRGTDTNLFFSPDGERGNVRARRERAA
FT                   KQICQDCPVLAQCRAHALTTTETYGIWGGMSETERTRHTRRTRVPARHRDATPAPAPQP
FT                   PPLYLLAHVTNACAAKPVPPVTAPPSEPANVSP"
FT   CDS_pept        39538..40362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00480"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48295"
FT                   /db_xref="GOA:C1AS46"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS46"
FT                   /protein_id="BAH48295.1"
FT                   /translation="MSGTIESSPHDGARVLVVILSAVAAVVGSIIGSGALVGTPISQVA
FT                   DGALAADATAVAPGGPAFSIWTLIYLGFLALAIWQALPAHRTDPRQRRAGWWLAAAMIL
FT                   NAAWIACVQFEQLWLSVLTILALLAVLVVVFHILTNTKPSSRAEAIVVDATAFVYLGWV
FT                   CVAVVANIAAALAAAEIDPFALGADTWAVLVLTAVALVAVVLAVAGHGRFTVTAAIVWG
FT                   LVWIAVARTTGDGFTSQPAAIAALTAAALAIAATAIARLPRARSGEASVTKP"
FT   CDS_pept        complement(41126..41503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS47"
FT                   /protein_id="BAH48296.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGEEVGWAA
FT                   SPLSDDEVYDASNYLFKEGYVTGMPVKDVGIPRPMLTLVGRRVAKTGNPLRSKANARDA
FT                   KPRRRPGTFAEASVTTAGTAK"
FT   CDS_pept        42310..42867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48297"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS48"
FT                   /protein_id="BAH48297.1"
FT                   /translation="MRVLNVMQRPVRVVRQSDSMRTAAVLLAEYGFAAVPVVDDHDRLV
FT                   GMLNSGDVLRAGTASSETVGEVMTAPAVAAPMYQYVADVSKMLLHQGLRSLPVVDIDGR
FT                   VVGILSRSDVVRLMLKPDETIAVGAQRRLDDYTGDGRWHVTVEEGCVTLAGPFADESER
FT                   RIAIALSKTVPGTRMVSIAAGE"
FT   CDS_pept        43113..43325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48298"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS49"
FT                   /protein_id="BAH48298.1"
FT                   /translation="MYRSRTPAAAIHRSFAHGGSMSTRQIKAHLEVMFAPETDHGTPPE
FT                   NAGSVFAHQLSEAEENTALPLADIA"
FT   CDS_pept        43480..44001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00520"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48299"
FT                   /db_xref="GOA:C1AS50"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS50"
FT                   /protein_id="BAH48299.1"
FT                   /translation="MTPTPITTTLDTEQQRIAGKALQGTVVDLIDLSLIAKQAHWNVIG
FT                   PHFLAIHPALDELATVARKFTDEAAERATAIGVSPDGRAATVAADAGTTGFAEGWTSDG
FT                   EVVETIAANLAAVIARLRASIESTEKADPVTQDLLIGITARLEQLHWRWQAQSTQPSAQ
FT                   RPRLGQVLVG"
FT   CDS_pept        44146..44832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48300"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS51"
FT                   /protein_id="BAH48300.1"
FT                   /translation="MIGCGRFQRLRQRVFENPIWHACASENRLLIGSVITRSPTQREPN
FT                   VIIVDFVVPGDMVARSTRRRSPTQSGPLDSRFLHQWLGRSREVTREVVLPLILDGIQYI
FT                   MRGGTAWWRLPVEFWSTGTVSAVFARKRPVHETRPETHRKGLRIWISTNPSALDGTPES
FT                   ARSGAACGTRSALSTVREAHAPVLLCLAEASDGANPPRSRSAWGVTGRWGDPSTPHRCT
FT                   HRHTNR"
FT   CDS_pept        complement(44768..45133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00540"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48301"
FT                   /db_xref="GOA:C1AS52"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS52"
FT                   /protein_id="BAH48301.1"
FT                   /translation="MNGWRAAAPNCRCSFSPDGERRGAPDRCEARARQICQVCPGLVRC
FT                   RDHALTSGESYGVWGGMTESDRRKHTNRSRRGERRPLGSFQERPVGAASGVRGATFTGS
FT                   YGGAYTGGASRGRPTAR"
FT   CDS_pept        45145..45558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48302"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS53"
FT                   /protein_id="BAH48302.1"
FT                   /translation="MTAAGNGSLKIGNGGFLSIDTVGVAARQHCGTGMLLLTATAIRRR
FT                   PRQDTDSCGGGADMVPAGHIEESIEAGVIATGALLGQDRRRGGQQLRVRRLRRMSSSGY
FT                   CGGVGRHEGPFATSARTAGQVRSARGRGLASHC"
FT   CDS_pept        46705..47097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48303"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS54"
FT                   /protein_id="BAH48303.1"
FT                   /translation="MFAIVARFSVLWIDEVGMASVRDRTHPAARLHFKCAGTGSAGAPV
FT                   PDPPHRMIAHTHVLLTPLDRAPRTFDQPLTWNAVPPAAVGGTAPRGLDGGGATDSAGEN
FT                   KQEQGDIEVHGTGPSRGAECCCRCGS"
FT   CDS_pept        complement(47795..48211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48304"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS55"
FT                   /protein_id="BAH48304.1"
FT                   /translation="MSAATDRQWAVRDAVLRWLLAKTTEGYRSPILDADAIGAEVGWVA
FT                   SPLTRDEVVDASMFLFKENYVTGVPVMGIGIPRPMLTVAGRRVAKAGKPLRYKVDAHEA
FT                   KVRRHLGGTAGRDIRDDDGGSEVKERMARPVTRR"
FT   CDS_pept        49076..50764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48305"
FT                   /db_xref="GOA:C1AS56"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS56"
FT                   /protein_id="BAH48305.1"
FT                   /translation="MCRELMEQKMNRPGLVTRRPAPASLSSKRGRAMLRVILLPLDIVE
FT                   SADPVPVPAVDEVEPFLPARISAPTATGDDGPQAQLLAFRHIVDRRSPPVTFGLALDGQ
FT                   RAPDGRRRPYVGPPATCLSLWEVPGNGLVLACEELTPDRAGSLIDRHHDPLRGGGSPEF
FT                   WAAIEAFLRPFGLTPDASPMDVFPRLNTRLPSSAVYRPLRSLTIHGPHRTDSDTLEGLI
FT                   IEVHTDGVDTVRRLVDEPGTSPCGGAASRSYRGLLRWHRVPLIDRASRLGSGIAIREDA
FT                   RALAVDVGAPVIGRQYVDRGTREMLYCLIGWVALRAQHSADHRRVLSLLRNRRQLSEGG
FT                   ALAGLGDIAAARTRMIETRLLQAHPADDHRLPPRIESTHLRSTLVHRTADEIAFLHTEL
FT                   GKLCDSAESSLLPHAVASARERRSTLVSVAAAGALFVTSLHAAVAASPVDLQRWGFTVA
FT                   VAAAIGAVALLEVVSRRRPSRTPLKPTPVAPPHASPVVTPVRDLERRRLESIFPFETQV
FT                   WRTVPSRRGMTPTFRECLEANDLSVGEPSNSLLVMASPTFRPAPK"
FT   CDS_pept        50864..51622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00590"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48306"
FT                   /db_xref="GOA:C1AS57"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS57"
FT                   /protein_id="BAH48306.1"
FT                   /translation="MLVTSYPSWWQMLAVLSVAVVLSTAVGMERQLRQKSAGMRTHTLV
FT                   GLGAALFMIVSKYGFSDVLTEGLVTLDPSRVAGQIVSGIGFIGAGLVFVRRNKVRGLTT
FT                   AASIWLTAAIGTASGAGLILPAMFVTGCHFVIAFAYPVVVRYSRLGKSSQHLLRVRYAD
FT                   GTGALRRIISACTEHGLAVQGFATRHPDADAGAGGVLTRLRDNLDTAMPLASGVEVELE
FT                   LYGTTNLSELMTQLSVLDHVDGVHCDDPLE"
FT   CDS_pept        51675..51905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48307"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS58"
FT                   /protein_id="BAH48307.1"
FT                   /translation="MTGNTENVNRMMTFALHWFPHRGGPAAEIVAVLGMDTGEFFRCLN
FT                   AQLHPNPPTPLRPEIVQKMKAVARRRLWLAG"
FT   CDS_pept        complement(52161..52730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00610"
FT                   /product="putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48308"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS59"
FT                   /protein_id="BAH48308.1"
FT                   /translation="MSAPFDITDTIIGSGARAGSGIRDDAHRLLRECRAKAALVTELSL
FT                   DGPLSAKTYAGVNLPAARRRRHPAASEPPWGRDEVEALPSGSALLVVTRGPNRGEWFLL
FT                   DQPVTTIGRHIDSDIYLDDTTVGRRHAQIRCDNDTFRVTDVGSLNGTYRNRAPVDTALL
FT                   ADGDEIKIGKFRLAFLITPPSAATDQ"
FT   CDS_pept        52957..53649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00620"
FT                   /product="putative SufR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS60"
FT                   /protein_id="BAH48309.1"
FT                   /translation="MSEQTLTDPTPATALGETRNRVLELLCVAAEPMGVQDIAERVDLH
FT                   PNTARFHLDGLVDTGLAERRAEDRRRPGRPRMVYAATTSDASTGRRSYRLLAEMLTGLI
FT                   GDTLPEPGQAAETAGEAWGRYLAERPAPSQRVDAADGVRRLSTVLAESGFAPGVVDDLT
FT                   RPVIPLRHCPFREVAERHRDVVCSLHLGLIRGALAEVRAPLAADRLEPFVEPSLCLAYL
FT                   TPTPDEPS"
FT   CDS_pept        53730..54014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48310"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS61"
FT                   /protein_id="BAH48310.1"
FT                   /translation="MPVFVVEYTYSPETSSGRDDHRTDHHAWLAELVRRKVVLSSDPLA
FT                   DHTGVQFIVDAADEDTVTRLFTHDPFAQANLVSKVLISKWHPVIGEIHD"
FT   CDS_pept        complement(54271..54684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48311"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS62"
FT                   /protein_id="BAH48311.1"
FT                   /translation="MCAAKVASSVMQVAELDRSVKYYCDVFGCRVAVREPDAALLLTPD
FT                   NFQIYMYAKKGASTRRGVSVIGVHYVMWAADTEDELERITERLHAYDATTYTQTVGGVT
FT                   FVDGCDPDGIRVIVAYPGPEQLPRELIAQRFRG"
FT   CDS_pept        55023..55382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00650"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48312"
FT                   /db_xref="GOA:C1AS63"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS63"
FT                   /protein_id="BAH48312.1"
FT                   /translation="MPESLYQPTTTEISERRKALAPGIHDAFENFSRAVFADGALPEKT
FT                   KQLIAVAVAHVTQCPYCITGHTKLARRKGAEPEEIMEAIWVAAEMRAGGAFAHSTLALN
FT                   AMNHSGHTSTGEPEP"
FT   CDS_pept        55379..58177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acn"
FT                   /locus_tag="ROP_00660"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="protein synonym:aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48313"
FT                   /db_xref="GOA:C1AS64"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS64"
FT                   /protein_id="BAH48313.1"
FT                   /translation="MSGNSFGARSTLTVADQTYGIYRLDAIETDVQLPYSMKVLLENLL
FT                   RNEDGRLVTAGQVSALASWSPRNPGHTEIQFTPARVLMQDFTGVPCVVDLVAMRDAMTA
FT                   LGGDPRKINPLIPTELVIDHSVIADVFGRPDAYRVNADLEFSRNKERYQLLRWAQQAFD
FT                   DFLVVPPDTGICHQVNLEYLARVVFTQETPDGPLAYPDTLVGTDSHTPMINGLGVLGWG
FT                   VGGIEAEAAMLGQPMSMLLPQVLGLKLTGALPEGTTATDLVLTIAELLRKTGVVGKFVE
FT                   FYGPGVANVPLANRATLGNMSPEYGSTCAIFPIDDETLNYLRLTGRPEQQVRLVEAYAK
FT                   EQGMWHDPDQEPAYSHTVELDLATVEPSIAGPKRPQDRIPLASAPHAVGSLLAGQPLPT
FT                   ALDAGLDEASGESFPASDPIAVDHDRASDGPAAPCRCGKSHVWPSDPVEVVLDGEVHSV
FT                   DHGHVVIAAITSCTNTSNPSVMIGAGLLAKKAVQAGLTRKPWVKTSLAPGSRVVTDYYD
FT                   RAGLTPYLERLGFGLVGYGCTTCIGNSGPLISQVSDAVTGHDLTACAVLSGNRNFEGRI
FT                   HAECKMNFLTSPPLVITYALAGTMLADVLHDPIGTGSDGRPVYLRDIWPSTEEVKAVID
FT                   ECLQSQMFTDGYSNVFAGDDNWRGLDVASGEIFEWHEDSTYVRRPPYFDGIQPEPQPIS
FT                   DITGARVLVMLGDSVTTDHISPAGTIRRGSPAGIYLREHGVEPPDFNSYGSRRGNHEVM
FT                   IRGTFANIRLRNLLAPGTEGGVTRHLPDGQEMSIFHAANAYAAEGTALIILAGAEYGSG
FT                   SSRDWAAKGTLLLGVKAVLATSFERIHRSNLIGMGVLPLQFPPGHTRESLGLTGEEEYS
FT                   ITGLEGGDPGADFPTEVTVRAHHHGQVQEFRATVRIDTPAEAGYFRHGGILQYVLRQLL
FT                   VT"
FT   CDS_pept        complement(58342..59136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="ROP_00670"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48314"
FT                   /db_xref="GOA:C1AS65"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS65"
FT                   /protein_id="BAH48314.1"
FT                   /translation="MSVPMNSEGPGSVALPPVPEGAVMVTLKIRRFSPEDPGKAGWASF
FT                   EVPCLPTDRLLNLLTYVKGYLDGTLTFRRSCAHGVCGSDAMVINGVNRLACKVLMRDIL
FT                   HKDGKNTTVTIAPLKGLPVEKDLVVDMEPFFSAYRQIKPFLMTSGQEPTRERIQSQADR
FT                   ARYDDTTKCILCACCTESCPVYWADGSYFGPAAIVNAHRFIFDSRDEGAGERMDILNGI
FT                   DGVWRCRTTFNCTDACPRGIKVTQAITEVKRTLLFNRKAVVR"
FT   CDS_pept        complement(59204..59482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48315"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS66"
FT                   /protein_id="BAH48315.1"
FT                   /translation="MTVPTTNDKPAVHCGGEDRGHRAGNRVVVAAGAFAGHATMSIGML
FT                   VHELSVLVAIVNPMRLFVGGVSAPHITRRPRRARGSEPGFPIRRSNR"
FT   CDS_pept        59502..59858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48316"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS67"
FT                   /protein_id="BAH48316.1"
FT                   /translation="MGPIELVRAYDARGTKKTSPTFLVDRLWPRGIAKADLDCDAWIKE
FT                   VAPSTELRTWFGHQADRFPEFRTRYLQELDTNRTAAQPIVEAARNGTVVLLYSAKDLEH
FT                   NQAVVLREWISNQF"
FT   CDS_pept        complement(60197..61093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00700"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48317"
FT                   /db_xref="GOA:C1AS68"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS68"
FT                   /protein_id="BAH48317.1"
FT                   /translation="MILYAVAVIVGLGLLGLSSSIRVVTQFERGVVFRFGRVQPAVRGP
FT                   GLMLLIPIADRLEKVNMQIITMPVPAQDGITRDNVTVRVDAVVYFNVADPVRVAVDVQD
FT                   YVSAIGQVAQTSLRSIIGKSELDDLLSNREGLNQGLELMIDSPALGWGVQIDRVEIKDV
FT                   VLPDSMKRSMSRQAEAERERRARIITADGELQASAKLAQAAETMTEHPAALQLRLLQTV
FT                   VEVAAEKNSTLVLPFPVELLRFLERATPHTAHAPTRTAEPTTTTTPANVNDEPSTRHTQ
FT                   HTPVDARGFALEQSRFG"
FT   CDS_pept        62973..63413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00710"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48318"
FT                   /db_xref="GOA:C1AS69"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS69"
FT                   /protein_id="BAH48318.1"
FT                   /translation="MTADEHVESEPLTKRDFEALARFRFGIRRYLRFSEDTVRDHGLTP
FT                   QHYQLLLALKGFPGREWATMRELADRLQLRHHSVVELVDRAQKHGLVERAPHPSDARAV
FT                   RVELTEHGQLILARLSAMHRDELLRLGPTLELPIWDDPPQDP"
FT   CDS_pept        complement(63621..65201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48319"
FT                   /db_xref="GOA:C1AS70"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS70"
FT                   /protein_id="BAH48319.1"
FT                   /translation="MIRWLVIAGAWVLGVASLLLIFLVSSWWLLVTVIAAAIAMVGTWD
FT                   LLQRRHSVLRNYPVIGHARFLLERIRPEIQQYFIERSTDGTPFDRDTRTTVYERAKGTK
FT                   DVEPFGTERDVTATGYEFVTHSLRAHTASDDTPHVRIGGPQCTMGYDIALYNVSAMSFG
FT                   SLSGNAIEALNGGAARGGFAHDTGEGGISPYHLAHGGDLIWEIGSGYFGCRDPDGHFDP
FT                   GEFAAKAALPQVKCISIKLSQGAKPGLGGVLPAAKVSPEIARTRGVPVGQTVISPPSHS
FT                   AFCTPLELIDFITTLRALSGGKPIGFKLCVGSRTEFLAICKAMLETGITPDFIIVDGSE
FT                   GGTGAAPLEFEDHVGMPLTEGLMLVHNALVGTGLRDRIKIGASGKVANGIDIIKRLIQG
FT                   ADFTLAARAMMFAVGCIQAQRCHTNRCPVGVTTQDARRARALHVPDKTTRVYNLQRSTV
FT                   ASAQQILASMGLDDFCDLDPSMLNRRIQGHRTMTYADLHEWLQPGDLLTEDPPTSWLRD
FT                   WTNADSSRF"
FT   CDS_pept        complement(65274..65429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48320"
FT                   /db_xref="GOA:C1AS71"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS71"
FT                   /protein_id="BAH48320.1"
FT                   /translation="MVRGDTHAPAAGTDANTRDTAPVSVVVVSTALLELVRTSWIHRRR
FT                   LRFGRT"
FT   CDS_pept        complement(65416..66672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00740"
FT                   /product="ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48321"
FT                   /db_xref="GOA:C1AS72"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS72"
FT                   /protein_id="BAH48321.1"
FT                   /translation="MATAEQTFVIVGAGLAGAKAAEALRTGGFDGRIVLIGDETDRPYD
FT                   RPPLSKSYLQGTTERQKIYIHPAGWYTEHDIELRVGTPVTALDTAEHEVVIDGVERLGY
FT                   DKVLLTTGSSPRRLQVPGADLGGVHYLRRVTDCETLKAAFAAADRVAIVGAGWIGLETA
FT                   AAARAAGCDVTVVGRSKLPLLAVLGAEVAETYAALHRDHGVELRLNSGVREIAGKDNQA
FT                   TGIRLTDGTVIEADTIVVGVGIVPNTALAETAGLAVDNGIVVDEHLATTDPDVYAAGDV
FT                   ANTYYPLLGTHLRLEHWSAALNQGPVAAANMSGRVTAYDQVPYFFSDQYDSGMEYSGYA
FT                   PHGSYDSVVFRGDVAAGEFIAFWMRDGRVLAGMNVNTWGVTDAIEALVRSGERVDPAKL
FT                   ADPDELLRYLADPVPGGAR"
FT   CDS_pept        complement(66810..67955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="ROP_00750"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48322"
FT                   /db_xref="GOA:C1AS73"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS73"
FT                   /protein_id="BAH48322.1"
FT                   /translation="MMTRFPPAPVGATVSRLHRLYREQGQSPWLDNLTRPYLRDGTLAE
FT                   FVAAGIRGVTANPTIFARAIAGSDAYDAQFAALIAQGRAVEDAYWELAAADVVDAAAVL
FT                   RPVYDTSGGTDGFVSIEVAPELARDTDATIAAAGRLHERIARPNVFVKIPATAEGIPAI
FT                   ADMIGKGVSINITLIFSLARYEQVIEAYLQGLEARAARGADLAAVRSVASFFVSRVDTE
FT                   VDKRLEHSGDPEAPALRGRAAIAQARLAYRIFQDRFTGTRWETLAARGARVQRPLWAST
FT                   STKNPDYPDTRYVDSLIGPDTVNTLPEATITAFEDHGTLTRSIDTVPAGAAAVLDELAA
FT                   AGIDMDDVGRTLEDQGVAAFHQSFADLLTELRAKAHQLAQR"
FT   CDS_pept        complement(68027..68752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00760"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48323"
FT                   /db_xref="GOA:C1AS74"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS74"
FT                   /protein_id="BAH48323.1"
FT                   /translation="MGQGGPHRSKPYLCKGLHPMGVYRILWWVVTVPLGLVGFAVAIFT
FT                   VHPDVLVSAAFAAAVTGGGLPAMVADRSAATPRSWLPAAALHAATAGAALICVVGLIAL
FT                   SGAAAVPLVLVLTVTAGPVARRLRRWPPLAQLLSPQPAALSDPDEASAPGSLPTPPSCA
FT                   ELSDDALCRGWRTSFAELQNATSVTDRLQLARIRRQYLDEIERRDPQGFAAWFTSGARA
FT                   GSDPSKFLAPREQPPTDRQ"
FT   CDS_pept        complement(68973..69686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48324"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS75"
FT                   /protein_id="BAH48324.1"
FT                   /translation="MSTPRSAAPAVLAALSNLDDPLRRRLYDYVTESGAPVSREQAAAA
FT                   VDVGRTLAAYHLDKLADADLVTVSYQRPAGRGGPGAGRPAKLYTRATTEMTVSVPPRDY
FT                   ELLARLLVTSVEQDTSGTVRAAVNEAALDAGKRAAADTGGDLLAALRGCGYLPQVGDDG
FT                   RIDLRNCPFHHVARDHLDVVCGLNLRLVQGVIAGSAGHDAHAELDPRPDRCCVVVHHAA
FT                   SAHAHSPPPPGPARP"
FT   CDS_pept        69778..70260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48325"
FT                   /db_xref="GOA:C1AS76"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS76"
FT                   /protein_id="BAH48325.1"
FT                   /translation="MTTPTPDSSATAPTPGTALQRARSDPAYGAFLLLRIGFTVLPIVM
FT                   GIDKFTNVLTTWEDYLAPWIVDLSPFSAHQTMLVVGVIEIVVGIAVAIKPRYAAYIVAA
FT                   WLAGIVINLLSYPGFYDVALRDFGLMLAALTLGRLAYVYDPAWHRRTALAPKLSAA"
FT   CDS_pept        70390..70986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="ROP_00790"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48326"
FT                   /db_xref="GOA:C1AS77"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS77"
FT                   /protein_id="BAH48326.1"
FT                   /translation="MPSTATLHVLHQAPGRDLAAAEEAAAAFLDALGIDLDSESLRETP
FT                   RRMAHGYAELFTPRAFDLTTFPNDEDYDELVLVRNVPLRSVCEHHLLPFAGTVHIGYLP
FT                   GDRIIGLSKLARVAEHFACRPQVQERLTKQIAGWLDEHLHPRGVGVVIEAEHSCMTLRG
FT                   VQSVGSATVTSALLGALRDDPRSRQEFFALAGVHA"
FT   CDS_pept        complement(71131..71700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48327"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS78"
FT                   /protein_id="BAH48327.1"
FT                   /translation="MWSPVGGGGEAMLLSVGHGRLGREELTTLLNRAGVDAVVDIRRYP
FT                   GSRRNRDVGSEMMTHWLPDAGIGYRWESRLGGRRRLSPGEPREDPWWQVDQFAAYAAHT
FT                   RTTEFAVALTELLDRAARQRTAMMCSESVWWRCHRRLVADVAVLRRGVSVEHLMHDGRR
FT                   TPHLPAEGARVRADGQVVWDRHRARS"
FT   CDS_pept        complement(71746..72435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00810"
FT                   /product="putative SufR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48328"
FT                   /db_xref="GOA:C1AS79"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS79"
FT                   /protein_id="BAH48328.1"
FT                   /translation="MAIQKGTGAERAGTHAVLASRRRVQLLDALRASPTPMAIGELAAL
FT                   CELHVTTVRFHLDALTSAGLVSAEPERNPARGRPRRLYRALAPLEPGHADSGYQRLARV
FT                   LAAHWASSEDDPVARAEAAGRAWARDDLTETPGSPRSIEDAASTLTTLFAEMGFDPELE
FT                   ASEDEMRIRLHACPFESVARQSPNVVCALHLGLMRGVLDRLGAPESDNRLIPWETPRTC
FT                   VAHLARR"
FT   CDS_pept        72497..72883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00820"
FT                   /product="7Fe ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48329"
FT                   /db_xref="GOA:C1AS80"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS80"
FT                   /protein_id="BAH48329.1"
FT                   /translation="MTYVIAEPCIDVLDRACVEECPVDCIYEGGRSLYIHPDECIDCGA
FT                   CEPVCPVEAIFYEDDLPARWVAFTDDNARFFHSPLPGASAALGMPGGAGKLGPLAADTE
FT                   LVSGYPPSGPAATGGASPCGGGAS"
FT   CDS_pept        72880..74625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="ROP_00830"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48330"
FT                   /db_xref="GOA:C1AS81"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS81"
FT                   /protein_id="BAH48330.1"
FT                   /translation="MTPLTVEVVPVRPFPARRGIKGSFLYKAATTTDPKMLGLMYMVTS
FT                   FVFFMVGGLMALLIRTELAVPGLQFLSNEQYNQLFTMHGTIMLLLYATPIVFGFANYIL
FT                   PLQIGAPDVAFPRLNALSYWLYLFGAIITVSGFLTPGGAADFGWTGYSPLTSAVHSPGV
FT                   GADVWITGLALAGVGTILGGVNMITTVICLRAPGMTMFRMPIFTWNIFITMILVLIAFP
FT                   ILAAALLGLLVDRHLGAHLFDPATGGALLWQHLFWFFGHPEVYIVAIPFFGIVSEIFPV
FT                   FSRKPLFGYTGLVYATIAIAALSTAVWAHHMFATGAVLLPFFSLMSFFIAVPTGVKFFN
FT                   WIGTMWKGQLTFETPMLFSIGFLVTFLFGGLSGVLLASPPLDFHVTDSYFLVAHFHYVL
FT                   FGTIVFATYAGIYFWFPKMTGRLMDERLGRWHFWTTFIGFHTTFLVQHWLGAEGMPRRY
FT                   ADYLPSDGFTTLNTVSTIGSFVLGGSVLPFVWNVFKSYRYGQVVTVDDPWGYGNSLEWA
FT                   TSCPPPRHNFTELPRIRSERPAFELHYPHMVKRMRAETYVGRRPKSVAVTAGTVSGPER
FT                   EAGRR"
FT   CDS_pept        74622..74816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48331"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS82"
FT                   /protein_id="BAH48331.1"
FT                   /translation="MSDTVDRSYSFLRCRVADAADKHARSSSSAATSPTTRAPLHPSTG
FT                   DRPANPNPNPNRPREVDGP"
FT   CDS_pept        74833..75279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00850"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48332"
FT                   /db_xref="GOA:C1AS83"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS83"
FT                   /protein_id="BAH48332.1"
FT                   /translation="MTEVARYTQLILPVFWLGMVVAISFLEAPIKFRAPGVTLAIGLGI
FT                   GRKVFLALNAVELVLALALLASCVAAPPGATALTVLALVTVVLVVQIAVVRPPLSKRSD
FT                   RILAGEHLPRSRIHLVYIGLEVAKVALLIALIFQLFRAVASCLH"
FT   CDS_pept        75267..75932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48333"
FT                   /db_xref="GOA:C1AS84"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS84"
FT                   /protein_id="BAH48333.1"
FT                   /translation="MPSLTPGEPTRTDLATRTDIEDVLRRFYGRVLVDDLLAVPFAEIR
FT                   ESGLESRLPIMCDFWETVLFGARLYQGSAGRVHRSVHTRHRFEAWHFLRWLTLWSTTVG
FT                   QMFHGPSAAHATVHATRIARAMHRNLTGTDSAELDALTTREPHRVRDDHPSDRSPGGDL
FT                   DDGTASHRRVHGEATDLPEDHHTPRRTDQTVAADKPPGVASVDSDGPRRRIRKEVLQP"
FT   CDS_pept        75929..76240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48334"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS85"
FT                   /protein_id="BAH48334.1"
FT                   /translation="MNEKTWSVNIVIDEHKSAETGAQTRARARLRTSGRAAFVGTGLAR
FT                   RNPHHTDVPEVSDDMAAARALADLSHQLYEAAAQREAVTRSALTSARAADFGRRRSSA"
FT   CDS_pept        76333..76743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48335"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS86"
FT                   /protein_id="BAH48335.1"
FT                   /translation="MSEHLFHIALADDWEGAARFGEYEASTRAHTLDQIGFIHAATAEQ
FT                   LEHVLATVYGDVNLPLAVIVIDQDALRDAGVDVRWDERAGPSDTPGRWVPRIMGAVPLD
FT                   PDIVVATIPLEKHGENWTVPDLSGYSVDEAAS"
FT   CDS_pept        complement(77092..77880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48336"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS87"
FT                   /protein_id="BAH48336.1"
FT                   /translation="MKGDEVDEASDARGPRRNFLPRNRQRERVLRMVREHEGAVDAVEL
FT                   ASQIGVHVTTVRFHLDALCDDGAITRTRMNRPGAGRPRTGYLAIEERVDYRTLADVLAM
FT                   ELGQTVQTRARRAEHAGHEWATRMAASRSAGTGDGGHTPESDAGDALDHAAARTTNAFA
FT                   RMGFGPELVSAPDPSTPPSADSGGPAGERERIIRLHACPVRDLARSHPEVVCGVHRGLL
FT                   QGLLNTSTTEGNRKPHQPALSAHLEPFVEPELCVARLVAG"
FT   CDS_pept        77945..78847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48337"
FT                   /db_xref="GOA:C1AS88"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS88"
FT                   /protein_id="BAH48337.1"
FT                   /translation="MTVDTICDPDIPMTTQVELFGPEFTQFVLPYQCAISTMTTKVHIL
FT                   RKGFTHLDRHCPIEHVSARVKSPDSIMAKAQRLRCPLTVSHIRQNIRDIAGVRITCGLI
FT                   SDTYRVADLIGGQPDVTVLEVEDYIAKPKSNGYKSLHMAIEIPVFLSDRVVQVPVELQI
FT                   RTIAMDFWASLEHKIYYKYKRSVPRRLLQELTEAADVAHRLDRKMERLHNEVAGLKSVV
FT                   DSDGPLSLEATDHDHGDRSQNRCGKPHNSTAGPLVRNPPAGGVDVCRNTTHLTDAVLQG
FT                   NTRVGPSTAPTACRRNPNP"
FT   CDS_pept        78917..79477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS89"
FT                   /protein_id="BAH48338.1"
FT                   /translation="MDASKATPSTSRGLRLRLKPVQSRGFVQGAWWPRSTHLTDELPAL
FT                   LTALSRRLGHIDRIIYDENGWAPAPSRIDHAGNTVDLRHSSDQSSNTLAITGEKFGRLV
FT                   LLVVPPYTDPVFAYATIMTAASPRDVSTADELLAIGAREAEDRRLALRAQHRWESEGGA
FT                   LHHRGDKSVRPRRTGDSDRVRHG"
FT   CDS_pept        80188..80616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48339"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS90"
FT                   /protein_id="BAH48339.1"
FT                   /translation="MGIVHGRSVLAAGLGITVELIDLLRYPAGVELRLALTAYGHAAQQ
FT                   ARYETRPLTDPGDPSPRWSFLRTHVRAGDLTGEADPYQAPILSTGTTRLIDFRTTPRYW
FT                   IDGIPAPVSLMVTVEWARIGLAATSSTIEIGPVPHPLP"
FT   CDS_pept        complement(80671..80919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48340"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS91"
FT                   /protein_id="BAH48340.1"
FT                   /translation="MVTGWCEQVTRAFRWRIEHDHRELKPVLGLDHYDEPSWLGGHHHA
FT                   ALVTAAHLFLATLRLTHPNSVRQNRPATPPAANVHAH"
FT   CDS_pept        complement(80933..81427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00940"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48341"
FT                   /db_xref="GOA:C1AS92"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS92"
FT                   /protein_id="BAH48341.1"
FT                   /translation="MRKRGGDDESVSTSPEDLRAFEVATRDLVGVALRSIEGGDVDVTL
FT                   PQLRLLMVLSEEGTVSSSQAARALDVAASTVTRLADRLLASGHLRRGADRSNRSVVTLE
FT                   STARGRAVVEQVNARRQGELRRILDQLDPTERSDCAATLRRIHECLDGTSTPPALSSLL
FT                   R"
FT   CDS_pept        81600..82241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00950"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48342"
FT                   /db_xref="GOA:C1AS93"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS93"
FT                   /protein_id="BAH48342.1"
FT                   /translation="MHTDSPHPTTPASAWRVLRQGNERFVNGTPLHPNQGIADRAALSD
FT                   GQHPTAMLFGCGDSRVAAEIIFDQGLGDVFVVRTAGHVLDDAVLGSIEYAVEIVNVPLI
FT                   IVLGHDGCGAVKATLDALDNGAVPDGFIRTVVERVAPSVMTGRREGLCTADELEVRHVV
FT                   ETGELLAQRSRIIAGRIEVGTCAIAGVTYKLSDGRIHLQGTVGDIGEPGD"
FT   CDS_pept        82395..82679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48343"
FT                   /db_xref="GOA:C1AS94"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS94"
FT                   /protein_id="BAH48343.1"
FT                   /translation="MSTALYFAGLSLIGIGGLGDGLIRGLNPSAHPGTHKVSMGLALAG
FT                   VLCWTVGAVVSDQPLWWKIVASVFVLTIGFLLTMRSRFLPSHQWCEPDE"
FT   CDS_pept        82693..82881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48344"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS95"
FT                   /protein_id="BAH48344.1"
FT                   /translation="MYRQYILVEPPVVQHVATANTDRVGLHVPRNPVVGGSYSLRGQSV
FT                   GVIGVTTGPATRTPATC"
FT   CDS_pept        83006..83371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00980"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48345"
FT                   /db_xref="GOA:C1AS96"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS96"
FT                   /protein_id="BAH48345.1"
FT                   /translation="MAANSRQPLYQMKADFFKTLGHPARIRVLELLSEREHAVSEMLPE
FT                   VGIEPANLSQQLSILRRAGLVTARREGLSVSYALTSPRIAELLRVARGILTGVVAGQAE
FT                   VLEDLPAPPALVGETAG"
FT   CDS_pept        complement(83202..83861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00990"
FT                   /product="putative monooxygenase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48346"
FT                   /db_xref="GOA:C1AS97"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS97"
FT                   /protein_id="BAH48346.1"
FT                   /translation="MSIPVDDADRYDVVIIGGGISGIGAAAYITREFPKKKVALLEARD
FT                   SVGGTWDLFRYPGIRSDSDLHTFAYEFKSWRHETAIAPTRSCWASGWRTRRAPRQRFPS
FT                   TRPRTRRAARWRDRRDCSSPPTSLSGSERRISAANDSNVCTLENSQLILVLSDSGWVGP
FT                   VSPRSRPPRREVREGPRAPRPARRPPPSKSRARRVAARRCGGTSARRTPTGPRGGR"
FT   CDS_pept        83492..83647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48347"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS98"
FT                   /protein_id="BAH48347.1"
FT                   /translation="MTNNHDDRASGPPDGSEVALTGIAVAVLAVSATRSPSTTGSARLQ
FT                   SRDANS"
FT   CDS_pept        84249..85691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01010"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48348"
FT                   /db_xref="GOA:C1AS99"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS99"
FT                   /protein_id="BAH48348.1"
FT                   /translation="MSATNPPSKSMGAGIADSSATAATADETSAEDTGRLSPTALVSLS
FT                   LASFFPAVSFAMVPFLVFTTSGTNAWQSSLLATIGVICIGRAVIAFARRYVASGSLYSY
FT                   VGEVFGPWARHLTAASLLAGFIVGVAALAAVVGVFVGSFLHARGIHGALNFDTQVIVFG
FT                   LALVLAAAVAIRGLDTSVMVAVTLAVIALPLVLIITVASAAHTGLDLGTQFSFTGFEVG
FT                   PVFQGIAVGAAFLVGFESCAALATETKDPKHSVPTAIMAVPVILGGLFPIVTILQVPGL
FT                   IATSDELAAGVSAPAALAQLSGLGHGVATATDLVLAAASFASLVGFLNYAARFTMTLSE
FT                   DGLLPSVFSRLHPKHKSPSAAVLLMTLCAFLTISGMLLWTGDIISAYTPNATLLVYMWV
FT                   VPYVIICVGAIRLSIRLREFRPGLWIAAVAGAATMTWAYTNGLVNPPPAPADSMIWVAP
FT                   VAIALLFGVVRINVSRTRHIAE"
FT   CDS_pept        85894..87123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01020"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48349"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA0"
FT                   /protein_id="BAH48349.1"
FT                   /translation="MTEALWPTPSESVRTLIRDIAESLIPRYHEVVDELVAASLADPRY
FT                   HEIAADPVLAEADARLSVANLKHWLTSNIADPGRRVPTHASQEIKIYARDVVLRELTTD
FT                   DVASWRATHRVTWHWWLNECFAATDDTDVLHELVEVSANSLTAFVDDSIAALADYIQAV
FT                   REELAGGPQLQRYATVELLLHGSNIEPSRAEAQLGYALTGSHVGAIIWADSEEDVGGLE
FT                   PAAEQIMRACGAVSRLTVVAGTAALWLWMPSRLVPEVSDVADRIKHIKGIRVAFGRMSA
FT                   SVAGFRRTHMDAAAAQRLLARLNSRLSIVRYEDVQLVDLMSADPALAAQYVLDVLGEFA
FT                   DADPVLHQTVLTCVQAGFNRSSAAERLYTHRNTIDRRLARIDELLPKPLASDPAGVVAA
FT                   LTLLNIRTGH"
FT   CDS_pept        complement(87242..88183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01030"
FT                   /product="putative flavin-containing amine oxidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48350"
FT                   /db_xref="GOA:C1ASA1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA1"
FT                   /protein_id="BAH48350.1"
FT                   /translation="MTFMSWVTRTTKTVFARTLWSIIGALTIGSQPGEMSLLYVLRHVR
FT                   ALGGMDSLFASLSGGNERSFTGGSARLAEMMAADLGDRLAVDCPISSVRYHDQSVEVTT
FT                   VEGEVLRARHVIIAMSPADRESIRFDPPLPAAHRTLGERMSMAHAYKVHVVYSSPFWRD
FT                   RGLNGSIMTDTGPLILTFDDTPPDSQEGVIVGFGRADGGPNCYLPDAMPSDPAERKRAV
FT                   LAGLARACGEQAMSPTEYHEFDWTQEPYTVGCIPVWPPGLVTAVGAGFTDPVGPLHWAG
FT                   SELSPRWAGTMEGAIVTGERAATEVVVRMCTG"
FT   CDS_pept        complement(88180..88635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01040"
FT                   /product="putative flavin-containing amine oxidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48351"
FT                   /db_xref="GOA:C1ASA2"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA2"
FT                   /protein_id="BAH48351.1"
FT                   /translation="MNTDTDFVDVIVIGGGLSGLTAARRLIQAGITSIRVLEAKDRVGG
FT                   RTRLRTLGGGRVVEDGGQLIGPEYHRLQALGEERGIETWPHYDAGKSIIERDGRVLEFS
FT                   GSMPWSSDPIGSADFAQSLLRLGRLVKSAPADDELGTLEAARLDSTR"
FT   CDS_pept        complement(88632..89075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48352"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA3"
FT                   /protein_id="BAH48352.1"
FT                   /translation="MTEKSESTEMLDRYCAVIRELCDAVAAHDTDHMLRYFDDSCVFVN
FT                   GVDGRHTAKDGLVEFFQQVWESFPDYAPVPVEMHLNGDVLAVIFRTTATVRVGESEQIV
FT                   SWLMTSFSTFDPETVTIVRDVYFADEEALEETIQRLHEAATVQ"
FT   CDS_pept        complement(89089..90495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01060"
FT                   /product="putative NCS1 family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48353"
FT                   /db_xref="GOA:C1ASA4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA4"
FT                   /protein_id="BAH48353.1"
FT                   /translation="MKAESHGIEFIPQSERYGHPRRLFSIWFSANMQVTTMVVGALGVV
FT                   AGLGLTWVVLGLVLGNLVGGIFMAGHSAQGPHLGIPQMIQSRAQFGVYGAGIPLAAVVV
FT                   AYVLFFAANAVMMRDAVERALPVGDNTALILFGTVTLVVAFFGYELIHRLGVVMAWASG
FT                   LLFAAVFVIVSLSDEPGAAIVESIPSTSFSLPIFLLVFTQALSWSLGFGPFVADYSRYL
FT                   PETVSSRATFMYSYAGQVLGASIVMVIGAVVTSAAVDVQASPAIGIAALFGPLGSVGLI
FT                   VLLLGVVMFNVLCLYSGFMSTVTIFSSMRGSNTIRPGTKLLIMSAIAAVGTVVAIATQH
FT                   DFYTFFGDILVAQVYFLVPWTAINLVDFYVVRKGKYRIRDVFDPDGTYGRFNVPTIAIF
FT                   VVSVLAQLPFMNLNVYHGPAARWIGADISCVVGLVVPVVLYLAMARIGRLDSRGPADDV
FT                   SAESSAVPSP"
FT   CDS_pept        complement(90492..91703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01070"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48354"
FT                   /db_xref="GOA:C1ASA5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA5"
FT                   /protein_id="BAH48354.1"
FT                   /translation="MGKTRVVIVGAGVVGLSAALQLSEAGNYDITVAETDHIGSGSSSR
FT                   SVGIVETQYIEHFDIEVRAYGHRFIRALAEQSDLQLHMNGYLRLADSDATLGQYELSVA
FT                   RQRECGVGDAQVLDVDDVKALIPFMEMSDRAGALLGASDFYLDGYLFANLMAARARDNG
FT                   VTVLQRARVLECEWTADGEAELRTERGTLHADLVVNAAGAWAGRVGEILGAPVTLYPEL
FT                   HHAVTVVSKTAAASRIPSVMDYVPGDGAEGVYLRPEGESEFFAGLHSEQASRSAVDLDD
FT                   VPLSAVDGDFVAALAESFSTRFPGLEDAQLGSGWSGLFPMSFDSRPLVGPHPANEQVIC
FT                   ALGSGGNGIQLSPAIGRTVVEYVRGERPSMAAPGSDWDPQRMPANPGDIAGIQQSTPTS
FT                   GVRE"
FT   CDS_pept        complement(91762..93309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01080"
FT                   /product="putative acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48355"
FT                   /db_xref="GOA:C1ASA6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA6"
FT                   /protein_id="BAH48355.1"
FT                   /translation="MYRTILSTLDDAVEREPDTPALVFEGRTYTNEQLKTAALVRLGAI
FT                   QAAGLLPSTPVLVMLDNTDEAVITWLALALGGYTEVPVNTAYIGETLAHLCRDSGAPTI
FT                   ITEGRFVERLSSTLLGDVTSILLVPTGTEAASGLGEESVLRDDPSSLGSIVVRDELDET
FT                   AVMYTSGTTGPSKGAVITERHAYTYASSVAETIDLKRGDVYYAPLPLFHIAGRWAVVYA
FT                   ALQRGACTVLVRRFSITSFWQDVRHHQVTATFLLGAMAQFVLSAPPRPDDDDNPLERVL
FT                   MVPLIEGVDDFRARFGVQVATCFGSTEANVPLASGWDAGIDDGVGRPRAGFRLRLVTAE
FT                   GEDAIQGERGELLVSTDEDGICLARYHHNPDATSRAVIDGWLHTGDIFVLDEQARYHFV
FT                   DRLKDALRKRGENISTFEVEREVRSHPGVAECAVVGVASEHTEEDVVAFVQLRSESGPV
FT                   TPQEIREHVLARAPKFLAPDHVILVSDFPTTPTGKIQKFELRETAHRMMAAPTAAAD"
FT   CDS_pept        complement(93353..93766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48356"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA7"
FT                   /protein_id="BAH48356.1"
FT                   /translation="MKAASTDHETNYGEGIVVENNPQPVVAIQQDRYTFDNGPMKLELR
FT                   SARTGIDQLAGGILRFDDGGAGEPWKLPYDEMLYVITGTLRLRFADQILSLAPGEVAAI
FT                   PRGAEVVYEGEPGTTAFYALTPADWHVEHPDGL"
FT   CDS_pept        complement(93767..94567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01100"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="protein synonym:5-keto-D-gluconate 5-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48357"
FT                   /db_xref="GOA:C1ASA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA8"
FT                   /protein_id="BAH48357.1"
FT                   /translation="MPISEALAPDETGPGIFDLTERRVIVTGASRGLGRQLARGLAAFG
FT                   ASVACVARDQAALDETVALIEAQGGKASAYVADLGDPDAVTSLIERVAIDMGGIDVLLN
FT                   NAGVDHDSPIEETSLETWEKVIEVNNRSVFLMIQAASPYLRASGGYGKVINIASILGTV
FT                   AMRDNSAYVMSKHAAIGLTKSIALEWGRRGVQVNALCPGFLVTDMTIHSVSDEASSKWI
FT                   TSRTPMGRWGQPSDYVGAAVFLASRASDFMTGQTLYIDGGWTAQ"
FT   CDS_pept        complement(94567..95397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01110"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48358"
FT                   /db_xref="GOA:C1ASA9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASA9"
FT                   /protein_id="BAH48358.1"
FT                   /translation="MDLAGTDSEGYTRVYGQGFTGGRSLDHLVGELEQHDVAGVMQAEW
FT                   EEDDPAKVNTRVAEAIATHPDHLVAGIATTDPRLPNALEILKHAHDEQGLRGWNFQPGF
FT                   LKVAANDPSVAPLLDYCQENGHPVTIHSGINFSETGPIKFGHPGALCEVACAYPDLTIV
FT                   ASHGGWPWVTEMLAVMWKHSNVYADFGAIAPKRMVGPRGGWEPIAHWMNTMVADQVLMA
FT                   TDWPMIRHERLLAELDYLELSDESRAKFTFLNAARLLDKHWGIKLTNNDQVGEL"
FT   CDS_pept        complement(95509..96621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01120"
FT                   /product="zinc-containing alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48359"
FT                   /db_xref="GOA:C1ASB0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB0"
FT                   /protein_id="BAH48359.1"
FT                   /translation="MKVKAAVFERVGEPIHVEELDLEDPKRGEVLVRLEAAGVCHSDYH
FT                   VVKGEWESAGPLVLGHEGAGVVEKIGPGVTSVSVGDHVVLSWVPYCGTCAYCMAGKPAL
FT                   CPKVEETAYQNVQYDGTSRLSRGDESVPSYLATGAFADRVIVHETGAVPIRKDAPLDRA
FT                   ALVGCAVATGVGAVLNTADVQPGDTVLVFGCGGVGLSVIMGAGLVSAGQIIAVDMSDKA
FT                   LELAKSLGATAIINPSRDDVATTVRGLVDERGVDWAFEAIGLKPTIEQAYELISPGGTV
FT                   VVVGQSADGVTIEIDPMVMSDREKSIIGCNYGSSRPAIDFPRLIDLYMQGKLDLDRLVG
FT                   HTSSINEVNEAFTRMGQGEGGRTVILYDHA"
FT   CDS_pept        complement(96675..98174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01130"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48360"
FT                   /db_xref="GOA:C1ASB1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB1"
FT                   /protein_id="BAH48360.1"
FT                   /translation="MLTSDTLTAARDRIKTMRVTHFIDGAFVESESGCDTTDIVNPADE
FT                   SVLATAPRGGREEVGRAVDAARRARRRWAKTTPGERAAVLLHIADVIDANVELLAAVES
FT                   LNVGKPLAAVMEEIPVASDCLRFMAGAVRTAQAPATAEYVSGHLSTIRREPVGVVGAVV
FT                   PWNYPLMMAAWKIAPILAAGNTLVLKPSELTPLSMVLLAELVSDVLPEGVLNVVLGPGR
FT                   VVGDALGRHPGIDMIALTGSTRAGQEVAAGASGTVKRLHLELGGKAPVVVFDDADLEAA
FT                   VEAVVAAGFVNAGQECGAATRVLVHRDVHDELVERLSRAAAALIMGDPADGSSIELGPM
FT                   VSGAQRARVAAMVERAIVAGAVAVAGGAVPECRGFFYPATVLTGIEAGSEMAREEVFGP
FT                   VVTVETFETESEAIAKANDVVYGLAGSVWTRDHGRALRVVDQLDFGSVWTNAHLIFSSE
FT                   MPWVGFSQSGYGRDNSTYALDDYTRTKHITMSMGMPADQAR"
FT   CDS_pept        98567..100549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01140"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48361"
FT                   /db_xref="GOA:C1ASB2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB2"
FT                   /protein_id="BAH48361.1"
FT                   /translation="MTASASADRIAEETEEFPLLFSPLRIGPIDLPNRIVNAPHQTGFA
FT                   RDKGYSPQLIEYHRERARGGAALIMSQANSVVPGYLDMHNVSDEIIPQYREAVRAVGEF
FT                   GAHYGVELYHPGSQGSYEGTGTDVYVGPSGVPSNYFHAGWRVPHALTEREILQIVDAFA
FT                   AAARRCSDAGVSVIEIHLGHGNLIEQFISPRTNRRTDEWGGPLENRLRFAEHVLNAVRN
FT                   AVGPNVAVGARMTATGLEPDDPGVMDSTEIIGTVGSWDLLDYVSLTMGRYSDALNTARN
FT                   IPNMTFPPGLWQRYGRAIKSVLEVPTFMVGRINHPRIAEEMIESHSCDAVAMVRALIAD
FT                   PYLPQKSKTGKVEQIRPCVGAMNCLHRLDQGRGIRCIHNPAVGHEGELSEDVGSSPKPG
FT                   TVLVVGAGPAGLEYARVAARRGHQVTVVEQSRIGGRALAVSKAPTRGELSSITEWLHEQ
FT                   CLELGVEFRIGTTASRESILDLSPDIVALATGSRLPENPFAGDSLPIIDAESVLSTPSF
FT                   TGRIAVFDSFGDWHGISLTHVLAARGAKVEYISPTPYPGSSLEMTNWRIEYANLVAAGV
FT                   EFHPVSEIVGVEPSAVRLRAGFSKTELRIEELDGLVWVAPPVAEDGLFHQLSDTNLRID
FT                   LIGDAYAPRGIEQSIFEARQAAAKI"
FT   CDS_pept        101378..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48362"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB3"
FT                   /protein_id="BAH48362.1"
FT                   /translation="MTNTENRVDTEACVERIESVCMAVVARDLEGVLDHFAEDCVFVNG
FT                   VTGTTVPGKAELVNFLNDIWASFPEYTPRPVAAHLEQTTLGMLFETTVELPATDEKASP
FT                   DGTKVRWLTSSFFTFDPTSMKIIRDVYYADEAAVEQMINEAGRAG"
FT   CDS_pept        complement(102807..102995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48363"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB4"
FT                   /protein_id="BAH48363.1"
FT                   /translation="MPPRRDSDETRFDSDEPAKKPETAGLFAGWAKADRFGIVVAKPLR
FT                   CPHSHSACRLGLPRSVR"
FT   CDS_pept        complement(103043..105289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01170"
FT                   /product="putative ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48364"
FT                   /db_xref="GOA:C1ASB5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB5"
FT                   /protein_id="BAH48364.1"
FT                   /translation="MRSGFTTRALEALDWAQAQSIPVATRPEHVLMALLDQDATIVEPV
FT                   FEALGVDADDLRRSSPSVTVRRGAAASAAAPGIDADMASLLRAAEHEARQLSDHLVSIE
FT                   HLLIALAGRRDGVGEALRAAGADRSSMLEAVRRVRGPAAVVDAEPERTYLGVRWRPPAV
FT                   SSQVLRYSRDLTELAFRAELDPVVGRDAEIERVIQVLSRRRKNNPVLIGDPGVGKTAIA
FT                   EGLAQRIVAGDVPAALLNRRVIALDVGALVAGATYRGEFEDRVKSLLKDVVGADGGIIV
FT                   FIDELHTIVGAGAAEGAVDAGNLLKPMLARGEFRTLGATTLDEYRKHVESDGALERRFQ
FT                   PVRVDEPSSANALEMLRGLRSRYESHHGVAITDAALSAAVSLSDRYIADRFLPDKAIDL
FT                   IDEACSRRRIQSDSLSSVTRGAGSCTPPLVDDDDIARLVGQWTGIPVSRLQEEELERLV
FT                   HMEHRLAERVVGQAKAVVGVSAALRNSRTGLSDPNRPIASLMFCGPLGVGKTYLARVLA
FT                   DVMLDSGEALVQLDMSDYAEKHSVTRLVGASPGYVGYEEGGQLTDAVRRRPYCVVLLDD
FT                   IEQAHPDVHGLLRQVIDDGSLTDGQGRVVSFRHVILVMTSSLPDLGAVNQHFRAEFLTR
FT                   LDDVLEFAPLRRKDLEQLVDIQVRSVAARLSDRGIALELTHEARALIAELGDDSRQGAR
FT                   PLVRVVQKELISAVSRSILLGDACPGDTIRVDQEGTSVTLTVLSRPAEAVPQLS"
FT   CDS_pept        complement(105364..106773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01180"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48365"
FT                   /db_xref="GOA:C1ASB6"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB6"
FT                   /protein_id="BAH48365.1"
FT                   /translation="MNAAKFDYDTVVIGGGFAGVSACRDLADQGYSVLLLEARHRLGGR
FT                   TWSEQRTVGDFEGVIELGGQWVWPDRQVNMMAEIERYGLNLTHSAMPERYPTFLAGKYN
FT                   EGPLPVPVEDVYDFEKAAFKFLTDAHRIQRGVPLDRQNLDDLDIPFSEYLDNLGVSDAT
FT                   RGFFTFFGTVFQGRNPEDISALLPLAFIAQMDHSLIGAWGILDAYIVEGTSALINAMAE
FT                   DSGADIRFETPVARVVQDEDGVTVTTQAGDAFTARTVVVATPVACWADIQFEPPLSEVK
FT                   FIVSSDGGVAKVCKVYAQVKNAPRLPYMIADAPAANGAAIISGAYDLDEDGQLMIGFFI
FT                   DDPDNVDRFGADFAGIERFVKTMCPEAELVAYECHEWVSDPWAGYGGYPAYKPGRLSKG
FT                   HSELTRPEGRLFFATADIANTFMVWMEGAVEMGKKAALDSQRRMERDALEIKVHARARA
FT                   SSDAASARNNA"
FT   CDS_pept        107239..107475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48366"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB7"
FT                   /protein_id="BAH48366.1"
FT                   /translation="MSSSPAEPDPGGHRASQPYLDHLLDPADATISTLRASRLLALANS
FT                   HDPHLIATTYGMSAEGVLAYFADRVDRTLLADL"
FT   CDS_pept        complement(107521..107991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48367"
FT                   /db_xref="GOA:C1ASB8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB8"
FT                   /protein_id="BAH48367.1"
FT                   /translation="MSRRESRSAILRSMKVGLDQSMRIDTWNALDDLRYDRSLLSDLVS
FT                   LRFAEAGHSVLVLGPVGVGKTHLATALGHVAIRRRMTVLCARADKLFALLRAARLDNSV
FT                   EAEMRRIATVDLLVRRFCVAAPGRHRDQRLLRVGHLAPSPQGDDRQLERGAF"
FT   CDS_pept        complement(108408..109019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01210"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48368"
FT                   /db_xref="GOA:C1ASB9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASB9"
FT                   /protein_id="BAH48368.1"
FT                   /translation="MGEPFRVGSARCSTDEQDVGIQTEQLLALAVPRERIFIDKGFSGT
FT                   TRKNRAGLDNALAAVTSAAAAVTGRQVVLTTTKFDRFARNMAEAGEILTGLREREVLFG
FT                   LGNSVYDWNDPFGKLFLQTLAMVAEANLNHLRTREGMAKARAKGRLKGKQPKLPLAARK
FT                   TIHRRYHDPDDDASLADLADEYSVGRSTIHRIVSGTTPRA"
FT   CDS_pept        complement(109178..111496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01220"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48369"
FT                   /db_xref="GOA:C1ASC0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC0"
FT                   /protein_id="BAH48369.1"
FT                   /translation="MPLLTLSRVGNLPSELSSFVGRRSEVSEVKHLLSAFRLVTLTGFG
FT                   GVGKTRLALRVATDVSRAFTDGVWLIELGEQQDDTRFTETVARALGIEMPSATMPLEAL
FT                   TEYLAPRQLLLVLDNCEHVVDGIAAPATTLLRKCPRLRILATSRETLAIAGEAALPLRP
FT                   LTFPDPNPSCSAQDLSSYEAVRLFTERARAAVPGFGVTEDNKAVIARICQRLDGLPLPI
FT                   ELAAAGLRVLSAQQILLRLSDRYRPPSITNRGTPARQQSLRRCIDWSHELCTAREREVW
FT                   RRVSVFTGGFELDGAEALCAGEFSPNELLEVLAALVNKSILIPEQTHGVIRYRMLETVR
FT                   DYGRDRLRESGEYSTFQRRHRDWFEQLTVRAHAEWLGPRQAEWTTRLDRELPNLRDAMT
FT                   YCLADPIHAPVGLHIANALRRFWISRGLLSEGRQWLRRALTSQVEQPTTSQVTALCTEG
FT                   MLAAMQGDVTDPVALVAKARHYAAGVADPGLEQLVTRTEAQLALSSGDAALAVTHFEKV
FT                   LDACRASEDLDTQLEVLLGLGVACGRCGDRARAMTCFEEILAITEPLGDTVHRAQALAA
FT                   LGSTISCTDPVQAAHLLTRGLQLSRSLNTPGTATSCLYTCAWIAATEHRTEHAAVLIGA
FT                   VEKLAESTEAHWLNGYTIDTGQESSLARVRLVLGERAFSKAVEHGRGLTLREAVAYALG
FT                   ENTAADDPSRSGPSKDLTPRERQVADLVAQGLTNRAIADKLVISQRTAQGHVEHVLAKL
FT                   GFGSRAQIAAWVAPNAGER"
FT   CDS_pept        complement(111984..112535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01230"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48370"
FT                   /db_xref="GOA:C1ASC1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC1"
FT                   /protein_id="BAH48370.1"
FT                   /translation="MQVTHFIDGAFVDPESGCDSTDIVNPADESVLATAPRGGPEEVGR
FT                   AVDAARRARRRWAKTTPGERAAVLLHMADVIDANVELFAAVESLNVGKPLAAVMEEIPV
FT                   ASDCLRFMAGAVRTAQAPATAEYVSGHLSTIRREPVGVVGAVVPWNYPLMMAAWKIAPI
FT                   LAAGNTLVLTNLGALWRSTR"
FT   CDS_pept        113319..113927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01240"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48371"
FT                   /db_xref="GOA:C1ASC2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC2"
FT                   /protein_id="BAH48371.1"
FT                   /translation="MARLPAGQRRKDFIAAAVQIIAERGMHGATTRRIAERAQAPLASL
FT                   HYCFHTKEELFLAIYEDMAASQLREGFHVREGSGLGRAAAGLLRQIEAWFGKEDTYAQA
FT                   QLELFFWVFRQDGDLAKRLYQLHLDVLEGLLRQGLRPDDNVKLVEVLARAIATVVDGLV
FT                   PQWLTFKDRVMHDTTVDVIAESLERLADAHRITQAAAAG"
FT   CDS_pept        complement(114052..114234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48372"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC3"
FT                   /protein_id="BAH48372.1"
FT                   /translation="MITEVVLIPNIASVTEPLRGHDLGVWLVAETIHRMLPAGIVLMWP
FT                   YPVLSVDAEPDPELG"
FT   CDS_pept        complement(114231..114497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48373"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC4"
FT                   /protein_id="BAH48373.1"
FT                   /translation="MPRVQFRSVGLSDLDACLDWFAELTMTVDLDDADDVVVGSLDFTL
FT                   IRLGTEDPIALCLGQFDGDREIMACSMAINSPNRSRSSTRRWP"
FT   CDS_pept        complement(114923..115267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48374"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC5"
FT                   /protein_id="BAH48374.1"
FT                   /translation="MVARTAGFVKQVISSTLYRPDGTVETTRDPAVWTLAHRGYSGSAR
FT                   LDVWAYRTKDDALRAGARLAMDCGMDEDARCRELFDAGRWTAVMERYEELSPDGHLLRV
FT                   QAAFLQLDDE"
FT   CDS_pept        115545..115790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48375"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC6"
FT                   /protein_id="BAH48375.1"
FT                   /translation="MGEEFLARAVAAALADGASWAEIGARLGVPTPHTTGAGGTPSDAD
FT                   WQNAIAEHENTHVTRRHPKPPGTQETTTPTDATGNH"
FT   CDS_pept        complement(115975..116223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48376"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC7"
FT                   /protein_id="BAH48376.1"
FT                   /translation="MAHRSSTRRVHGPELKVGARVLVRRHAEADVIGEVVEDYGPLTES
FT                   GGRGHEWAPAHRWAVALDDGRLIFADTDEVTVDPGNR"
FT   CDS_pept        116454..116879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48377"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC8"
FT                   /protein_id="BAH48377.1"
FT                   /translation="MHDRLPLTRNTDLMLELVRITSYPSGLAVQLALTATGRPARRAWH
FT                   ETRPLTDPTDLSAHWSYLEVWAGSGDLAAADPYFPRPDLQAAASGICSYRSEPLYWLPT
FT                   APAWALTLATGWPQIGLPTAVTTMHLDPITPPTSRRA"
FT   CDS_pept        117247..119745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48378"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASC9"
FT                   /protein_id="BAH48378.1"
FT                   /translation="MRRYHRSVTDPTDPTAEAAMSLLREHGPLHPDEWARRLVAEGHGY
FT                   LADMEELTEYIGHPRLGYLADGRSAALDALLDGRVLTHRLTEMEISSGILDANPDLMPL
FT                   LPFDDDDPAAGGLRILFRDLDDDVFDERGALDADWPADAALLLEPDALTGLRPGDLVAL
FT                   TFTGGVLRLTAAENPPAPAPDLTAALTGLVTEDRPEPLDGVIWQLMADDPSLLTAPTTP
FT                   LGELITAAGYVCDGDDIAAAGFDFAAHRGKAHMATVAAAHHLTDDQTDAVLAFLALIGV
FT                   LERTPDDQRAAAVDAVAANFGDRFAGLAHPNAARAAFGEAYATAHAGTDTLRSAAAVLR
FT                   DRGPRRIAPTAHWLAGKAAELDGWTADAERHYERALAVDPNWDEALEALARFASDRGDA
FT                   VRAIGLLDRVEGAYREPMYDLLQSFLPVDRPDLGRNDRCWCGSGRKYKACHLGTAEHSL
FT                   EQRAGWLYQKAGSFAQGIEWRPLLLSLAQIRSVHNDDPFALYHALDDPLVADVVMFECG
FT                   AFARFVAERGVLLPADELLLAQQWSLTERSVHEVETVRPGEGLTLRDVRTGDRHEVTER
FT                   TASRQLRVGDFFCARVVPAGSTTQIFGGIEPIAPGQRGQLIELLDSNATDPEELVEFLS
FT                   ARFAPPRLITPDGHPMVACRAVFEIADTTGIRRKLSRRFGAADNDRWTWTEQNSVLGVL
FT                   TLTRSTDRWELEAEAMNEPRFESLIDAVRAADPGGRLREQTRTPAAELIAQTQDNGAHP
FT                   HQPVDPEDPEIAATLDEHIRRYEQQWLDEAIPALGGHTPRQCAADPTRRDELIRLLDSF
FT                   PQQDRPGAMSAHRLREALGL"
FT   CDS_pept        120018..121892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01320"
FT                   /product="putative ribonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48379"
FT                   /db_xref="GOA:C1ASD0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD0"
FT                   /protein_id="BAH48379.1"
FT                   /translation="MTSPTTTDMATLLMIDSQHARDRDDAFAVTPPAGGRGWAVDVHIA
FT                   GVADVVGLGSVADEQAFLRAETRYLRSRTIAMLGETAEQAATLTSEAARTSLRVTGTLT
FT                   TDGRLVDVTVARGQIPSGRCVAVDHAQAPGILTDPQHPLHAWLAAADAAAQVLLGARRD
FT                   GGALAFYDLTRGWASNEDGAIVAIPDALRTVAYVIVQELMIATNEAVALWCVERGLPIL
FT                   FRNHRPNPVAGSTDELMTEIAAAAGDPDLFAKLRGRLLSTLRAATYDPTVHGHYGLRLS
FT                   AYTHVTSPLRRVADLINQRVILAHLDSSPTPYTSDQLAALGDDLNRRTRAAREAKKNHF
FT                   KHADQRIIAQEAARDLTALDARTFHKVLKSAAAAPLRDEIATELARRVDADLMTAPDVA
FT                   VLIDAADPTWLPLQLRVLDTLADTHPEMGPSVASVWRQTHPDHPATDLETRRGGADHHP
FT                   LFAARATHLGIHGPWTIAAAKKLAEQAALWAGLRAQLTGTNHPDPEPEWLAAPQNPQPP
FT                   ATPAAADPGPAIASPPHDTATLTVLNLDGAKKSKALSNPIAWLMSLAQNNRQAPPEWEI
FT                   RTDGPAHAPRFTATVHLAGHTATADATTKTAAKTASAAALVEALFARQ"
FT   CDS_pept        123061..123699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48380"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD1"
FT                   /protein_id="BAH48380.1"
FT                   /translation="MRPSSSPMIGEVVAAVRAFIDGIDEITEVDQVFLDNATAVWQIGR
FT                   AVPLPGIGGRNRGEPDFLPTPVTRMFLWHITHYQPGAAEQHERAAHISRHRTSAGPAAK
FT                   YQLDWFRIDTPGSRGRGRLQRDDVLLQVTADNEWLYSPAVVDSDPNAIPHTRTAVAYHL
FT                   RTRVDLEPIAVTDAEVLLADAGHPGPRLRTDHRIVSASLRAALLRLWNL"
FT   CDS_pept        124043..124543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48381"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD2"
FT                   /protein_id="BAH48381.1"
FT                   /translation="MISMRARPPAASPLQLYAEFRRRHPALVMPANYVTECGFRLGRWQ
FT                   NRQRVARMLGTLPPQRITQLDAIGFVWTDDSAPLPAVPPAEGKRRRMLTEIAAYREEHG
FT                   DALVPANYVTADGEQVGQWLYRAVKKWRANALPDNERRPLAVLGVSPGPRPRGPRLSAH
FT                   PMR"
FT   CDS_pept        125346..125726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48382"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD3"
FT                   /protein_id="BAH48382.1"
FT                   /translation="MRGTADVREFLDHGWRAFPDLTFELAAGPTHNERRPPRRLLVKTT
FT                   ATHQGPLDPPGIPATGTHIEFDGVDIHEYRDGKIATADHHQHDDIALQEGLLPAPGSKA
FT                   ERVMTGLQKLRSRLTRSRTSST"
FT   CDS_pept        125853..126185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48383"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD4"
FT                   /protein_id="BAH48383.1"
FT                   /translation="MNTNETTGTECAPWCTNEDARGRNDHTCTGDNSNCIELTAALDYL
FT                   TLDDDGIESSFCFVTPVREADRRPRVSMTWEVGNHPEFRPRLTPEEARRIAAELVAAAD
FT                   VIEGRR"
FT   CDS_pept        126384..126932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48384"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD5"
FT                   /protein_id="BAH48384.1"
FT                   /translation="MRITDSARKHHISNTDITHAFENAIRYAEYEDDGEERLLIIGTDT
FT                   AGRLLEPVAAPAGEPNRRVRAAIAAAASETTREGGRQPHCHTPHPLTPRRRRPGTEAGR
FT                   LLRGGTKIRGAAGGAGAGSLRHNGLRARHGQRQGFSTAWGPWQRRGRPRYLARPTIARC
FT                   GAVRGLEPATSTPDLRLAD"
FT   CDS_pept        complement(126965..127318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48385"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD6"
FT                   /protein_id="BAH48385.1"
FT                   /translation="MSPKRGERVAPPAAGELWDLRFATSDAAKGWDELCRQAPANTLVA
FT                   YEELRRRAVGQESTTRHHRLKGRLATGVHNGVEMEQWQYEVTAGGRVWYVVDVEHRTLW
FT                   LKYAGTAHPKQTE"
FT   CDS_pept        complement(127315..127782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48386"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD7"
FT                   /protein_id="BAH48386.1"
FT                   /translation="MSVGEVPFSDIQNKGKATLAEWQRSGARPLRVTRRDDEDLVLMTA
FT                   VRADQEREVLAAATAMVEALLHSDDRVLVRKVVAAAFPWVSYLSGEELADFVDELIASL
FT                   RAGSSLDNPAPPARTIETWRHTAEVYADPDLARILSAPSGGDFGVVPVPEL"
FT   CDS_pept        complement(127811..128017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48387"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD8"
FT                   /protein_id="BAH48387.1"
FT                   /translation="MSQGVSFSLSTRFVQNDSVMESELYERCLSLELLPILLLCAGGGG
FT                   VGFSFVSTVGGASSVPERSPSPC"
FT   CDS_pept        complement(128075..128374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48388"
FT                   /db_xref="GOA:C1ASD9"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASD9"
FT                   /protein_id="BAH48388.1"
FT                   /translation="MFVMLGLPSSGGTIPLEATPSLYRWLGGFEPMHQIYRGVRAIIFF
FT                   GASGAAGLIHAVWMTFAGLVIGLVVGAVITRFYDRKGLHRRLEAQAPVPVEARS"
FT   CDS_pept        complement(128365..129435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48389"
FT                   /db_xref="GOA:C1ASE0"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE0"
FT                   /protein_id="BAH48389.1"
FT                   /translation="MARTGGSGTDDPVVNRSAWSVLRTPRLVMAPVVLVCIVMSLLAVL
FT                   YMGAMLDPTKHLHHFPIALVDQDEGDTVPGSDPPVQRKLGDQIAAGLIDGVDPEKIQFR
FT                   RMGIVEARSLLDDGKIYGAIGIPSDFTKRTFVLAQASVVPGDVDRPVITVYTNPRAGTI
FT                   SANIVRAVGATALDEANRALGEQLTAQVNEQLAAGGGGTQLSGASRLVLADPIDVRTVA
FT                   HNPLPFGTGFGLAAFYYALLLVLAGFTGANLVNALVDGMLGFTPTEVGPLYLYRAAVPI
FT                   SRFHTLLVKWAIVVALGMIVSGLYLGIGSALGLPVTDPLALWGYGAFAIAAVGITAVSV
FT                   VAAIGNLGLLAICSCS"
FT   CDS_pept        129716..129982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE1"
FT                   /protein_id="BAH48390.1"
FT                   /translation="MRYGQCGMGGAVWAVQTISMELGTLVVDPGTGHDTTITVVQVATD
FT                   RDTFTRLDLSRVEARATLDHLRAGVSKNPHDLVPVAHSRGVRG"
FT   CDS_pept        130002..130337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48391"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE2"
FT                   /protein_id="BAH48391.1"
FT                   /translation="MTTPAPAVTITALREMLVIKEREANTLLDRIAGLERDPAHATENA
FT                   AAPPRHPPRIVHPPAAAPIPASSRPTIASCCKKSGSTPTTTPRERRPIPRPTRHPASPD
FT                   QGRGHQW"
FT   CDS_pept        130357..131244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48392"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="InterPro:IPR025280"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE3"
FT                   /protein_id="BAH48392.1"
FT                   /translation="MFSSNNSLANGRKKTADLSKLMLRAYNAEADICVRTLRAGNLTTA
FT                   ITRLNKAATTITKLGAMMDMHLADTYHALRIRELELTADYLMKAQEEKEAARAEREHLR
FT                   EERKVEQELAAQREKLDNERAHYRKVLTSIGGTDPQEKQRILDKIADLDKAIEDNDHRQ
FT                   ANIRAGYVYVISNQGAFGPNVVKIGMTRRLDPTDRVRELGSASVPFPFDTHALYFSDDA
FT                   ITLENKLHNAFTGQRLNHANPRREFFFATPAQVRDVLAAHVGNLLEYTETPEATQYFQS
FT                   RSNWPAGAAIGPTT"
FT   CDS_pept        complement(131307..131858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48393"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE4"
FT                   /protein_id="BAH48393.1"
FT                   /translation="MTFTVLYDANVLYPNVLRDVLIRLAQTGLVHARWTDRILNETFEN
FT                   LAEDRPDIPAATLTKLRELMNRAVPDCLVTGYEKLIPALTLPDADDRHVLAAAIRAGAQ
FT                   VIVTANLRDFPDAELAQFGIEAKHPDEFVMDLFHLDGVRVHQAVSATAAAWRNPPGTPA
FT                   DVCDRLAAAGLPISAAALRR"
FT   CDS_pept        complement(131860..132300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48394"
FT                   /db_xref="GOA:C1ASE5"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE5"
FT                   /protein_id="BAH48394.1"
FT                   /translation="MMAAAHDQPTVVEQEQARQALQLLRDVDPAGETLDVTVAGTSESV
FT                   HLPRAALDLIREVLANMAAGQGVTVVPAHAELTTQQAAQMLNVSRPHVIKLLDEGHIEY
FT                   RMVGRHRRILTSSLLAYQRTQLGASRAAADELAALTEDLGLY"
FT   CDS_pept        132429..132776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48395"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE6"
FT                   /protein_id="BAH48395.1"
FT                   /translation="MKKTTLAMAALAISALLSGCRWRHAVQQHIDHHHGIGGPAGRRIE
FT                   RTAHDHHGPAPTTATAALPVTRSAAVAPPITPVTPTTTVAVAPPPAPAVIPANPRRRST
FT                   PSRISESVHSR"
FT   CDS_pept        complement(133005..133856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48396"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE7"
FT                   /protein_id="BAH48396.1"
FT                   /translation="MDNPRHWVGHLRVLSGIQDRIGGFTEFVPLPFVHQSAPLYLAGAS
FT                   RPGPTNRDNRAVHALARIMLHGRIPNIQTSWVKLGVTGTQVMLQGGANDLGGTLMEETI
FT                   SRMAGSEHGSEKTVEELRAIAEGIGRPARETHHHTRPPAPPPRAVMSTIGVDGYAVVVP
FT                   IRSLRMAKSRLRTSDTMRSQLALAFFLDTITALERKHRGGADRGGLRRRHHPGVGAGAL
FT                   RRPDGRRNGPPRRNQSRHRKAPKDKPFRAGGRRPPGTALCDRWRVRHASRLCTRTPAGL
FT                   PG"
FT   CDS_pept        complement(134019..134603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48397"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE8"
FT                   /protein_id="BAH48397.1"
FT                   /translation="MRTRGGGRNGFCTDVVADVADRFVVSAGGIPRASDARGWAGGVHP
FT                   ARGRRRRGGAGDVRGRCRRRAGGIVVPQAGPPVADLTGPVGLGHRRPRRSRPSRPPGRA
FT                   APARGHRGAADPGVPAACDPAGSVPAAVGDAPDRGPGRRPVRGLHQDPPRPRRRRDGDD
FT                   PAATQHDRGSVPPRHVRPWQPTRAENESSRV"
FT   CDS_pept        135032..135304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48398"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASE9"
FT                   /protein_id="BAH48398.1"
FT                   /translation="MAASLHSPHTHPRGTGSRTRALDTAEGVLIGIRRIPAADPFDELV
FT                   GAARRHGVSLFALAEALVALAGGTESPDAAADDAARTEWGALFRP"
FT   CDS_pept        135456..135671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48399"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF0"
FT                   /protein_id="BAH48399.1"
FT                   /translation="MTPKPARLDHVDAAEVTEAADLAGRHVTSRIDRRDGLGTRLTRSR
FT                   SPTQRARLSSSSAGPPVWTGTGEIAG"
FT   CDS_pept        complement(135730..136125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48400"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF1"
FT                   /protein_id="BAH48400.1"
FT                   /translation="MMDDTEFLSRVREYGEYDSLGQATRVTTVVLRKLGARLTPGKVRA
FT                   LAAQLPPLARNALGPIEDGRSAPDFGVEEFRHRIAQALDAHPATAEWDTSAVLATVAQA
FT                   VDDDCLRAVLGSLPEGFAPLFGRPETV"
FT   CDS_pept        complement(136349..136537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF2"
FT                   /protein_id="BAH48401.1"
FT                   /translation="MTDETLVALKNYEYLILEHGCENVSLVWHTDSVVFGDDGWADIDM
FT                   LTQPGFTPATECFAHRD"
FT   CDS_pept        136963..138834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="ROP_01550"
FT                   /product="chaperone protein DnaK"
FT                   /note="protein synonym:Hsp70"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48402"
FT                   /db_xref="GOA:C1ASF3"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF3"
FT                   /protein_id="BAH48402.1"
FT                   /translation="MARAVGIDLGTTNSVVCVLEGGDPVVVANSEGSRTTPSVVAFAKS
FT                   GEVLVGQPAKNQAVTNVDRTVRSVKREIGTDWTVAIDDKNYTAQEISARVLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLTVLRIINEPTAAALAYGLDKGGKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDDRIVRWLAEKFKASSGF
FT                   DLTKDKMALQRLREAAEKAKIELSSSHSTSINLPYITVDADKNPLFLDEQLSRSEFEKI
FT                   TSDLLGRTRAPFDSVIKDAKISVGDIDHVVLVGGSTRMPAVTNLVRELTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLGGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVYQGEREIASHNKLLGSFELAGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENRIRIQEGSALSKEDIDRMIRDAEAHAAEDSRRREEAETRNQAESLV
FT                   YQTEKFIKDNDNKVPADVTDKVRSAIAQVQDALAGTDIAAIKTAMEKLGTESQALGQAI
FT                   YAAQAQQDGASAGGDGGPGAGAGASGDGHGADDVVDAEVVDEPREGR"
FT   CDS_pept        138841..139632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="ROP_01560"
FT                   /product="GrpE protein"
FT                   /note="protein synonym:nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48403"
FT                   /db_xref="GOA:C1ASF4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF4"
FT                   /protein_id="BAH48403.1"
FT                   /translation="MNTPYDEQQRSGTAGRGRGNGRQPPREPIAITDRRRIDPVTGRVR
FT                   QDTPGSHSPQDRGASTLSGKASPGEKAGTSSLDTGAARPEPRQVDSDRVAELTADLQRL
FT                   QAEYANYRRRVERDRAAAAENAKASVVAEFLGVLDDLDWAREHGDTAREPRHSLSRKIR
FT                   TILARMGVAAFGERGDRFDPTLHEAASHDGHGTDLVVDTVLRRGYTFGVHTVLRTALVT
FT                   VIDRDRYENTSNPGPPADTDARPESGGAGDPGDDPNPYRCG"
FT   CDS_pept        139725..140915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="ROP_01570"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48404"
FT                   /db_xref="GOA:C1ASF5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF5"
FT                   /protein_id="BAH48404.1"
FT                   /translation="MTQQEWIERDFYADLGVPSTASAEQIKRAYRTLARRLHPDANPDD
FT                   AAAGERFKAVSEAHAVLSDPATRAEYDRTRQLYRSGSFRQAGTRAGAAARSGGGMGGFD
FT                   LSDLFGSGSAAFTSGDAGFGDVFGDLFRRSGTRTTTASSRPRRGSDVEAQTRLPLRQAV
FT                   TGVVLPLQVSGPTVCTTCHGSGARPGTRPRRCPSCGGAGTLTRNQGGFGFSEPCDDCRG
FT                   TGMIVDHPCADCQGTGVGHRTRTINVRIPPGVTDGQRIRLPAHGEPGLRGAPAGDLYVT
FT                   VTVDPDPVFGRDGDDLTVTVPVGFGELALGTTISVPTLDGRVSVKIPAGTPSGRTFRLR
FT                   GRGVHRGGGPAGDLRVTVQVAVPTRLDRSAVDALRAYDKAEKATGFDPRAAWPGHR"
FT   CDS_pept        complement(140844..141416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48405"
FT                   /db_xref="GOA:C1ASF6"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF6"
FT                   /protein_id="BAH48405.1"
FT                   /translation="MISTQPAQRGSRSPPRFRRRPCWWGRCSWWSGCSGSSPGVTTDYD
FT                   TLTFAGHHTEAALLGIFQVSVLHNIVHLLFGVAGIAAARTAGAAKGFLVGGGLIYLVLW
FT                   IYGLVIDQDGSAYFVPVNTADNWLHLVLGAGMVVLGLLLPRLRTTAPRLIPPPLPGRGA
FT                   VALRLSVAGPGGAGVESGGLLGLVVGA"
FT   CDS_pept        complement(141662..142153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48406"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF7"
FT                   /protein_id="BAH48406.1"
FT                   /translation="MGSDLGGRFGPDAEVAGHLLALVSEHRYPALGRELSSLMAPPDPA
FT                   AGGGSCYGGVLAWLTGAIADVAVARLGPAAQDESFILEVRTAAGQLVDARKLPPRQARV
FT                   ARSVLALLAGDRAAARVHLGAAEREPDSQVRVTTLIEALTWLNALLDAPTPALPDPPPQ
FT                   "
FT   CDS_pept        142211..142708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48407"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF8"
FT                   /protein_id="BAH48407.1"
FT                   /translation="MRPRPAPRGRFDIAADGCMVPRMKDVSTMSSGVGAGDNPDSSAYV
FT                   FAVARALSAETIRRWDEVTFDAVVVLSKQSRYCSGRRILLAWNHHFGWSLGIEGQGPDR
FT                   VLIIGGLGLGRQPLPECIADRADEVITDLLHLECRSPERFPVPTVVHRRGAGPADHRPP
FT                   LR"
FT   CDS_pept        complement(142845..143081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48408"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASF9"
FT                   /protein_id="BAH48408.1"
FT                   /translation="MSVGVAVIPGSPTPREQVLRPGGRPSDVWSGLLDQQQDILGVLER
FT                   LHPGCPGRHAWAQVVGDRPPQRLGVVEEGGWRP"
FT   CDS_pept        complement(143425..143712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48409"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG0"
FT                   /protein_id="BAH48409.1"
FT                   /translation="MTTSPHITTDHAEIRRWIQAHRGGPARDGTGSLRIDFLGVATGLE
FT                   HLSWKQWFTAFEDQNLALCYPQPHVHGGTSAWCELAPRTRTATGAAGSVR"
FT   CDS_pept        complement(143732..143980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48410"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG1"
FT                   /protein_id="BAH48410.1"
FT                   /translation="MTHRTACVRQLSGTQRGERRRTRDDILAPASVHSSAAAAGSSRQL
FT                   NVNVGESVVRLRLHLTGVCCTAGSIGPVGIAWCADDP"
FT   CDS_pept        complement(144294..144782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01640"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48411"
FT                   /db_xref="GOA:C1ASG2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG2"
FT                   /protein_id="BAH48411.1"
FT                   /translation="MSEESGRRDRESPSVRGVYGISVAAELSGFGVAALRLYEEYGLIT
FT                   PGRTGGGTRRYSDFDLARLRRIAELIDAGVNLVGIGRVLDLEHRTGELERDNRRLEADN
FT                   AQLRADQDPDAASADDPAGETAPEPGTGRTGRRRSPTSQGRTCVGGGAAREQAGGDHH"
FT   CDS_pept        144915..145340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp18"
FT                   /locus_tag="ROP_01650"
FT                   /product="putative heat shock protein Hsp18"
FT                   /note="protein synonym:18-kDa antigen"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48412"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG3"
FT                   /protein_id="BAH48412.1"
FT                   /translation="MLMRTDPFRDLDRLTQQIFGTAARPAVMPMDAWREEDRFVVEFDL
FT                   PGVNADSLDLDVEKNTLTVHAERAALNENREMVAAERPRGVFSRQLFLGENLDVDKIEA
FT                   NYDAGVLRLTIPIAEKAKPRKIEISSNGHSEQKAVNA"
FT   CDS_pept        145410..145718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48413"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG4"
FT                   /protein_id="BAH48413.1"
FT                   /translation="MTSTNPVAEVNATDTRERTERETMWPWHELDYALLVADSDRILAD
FT                   ALTPQAVVLLHRVATAPAGRARPSPPTPVGWTALPPPLPEIRATQRSPPRPEKPGKV"
FT   CDS_pept        146105..146512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48414"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG5"
FT                   /protein_id="BAH48414.1"
FT                   /translation="MATERDPYRVLGLSPSASQADIASAYRRLLRRHHPDTRTRHPADP
FT                   AADEYLQQVMTAYALLRDPDHRAAHNQAEADRTEADRVDAEAIVPEPRGRRRGRAPWAA
FT                   APPLIRVVVADAPPPHPPATGLWVGPVRRHR"
FT   CDS_pept        complement(146930..147970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48415"
FT                   /db_xref="GOA:C1ASG6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG6"
FT                   /protein_id="BAH48415.1"
FT                   /translation="MSTPTTGNVASGVSATRRGLGICVTPLETRRDVILHVARRAEDLG
FT                   YDGFFLAEGWSQDAAVLLTEIATKTERITIGTGVLSVWGRTAGTLAMLATSLDQVSHGR
FT                   FVLGLGASSPQLVEGLHDQSFTAPVAKLRAVTAQVRRLLDGERVSPTTTHDHRSLRLGV
FT                   AARTGLPIYLAGLGNKSIQLAGELADGWMPFLVPRSWLPHGIDLLQQAGARSGHTTRPL
FT                   VCPAVPTAVAADQAKAHEIASWWIAFYLTSMGSLYRRSLSERGYHHQVEAVLASNPTHD
FT                   TTDVPAAAHALLDELTVWGTPDTAHDHLQRWYTAGAETPILTLTLPPHRTTAELDYMLE
FT                   TMRPHP"
FT   CDS_pept        complement(147967..148605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01690"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48416"
FT                   /db_xref="GOA:C1ASG7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG7"
FT                   /protein_id="BAH48416.1"
FT                   /translation="MAQKRNTTPGAKTRETVLHAAADVASIDGLDGLTIGHLASLTGMS
FT                   KSGLFAHFGSKQDLQLATIEVARQRYVREVVTPALESGPGMQRLTALCESFLSYVERGV
FT                   FPGGCFFAAAMAEFDGKTPGPVRDAVTECQRQWMETLAQSAHEAQQSGELCIDTDPDQL
FT                   AFELEGTLLAANSYFHLFADTRYLDRARLAVRTRLSSGASTPERTATRA"
FT   CDS_pept        148688..149890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01700"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48417"
FT                   /db_xref="GOA:C1ASG8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG8"
FT                   /protein_id="BAH48417.1"
FT                   /translation="MFDVIVVGARCAGASLAMLLARGGHRVAVVDRASFPSDTMSTHFL
FT                   WQRAAFRLRDWGLLDRLHARGCAPIEQITFDVGPVQMSGIGPGVEGQTAVYCPRRTVLD
FT                   AVLVEAAVEAGAELIDGVVVDDVVWADGRVSGVRGRCRGVGGSLSLRAPLVVGADGLHS
FT                   TVARRVAARVYNHHPPLTCVYYSYWSGLGNVRASFHARTGQLILVWPTNDGLTCIYVGW
FT                   PRREFARVRTDLDRSFQAALDLVPGLRDTVASGHREQRFVGTADLPNQYRTSVGPGWAL
FT                   LGDAGHHKDPSTGMGIADAFLSADLLAKAIQSARAGRSVDDALGDYQRQRDQLTANGFE
FT                   LALNTARLAPLSNGLTAFYRAAATQPEVVERIFGVLGGSVPIRDVYSAPRIASVLAQAN
FT                   A"
FT   CDS_pept        149909..150151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48418"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASG9"
FT                   /protein_id="BAH48418.1"
FT                   /translation="MVDGRHARHGGGKRKSNAEEIVADGRSILAIIWHPLDGAGATFHG
FT                   LGTEHSSRNVKPGHEDTQSHRQLETLRHVTLIPAA"
FT   CDS_pept        complement(150240..151577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH0"
FT                   /protein_id="BAH48419.1"
FT                   /translation="MTTRIGHRAVVLGASIAGLLAARVLSEAYAQVIVVDHDHLPGTAA
FT                   PRRCVPQARHTHVLIERGQQVLEELFPGFTDDLAARGVPTLDNLRDVRWCLSGHRFPQP
FT                   ESGMTVVSASRSYLEGCVRARVSELPGVTLVDCCDAAGLTMTPDRRRVTGVRVLRRADG
FT                   SAEEVLDADLVVDATGRGSRAPTWLAELGFESPEEEKLQVGLGYTTQIYRAPAPGLGND
FT                   LGVVIGPTPDAPRGGALQLLEGNRFLVTLMGMLGDYPPTDPDGFLDFARTLPIPDLCDV
FT                   IRDAEPLERARSFRFPASVRRRYERLSRFPAGFLVTGDALCSFNPIYAQGMTVAALEAI
FT                   TLRRHLQRATEPHPRTFFRDVAKMIDVPWDMSVGADLAFPDVIGARSPKMRIANAYIPR
FT                   LHAAAAHDPVLATTFIRVAALVDRPERLMSPGTVLRVLRQILPRPR"
FT   CDS_pept        complement(151668..153749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH1"
FT                   /protein_id="BAH48420.1"
FT                   /translation="MEGTGPSSIPLGDLLNSRRRRTYVGREGERELVRARLESADPQWS
FT                   VLYLHGPGGIGKTALLDVLAEIAEDVGATVVRLDGRDLSPSPSAILAALSDAVEVPVTG
FT                   VITSTEERLCVLVDSYEVLGPIDEWMRTRLLPRLPATALTVIAARTPPSPQWRADAAWS
FT                   ALLRVVSLRNLTPGECREFLRAVAVSTQLHDRICQVTHGHPLALSLLADVASRGGEVAA
FT                   DPLTPDLIGVLMQRFIEVVPSPVHRRALEVCALARVTTESLLRDVLELDDAHEVFAWLR
FT                   QLSFVEAGPEGLFPHDLARDVVDVDLRWRDLDFYTEVFHRVWRHLRRRLTSCSGREQQR
FT                   VIFDLKFVFRNLPGVLSPVDWESWGHHYPEPACEEDRETIVELVRSHEGAESAEIAAAW
FT                   FRRQPEGFYIVRRPDGTARGFFGLLDLSRASADDIAADPGAAAAWDFARTQSPPREGEA
FT                   ITQTRFVIDATAYQDPSPTLNAIPIMTMQRYLCTPRLSWDFLTLAEPDRWNEYFAVADL
FT                   PRAGGADFEVGARRYGLFSHDFRRVPVDAWFEQVAVRALSDNPVAPKRPAPQLLVLSQP
FT                   EFEQAVRQALHDWRRPDLLRRNPLMRTRVVCDRGGAEPDVAELDTVLRDAVDALADDPR
FT                   DDKMVRAVDRTYLRPAATQEAAAQILGLPFSTYRRHLTQGVAQVVSWLWDREIYGRHE"
FT   CDS_pept        complement(153931..154140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48421"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH2"
FT                   /protein_id="BAH48421.1"
FT                   /translation="MTSIQPAGSGGGGVSGGPRSGSLADVIDKVAVAGICHFRRSLRDL
FT                   DTVASADAGLSRSPSQHRLARRAS"
FT   CDS_pept        154172..154399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48422"
FT                   /db_xref="GOA:C1ASH3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH3"
FT                   /protein_id="BAH48422.1"
FT                   /translation="MAGGFARAATACRRRRCLLFLRLLVLVLVTRIGLRFVLGRFLVVL
FT                   GLVGFDNLAIPDLSAPPSISSGWRTDWVMT"
FT   CDS_pept        complement(155001..155600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48423"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH4"
FT                   /protein_id="BAH48423.1"
FT                   /translation="MKIMKARSKVEVAAAVGAGYLLGRTHQLRMAVKIAGAGGRCPMGP
FT                   EDLLAQGSEFLAASPEIADLGDSVRDELLDTAAATAEASSEHVGSFRDRVRSGGAHFVA
FT                   GGGNLVAGVKRIGRRGHAHPRDPEDSTVDGALDHGKGEDGPSSPAVQEERQPKPRRRRK
FT                   PRITTPSDSAGASRDESAPEARPDTAARRKGTAKAH"
FT   CDS_pept        155832..156035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48424"
FT                   /db_xref="GOA:C1ASH5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH5"
FT                   /protein_id="BAH48424.1"
FT                   /translation="MRTTDHERRRHTGGLALVEGREAGIAIPLGLALLVILVWAAVLGS
FT                   SPLVLVILVAVAGIAALTAAAL"
FT   CDS_pept        complement(156378..156554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48425"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH6"
FT                   /protein_id="BAH48425.1"
FT                   /translation="MCSVGVALDQDVTARGGPPRRMPVVVSSRNHSRWDVARPGVMGAD
FT                   QVAALRVAVLAYL"
FT   CDS_pept        156877..157236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48426"
FT                   /db_xref="GOA:C1ASH7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH7"
FT                   /protein_id="BAH48426.1"
FT                   /translation="MPAAAPVAGAFRATFFFTAVVFAAVVSASAADSTADSTAAVFAPE
FT                   VFAGAFLATFFFTAVISAAVVFGAAVFAVAFFAATFFAADAFFATVFFATDVSAGAFSA
FT                   TTFFTGVFFAGIASA"
FT   CDS_pept        157342..157596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48427"
FT                   /db_xref="GOA:C1ASH8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH8"
FT                   /protein_id="BAH48427.1"
FT                   /translation="MVVVFAGALPTVAALFAGAFVATVFSEAVVFGAVAFVAAAFLTAT
FT                   FFAGGAFLATAFSAAVFFTAVFFAADDFAATFLAGADFV"
FT   CDS_pept        157687..157911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48428"
FT                   /db_xref="GOA:C1ASH9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH9"
FT                   /protein_id="BAH48428.1"
FT                   /translation="MVVVFAGALPTVAALFAGAFVATVFSEAVVFGAVAFFAAAFLTAT
FT                   FFAAGAFLATAFSTAVFFTAVFFAGADFV"
FT   CDS_pept        complement(158423..158701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48429"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI0"
FT                   /protein_id="BAH48429.1"
FT                   /translation="MSSQSVIDLGAAGAASVAQTEPIGPNGPTGGPCPIVTTYSQGNET
FT                   VTYGKPGDRNGALVCGADGEWTIGRSKGNPGQIQTQPGLSVGWEMTP"
FT   CDS_pept        complement(162527..163714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48430"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI1"
FT                   /protein_id="BAH48430.1"
FT                   /translation="MTVEAEEFALSGSCCSSGSEPGLSRRGLLGALGIGAVAAGVAACS
FT                   GPSAGAGAQTGPVSNLDADGPFGPLELVLLGTKAGPPIVPSRAGISTALVIDGATYVID
FT                   CGRSSTTQFARAGLRFDGLRSIFITHLHADHIADYYNYFLLAGSIPNQETRDALANPVS
FT                   VFGPGPAGGLPEKFGGGQAPTVSAEDPTPGLAAFTEKCHDAFAYSSNVFLRDTGIRDIR
FT                   TLVDVHEIAVPDVGASYTMTSPRMDPFPVMEDDHVAVTAVLVPHGPVFPSFAFRFDTAH
FT                   GSVTFSGDTSYSDNLIALARGSDVLVHEAINVQGPNVSLPPAAMDHMLQSHVEVQKVGA
FT                   IARAAGVRTLVLSHLSDFDEEPLDPVRWRKWIEPEFDGEIVIGDDLQRIPIPSSL"
FT   CDS_pept        163999..164205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01840"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48431"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI2"
FT                   /protein_id="BAH48431.1"
FT                   /translation="MKRSDRDIMEILEAYDTTGTAHSAASLAGVDPKTVRHYVTVRRRH
FT                   AGDRPVAATPHHRRSSTPDRAMG"
FT   CDS_pept        164132..164506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01850"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48432"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI3"
FT                   /protein_id="BAH48432.1"
FT                   /translation="MPVTGPSRRPRIIDDHLPQIEQWVERSKGRVRADIVHERLLALCF
FT                   DGTEHATRRAVAEAKAAWRAGHHRTYRPGGYLPRVGESPNPGCGCNSTGVKARKYPERA
FT                   EPCARRCCSAPGWPGHATGW"
FT   CDS_pept        164317..164964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01860"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48433"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI4"
FT                   /protein_id="BAH48433.1"
FT                   /translation="MAGRAPPHLPTWGVPPTSGRITEPGLWMQFDWGEGPKVPGAGGAL
FT                   RSTLLFCAWLAWSRYRVVIPVGDQTLPTLIACLGAPLRCGADLRVDRQPAHGQHRPRRR
FT                   DRGAASADRRNRPPLRRSRPGGPPRRHATSRDGADRTLGMATPRVSAGAPPGHGRRRLV
FT                   RFCIYDRVRTPGMRVDTVLVTANDQQPSRRCRFISTLRRNGSNPVRESLPRR"
FT   CDS_pept        164552..164845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01870"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48434"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI5"
FT                   /protein_id="BAH48434.1"
FT                   /translation="MRRFGVVPTYALTDNPRTASIDHVAGIAVRRPQIVETGRHCGVRD
FT                   LVDPPDGTQPVGMVRTARWGWRRRGCRLAHHLVTVGGDSSDSASMTACAHRA"
FT   CDS_pept        165068..166054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48435"
FT                   /db_xref="GOA:C1ASI6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI6"
FT                   /protein_id="BAH48435.1"
FT                   /translation="MDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYTDGQLDLYTAR
FT                   GRVLASTDPTGRQLVVSCGAALHHLQTALTALKWAADVRRVPEGPHSGHLATIRFRHEA
FT                   RPQSHDFDLLAAIRHRHSDRRPFGPVSVKTPLPAALNDVVHRRDVNLTVLRQEARPTLA
FT                   RATETTAAARKYDTAYQAELHWWAGHSIAQGGIPPDALATADDRDRVDIGRRFPAGLDA
FT                   GATTEPDRSTVLVLSTAADGRGEWLRAGEALSAVLLEATVGGLSTCPLTHMTELRQGRD
FT                   IIRDLLPDRGFPQALIRVGTTEKKSAPRQTPRRPVESVLSVGRRIPH"
FT   CDS_pept        complement(166082..166426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48436"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI7"
FT                   /protein_id="BAH48436.1"
FT                   /translation="MNTPIRDFDVEGSTEWTIPALLNETTWLVEVVVDEHDSDEGGSRI
FT                   RAQARLRTRDTRTFVGSGLARRNPDDAEISEIGEVLATARALSDLAHQLIEATAADVET
FT                   ATHSRVHLAG"
FT   CDS_pept        166462..167073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48437"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI8"
FT                   /protein_id="BAH48437.1"
FT                   /translation="MPAGKLRLHGVAVLMPDEEPEPTNVVRSPSLHVRSNELMDQRDLL
FT                   NRFLAEGRRYEIDGFFSDMSDLLGGRLRDAALKRGRLYRLMHGGRGLLLDQTGGLSVAG
FT                   RTSGRPRGGICSVCYPGGSAPPTSEDGRVTFGPGIALPVIAPLYEGRRKTQAAGEGTRT
FT                   PCSNTPPHRRARIVTGGRTNPANSCTCIPRGSRSRWCRGR"
FT   CDS_pept        167028..167237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01910"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48438"
FT                   /db_xref="GOA:C1ASI9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI9"
FT                   /protein_id="BAH48438.1"
FT                   /translation="MHPAGFALAVVSGAVTAGLVVLLGAWLATPLVGVGAAATLVATVG
FT                   LAAAMLMPHRPRRRGSGPFRPAAR"
FT   CDS_pept        167313..167960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devR"
FT                   /locus_tag="ROP_01920"
FT                   /product="two-component response regulator DevR"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48439"
FT                   /db_xref="GOA:C1ASJ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ0"
FT                   /protein_id="BAH48439.1"
FT                   /translation="MIRVFLVDDHEVVRRGIADLLASDPALTVIGEAASYAQAMARVPA
FT                   LKPDVAVLDVRLPDGNGIELCRELHSLMPDLHCLILTSFTDEQAMLDAILAGASGYVVK
FT                   DIRGMELAQAVHDVGAGKSLLDSRAAGVLMDKVRADADGKDGIFAHLTNQERTLLALLG
FT                   EGLTNRQIAARMFLAEKTVKNYVSRLLTKLGVERRTQAAVLATKMPPKPTCT"
FT   CDS_pept        168009..169739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devS"
FT                   /locus_tag="ROP_01930"
FT                   /product="two-component histidine kinase DevS"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48440"
FT                   /db_xref="GOA:C1ASJ1"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ1"
FT                   /protein_id="BAH48440.1"
FT                   /translation="MRRVTRLPDERDRGPLLGSLSELRLRELLTEVQDRIAQIVDVRDH
FT                   VDGLLEAMLAVTSGLDLDNTLRTIVHAAIDLVDARYGALGVLAPTEGLSEFVYEGIDQE
FT                   TRERIGDLPRGRGVLGFLITDPKPVRLVDLSRHPVSVGFPPDHPPMKTFLGVPIQVRDE
FT                   VFGNLYLTEKANGAQFTEDDEVLLRALAAAAGIAIENARLYEESRTRQAWLEATREIAT
FT                   ELLAGSETADVLQVIADDALALTAADSAFLAVPDDPDIPSDEVTELVVTASAGTVSDRI
FT                   IGRAIPVERSTSGEAFRERTPLRVSALAFDPGFETGARFGPALALPLRAAQSVSGVLVT
FT                   LRHVDASPFTDDQLALMSGFADQAAVALQLANSQRRMHELDVLSDRDRIARDLHDHVIQ
FT                   RLFAVGLSLQSTLQRAKAPVVKDRLEQSIDDLHDIVRDIRTAIFDLHGGSGGITQFRRR
FT                   LHEIVAETTADSGLRTTVHMSGPLSVIDATLAEHAEAVLREALSNAVRHAGADTVTVSI
FT                   SVYDDLAIEVADDGKGFEGSVLTSGLDNLAARAREVNGHCAVDSTLGGGTTLRWSAPLP
FT                   "
FT   CDS_pept        complement(169993..170739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01940"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48441"
FT                   /db_xref="GOA:C1ASJ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ2"
FT                   /protein_id="BAH48441.1"
FT                   /translation="MNSVSSPAVARPRVLLIDADVESSLVERLRDGGFFVTRTYAEPVR
FT                   SRIEPPDVVIVDARSPHLDADTTVRGLKAMRFALAIVVIGRFCSGNRRSDLLEAGADDV
FT                   LEIPVGADELVARLRAILRRVKPDVPAPAPVGSHDVCLCEERHDTDYDGLRTTLTRTEF
FT                   ILFTVLAQNVDRVVTRRDLMLMVWGVTVESKTNVLNAYICSLRRKLVAVGSPYVVHTVR
FT                   GVGFALGENVRPGSIDPAREVSVAVS"
FT   CDS_pept        170896..171744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01950"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48442"
FT                   /db_xref="GOA:C1ASJ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ3"
FT                   /protein_id="BAH48442.1"
FT                   /translation="MPELRHIALHGDDIAYRLSGEGETLLLVHGMAGSSAAWRAILPEL
FT                   AQRYRVLAPDLPGHGDSAKPRGDYSLGAFAAWLRDLLHELAIERVTVVGQSLGGGVAMQ
FT                   FSYQHPELCERLVLIGSGGLGPDVNWTLRLLAAPGSEFLLPLMAPPAIRDAGNKVRSWL
FT                   AAIGVQSVRGDEMWHAYSSLSDPETRQAFLRTLRAVVDHRGQAVSALSRLYLNAGLPTQ
FT                   LIWGDSDGIIPVSHGYAAHEAMPGSRLAVLDGIGHYPHLEDPAAVVDIIDAFVTTTPAR
FT                   R"
FT   CDS_pept        complement(171751..172407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48443"
FT                   /db_xref="GOA:C1ASJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ4"
FT                   /protein_id="BAH48443.1"
FT                   /translation="MADMQREKQFRRLRTPRSAAVAGIVFAAFFSASLVLLHTALPADP
FT                   FDETPWVGSGETRIKTALVLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFISMGVAGGVLAIARHSGSSADEIVYFGREIMLQINHVYALRMAAVFMLSLGTIWL
FT                   RTGLMPRFLVVTTYLLALALLLVVSFSLWTTLAFPAWVLLVSIYILVTGRRIRAA"
FT   CDS_pept        172740..174248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01970"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48444"
FT                   /db_xref="GOA:C1ASJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ5"
FT                   /protein_id="BAH48444.1"
FT                   /translation="MMVTHAPDGGSARTRQQDATDERWTPRLIFSLASIVLLLEMLAVS
FT                   YMMISIALPQIVTHYRTTQGAWLLTSFLLVGAITCPLIGKLADTHGKRKLLLTAVGLSA
FT                   LGSLISAIAPTYAVLIAGRSLTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGMGLI
FT                   AIPAPFFTGWLIDNFGFRSIFWFFLAGLVVLAVLIRATTGESPVRLRSRIDLIGAALLG
FT                   AGLAGILVGVSFGPSWGWTSGSTLGFVAGGVALLVAWIGSALLLSDPLIDIRFFGKRPV
FT                   FLTALGAGFCYGTSSVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGGAVVLGG
FT                   LIVGTLVPRNVRPRILMVVGMLVMAAACLLTATIHDDKALLIGFAALLGVGMGMGYASI
FT                   PNLLIAAVPPQLQATTASMVAVFQSILPAILPVIAFTVLNSHIATVMQGAVFYTDTGIT
FT                   IAFVIGAISALLGAMVAVALPRRISQLSAPGAESTTATDVVLAH"
FT   CDS_pept        174413..174883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48445"
FT                   /db_xref="GOA:C1ASJ6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ6"
FT                   /protein_id="BAH48445.1"
FT                   /translation="MRSGEAAACLNVSVVGVRKAASAGRLPSRRTGSGQRVFDRADLDV
FT                   YLGRPTWKNVRADRAEASYCRVSGSTGQKSSLADQEKMLRESATGTVYRVYKDRGSGLR
FT                   ETRTGLNRMLDDATKGRFTVVRVVWRDRLARFSGGVDRTLPVGGRRQGRGPA"
FT   CDS_pept        174920..175681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48446"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ7"
FT                   /protein_id="BAH48446.1"
FT                   /translation="MTSWHCSPRFPAASAQLRSKRNQRRLRWRCGSTVGEDYLMADAGL
FT                   PAVRQFSFTARPYLAVDDVTGEPIGLDGVDTRVGWLLDLISGAEAQMLSRLWQPATFDV
FT                   LAAGVDRQDRRLPAQGHVAASRLGWTPHYPDGVYIPSRVTRVVTAQVMATLRTLAFRDT
FT                   AITSLSERFDPATGQIAPPTCAADWVPLGFARGVRRQLIARSRREGNAVPSGRVRITDM
FT                   QAPPKTSVMARLSAADRQLAQLAVTDVVMTL"
FT   CDS_pept        175678..176772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48447"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ8"
FT                   /protein_id="BAH48447.1"
FT                   /translation="MKLPTTPVPTGRAQWRRVRLTATLPAHLHDRPISDWHLPTLVLDH
FT                   RGLLLRCAATETVPAAELTSGTTAVGVDWSPATLGAAAITTETPDGLSSDFQGWTYDDD
FT                   RGLGTKLARLQAEGHMLHRKAARLTQLATNAEPEVRTQLEAKIALLDAHRTAVGAKRGK
FT                   INRELGFHFARQVTDYATAASATVIAVEDLTTLESRGHGRVNNNRAAQSARRKAVIALA
FT                   HTAAGVGITVVSVPARGSSARCPGCDAPLARPGGYHTAWCQGCRVGGNRDHIAGVNRAK
FT                   RALLGKTKVTRRRGQMPAIRVAEHAPVRKSRDKTGPTPRPPRHRRVRRSLPTVTPRAGV
FT                   TPKQICSCTSSVGVGHGPTRTTSE"
FT   CDS_pept        176891..177316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48448"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ9"
FT                   /protein_id="BAH48448.1"
FT                   /translation="MRLTTLGDLPGRIATGSFILHSGLQKWSADEQTAQGIHGMAAGAF
FT                   PFLNAIPPQRFVKLLSVAEISTGAALLAPFVPTAVAGAALTGFSGGLVAMYARTPGLRN
FT                   PGSIWPNENGIAVAKDTWMLGMGLGYVLDGWTRLRSR"
FT   CDS_pept        complement(177345..177881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48449"
FT                   /db_xref="GOA:C1ASK0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK0"
FT                   /protein_id="BAH48449.1"
FT                   /translation="MSVLGQMDSFRRVFPTARRNRADLFRWLRRRPQLLAAVGFHEVAL
FT                   AASARVDPRLKALAEIKAAALTNCEYCLDIGSAFSRALGVSDAQLRALPAFRESSAFDD
FT                   TEKLVLEFADAMTRTPAHISDDLRGSLLAAFSESQVTELAAAIAWENHRGRLNQALGVR
FT                   PSGFSDSDFCAVPEQ"
FT   CDS_pept        178008..178193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48450"
FT                   /db_xref="GOA:C1ASK1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK1"
FT                   /protein_id="BAH48450.1"
FT                   /translation="MKAVVCTETRLEFGDVPDPVPARGQVLIDVSRCGICGSDLHARTH
FT                   ADEMAELAAQISAAAL"
FT   CDS_pept        178207..179076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02040"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48451"
FT                   /db_xref="GOA:C1ASK2"
FT                   /db_xref="InterPro:IPR027948"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK2"
FT                   /protein_id="BAH48451.1"
FT                   /translation="MNPNHPRLRWVAPALLLALIYAASLTVYGLSSRTEDEGPFAGNDD
FT                   EVVVLVTAKSLQPTTDRVQAEVTIAVGEEYLHANGDTLNRDITLLLFPSTSHEEIVFRA
FT                   GAAPTTFDTEFIATGNAAYWPFDRFEVNPMVVEAYEGAGADRALLPTGLLVDGRVDGWK
FT                   ARADAVAVDTDLSRNGTGAALLFARTGGNLIYAGILLLMMTILAGLAAFVALQTFRRKR
FT                   AVNTDMLGWMAAMLFAVVPLRGILPGSPPIGSWVDIALTVWVVSTLVASLALFVFCWWR
FT                   DSEQPAQP"
FT   CDS_pept        179127..179579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48452"
FT                   /db_xref="GOA:C1ASK3"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK3"
FT                   /protein_id="BAH48452.1"
FT                   /translation="MVRRTGRVLPPWYLGPVNKVIVGLHRLGVPMPMPALTVPGRETGV
FT                   LRSTPVSPYEVDGRTYVVAGYAESDWAKNARAAGRGELTRGRRRERVRLVPLPVSERAR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRVEPLD"
FT   CDS_pept        complement(179586..180002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02060"
FT                   /product="putative copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48453"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK4"
FT                   /protein_id="BAH48453.1"
FT                   /translation="MKRVPTLVLPILLAILALAACGNDSDDSSASSESEHGGNHMMTDM
FT                   PSMSMPMSMPAGAREIVISDFKYTLPGTFAPGEQVTVRNDDTAEHTVTADTGDLFDVEV
FT                   EPGAVATFTVPGQPGTFAFHCTYHPNMVGTLEVR"
FT   CDS_pept        complement(180112..180822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02070"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48454"
FT                   /db_xref="GOA:C1ASK5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK5"
FT                   /protein_id="BAH48454.1"
FT                   /translation="MPYLERSGDVFVLYFGEEGERDSENAFHPDWIVSVDGLLDRVEQH
FT                   DGPAALVTTAVGKFYSTGLDTAWVLANTDKLNSYIDRVQALFARILTFPLPTVAALTGH
FT                   TFGGGAILAAAHDHRVMREDRGYFCLPGITIGASYAPGSIALLAARLPARAVHTALVTG
FT                   RRYGGVAAKELGFVDEVAPEQQVLADAVAHAQGLVATRGRTLGEIKSSLYADAVVSLRT
FT                   PVANLETQEALNGG"
FT   CDS_pept        180907..181380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48455"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK6"
FT                   /protein_id="BAH48455.1"
FT                   /translation="MSIVKQLRRWTMKSGTGIADTRTVRDYIHTVARSVHADSIDWWEC
FT                   DGFDAVLVLPFRLHYLPGRNAVLAWNRTFGWSLGVEGLGRRSVIVIDGLGLGRMPSPAG
FT                   CAERAAELIDDYCRSTPALPGPHSAVAPAAADRCPRIGNAAGGGRRDRVVRRP"
FT   CDS_pept        181377..182543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02090"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48456"
FT                   /db_xref="GOA:C1ASK7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK7"
FT                   /protein_id="BAH48456.1"
FT                   /translation="MTGGAEGHDDNVAQPHSSAQEQPIVAAEQGAARISTAAHPLGRPG
FT                   PRFDRRSPFFIGMAGAAGVAVTYALIEVVLAARGVLVLIAVAAFLAIGLEPAVSWLVRH
FT                   GFPRWAAVATVFVVAFAMLAGFLAAAIPPMVTQGAALVHNAPDYLGHLEQRYPVLQELS
FT                   ARFHLQDELRRALDAGNAPMVLGGIVGAGKFVFSAISGTVIVVVLTAYFLADFGHIRAS
FT                   LYRLAPNSRRPRTILIGDEIFAKVGGYVLGNLLISLITAVLTFVWLVAFDVPYPLLLAV
FT                   LVAVLDLIPVVGSTLAGVVVALVALTVSLPVSLATVVFFIALRLFEDYLLVPRIIGRTV
FT                   KVPPMVTVVAVLIGGALLGIVGALLAIPVAAAVLLLARETVFPQLDRG"
FT   CDS_pept        182664..184049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02100"
FT                   /product="putative wax ester synthase/diacylglycerol
FT                   acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48457"
FT                   /db_xref="GOA:C1ASK8"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK8"
FT                   /protein_id="BAH48457.1"
FT                   /translation="MSVMSPTEAMFVLFETPSHPMHMGALELFEPPRESGPDHARLMFE
FT                   ALISQEGASDTFRRRAVRPLRGASYPWWSVDDRVDLGYHVRHTAVPGRGRMEDLLSLVS
FT                   QMHGMPLDPQHPMWEIHVIEGLADGRTAVFSKIHLSLMDGPAGLRLLHHALSTDPDARD
FT                   CPAPWTPGVSGTSRRESALPVAAVRAGVRAATSIVGVLPALAKVAYDGVRDQHLTLPLQ
FT                   SPPTMLNVPVGRARKLAARSWPIRRLVSVAAAARTTINAVVLAMCSGALRHYLVEQYAL
FT                   PEAPLTAMLPVPLDLGGTMIGPRGRDHGVGAMVVGLATDEADPAARLARISESVEHTNR
FT                   VFGALSHTQFQVMSALAISPILLEPVRRFVDDTPPPFNVMISYMPGPSRPRYWNGARLD
FT                   AVYPAPTVLGGQALSITLTSRSGQLDVGVVGDRQAVPHLQRIITHLETSLTDLENAVAA
FT                   SGT"
FT   CDS_pept        complement(184057..185127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48458"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK9"
FT                   /protein_id="BAH48458.1"
FT                   /translation="MTTLHSRSASGTAPQAGTSMPCPAPRGPVSGLLFPILRGDTAEAE
FT                   PFVTAALALASAERDDPRAFLFDEDAQICLTALYELHLQGIAGVDDRWEWDSDLIFARS
FT                   ALEVPFDAAIRALADPPTAVGDVVAALWEMTAPSTAPGLSGYMAHDADLSQFRELLIHR
FT                   SLNQLREADVHTLGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDG
FT                   YAHYVDAVPAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGF
FT                   GKAATLFFDEHVEADSVHEQIVCRDLAGGLVAARPAAADDVLLGAAACLAFDDLVGDHV
FT                   TRCWERNRTSLRQPAG"
FT   CDS_pept        185128..185349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48459"
FT                   /db_xref="GOA:C1ASL0"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL0"
FT                   /protein_id="BAH48459.1"
FT                   /translation="MNSIPLSGAGESDVTITVCPDGPLLVRGAARILDTEGNPIGGDRA
FT                   TVALCRCGRTSIAPFCDSSHKKKRRRPQ"
FT   CDS_pept        185567..186022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48460"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL1"
FT                   /protein_id="BAH48460.1"
FT                   /translation="MKTVLGARPTRRAPAEKPALFSWAVEPEHGRLSVDSAPAADGILV
FT                   VRISGDIDVTTLPSFGSHLEEAIDERLPFVLDLTDVQFFCASALPVLEIMSARAHRLAV
FT                   PWAVTGNNALRRPLTAMNMAAAIPFCTDLEDAFRLVAGGMRQGGRSA"
FT   CDS_pept        186019..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="ROP_02140"
FT                   /product="putative alpha,alpha-trehalose-phosphate
FT                   synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="protein synonym:trehalose-6-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48461"
FT                   /db_xref="GOA:C1ASL2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL2"
FT                   /protein_id="BAH48461.1"
FT                   /translation="MNDSAPHGTSDFVVVANRLPVDMETLDDGTTRWKRSPGGLVTALE
FT                   PILLGRERGSWVGWPGVPDTKVEPIVSGGVDLFPVELSSDEVARYYEGFSNATLWPLYH
FT                   DVLVAPVFDRDWWHTYLEVNRHFAEETARTAAEGATVWVQDYQLQLVPRLLREMRPDLT
FT                   IGFFLHIPFPPVELFMQLPWRKEIVEGLLGADLIGFHLPGGAHNFLFLARRLLGLDATT
FT                   AGVGVRGALGTVTLDDRVVHVGAFPISVDARKLVEQATEPAVVERAAEIRRELGNPRKI
FT                   LLGVDRLDYTKGIDLRLSALGELLDEGRLDPSDTVMVQLATPSRERVEHYMKMRSSIEE
FT                   QVSHINGDHGQIGRPVVHYLYQPVDRSELIALFLAADVMLVTPMRDGMNLVAKEYVACR
FT                   ADLGGALVLSEFAGAAAELRGAYLVNPHDLDGVKNTIVAALGQEREQGRRRMSRLHRQV
FT                   LDHDVHRWAQSFLGALDPNAAD"
FT   CDS_pept        complement(187482..188252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48462"
FT                   /db_xref="GOA:C1ASL3"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL3"
FT                   /protein_id="BAH48462.1"
FT                   /translation="MSETAGERPESMSPDLDGGTIAAQLGSLATALDEFNWNSGSQVEM
FT                   GLLLQRVCEQVVDAIADADMAGVSLLRDGLVETVAYADETVRQIDIQSFQAIDGDDYFG
FT                   VAGSRKVVKATRGEAAARWPSLADNLDQAGMRSFLSAPLAVDEALAGTLDIYGRGDHGF
FT                   SELDAVVLLVYTTAIEGLLRSARSVELARNEVTGLTRAMKTRAVIEQAKGIVMALRGVS
FT                   ADRAFEILVAQSQQEHVKLAEVARRIVESVTNPE"
FT   CDS_pept        complement(188430..189227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02160"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48463"
FT                   /db_xref="GOA:C1ASL4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL4"
FT                   /protein_id="BAH48463.1"
FT                   /translation="MSPVSERSERHRPGRDDYKDVAPAVARLRILEESSGEASALRDEI
FT                   ITRCLPLADHIARRFGGRGEAHEDLLQVARLGLVKAVDRFDPDRGFDFVSYAVPTIMGE
FT                   VRRYFRDTGWSMRVPRRMQELHALIAKAVDELSQELGRSPSASEIAAELELDVREVSEG
FT                   LLAKNAYQTLSMDAAMGDDPDDLPLAETLGEEDPELANVESHASVRPALEKLPPLERRV
FT                   LMLRFFGSMTQTEIAQRVGVSQMQVSRILARTLSGLREQLGGG"
FT   CDS_pept        complement(189227..189658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02170"
FT                   /product="putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48464"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL5"
FT                   /protein_id="BAH48464.1"
FT                   /translation="MAEVGEVRRMKTRSGVPVELRVAAEFEQLPVVRAVAETLAVLGDF
FT                   TLDDVADIKLAVDEVCSELIAATPGSAELTCSFAVTETGLHVTISAPLSRRGVPNRESF
FT                   GWHVLETLMNAVSVSEGPVGNGSVERTVAVELVKYRGTN"
FT   CDS_pept        complement(189795..190040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02180"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48465"
FT                   /db_xref="GOA:C1ASL6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL6"
FT                   /protein_id="BAH48465.1"
FT                   /translation="MSAGDTLPARPSTALRTGTVRWFNADQGFGFLAPADGSDDVFVHV
FT                   SEIAGDGHRILVEGQRVSFTVCRTDTGNQARDVRIA"
FT   CDS_pept        190514..191053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="ROP_02190"
FT                   /product="DNA-binding protein Dps"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48466"
FT                   /db_xref="GOA:C1ASL7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL7"
FT                   /protein_id="BAH48466.1"
FT                   /translation="MSKFTVPGLSDDQGARVADILQKRLSAYNDLHLTLKHIHWNVVGP
FT                   NFIGVHEMIDPQVELVRGYADAVAERIAALGKSPDGTPAAITRDRTWDDYSVNRDTAQA
FT                   HLGALDLVYSGVVEDNRKAIAETGDLDPITEDLLIGQTGELEKFQWFVRAHLENSGGGL
FT                   STNGANTEKQAASQAR"
FT   CDS_pept        191096..191332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48467"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL8"
FT                   /protein_id="BAH48467.1"
FT                   /translation="MAENNSGPAEAVKGVVEDVKGKAKEAAGAVSGQDDLTREGKAQQD
FT                   KAAAQREAAAKEAEAEKARGKAEAQEARQRAEQ"
FT   CDS_pept        191379..191642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02210"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48468"
FT                   /db_xref="GOA:C1ASL9"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL9"
FT                   /protein_id="BAH48468.1"
FT                   /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIVLNIVVGIVGGLL
FT                   GGFILSLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRR"
FT   CDS_pept        191969..192118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48469"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM0"
FT                   /protein_id="BAH48469.1"
FT                   /translation="MIVSESTRDEKDEPKGGRPGPADHGKDGGMATRENAPELTEDSAD
FT                   AEND"
FT   CDS_pept        192157..192480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48470"
FT                   /db_xref="GOA:C1ASM1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM1"
FT                   /protein_id="BAH48470.1"
FT                   /translation="MTYQPDNGPSRELNSEFRPQDDAHTMRNHVGEAITDGRNWPGYIL
FT                   IATGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVLGTVLVLLERRRVKALEGETLTDQ
FT                   EGH"
FT   CDS_pept        192477..193058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48471"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM2"
FT                   /protein_id="BAH48471.1"
FT                   /translation="MTDPKADLHDYLQAARDALLWKLDGLSEYDIRRPMTATGTNLLGL
FT                   IKHLTGVEIGYFGEPFGRGVDFPPWVTDDAEDNVDMWATADESRDYVVGQYRQAWEHTD
FT                   ATVRALPIDAPGRIRHWPEDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTAGLRA
FT                   DNDNLPTAERTWWESYRARVERAAREAGQG"
FT   CDS_pept        complement(193065..194798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48472"
FT                   /db_xref="GOA:C1ASM3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM3"
FT                   /protein_id="BAH48472.1"
FT                   /translation="MKRRVSARKVAHRRRIAGSLVAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDSPRPGTHQMLVAPDGTPLPASYSSNYTSPWIDEV
FT                   VNAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGY
FT                   SEGADVARRVAMEVGNQDGQDGSYDILDPASVVGVVILADAGRNLGEGAFPGAENEFRN
FT                   PDGFDLAYQSGQTSTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAI
FT                   NVGRQLNVDALQKEGLTPATGQDLAVVLGQIALAAFADIQSQDNWMQSDETFLDVLVKV
FT                   SDPAYKPADPVAAQSDTPTGPISSNQAVDLVYLPTKVRNEIIGFIADNQNTIQVAMSDP
FT                   YQQTLGEGTGHHFDYWRDANAGNGRPLTSAQYAAAWLTHLAQEAEKGEARSAASQQATA
FT                   KLAAASTPDTEAAQVAPTTTAGAKKPALASDAVSATTTTTGSPAPTTVASTTSPEPTTA
FT                   EPTTAVEVATPNTTSPPAAQAVSESSAVATTTAEPAASTATESATTTPVVTTTTVQPAA
FT                   G"
FT   CDS_pept        195299..196024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48473"
FT                   /db_xref="GOA:C1ASM4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM4"
FT                   /protein_id="BAH48473.1"
FT                   /translation="MSNDPSEAAHVGRDSPSAVFAKLAEMVYNGDDFDHVYQAICDAAA
FT                   TLVPGCAHASLMLKQKDRHITVAASDEVAAHVDALERAEQEGPCLDAIENDAPQVEAEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLLIHGRKVGALNLFADNPGEFTDESIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLRDGLASNREIGKAIGLLMAFHDISEDRAFELLRKTSQDMN
FT                   IKLTSVAREVIVHHNSKFD"
FT   CDS_pept        196338..196670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48474"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM5"
FT                   /protein_id="BAH48474.1"
FT                   /translation="MTVEFAAEADATVGRISGEIDVLAAPSFALALARLTDGVSSARVI
FT                   VDMTAVDFVGTSGLSILSEFAESARRQHITWALAGNRAVLRPIEAIGLSATIPTCSTLH
FT                   DAVDRV"
FT   CDS_pept        196701..197372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48475"
FT                   /db_xref="GOA:C1ASM6"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM6"
FT                   /protein_id="BAH48475.1"
FT                   /translation="MPGKQPTRGRSTSGAGETVRMLLDKAGPTYASASHITLKDTPTPL
FT                   FQLLTLSLLLSTRISSEIAVSAARELFRARLRSPRAMREADRRTVISALGRGNYVRYDE
FT                   STATRLHAAAVRVDEEYGGDLRRLASACDHATSAAVRLLTEFDGIGPVGADIFLREVQD
FT                   VWSWVRPYFDTRARESARDLGLPDDPHALYDLAPPGRVAELAAALVRVSLDSQLRDEVR
FT                   G"
FT   CDS_pept        complement(197622..197843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48476"
FT                   /db_xref="GOA:C1ASM7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM7"
FT                   /protein_id="BAH48476.1"
FT                   /translation="MIRTTVQQHDQRTMSPPAEEPAAKHTLRPTVYIASISAATATAPA
FT                   IVVTGSILVAVATSVTVLAAVALAALLI"
FT   CDS_pept        complement(198083..199066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02300"
FT                   /product="putative metal ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48477"
FT                   /db_xref="GOA:C1ASM8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM8"
FT                   /protein_id="BAH48477.1"
FT                   /translation="MDVRFVSDDGVRSCAATELKELLDRPDGLVWVDIPTWDDQAHDTL
FT                   TTVFDCHPLAVRDSKNRNQVPKVHRYVDQLFVVLHAPQSGAHGHVHYVELDQFIGARYL
FT                   VTVHGPVNPAIDPSTAMVEVNVVLSRLESGKLRPGTAFELSFALLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGDPETFLDEMFRVRHGLLTVGTMAALSGEVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMARGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWPAVAVIVLVMLAMSGALLVWAKRKGWF"
FT   CDS_pept        199173..199586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48478"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM9"
FT                   /protein_id="BAH48478.1"
FT                   /translation="MADNRTGLIVVDAANVVGSRPDGWWRDRAGAARRLLVQLDALEQH
FT                   LDQPAEVVVVIEGAAKAAVAGDPNRELNGLRVVSAHGSGDDAIVDVVAAEKDGERQITV
FT                   VTADRGLRARVEALGAVTVGPRWLFARIDAASS"
FT   CDS_pept        complement(199590..201212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02320"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48479"
FT                   /db_xref="GOA:C1ASN0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN0"
FT                   /protein_id="BAH48479.1"
FT                   /translation="MTVQTVDAVVIGAGPNGLAATATLAAAGWDVVLLEQQPEPGGAVR
FT                   SAELFPGFRTDLFSAFYPLAAVSPAIRHLDLGGVGLRWSRAPAAVGHPRHPDDDDAPLI
FT                   RRDPADTAADLERRQPGDGQAWLRLFEQWKDVKEPFLDTLFRPFPPVRGPRRLLSQLGT
FT                   AEALRFVRFLMLPARRMTHELFDGDAARVLLLGNAMHADTPVDSPGSGVMGYLLTMLAQ
FT                   DDGYVVPVGGAGALSAAMAERARRDGAHVRCGEEVTSIEVSGGAATEVRTAGGDRYLAR
FT                   RAVLADVSAPALYGRLLDSSVVPVGVRADLEKFEWDTPVVKVNYALDRKIPWRSRNLES
FT                   AGTVHLGADDDGLVRWMADLTTGVVPERPFLLFGQMTTSDPSRSPDGTESAWAYTHLPR
FT                   GVTDDESAERLAHRVDAMLESHAPGFAERVVGRNVQRPGDLEASNANLHGGAVNGGTAQ
FT                   LYQQLVFRPTPGSSGPYTSIDRLYLASSATHPGGGVHGMCGYNAAHAALADDGRWGWAR
FT                   KKVRGRILDLVAAPDGQQSPRHR"
FT   CDS_pept        complement(201217..201729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48480"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN1"
FT                   /protein_id="BAH48480.1"
FT                   /translation="MTHVFDRVAEGKREESVQYSFEGVVVIEAHRDTSASASEVWSVLA
FT                   NGWLYPSWVVGATRMRAVSADWPAVGSRLHHSVGSWPALIDDSTEVLFAEENRELRLLA
FT                   QVSPTKAVVRLRLEPRESGCHLEMSEAAASAPLTWVPRIAQDLAVLPRNLECLRRLSFL
FT                   AERNTKP"
FT   CDS_pept        201773..202462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02340"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48481"
FT                   /db_xref="GOA:C1ASN2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN2"
FT                   /protein_id="BAH48481.1"
FT                   /translation="MSSETPSSTRAALFDVDGTLVDSNYLHVRAWQRAFREVGHDVDAW
FT                   RVHRAIGLDSSLLLESLLGDDARMLGQRAKDLHSTYYLGARDSMRPLAGARDLIRELHG
FT                   RGVQVVLATSAPEEELDVLREVLSVDSFIAHATSSEDVDDAKPDPGVLRAAMDRASVSA
FT                   DSAVMVGDAVWDAKAASRAGVTFVGVLSGGISRAELTEAGAVAVFEDAQDLLDHLESSP
FT                   LSALLGN"
FT   CDS_pept        complement(202459..202680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48482"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN3"
FT                   /protein_id="BAH48482.1"
FT                   /translation="MMSDSKKEFVALRLDEVIHEWEANAPAGGSGSEGPLVTAQRHRAE
FT                   IDSASDDRVDEIAEAYPEIAQAWSSRGA"
FT   CDS_pept        complement(202699..204027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02360"
FT                   /product="putative NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48483"
FT                   /db_xref="GOA:C1ASN4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN4"
FT                   /protein_id="BAH48483.1"
FT                   /translation="MTYESAGEPTRVVVVVVGSGFAGFECARALARRLRGTEARVIMIS
FT                   PHDYMLYTPLLPEVAGGILDARFVTVPLSEALPDVELVTGRVDAVDFEARTVHVTDCEQ
FT                   GFEQVAWDRVVLTPGSVTRLFDIPGLAEHARGLKTPAEALYFRDQLLTQIELAERDTDP
FT                   RVADARRTVVVVGASYAGTELTAQLRALADEAASRRNLDPAKIRFLLLDVAGSVMPEVG
FT                   EKLGDKVLDVLRSRGIDVRLDTTLTELGPEHVTLDDGTVVPTRTVAWVTGVTASPLVDT
FT                   LGLPTEKGRLTVRPDLSVDGHPDVFAGGDAAAVPDPKNSGSITPPTAQHAVRQGQALAR
FT                   NVAASLGVGDAKPYTHRDMGLVVDLGPGFAVANPLGIQLSGFLAKVVTRAYHLYAMPNA
FT                   ANRWAVALAYLTDLIFPRPLVSIGLVTDSESPFAAGEEIGAQA"
FT   CDS_pept        204160..204429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48484"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN5"
FT                   /protein_id="BAH48484.1"
FT                   /translation="MSAASKAMYKPLALAASVAGGIAASAVFGQVWKRLAGESEVPDPK
FT                   DLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHADPR"
FT   CDS_pept        204469..205116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02380"
FT                   /product="PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48485"
FT                   /db_xref="GOA:C1ASN6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN6"
FT                   /protein_id="BAH48485.1"
FT                   /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLEADLGLAEHV
FT                   IDASGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAKIA
FT                   RRRHPEHVVPDEVRDVFTEMGSVAVAQARETEQVLQHRDPERARGLLTADEAMDDLHRS
FT                   LFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
FT   CDS_pept        complement(205201..205902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02390"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48486"
FT                   /db_xref="GOA:C1ASN7"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN7"
FT                   /protein_id="BAH48486.1"
FT                   /translation="MLSTGDGRCVDLGGGSGHRGGRGGHREAVPGSSLTVSLPRNNFDL
FT                   GAGAEYVFVAGGIGITPLLPMIAAAEAAGAAWTMHYGGRSRQSMAYLDEVAVYGDGVGV
FT                   LPQDEYGVLPLADILARSAPRAQVYCCGPEPLLAAVESVIGPRDAQRLHVERFRPRPTD
FT                   EESAPDRDFTVRIESTGATVRVGEGQSIVDAPEGVDDRRGDVVPRGHVRELRDLGSRRR
FT                   GMPSRFGAFRR"
FT   CDS_pept        205986..206438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48487"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN8"
FT                   /protein_id="BAH48487.1"
FT                   /translation="MFVLLRHAHAIGQQDWTASDALRPLSDLGRDQATGLIGTLAGVDL
FT                   HVLYCSPTTRCLDTLAPLAAARGLHVQEHPLLAPDAATDELCAALDAIDLAGTLWCTHG
FT                   EILTALAAITRADGTPAFPIGHTAKGGAWLLNARTPLRYLDPDPPQ"
FT   CDS_pept        206954..207991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02410"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48488"
FT                   /db_xref="GOA:C1ASN9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN9"
FT                   /protein_id="BAH48488.1"
FT                   /translation="MNAARMRRLRPVPDTRPQMMFRTIHGYRRAFRMIGEGPALLLLHG
FT                   IGDNSTTWTEIIPHLAENYTVIAPDLLGHGRSDKPRADYSIAAYANGMRDLLSTLGIDH
FT                   VTVIGHSLGGGVAMQFAYQYPQMVDRLVLVSPGGVTKDVHPVLRLAATPIVNEALKLLR
FT                   LPGAVPVMRWAGALLTRLHGTPLRPGAALHDTPDLVRILTDLPDPTAHEAYLRTLRAVV
FT                   DRRGQMVTILDRCYLTESIPVQLIWGGRDTVIPVGHAHLAHAAMPDSRLEIFEAAGHFP
FT                   FRDDPMRFLHTVEKFLSDTRPLPFDEARWRQLLSTGTAENPVTTDPAMRTDVLDAVGSS
FT                   QRSAT"
FT   CDS_pept        complement(208036..209244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02420"
FT                   /product="putative S12 family peptidase"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48489"
FT                   /db_xref="GOA:C1ASP0"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP0"
FT                   /protein_id="BAH48489.1"
FT                   /translation="MGDRPLHRFRTRQRSSRQTLRVLGMAVAVVLSAVTGCAQSAGTAE
FT                   TDSTAGLSQHVVSSASAMLDKFVADGRTPGAVVEVSTPDGVWTHTAGRSATSPDTPMYA
FT                   QLQHRIGSITKTFTTTLILQLVQEGKVGLDDPVSRYVEGVPNGDRITLRMLGTMTAGLS
FT                   EYLANPDFRNRFFEDPMRVWTPSELLDASYALGAQFPPGTDSDYSNANTVLLGLVVEKV
FT                   AGAPFGDVLTDKILRPRGLDHTVWPVDASFPQDHVLGYTTLDPVRGVTDSTSWSPTQAY
FT                   SAGQMISTAGDLTQWIRLLGRGDLLTPELQAERLRWQPLGDNDDNWHYTFGLEENSGWI
FT                   GHNGAIPGYMSYAVYHPALDATIVLLINSDAAIDGEPPVNVLLRDLSPVLFPEQPVRVP
FT                   VVR"
FT   CDS_pept        complement(209467..210372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="ROP_02430"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48490"
FT                   /db_xref="GOA:C1ASP1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP1"
FT                   /protein_id="BAH48490.1"
FT                   /translation="MTVSSAPAAPFGRVLTAMATAFTEDGELDEEATARIALHLVDHGH
FT                   DGLVVSGTTGEAATTTTAEDGRILRVVKDAVGNRAKVVAGVGTNDTRHTLELARQAVVH
FT                   GADGLLLVTPYYNKPSQGGVLQHFRYVVDAVDTPVMVYDIPSRAGTKLAPSTFEAMAGW
FT                   PSVVAVKDAAGDPTQAILLRELGFAVYSGDDSLTLGFLAYGACGVVSVLGHVAGDEIRA
FT                   MIDAFFSGDVESAREINARLQPALRAVMGVPNYGATTVKGALQLLGVLQDRTVRSPLLA
FT                   LDDVEYEALRAGLSASELLP"
FT   CDS_pept        complement(210421..211026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48491"
FT                   /db_xref="GOA:C1ASP2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP2"
FT                   /protein_id="BAH48491.1"
FT                   /translation="MRSAHGCGDRSFENSGLDMSDGSVERDQDDEWNYRARHETETQRL
FT                   DRNWAALLQELRVVQTGVQLLTGFLLTLPFQQRFTDLTDFEVIVYLMTVALSVLSTMLL
FT                   VAPAGFHRVLFRRHALPALVSAAHKLTVCGIATFGAALVGVVLLIFSFVVSPRVGLVAA
FT                   VVAAGIFCGLSVLAAILRLRNRVDDDPPTSDQRRSDRD"
FT   CDS_pept        211185..211454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP3"
FT                   /protein_id="BAH48492.1"
FT                   /translation="MRSSQRARTKLTRVDTGEHHLFMNSAEEARQILQVTTRLITKFPA
FT                   VPRESVEAAVQDAVVQFEGGRIRDFVPLLIERTATANLVSSVNA"
FT   CDS_pept        complement(211503..212117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02460"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48493"
FT                   /db_xref="GOA:C1AR16"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR16"
FT                   /protein_id="BAH48493.1"
FT                   /translation="MSAMDPGYFESMYAESADPWGFDERWYERRKYALTLAALPRPHYR
FT                   RAFEPGCSIGVLTAQLARRCDRVVATDVVSGAVERARDRLRREGVAGRVELCLASLVGP
FT                   WPPGTFDLVVFSEVLYYLTPAELGTTLNRAVDSLEDGGTLIAVHWQHHVPEYPQTGRAV
FT                   HDAIAATDGLDPAGSYRDTDFHLDVYTRGPVPSVAAADGLS"
FT   CDS_pept        complement(212114..212887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48494"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR17"
FT                   /protein_id="BAH48494.1"
FT                   /translation="MGNGTRFRDTPVAARGTPEEVWQSWLGSVHCPPIPLKDCDRMVVV
FT                   APHPDDEVLGVGALMATTATAGVPVQVVAVTDGGASHPQSPTLPPAALAAARIAESNRA
FT                   TALLGVGEPLRFGLPDGGVSAHEHELTTRLVDVLTATCRAGERVWVLATWRGDGHPDHE
FT                   ATGRAAAEACSITGHRMVEYPVWMWHWARPGEASVPWNRIRVLAPTADILARKRRAVDE
FT                   FRTQILPLSDDPRDAAILPPWVLARLMRPTERVLW"
FT   CDS_pept        complement(212890..213855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48495"
FT                   /db_xref="GOA:C1AR18"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR18"
FT                   /protein_id="BAH48495.1"
FT                   /translation="MSTDVTHDSTPTSAAVRAIIRSGEAELPLPGDGSTAVRWGRLTEW
FT                   CRRDLSIGRLLEAHADADAILAEIDGTRAGRNEWWGVWASEPPQPVLDAAHDSSGWRLR
FT                   GTKAWCSGASMCTHALITARVDGRPRLFAVDLREPGVTPGRGGWRNPGMAATDTEAVTF
FT                   DSVPARPVGSADRYLDRAGFWHGGIGVAACWFGGALAVAEPLRVRARGGRADSHQLAHL
FT                   GAIDVAVSAARWALASAAAEVDSDPLDRRSAQVRAFRVRGLVERTASEVIDRVGRALGA
FT                   APLASDADHASTVADLLVYIRQSHAERDLATLGELVAGED"
FT   CDS_pept        complement(213852..214535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02490"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48496"
FT                   /db_xref="GOA:C1AR19"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR19"
FT                   /protein_id="BAH48496.1"
FT                   /translation="MIGKDVMRVEHITVVVPAHDEEALLPRCLDGVRTAARAVSVPVTV
FT                   VVVLDGCTDGSEAVARAADVDVVVLGARNVGAARRAGFGSVAPRPHEWFATTDADSVVP
FT                   AHWLSSHLQHAGHGAQLVAGTVSVTDWSGWPDHVRSRYGSAYRAGAAHGHVHGASLGFS
FT                   ADLYRAVGGFASLPAHEDVDLVQRMVEHGADVVWSIDAPVETSARSDARAPLGFATYLE
FT                   GLQDR"
FT   CDS_pept        214631..215158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02500"
FT                   /product="oxidoreductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48497"
FT                   /db_xref="GOA:C1AR20"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR20"
FT                   /protein_id="BAH48497.1"
FT                   /translation="MNAADSPRYRKIVLTVDGEERTLDVDTRTTLLDALRDHLGVTAPK
FT                   KGCDHGQCGSCTVLLDGRRATSCLTFAVAHDGARVVTAHGLADGDVLHSVQQAFVEQDG
FT                   LQCGYCTPGQICSAIGMFDEFLALQPSAVTENLTAPPELTDDEIRERMSGNLCRCGAYP
FT                   NILAAIRQAAEA"
FT   CDS_pept        215155..216147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02510"
FT                   /product="oxidoreductase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48498"
FT                   /db_xref="GOA:C1AR21"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR21"
FT                   /protein_id="BAH48498.1"
FT                   /translation="MIPFDYERASDVDSAVATVTADPGASYLAGGTNLVDHMKLGVARP
FT                   HLLVDVSRLPLDDVEALPGGGLRIGAAVRNSDLAAHEVVRARYPMLSRALLSGASGQLR
FT                   NLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSALGGYVRYHAILGASEHCVAVHPS
FT                   DMAVAMTALDAVVVVRTADGERRIPLREFYVLPGDRPDRDTVLGHGDLVTAVELPAPPA
FT                   GNRSTYRKVRDRASFAFAVTSVAAELTVDDRSITSARVALGGVAHRPWRATRAEEVLLG
FT                   SPPTENTFTAAAEAELAAAQPLPGTEFKVVLTRRVLVSVLRSLAEEARR"
FT   CDS_pept        216144..218240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02520"
FT                   /product="oxidoreductase molybdopterin-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48499"
FT                   /db_xref="GOA:C1AR22"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR22"
FT                   /protein_id="BAH48499.1"
FT                   /translation="MTLVEPKVIGTPAERLDAHDKVTGTASYAFEHTVDDPAHLYPIPS
FT                   TIGRGRVTAVHTTDAEALDGVLAVLTVFDAPRLADTSDGELAILQDPEVHFRGQFVGAV
FT                   VAESPEVARHAAGLVRVDYDEASHDTDFRSGRDDLYAPDEVNAGFPTDTDDGDVDAALA
FT                   GSTVTVDQVYSTAMEHNNPMEPHATIAQWTPGGSGPVLTLHDSTQGVHSVRKTLAPLFG
FT                   LEVEQVRVIAPYVGGGFGSKGLPHAHNVLVVLAAQRVAGRPVKFALTRQQMFALSAYRA
FT                   PTVQRVRLGADADGRLTALSHEVITQSAKIKEFAEQAAVSSRMMYSAPTRRTTHRLAAL
FT                   DVPAPSWMRAPGETPGMFAAEVALDELAAACRLDPIELRIRNEPEVDPSTGRPWSGRRL
FT                   TDCLREGARRFGWADRDATARSRSDSEWQVGLGVAAATYPANTMPGSVARIVYQSDGTY
FT                   TVQIGSVDIGTGAWTALTQIAADALGCPLDSIVLQIGDTNLPPATVAGGSTGTTSWGSA
FT                   IVAAARAFRAEHGTNPSPGAEAAAGTLDNPDAAEFALHSFGAHFVEAHVRRDSCEIRVE
FT                   RMLGVFAIGRVVNARTVRSQLIGGMTMGVSMALHESSVNDPRFGHVVTQDLASYHVSTH
FT                   ADIGYLDAVCLDDVDEHAGPMGSKGAGEIGIVGAAAAVANAVHHATGVRVRKVPIHLDD
FT                   LLPG"
FT   CDS_pept        complement(218251..218580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48500"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR23"
FT                   /protein_id="BAH48500.1"
FT                   /translation="MTAVATETEGEPEEAFGTEWLRLALRRCELLAQMHSVSSDARWMI
FT                   SFAIQWAPFGGASAAELLERFGVNRRRFMELVLDGLAPKAGDIQKIRAMKAQLRTSLVQ
FT                   AWGVQ"
FT   CDS_pept        complement(218577..218966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48501"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR24"
FT                   /protein_id="BAH48501.1"
FT                   /translation="MTTDGMTRWQGIAQKCELMIQRCLNCTTLLAPLMATCSACQGSNL
FT                   ERVPSCGVGSIVSSKVVDRGLSGLDRGRVPCTIAIVELDEGPWVYTWIDGDVPAPSDCP
FT                   VRVEFRPASTAEQLPVFAVRAGDQR"
FT   CDS_pept        complement(219245..221602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02550"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48502"
FT                   /db_xref="GOA:C1AR25"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR25"
FT                   /protein_id="BAH48502.1"
FT                   /translation="MRRGLRVESDGVMPAAVKGTVGNLPHELTSFVGRRREVTEARRLL
FT                   SMSRLVTLAGIGGVGKTRLALRVAADASRAFEDGVWLVELGELDDDTTLVDAVSSALRL
FT                   REQRTGNPEVLLTEYLADRQLLLVLDNCEHVVAAAAALSETLLRSCPELRILATTREPL
FT                   AIGGEAVLRVPPLTVPEPERTSLQGLPQYEAVTLFVERAATAVPEFELTDENHVAVARI
FT                   CRQLDGLPLAIELAAVRLRVMSAEQILQRLTDRYRLLTVGSRGAPSRQQTLRLCVDWSH
FT                   ELCTDEERELWARLSVFAGGFELDAVEGICAGDLPVENVLDVVASLIDKSILIREEVGP
FT                   AVRYHLLETVRDYGREKLQETGELVALRRRHRDWYEQLVVRCEAEWIGPRQAMWIGRLD
FT                   AEKLNVRAALHFCLTEPGEAEPGLRTAAALYPYWRARGLLREGRRWLGQLLGRHPGGAS
FT                   RERIEALYVDSVLAGMHGDREAAKALVDEGAVLAQRNGDPLLGALVVHAAGCCAMFAGD
FT                   LPRARACFEEALPVFRDRGSLLQLTWGLLGVALVSGMQGDGAVAKMCGSEIFALTEAHG
FT                   ESVYRGWSLWAAGMAAWQRGHLALADDYVKQGLRLSHLVDDRISACGALEVLAWVAVGS
FT                   GRARNAAELMGAAEAVAQAVGNPSTVYPNLLVHHAECEQQARAVIGDRAFDAAFDHGMH
FT                   TSFDDAVALALDERRPDAAASSNGTPHLTKRESQVAELVADGLTNKAIAARLVISQRTA
FT                   QGHVEHILAKLGFTSRTQIAAWIVEHAQDPHP"
FT   CDS_pept        complement(221697..222383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48503"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR26"
FT                   /protein_id="BAH48503.1"
FT                   /translation="MHPSTRTAVVTGSDSPMGRAVALALADDGFDVGLAYVADRDSAEA
FT                   TAADVESRSVRAAVQHMDLADLPGSADAVDEFARDLGGIGVLVSCPGSTAVECIQRAVR
FT                   YMIAGGGGGRVVNVTTSSSGLGGLTGLLAAELARYSITVNSVVVPAVEPDFAAPGPGDR
FT                   EVAAVASYLCAPAGMFVTGAAYVVDGARIAMIPHSLTEAGALRPPRRAGRIRSYTGRWA
FT                   PTRWTR"
FT   CDS_pept        complement(222505..223725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02570"
FT                   /product="putative lipase"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48504"
FT                   /db_xref="GOA:C1AR27"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR27"
FT                   /protein_id="BAH48504.1"
FT                   /translation="MKRSRITSLTASALCAAFVACSAVANAGVATALPIYPASDPDPFY
FT                   GQPQGLAEAAVGEPLAVRPMPPLLAFPDTDVWQVKYRTTNSEDHPISSVTTVLVPRDRP
FT                   VNGPLLSYQHIINALGPRCAPSRTLYSNDPDLQIKEAPALNLALQRGWTVALPDHLGPN
FT                   SAYGAARLGGTITLDGIRAVQRVPELAVAESPVALAGYSGGGMASAWAAALAPTYAPEL
FT                   NIVGVAEGGVPMNIGKMANGLGMQPHPAFGLAMAAALGLEREYPDKLPISEQLNDRGLA
FT                   MRDEMVNACTNGILAAGAGRSATEVAKTTDLMSSPQAWEVLNENSVELYPGVPTAPIFE
FT                   WHSPTDVLIPVDSIEATVARYCAAGAKVQSDLFPSPDHLTTAVLGLPTALDYLDARFRG
FT                   DPAPSNC"
FT   CDS_pept        complement(223844..250627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02580"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48505"
FT                   /db_xref="GOA:C1AR28"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR28"
FT                   /protein_id="BAH48505.1"
FT                   /translation="MTSVNSPQPNDGAGDVNVPEGAFPLSSVQRSMWFAQQLSPTVPKF
FT                   IAQYIELRGEIDLDLLSDAAVRAGQEFQSPFLRLLDVDGEPYQAVDFSIDPSIGFLDFR
FT                   GESDPMDAARRWIDEDYATPLRLTRDRLVQMNVLQVGEQHYLWYTRIHHVALDGYSGMT
FT                   MVNRIAALYTAAIEGTEPEPNRALDLRELYELDQKYRKSSRFENDRLYWAERIVGIEHG
FT                   STLATHDAPAAAQSRLESARISESALGFLGESDQRVGATSAAVLLAGFACYLSRMTGKR
FT                   DVLINLPVSARTTAPLQRSGGMLVNVAPLRITVRPEDTVAELVQRTQLELMGALRHQRC
FT                   SLEDIRRDAGLAGTAEGLAGPMVNVMLFHQAFTLGTVSGEYHIVTSGPVDDLLVNIYQG
FT                   GDGETLLDFRGNPNRYGSEELRAHHRRFVELIEEFVAAEPQARTADIHAESARLGARFL
FT                   EQESQLAFWKRELAGLPEVTGLPLDRPRPAERAGAGEVVGFAVDAEVRHRAALLAEEAG
FT                   TGIFTTLHAALAVLLGRLGDTDDVVVGTPIVGRDTTDSEDPEAGAFFNKAVLRSQVDGA
FT                   SSFTDHLSRVRDADRAAFSHAALPFDDLVAAVVADPDPSHTPLFQVMLEFTDGGHPHDS
FT                   SGTVTVSPIQREHRALGLDLVFSLTESENGGINGRLRFATDVWDRDSAEALAARFVRIL
FT                   HAVTADPAAPIGDVDLLEPAEYAELAPVRDEPAVEPRTLPGLLAGAVTAGGDGDALVYE
FT                   GRTLTYPELDELSNRLARMLIGRGVGPGSVVALAIARSIESVLATWAVAKSGAAFVPVD
FT                   PNYPADRIEHMLTDSGAVVGLTATAHRSSLPTITPWLVMDDPSFSRELEQHTAGAVTDA
FT                   DRLRPLRTADPAYLIYTSGSTGTPKGVVVTHVGLANFAEDERQRFDVTAEARTLHFSSP
FT                   SFDASILELLLAVGAGATMVVAPSTVYGGTELADLLRRERVTHAFVTPAALASVDPTGL
FT                   DHIRCVVTGGESCPPALVQQWAPGRVMFNAYGPTEATVVASVAGPLTVGEPVTIGRPSR
FT                   GCGLLVLDSRLHPVPAGVPGELYITGDGVARGYHDRSVPTAERFVADPHGTPGERMYRT
FT                   GDLARWNAAGQLEYLGRTDFQVKIRGFRIELGEIDAVVRSHPSVAFATTVGRTAPSGDT
FT                   ALVTYVLPEDGAQIAVGDILEHAAAALPAHMVPARVMELLEVPLTPAGKLDRKALPEPQ
FT                   FEATSTVYRAPVTPTEMQIAEVFATLLGVERIGVDDSFFDLGGDSLVATRVVSRVNSAL
FT                   GTEIGVLDLFEAPSVALLSARVDAAGPRTSARPVLAPRAGSGPVQVSLAQQRMWFINQL
FT                   DTASPAYNIPVGIRLRGTLDVNALRTAVSDVLTRHESLRTVFPNTPNGPIQVVLPAAEV
FT                   SPRLDVIEVAESELESRLIDDAATGFDVTVEPPIRAELYRTATDDHVLVFVVHHIAADG
FT                   LSMTPLTRDVMVAYHARAAGEAPQWAPLEVQYADFAVWQRELLGSPDDPTSLLSRQLAF
FT                   WARTLDGAPEVMDLPTDRPRPARQSMIGATADFTIPARIHTALLDIAAANDASLFMVVH
FT                   AALAVLLSRSSGSSDVSIGSPVSGRGERQLDDVVGMFVNTVVLRTTVDPDRNFPEILSH
FT                   TRSVDLEAFSNTDLPYERLVDELKPTRSEAHSPLFQVMLVLQGFANTRLELPGLDVEVE
FT                   ALETGAAKFDLQVILTEHIEDSGAPGAIDVQFSYASELFDPPTMTALAARFVTLLETVT
FT                   AGSDAKVGDLDLIGADETHRMLEQWIDTDVPVPDSATLVSLFESQVARTPDAVAVVFAE
FT                   EELLYAEFDARANRLARELLARGVGPESRVAVALRRSLELMIAIYAVEKTGAAYVPLDP
FT                   DHPASRIAYVIESAEPACVLTASRDRCEGVDSADAAVIEIDTLNLSQRPSTPITDAERG
FT                   GPIHPDSTAYVIYTSGSTGRPKGVAVSHRAIANRLLWMQDTYRMDHTDVVLQKTPVTFD
FT                   VSVWELFWPLEVGARLVLAAPDGHRDPTYLSHIIADHQVTTMHFVPSMLAVFTAGAEPD
FT                   LCGSLRQVFCSGEALPPATADSFREFGSAALHNLYGPTEAAVDVTFWECTEGDRASVPI
FT                   GAPVWNTQLYVLDSRLHPVPVGVHGELYLAGVQLARGYVGRSDLTSDRFVANPFGAPGQ
FT                   RMYRTGDVVRWRADGNIEYIGRRDFQVKLRGQRIELGEVEAAVLAHPSVAQAVVTVHRS
FT                   EATGESLVGYVIPVAGADIDTAVVRDAAAEALPAYMVPTRIIVLDRFPLGATGKLDRGA
FT                   LPEPEFLSPSAEFVTPRNPIEEILASIFADLLDAPRIGVYDSFFDLGGNSLVATRLVAR
FT                   VNAALGSRIGVREIFDAPTVAALATRIESEAGQGAERPPLVAGVRPAHLPVSLAQKRMW
FT                   FINQFDLDSPAYNIALAVRLTGDLDEDAMQDAVADVMDRHESLRTRFPMVEGEPLQVIL
FT                   PTEDVVPDLTPIDSTEGQLPEHISRLAGAGFDVTVSVPVRAALYRTDPGEHVLVIVVHH
FT                   ISADGFSMAPLARDVMTAYAARTGGQAPDWTPLPVQYADFALWQHRVLGNADDPDSLLA
FT                   AQLDYWTHTLAGLPELLALPTDHPRPTQQSMRGGIHSFSIDRQIHSRLITTAREHNSSV
FT                   FMAVHAALAVLLARLGDTDDVAVGTPIAGRGDAALDDMVGMFVNTLVLRTPVEPSGTFT
FT                   DLLSTVRDADLNAFHHADLPFERLVDAISPERATSHSPLFQVVLEFRNNERPRLELPGL
FT                   TVTGLDLATDISNFDLQLTLTEEFGVSGEPAGISVAFTYASSLFDASTIAGFADYLQRI
FT                   FDAVTSEPGMAVGDIDLMVASERAALTPVMDGPDAEPRTLPELLASAASVDPKAAALSY
FT                   EGSEVTYRELDERSNRLARLLIGRGIGPESVVALAMARSPESVLSLWAVAKTGAAFVPV
FT                   DPNYPTDRIVHMLSDSGAALALTVAEFRPTLPDCTPYVVVDAPGFGDQVSAHSAAVVTD
FT                   ADRTHPLALENPAYLIYTSGSTGTPKGVVVTHRGLANFATDERVRFGVTPRSRTLHFSS
FT                   PSFDASILELLLAVGSGATMVIAPASVIGGTELADVLREGRVTHAFITPAAMASVDPAG
FT                   LDQLECVATGGDVCPPELVAQWVTGGRRMFNAYGPTEATVVSSVTGPMLPGEGVTIGRP
FT                   PMGTGEMVLDSRLHPVPNGVTGELYVTGSGLARGYKDRAGTTAERFVANPYGGLGARMY
FT                   RTGDLARWNTDGQLEYLGRSDFQVKIRGFRIELGEIENALTRYPGVARSVVSAHRGSTG
FT                   ANRLVGYLVPTAGAELDPEAVLDFVGGFLAPYMVPSALIVLDQLPLTPAGKLDRRALPE
FT                   PDFGARVSTGRAPVSEMEEVLAGLFAEVLGLESAGVEDSFFALGGDSIMSIQLVARAKA
FT                   AGVVLTPRDVFEAKTVAGLAAVASWIGAADIVVLDELPGGGVGDMPTTPITKWLLERGG
FT                   EFNRMSQSALLTAPPNLRELEPLIGTFQAVLDRHDMLRAQLMVSADESHLAVRPIGAVE
FT                   AQDLIRRVAVSAAPGTPAFAATVIADLDAALDRLDPAAGVMMQVVWFDAGESGGRLLVV
FT                   AHHLVVDGVSWRILVPDLATAWAQISAGQEPALEQVGTSMRRWAHGLVDEAANRAGELD
FT                   LWQRILDCEDPLVGSRPLDPDVDVNATVGRVTVQLPAEVSEAVLTALPEAIHGSVNDGL
FT                   LTALAMAVTQWRRTRGHTLHGRSVDGTLVSLEGHGREDQVVPGADLGRTVGWFTAMFPV
FT                   RLDLSGIDLDDAFDGGRAAGSAIKAIKEQLLAIPDHGMGYGMLRYLNADTAPLLAARSL
FT                   PQISFNYLGRFAADLSEAATRAGWTPTGEVDMDRAQDLDTPVTSAIDVNAVTTEVDDRP
FT                   QLRATWAYAAGVLTVAEVRELAELWVRALTALTTYAARPDAGGVTPSDLELVSLDQDAI
FT                   DRIESRFPALSDIWSLSPLQSGLLFHALLADESIDSYTVQVTLELRGAVSSRLRVAGQA
FT                   LLDRHANLRASFVYDEGGTPVQAVHGYAELPWTEIDLSALDEDSREAEITELLDTDRRR
FT                   GFDMATPPLLRFMLIQVGADEQRLIITNHHILLDGWSMPLLIRDLLTLYATEGDATALP
FT                   RVHPYRDYLAWMSHRSTEDSLGVWHRALAGVEEPTLLAPADAAAKSDTQSSELIVELDV
FT                   DRTDQLSVLAREHGLTLSTLIRTAWGIVLGGLVGRSDVVFGGTVSGRPPQIAGIESMVG
FT                   LFINTLPVRVTLDPRETLGELLERIQGEQAALLDHHYVGLTDIQSVAGPGAGFDTLTVF
FT                   ESYPVDREGLTEQTDIAGMHVLDVHDSANAAHYPLALIASAHENLQLKLEYVEDLFDRA
FT                   AVERIGDRVVRALIALAEHPGMKLAQLRLLTDVEEAELVPARGKPGRSVRTLPQMFADT
FT                   AAASGDATALVFGDRRMSYRELDERSNQLARLLIGRGVGPEDIVALGISRSIESVLAVW
FT                   SITKTGAAFVPVDPTYPRERVEHMVTDSGCTFGVRVGADRDRLPAAVTWLTLDDAETDA
FT                   AVGAMSTDTVTDDERVVPLRFAHPAYVIYTSGSTGKPKGVVVSHRGLDNFAEEQRDRYA
FT                   TDSASRALHFSSPSFDASVLEYLLAFAVGATMVIVPPSVYGGEELAELIRAEGVTHGFV
FT                   TPAALASVDPEGLDVFQNVVAGGEAVPPELVTRWAPGRTLYNGYGPTETTIMSNLSDHL
FT                   QVGETVTIGGPVRGVSEVILDSRLQPVSVGVAGELYISGEGLARGYHARAGLTSERFVA
FT                   NPYGEAGDRMYRTGDLARWRSDHTVEYLGRTDFQVKIRGFRIELGDIDSALAGHPSVAF
FT                   AVTLGRPGPAGDTVLVSYVLPEAESVLEPPELKEWTANLLPAHMVPSSIMILDEIPLTP
FT                   VGKLDRAGLPEPQFLPTSDAFRPPSTVLEHTIADVVTTVLGIERVGIDDNFFDIGGNSL
FT                   IATRVAARLTAELDTDIGVRTLFEAPTIHQLARLIESTAFAPAQDGDHVRLPLGPMAQP
FT                   AHVPVSLAQKRMWFLNQFDTSSAAYNIPLAVRLTGHLDVESLRAAVTDVFVRHESLRTV
FT                   FPSHDGEPTQVVLSPGQWTPNLEITEVSEAELREHIAGLATAGFDVTADVPMRSALFAL
FT                   APDDHVLVIVVHHICADGFSLTPLARDVMTAYAARIAGSAPQWNPLSVQYADYTLWQLQ
FT                   LLGDESDSESLISQQLRYWTDQLADLPELLQLPTDRARPVQQSFRGAQVDFTIPADVHR
FT                   ALSALARKHNSTMFMAVHAALSVLLSALSSTEDIAVGTPIAGRGDAALDDMVGMFVNTL
FT                   VLRSAVDPAAGFGALIDQVRGTDLAAFHHSDLPFERLVDVLAPERSTAHSPLFQALLEF
FT                   RNNETPRLELPELTAAAVDFDLEVAKFDLQLSVEEGFDADGVASGITAAFIYATDLFDA
FT                   GTVRTFADRFLRILTAVTADPQAPVGDIVITDAAERSAMATVWNTAGVEAGTDTLADRF
FT                   AQSVARFPGATAVTSEDVALTYAELDARANRLARLLIAQGVGPETLVAVALPRTCDLII
FT                   ALLAVIKSGGGYLPVDITYPADRLAFVFEDAAPNCVITTTGDVSALPDSETPAILLDDP
FT                   ETTADLAQQSPATITDADRVTPLDAASVAYVIYTSGSTGRPKGVVVSHRNVLTLFANTQ
FT                   PLYGFDENDVWTMFHSYAFDFSVWELWGPLLYGGRLVVVDYYTARSPEMFHELLRNEQV
FT                   TVLNQTPTAFYQLAETDRIVSEIDVNAAALALRYVIFGGEALDLGQLGRWYSRHDDAAP
FT                   TLANMYGITETTVHVSYLALDRAFAESASASVIGRGIAGLHVHVLDRRLHPVPPGTIGE
FT                   MYVSGDQVTRGYLGRAGLSSTRFVADPLRPGARMYRTGDLARWNTDGQLEYLGRSDFQV
FT                   KIRGFRIELGEIESALLRYRGIAQAVVLTRDDGHGGHRLIGYVVPESGATVEVSSALEF
FT                   VGTQLTSYMVPATLVVLDALPLTSNGKLDRRALPEPDFGARVSAGRAPATEMETVLAGL
FT                   FAEVLGLESVGVDDSFFALGGDSIMSIQLVARAKAAGVVLTPRDVFEAKTVASLAEAAS
FT                   WAGAADVVVLDELPGGGIGEMPVTPITTWLLERGGDFRRYTQTALLSLPAAADETLLKR
FT                   TIAAVVDHHDMLRARLVGAAPQWRIEVQATGAVDVDDVLHRVEVPSVVGSAFADVATRE
FT                   LDSAAERLDPEAGVMLQMVWFDAGTEGGRLLVVAHHLVVDGVSWRILVPDLATAWAQVS
FT                   AGQEPALEPVGTSMRRWSHGLVDATRERGAEIELWRRVLEADDPLIGSRPLDPAIDVAG
FT                   TVEKVTVEVPADVTDALLTRVPEAFHGGVNDGLLTALALALAQWRRGRGDLTRESLVSL
FT                   EGHGREDQVLPGADLGRTVGWFTAMFPVRLDLSGIDLDDAFAGGRGAGSAIKAIKEQLL
FT                   AIPDHGIGYGMLRYLGQDSADQLRALAKPQVTFNYLGRLGGATSTDVHGHAWVPVTDTK
FT                   LDDIPASDIPVASALDINAVTGTGPDGNRLRATWAFPTGVLTPSEVRALADLWVQALTA
FT                   LTTHVARPDAGGVTPSDLDLVTLDQDAIDRLEARFPALSDIWSLSPLQSGLLFHAQFSD
FT                   ATVDPYLVQLALKLRGDVNPDRFRRAGQALLDRHPNLRAAFVHDSAGASAQIIQQHVEL
FT                   PWSEFDLSALGPEETTREYERIVARDRSVKFDMADAPLLRLALVRLTDDEYRLILTNHH
FT                   ILLDGWSTPLVLRDLLTLYALDADGSLLPRVHSYRDYLTWMKRHDTTDSLDAWRAALDG
FT                   VEEPTLLAPLERGEAHSAVAEETAFTLSEEHTTRLRDLSRERGLTLNTVVQTAWGIVLG
FT                   GLVGRSDVVFGGTVSGRPPQISGIESMVGLFINTLPVRVTLDPWESLGELLERVQREQA
FT                   TLLDHHYVGLTDIQSAVGGGGTFDTLTVFESYPVDEAGLTEQTDIAGMFVLGIDGKDSA
FT                   HYPLAVVASGDARLNFKFEYLPDVLEESAVDEIADRLRRVLDALADRPEIPLAHMQLLT
FT                   EAELAEFAPVRGRPGFSVRTLPQIFEDAAALDPNRTALTFEGRNVSYRELNERSNQLAR
FT                   VLISRGAGPETFVALGIPRSIESVLAVWAVAKTGAAFVPVDPNYPMDRIEHMLTDSGAT
FT                   IGLTMAAYEKSLPDSVPWLQLDSPKFEKACQAKPALPVADSDRRSPISLDNAAYIVYTS
FT                   GSTGKPKGVVVTHEGLDNFAEDQRQRFAAAQTSRTLHFSTPSFDGSVFEYLQAFGVGAT
FT                   MVIAPPTVYGGAELAELIRSEHVTHAFVTTAALSTVDPEGLDEFQHVVFGGEACPPELV
FT                   TRWAPGRQLSNAYGPTETTVMANISDPMTVGEPITLGGPIRGVGELVLDSRLQPVPVGV
FT                   PGELYITGAGLARGYHRRPELSSQRFVANPFGEAGERMYRTGDIVRWRADHTVEYVGRS
FT                   DFQVKIRGFRIELGEIDNEIATFPGVGFAATLGAPGPSGDTVLVTYLLPVTEGGVDPAE
FT                   LTAHLSTRLPAHMVPTSIMFLDEIPLTPVGKLDRSALPAPEFHVTTTEFQPPTNDLERK
FT                   IVDIFTDVLGLERIGIDDNFFDLGGNSLVATRVTARLRDALDTDIGVRALFEAPDARSL
FT                   AERVADSVSGGARPALAPVERPDRIPLSLAQKRMWFLNQFDTSSPAYNIPLAVRLTGTL
FT                   DEDALRLAMADVLDRHETLRTVFPTVDNEPTQRILAAADAQPGVDTVPVDAADLPRHIM
FT                   DLVSRGFDVSTDVPVRAALFRTAPDHHVLTIVVHHICADGFSLAPLARDVMVAYTSRLA
FT                   GAGPQWAPLHVQYADYTLWQHAGLGSENDPESMINRQLRFWSEALAGLPDVIQLPTDRP
FT                   RPIQQTFEGDRVEFAIDADLHQRLTALARANNATMFMAVHAALAVLLSRLGSTDDVVIG
FT                   TPVAGRGEEALDEMVGMFVNTLVLRNRIDPSATFTELVQQIRESDLAAFAHADLPFERL
FT                   VEELNPTRSTSYSPLFQVALEFQNNENPTLELPDLRVENVDLETRVVKEDLEVILAERF
FT                   DQDGAPAGVAGGLDFAVSLFDPDTARSIADRFVRILAAVVADPDRPIGTVPMLDDAEID
FT                   EMVPARGKPDVRPEVWPDLLTAAAALDPDSVALSFEDRQVTYRELDEWSNRLARVLCAQ
FT                   GAGPETFVAIGMPRSIEEVVSIWSVAKSGAAFVPVDPTYPRDRIDYMLTDCRASIGLTV
FT                   AGRRDNLPDTVPWLVLDDHAFAKQVADVSSAPVTDADRTAPLHLAHPAYLIYTSGSTGK
FT                   PKGVIVTHRGMANLTAEEHERFQVTHDSRVSHLASPSFDASIFELMMAFGASARVVIVP
FT                   PTVFGGAELADLFRRNEVTHAFITPTALSSIEDVGLESLRVLAVAGEACPPELVEIWGK
FT                   HRNMHNGYGPTETTIQASVSAPMRPGGVVNIGAPALGFGSLVLDERLQPVPAGVPGELY
FT                   ITGPGLARGYHNRSALTSERFVACPYGEPGRRMYRTGDVVRWRGDHTIEYIGRTDFQVK
FT                   VRGFRIELGEIDAVLARHPAVAFAATIGHTGPSGDTLLASYVRAAEGHDLEPAELRTHA
FT                   SDRLPAHMVPSAVVVLDQIPMTPVGKLDRKALPAPEFGTTGAAFRAPTTATERIIVEAF
FT                   AEVLGVDRVGTADSFFDLGGNSIVATRVITVLQDRLGRQIPLQSMFLDPTPAGLALRVD
FT                   TENAAGSPVDEALGVVIPLRPTGDKAPLFCIHPGIGLSWGYAGLLQHLSPDRPAFGLQL
FT                   PIISGGTAVDSIEQLAHRYVLEMRKVQAHGPYHLLGWSLGGVIAHAMAVELRREGEAVD
FT                   TLALMDSYVANGTEQGPETLTVAELLHGLGLDLESVSGEELTYERAVELLDDAFGQKTG
FT                   LTPRHLERISAGFTNSSRIMNNFRPQVFDGDLLFFTAAGSASTGEHSPEEWRDSVTGGI
FT                   REVKIECEHNQMIEPEVLAVVGPVLEDYLGTH"
FT   CDS_pept        complement(250843..251175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48506"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR29"
FT                   /protein_id="BAH48506.1"
FT                   /translation="MTSASRRPDSCVWCGREVAETGMGRRRRYCRQSCRQRAYEQRNQV
FT                   KGTSIPADAVMLTAEEASAMVDRVFQVRCAAEDVATAVAEGAAAHEVESLCADLVQLAR
FT                   EAERFR"
FT   CDS_pept        251348..251686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48507"
FT                   /db_xref="GOA:C1AR30"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR30"
FT                   /protein_id="BAH48507.1"
FT                   /translation="MADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFA
FT                   DDAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDL
FT                   LKAKRRGA"
FT   CDS_pept        complement(252246..281813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02610"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48508"
FT                   /db_xref="GOA:C1AR31"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR31"
FT                   /protein_id="BAH48508.1"
FT                   /translation="MGSFPPPEWEMRTNKVVEAVPGGEVTAHGRIPDGAFPLSAAQRGM
FT                   WFAQQLDPSVPVTIAQCVELVGALDVALLSESLITAGRELGSAFLRLVEVDGVPYQLID
FT                   PTLEASVSVVDLQHEPDPRAAATEWMRQEYTTPLDVCRDRLVTSAVLRIGPNHHYWYCR
FT                   VHHVALDGMGSVTLVDRTAELYTAAVEGRAVAPSKAAELTDVARVDDEYRTSSRYLADG
FT                   EYWSERVSSIGEPHSLVDRTAPARARSRTTGGQILGPLADHLDAATNRHDSSAAFEVIA
FT                   AFAAYLARMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLRLDVRPDMTNTDLVAAV
FT                   RLEVTGALRHQRYPHMDIRRDAATDHQGFYGPLINVMLFHNEITLGSIVGRLELLSTGP
FT                   ISDLAVNVYHGVAGTSINLDLEANPDLYSDDALAAHHARFTRFLGAFLTSDTGTPRRIG
FT                   DLEILDEDECRILVPAAGRAGFAPVALPDLLAGAVRSNPDGDALVAPGHGTPDVTLSYR
FT                   ALDEESNRLARLLIDLQVGPEVSVALALPRSVESVSSVWAVAKSGAAFVPVDPGYPFER
FT                   IVHMLEDCGAPIGITTAALRAGLPDSTLWLVLDDDEFVSAVAAYPADPVTDADRTGVLM
FT                   VDHPAYVIYTSGSTGRPKGVAVSHRGVVNLAADERDRLGVSADSRVLHFASPSFDASVF
FT                   ELVMAVCAGAALVVAPTTMFGGVELAEFLAEHEVSHAFCTPAALASLDHRGLDHLTTVV
FT                   VAGDVCPPELVAKWAPGRIMVNAYGPTETTIMSSATGPMVPGQPVTIGSATVGVDLVVL
FT                   DHRLRPVPVGVRGELYVLGSSLARGYVHRAGLTAERFVASPFGTGGRMYRTGDVVRWGT
FT                   VPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALSAHPVVEFAHTVGYDDGSGRSRLVS
FT                   YVLPAPGTDVETRVLSEFVGTRLPGYMVPSSIMVLNMLPLTPAGKLDRNALPAPVFAAR
FT                   SADIVRPRTVSEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRVNAALDVRI
FT                   GVRDLFQSPSVSKLAATVANAGPQSDPRPALEPRERPDRMPLSVAQQRMWFLNQFDTAS
FT                   AAYNLPIALRLAGALDREALRAALGDVQERHEALRTVFPDSADGPHQLIKPAVSVLADT
FT                   DPLDVDPESLTAAVTALGSTGFDLTADTPLRAGLFREAPERHVLVLVVHHIAADGWSMT
FT                   PLAADVMVAYAARAAGHAPIWAPLPVQYVDYSLWQRDLLGSEDDPNSLSAKQIAHWRAA
FT                   LAGVPQLIELPTDRTRPAEMSHRGGRVEFTIPADVHGRLVDLAQSTGTTPFMVTHAALA
FT                   VLLRRLGAGSDIVIGTPVAGRGEEALDHLVGMFVNTLALRTTVDLGDTFEDVLARTRAA
FT                   DLAAFQHGDVPFERLVEVLSPARSSAHHPLFQVMLTFQNTANTRVELDGLEVEAAEIDV
FT                   QVAKFDLHLTVAENVDAAGNAAGLAVQLSYATDLFDHSTVVSIGERFGRLLDAVSGNPP
FT                   VAVGDLDLLDSREHAALTAANATHRPVPADTLASLFAAQAAATPDAVALVFDDRRLTYA
FT                   EFDERTDRLARHLIRTGVGPESVVAVGMRRSIDLLVAVYAIVKAGAAYLPIDPDHPAER
FT                   TAYVLDTAQPVCVLTRAADDTTFRTAAPVVNIDTLDLPDQDPTPISTALTAGNTAYVIF
FT                   TSGSTGRPKGVAVTHGAIVNRLLWMQHEYGLTPDDAVMQKTPVTFDVSVWELFWPLQVG
FT                   ASMVIAAPDGHRDPDYLATLIRRHRVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGE
FT                   ALTPEQVSRFRAVSGAGLHNLYGPTEAAVDVTYWETGAADALSVPIGRPVWNTQVHVLD
FT                   ARLHPVPNGVAGEVYLAGDQLARGYLNRADLSSDRFVANPFVAGGRMYRTGDLVRRRGD
FT                   GALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGR
FT                   RAAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPPPTLDTATAEYIAP
FT                   QTPAEVVVAGVFAEILGVERVGTHDHFFDLGGNSLVATRLVSRLRIALGVPVSLRDVFD
FT                   APTVGALAHRLDRVDPAAHPAPPALTPQERPEQVPLSPAQQRVWFLNQFDTSSPVYNLP
FT                   LAVRFSGGLDVTALRRALRAVLHRHESLRTVFPASDSSPWQRILDEHDVDLDLTVVEAT
FT                   DAELAAAIRGFALAGFDVTTEIPVRARLLRVRNDEHVLVLVVHHIAADGWSFAPLSRDL
FT                   MVAYAAHSGGRDLQWAPLPVQYADYTLWQRELLGEKHDPDSRAARQLAYWATTLAGLPD
FT                   SLDLPTDRPRPSVASKHGATVSWEISTELHERLLTLARTQDTTLFMVAHSALSVLLSRL
FT                   SATTDIAIGTPVAGRGDRDLDDLVGMFVNTLVLRAQLDPASSFAELLQQVREVDLAAFA
FT                   HTDVPFERLVEHLNPTRTAAHHPLFQVALFFQNHAPAHLELPGLSVSSQPILPDVAAFD
FT                   LQLVLTDTRDADGTPGPITAEFNYATELFDESTIRSFGSQFVRILDAVTMAPHTPVGDI
FT                   AIAHPAARIRELSGWNATDHDVPDTTLPDLFGAQAARTPDAPAVVFDGASLTYREFDEH
FT                   ANRLARYLISCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVL
FT                   QSAGPVCVLTTTADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYT
FT                   SGSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGA
FT                   ALVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEA
FT                   LPPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDS
FT                   RLHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRD
FT                   GVLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPA
FT                   PDRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFTSDATEYV
FT                   APSTSVERAVASVFCAVLGLERVSVRDSFFELGGNSLIATQLVSRLRGELDVPVTVRDL
FT                   FETPTVAELAARLSQSTGADTRPALIRRERPERIPLSPAQQRMWFLNQFDPSSPAYNLP
FT                   FAVRFTGPLDRVALEAAVADLVERHESLRTVFPDSATGPHQVVRDTADAPPNLTVADIA
FT                   EDELETVLARFFTTGFDVTTDLPVRVTLLRVSAHEHVLALVVHHICGDGWSMAPMVRDV
FT                   MVAYTARTRGERPAWTPLPVQYADYALWQRELLGDESDPDTLAARQLDYWTDTLAGIPD
FT                   ELELPTDHPRPAEQSYRGSHVDFDIDASAHRALAALAQSRRATLFMVMHTALAVLLGRL
FT                   SASSDVTIGTPVAGRGEPELDDLIGMFVNTVALRTHVDPGSAFTDVLDHVRDVDLAAFS
FT                   RADVPFERLVEVLSPTRHAARHPLFQVMLTFQNLEQTALELDGLTLRGLGTDIDVAKFD
FT                   LHLTLVERFDPAGRPDGMTAQLTYATDLFDADTADSIAARFTTILGAVTTDATTRVGDI
FT                   ALLGADERAALTLWNSTEHAVPATTLPVLFDAQVARTPGAPALVLDGASLTYREFDEHA
FT                   NRLARYLVSCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVLQ
FT                   SAGPVCVLTTAADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYTS
FT                   GSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGAA
FT                   LVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEAL
FT                   PPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDSR
FT                   LHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRDG
FT                   VLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPAP
FT                   DRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFSSDATEYVA
FT                   PRNEVEQALAGVFADVLGAGRVGVHDSFFDLGGNSLSVTRLAARITETTGTRLSVRDVF
FT                   EAPTVADLAVRIDPTARDVRPALTAAPRPARIPLSLAQQRMWLLNQFDADSPAYNLPFA
FT                   VRLSGVVDTAALAAAFDDVVERHESLRTVFPDGGDGPEQVVLAVTDVSVTLPPVDVTEA
FT                   DLPGRMAALASRTFDVTAETPVRATLFRTAPTEHVLAISLHHIAADGWSFGPLGRDVMV
FT                   AYAARTDGHAPQWAPFEVQYADFSVWQRDVLGSEDDPESVLATQLGFWTRTLAGAPDEL
FT                   PLPFDRPRPAQPTFAGGSVGFDIDPETHRRIRSLARDHGATTFMVAHTAFALLMARLSA
FT                   TDDVAIGTPIAGRGERALDDLVGMFVNTLVLRTAVNGGATFAEMLRTVRDTDLAAFAHA
FT                   DVPFERLVDALAPTRTAARHPIYQVALSMNPLQSPDYELPGLRIGVEDVDPGVAKIDLQ
FT                   LTLGEELDHTGAPSGMRAEFIYATDLFDESTISDVASRLQRILEAVTSDPDTLVGDLDL
FT                   LHDAERDALVPASGRPGLIPVTLPDLLAGAVRSNPDGDALVAPGHGTSDGTLSYRALDA
FT                   TSNRLARLLIDLQVGPEVSVALALPRSRESVVATWAVTKSGAAFVPVDPNYPADRIAFM
FT                   LEDCGAPIGITTAALRENLPDSTLWLVLDDDAVIEALTSYSSEPVQDSDRVAALSVDHP
FT                   AYLIYTSGSTGRPKGVAVSHRGVVNLAADERVRLGVLSESRVLHFASPSFDASVFELMM
FT                   AVSAGATLVVAPTTIFGGEELAEFLAEQEVSHAFCTPAALASVNHRGLDSLTTVVVAGD
FT                   VCPPELVARWAPGRVMVNAYGPSEATIMSSATGPLVPGQPVTIGSPTVGVDLVVLDSRL
FT                   RPVPAGVRGELYVLGSSLARGYVRRSGLTAERFVASPFGSGGRMYRTGDVVRWVTAPDR
FT                   PPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAHTIGFDDGSGHDRLVSYVLP
FT                   APAAEVDSRVLSEFVGERLPGYMVPSSIMVLDSLPLTPAGKLDRNALPTPVFAQRSEFT
FT                   APQTPAEQAIAAVFADVVGEPSIGLDDNFFDLGGNSLSATQVVSRVGSALGTRISVRTL
FT                   FDNPTVRALATAAASDTTAERPALVAGERPATIPLSPAQQRMWFLNQFDTTAAAYTIPL
FT                   ALRMSGRIDVATLRTALGDVLARHEALRTVYPATENGAHQVIVPVESIPLDLTPTRLSG
FT                   EDLSGAILRHASAGFDVTTDLPLRVHLFRESRSEHVLLFVVHHISADGWSFIPLASDVM
FT                   TSYAARTAGDAPVWNALPVQYADYAMWQRHLLGDSDDPQSLAASQIAYWKRTLAGLPDQ
FT                   VALPTDRPRPPAPSNLGGTARLTLDGDLHRQLHELARAHHASLFMVVHTALAALLSRLG
FT                   AGPDVAVGTSVAGRGEQSLDGLVGMFVNTLVLRTDVHPDSTGAALLEQVRRVDLEAFSH
FT                   VEVPFEQLVDAINPTRSTAFHPLFQVALALQNLQTPTLELPGLEVSALDIESPIAKFDL
FT                   NFVLGERHDEDGNPAGLDLELGYAKDLFDADTASRIGESFVRVLSGLAHDPRTPVGDLD
FT                   LLGDDARLRLLAQSHGATRETVHSTLVGLLDEQVRATPSAPAVRWRDTALTYAEFDACA
FT                   NRLARKLIADGVGPDAVVAVEIPRSLDLLVAVHAVVKAGGAYTPLDPGQPEQRNRDIVE
FT                   QSGASLVLTSSELLRQTGATRHGVRAIAPDALDPAEFGGEPIRAAERIAPLRPDNTAYV
FT                   LFTSGSTGRPKGVAVSHAAITAQLEWLREQYALGTADTMLLKTPVTFDVSVWECFAPLA
FT                   AGARLVIADPDGHRDPEYLAEIVRTHGVTVVHFVPAMLAALTSGPGLTDMPALRHVLVG
FT                   GEAVSPETIDDFRASHPAEIDNTYGPTEAAVTTTFFAARSDNSDTVPIGLPVWNTSTLV
FT                   LDDRLRPVPAGVAGELYLGGVQLARGYLGRPDLTAERFVADPFSTSGARLYRTGDLVRW
FT                   TAAGRLEYLGRTDFQVKVRGFRIELGEIVSALLRHEDVDQAVVVPHSDPHTGEHLVGYV
FT                   VPRGAVALDCDAVLAEAAGSLPSYMVPSLLVPLTELPLTPNGKVDRNALPAPVFAGKAE
FT                   YTAPRTESERVVAAVFAELLGVSRVGVDDNFFELGGNSLSATKLSTRIGVATQTRIAIR
FT                   DVFDAPTVAALARRLDQHGPSTAIAPLTAAVRPGRIPLSLAQQRMWFLNQFETSSPAYN
FT                   LPAAVRLTGSLDTAALAAAIGDLIARHESLRTVFPDSRGGPHQVILEPGDFTPDVAPVH
FT                   VSETGLRADLQEFLLAGFDVSEAVPLRVKVYSLGPAEHVLALVVHHISADGASMEPLIR
FT                   DVMIAYGSRAAGHPPTWAPLPVQYADYALWQRTVLGSESEPGSLAAAQLDYWTRALAGV
FT                   PDQLYLPGDRGRPAVPTHRGAATRFTLDAGTHRALTELARAHGASLFMVAHAALSVLLG
FT                   RLSTTADIAVGTAVAGRGRVELDDIIGMFVNTLVLRTTLDPGASFVALLAQTRTVDLEA
FT                   FAHADLPFERLVEVLSPVRSTSHHPLFQVALGVQAVSADGLELDGLSVTPLTLDASIAK
FT                   FDLHFTLTERLDDTAEPAGIDAELIYATDIFDESTAAGYATRLRRIFEAVVADPQRPIG
FT                   DIPVLGEDEHAALTPVRGADPRPVQMLPEILADAVAAAPDGLAVVFDGAGLTYRDLDER
FT                   SNQLARLLVDRGVGPETSVALALPRSFESVVAVWAVAKTGAAFVPVDPGYPADRIVHMV
FT                   QDSGAMVGITVSAKRALLPDSIRWMLLDDPALEVRCTHESRLPLTNRDRMRPILSDQVA
FT                   YVIYTSGSTGRPKGVAVTHRGLMNLVTDERELLAVTSRSRTLHFASPSFDASVFEMLMA
FT                   LGAGATMVIAPPTIYGGSELAELLAAERITHAFSTPAALASVDHHGLDELAVVVVAGDV
FT                   CPPELVARWAPGRRLVNAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLR
FT                   PVPVGVPGELYVGGPSLARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWREDRVL
FT                   DFVGRTDHQVKIRGFRIELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGE
FT                   DVDRVEVANFVGRTLPAYMVPASVTLLDALPLTPAGKLDRSALPEPIFAAAATTFEAPR
FT                   NPMEVIVAGIFADILALPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFES
FT                   PTVAALAARITETTTHGARRPALTARARPEHIPLSLAQQRMWFINQFDTASPAYNLPVA
FT                   LRLSGEVDLRAMQIAIADLVGRHEALRTVYPDSGDGPHQVIVPAADAVPDLTPVTAHPD
FT                   DVLERVLALVTTGFDVTSDVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVML
FT                   AYTARTEGHVPLWTPLPVQYADYSLWQRELLGDEADPESVAAEQIAYWTRTLDGLPDRL
FT                   SLPTDRPRPAVASHRGAHVPFTIDAATHRALLTLARGRNTSLFMVMHTALAVLLARLSN
FT                   ESDIAVGAPIAGRGEESLDELVGMFVNTLVLRTHVDLASSFADSLNVARSTDLSAFAHS
FT                   DIPFERLVDVLNPARSRSHHPLFQVAFSFQNLATATLELPGLHVEGLDVPNTISTFDLH
FT                   LTLSEKHDADGTPDVIEAQFTYATDLFDDTTVRAFAERFTRILESVVRDPDLAVGAIDL
FT                   LGGAERQSVIAEFNDTAVDLPPTTLADLFSAQAVRTPDYPAVFFEGTELTYSEFDRRVD
FT                   ALAHRLIDSGVGPDTVVGLAMNRSIELLAGMYAVLRAGGAYLPIDLGHPADRLAYVLET
FT                   ARPVCVLTTSPDGFTAENVPVIEIDTLDLTGSPRGPVTDAHRRAPLRPENTAYLIFTSG
FT                   STGRPKGVAVSHAAIANQLRWKQHEYPLDTTDAVVQKTPVTFDLSVWELFWPLMSGARL
FT                   VISRPDGHRDPAYLADLMRQQRVTTAHFVPSLLEAFIPDAGEQPTLRRVLCIGEALPVD
FT                   TAARFRSRFASVALHNLYGPTEAAVSVTAWTHTDVDTDTVPIGGPEWNTQAFVLDARLN
FT                   PVPVGVAGELYLAGDQLARGYVARTDLTAERFVANPFGAPGARLYRTGDVVRWRIRGTT
FT                   GVLEYLERSDFQVKVRGFRIELGEIESALIRSAGVGQAVVVAHRNPHTGTALVAYVVPE
FT                   DGSTVDPTAVLADVGAAVPSYMVPAALVVLAELPLTANGKLDRKALPAPDFASAAAEYR
FT                   APATPTEEIVAAVYADVLGVEQVGTAANFFDLGGNSLVATRVVARLSETLGRRVEIRSL
FT                   FEAPAVGALAALLDSTDATAPTRPALTPAVRPELLPLSSAQQRMWFLNRFDPDSAVHNI
FT                   PVAVRLSGVLDVDALQHAVADVLHRHESLRTIYPDSADGPHQVILSTDRVGAETSVDAA
FT                   DEAALPALIADLVTTGFDVTAEVPVRVRIFRISATEHVLAVVVHHISGDGWSMAPMVRD
FT                   VMAAYSARSAGTSPDWAPLPVQYADYALWQRDLLGDETDPDSVAARQLAFWTQTLAGAP
FT                   DQLDLPTDRPRPAVASYRGGTVDFTVPADLHGTVVGAARDANASVFMVVHSALAVLLSR
FT                   LAGSGDISIGTPVAGRGERELDDLIGMFVNTLVLRQHVDGGRTFAELLADVRETDLAAF
FT                   SHADVPFERLVEVVNPSRSTGRHPLFQVMLTFQNLDQESLELGDLSVSGVDLDVDIAKF
FT                   DLQLTLMEQFDSEGGPDGIAARLTYAADLFDEPSAHVFGQRFLQVLRAAVDGPDTAVGD
FT                   LDVLGRGERKQIAGTNATAHPVLAGTLASLFDTAVAADPDRIAVVFDRDELTYANFDAR
FT                   VNRLARRLIEQGVGPESVVAVAMRRSIDLLVGIYAVVKAGGAYLPIDPDHPVERTAYVL
FT                   DTARPACVLVSGAGLADSGSVPVVDIASEDLSRYGSAPVTDRDRLRPLTAANTAYVIFT
FT                   SGSTGRPKGVAVTHGAIVNRLLWMQHEYALTSADVVLQKTPVTFDVSVWELFWPLQVGA
FT                   SMVIAAPDGHRDPRYLTGLVQERHVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEA
FT                   LTPEQVSRFRGVSGAGLHNLYGPTEAAVDVTFWETGESDTHSVPIGRPVWNTQVHVLDA
FT                   RLHPVPNGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFVAGGRMYRTGDLVRRRGDG
FT                   ALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGRR
FT                   AAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPAPEVRSAAAEYQPPR
FT                   SAAERAVATVFGEVLEIDRVGATDSFFDLGGNSLIATRVAAALGSELGIDFPLQWMFSD
FT                   PTPRSLGQRIQNAAIDGVPGAGASLDVLLPIRTRGTAEPVFCVHPFIGLAWSYAGLSRE
FT                   LTEDRPIYGLQSPALTEAEPHPGTITDFADRYVREIRSIQPHGPYHLVGWSLGGVIAHE
FT                   MAVQLQEAGEEVRLLGLLDSYVGLDRSVENTATTADLLGGAGLDLPEDGVLDELSPDGQ
FT                   FDAERAAALLRVVGGPLAALTAPELDRIYRNAQQAPDLIDAHRPRVFDGELVFFTAALD
FT                   DGFHVDPVTCWGPYVRGRIDEHPVDATHWTMTTPDALAAIAPHLARTQRRPRHAAPDPG
FT                   RDTDPDDSANRPHSVR"
FT   CDS_pept        complement(282037..282765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppm1"
FT                   /locus_tag="ROP_02620"
FT                   /product="putative polyprenol-phosphate
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48509"
FT                   /db_xref="GOA:C1AR32"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR32"
FT                   /protein_id="BAH48509.1"
FT                   /translation="MIIPTYDERENLGLIVRRLHAALPRTHVLVVDDGSPDGTGDVADA
FT                   LASNDDAGRIHVMHRTEKNGLGAAYIAGFRWGLDRDYTVLVEMDADGSHAPEQLHRLLD
FT                   QVDAGADLVLGSRYVPGGTVVNWPKHREWLSRGGNIYSRLALGVKIKDITGGYRAYRRE
FT                   VLEKLDLAAVESHGYCFQVDLAWRAIQEGFTVREVPITFTEREIGESKMSGGIVREALL
FT                   KVTQWGLRNRLARIKGVAAR"
FT   CDS_pept        complement(282746..284449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppm2"
FT                   /locus_tag="ROP_02630"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48510"
FT                   /db_xref="GOA:C1AR33"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR33"
FT                   /protein_id="BAH48510.1"
FT                   /translation="MSGSATARWTTGKRGVLLRSVLSVAAGFLVFAGFPPRPLWFLAPL
FT                   GIALLTLILTGAGGAAPRLRAGFGYAYLAGLGLLVPLLPWIGVFVGALPWLALAAVESL
FT                   FIGLFGTLAVLVSRLRWAPLWIAACWSLTEWLRASVPFGGFPWGRLAFGQSEGWFLPLA
FT                   SIGGSPLLSFAVALTGAGLASVAVTVRARASGAANWARPLAGGLVAALAATVASLALWP
FT                   TLPDMDSGDRTITVAAIQGSVPKLGLDFNDQRKRVLDNHVNRTLELADDVASGAAPQPE
FT                   LVVWPENASDIDPLRNADAGADISRASEAIGAPILVGAVLVNADRTTTNSVIVWDGNSG
FT                   PQERHDKKIIQPFGEYLPYRGFFRHFSSYADRAGNFVPGDGDGVVHANGIAVGVATCYE
FT                   VAFDRAFEQSVRSGAELLAVPTNNATFGDTEMTYQQLAMSKVRAVEHGRAVVVAATSGV
FT                   SAIIGPDGSTVQQTPLFVPAALVSQVPLSTGTTLASRLGPIPEVLLCLAAVAAVAFAVV
FT                   QRRRTDRTPISSSTEKAPAVAGREDPHGIGDRFRAERGTERTDSGDHSDV"
FT   CDS_pept        complement(284439..286037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48511"
FT                   /db_xref="GOA:C1AR34"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR34"
FT                   /protein_id="BAH48511.1"
FT                   /translation="MTTQLLVGGRIYSSFAPDATSMAVTDGLVSWVGDDRAARALHPGA
FT                   EVVDLGGAFVTPAFVDTHVHVTALGLNIVGLDLVGVGSLRECLDRLASFARTHSDAVIW
FT                   GHGWDESAWPEGTGPTTAQLDEAAPGRTVYLSRIDVHSAVCSTALRRSVPGLSEASGFS
FT                   SEGPLTFEAHHAARTVARSLLTAEQRSAARVAALDAIASRGIVAVHECGGPDIAGLDDF
FT                   RELLATAHGVEVRGYWGEAVTDADEARKLLDTAGAHALGGDLFIDGSLGSHTAWLSAPY
FT                   ADLDGGTGKSYLGVDEIAAHVRACTIAGIQAGFHVIGDAAVRAAVDAFAVVADELGGPA
FT                   VAAAGHRLEHAEMMTGDDAARLAQWGVIASVQPAFDALWGGTDGLYAQRLGTERALTLN
FT                   PFAAAASAGVSLALSSDAPVTPVEPWAMLRAAVHHRTPGSGISPRAAFSAATRGAWRAG
FT                   GVRDGLAGTLAPGAPASYAVWDAGELVVSAPKDSVQRWSTDPRSRVPALPRLEDDAPTP
FT                   VLLRSVHRGSVVHER"
FT   CDS_pept        complement(286056..286562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02650"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48512"
FT                   /db_xref="GOA:C1AR35"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR35"
FT                   /protein_id="BAH48512.1"
FT                   /translation="MYAALFLLYVVVEIAALVLVGHAIGAVWTVLLLLGGTLIGLLLMR
FT                   SQWRRVMDGLRRAAGGDGSPGAAVADGALVALGSALMFVPGLVTSVLGLLFLIPPTRWA
FT                   LRPVVVLLAGRRAATVAAGAEAFARAPRRGRGEVIEGEVVDEFFEGEVIDEEHRTPTRD
FT                   PRVLP"
FT   CDS_pept        286766..287383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48513"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR36"
FT                   /protein_id="BAH48513.1"
FT                   /translation="MTRSTVFRRAAIVLASAAALGMLSSGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISATQLRFQAIPAYVAIPQSSELSVAWINLTTFQGGIVKLDDKLPIIN
FT                   TPLLSKIVDTGKGTVLATMFGTVGYADAVTCTVVPTVGTFTV"
FT   CDS_pept        complement(287411..288070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02670"
FT                   /product="putative NarL family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48514"
FT                   /db_xref="GOA:C1AR37"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR37"
FT                   /protein_id="BAH48514.1"
FT                   /translation="MPITVLLVDDQELMRMGLNMVLDAQDDITVVGEASDGAAAVAAVR
FT                   KLEPDVVLMDVRMPVVDGVSATAQILESGVASRVLVMTTFDLDEHAMGALRAGASGFLL
FT                   KDTPSEDLVSAIRSVAAGDAVVSPKVTRRLLSRFLDDGPAPLRDPEVLDVLTEREREVL
FT                   QLVATGLSNTEIAAQLFLSESTIKSHVGRILTKLNVRDRVQAVVLAYETGLVRPGS"
FT   CDS_pept        288248..288676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48515"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR38"
FT                   /protein_id="BAH48515.1"
FT                   /translation="MRISDVLRNKGPAVVTVDPEMSVSTLIGELARHNVGALVVTENDA
FT                   VVGIVTERDVVRRIHERGPDILNARVVDIMTTSVFACLPTDTVDSLAETMTERRIRHLP
FT                   VIVDGQLVGIVSIGDVVKSRIGELQTERDQLESYIDHG"
FT   CDS_pept        288688..288972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48516"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR39"
FT                   /protein_id="BAH48516.1"
FT                   /translation="MPLFVVEYTYSPETSALRDDHRTQHRAWLTELLRRKIMRSSGPLA
FT                   SGHGALFIVDAEDEDAVARLFAHDPFAEEKLVANVQIREWAPAMGEFSE"
FT   CDS_pept        289150..290763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02700"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48517"
FT                   /db_xref="GOA:C1AR40"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR40"
FT                   /protein_id="BAH48517.1"
FT                   /translation="MVFGFGGCAAPPPALYDVAVSTGLLNPPLDRSTPPPVENPYRAPA
FT                   ILAASGAVVAAVLFWVVSGSLTDDAYISLSAARNLAVHGEWAIVHGLTANTSTSPLNVL
FT                   VLGALTFLTRLWGPGDPLLALGMLNVAVTALLGWVLARIGRRLGLGTFWAALAGALVVF
FT                   NPFVLSAVGLEVLLIPAAVAVMVWFALDGRAAWFGAAAGMAALVRLDLLVFVLVIAALS
FT                   PAIRGQVRRALGGFAAIAGPWYLFSWLVLGSALPDTFLIKQGQASDVGGYNYLTGPIMY
FT                   FESNPWRTVAAFGPAALGLVLLLLALFSYARYRTRPLSVPGAVLALGLSGALYYVAYVV
FT                   LDTVPYHWYYVAPATTLAMFAVLAAGIHWTAARNTTDRAAVGALAGLLAVLGAGAVYFD
FT                   VEGGLPWEAPPIFGNWASAQDYERVGRAVGTLVGDAPVRSPGEIGTLAYFCECVIVDEF
FT                   SDRGLVVEDRLVPRLAEASEPARTLLRANYAFFDYRLAPVNPAFDLRYGEGRGPGGPMS
FT                   WEVFSAARGVGHFTLVPLAG"
FT   CDS_pept        complement(290874..291620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48518"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR41"
FT                   /protein_id="BAH48518.1"
FT                   /translation="MSEHTHELTPTPRGPVCCVHVHGAAAYRVGYPPTSWEWTPWEFAT
FT                   DGRFTGRWDDPAGVWRTLYVGATRLSCYLEVLAYARKSDELSTALDEIVDNDGDDEWPT
FT                   IAPGRVPRSWMAARITGSGVISGWFVVPGDAETMATLRIGFRALAIRLGLADLDTAAIR
FT                   DGRPRVLTQAISQWINTLTGPDGEPVAGVQFDSRHGDGLVLWALYERPGDRRVSSRVTP
FT                   LEYGPVRENDPDLIEAMRLHNLVWED"
FT   CDS_pept        complement(291617..292009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR42"
FT                   /protein_id="BAH48519.1"
FT                   /translation="MTTAHPRPDLAAYNDAARMTQSQLVTELRALLGAKLVAYLGKVKE
FT                   TRAVRQWADGTRTINNDTDVERLRIAYRAARLIAERDTSAVAQTWFQGLNPILDDQPPA
FT                   LLLREGDLNDVGPKVLAAARQFAAVG"
FT   CDS_pept        292382..293845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02730"
FT                   /product="putative glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48520"
FT                   /db_xref="GOA:C1AR43"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR43"
FT                   /protein_id="BAH48520.1"
FT                   /translation="MSTAELTQWNSEEALAEAMIPIIGGLHRRHSVTILLHSRSLVNKS
FT                   VIKILRTHRFARQIRGDELSVEETFPFLEALTSLDLRPSKIDLGLLVTAYHAHGGGAPI
FT                   PEFVAESLADLVGGAHTSPAQPQDVVLYGFGRIGRLVARLLIEKSGSGNGLNLRAVVVR
FT                   KGGKDDLVKRASLLRRDSVHGQFNGTIKVDDENNALIANGNVIKFIYSNDPTTVDYTEY
FT                   GIDNAILIDNTGIWRDRDGLSQHLRPGVAKVVLTAPGKGDVPNIVHGVNHRDIDPNERI
FT                   VSCASCTTNAIVPPLKTMDDEFGVVRGHVETVHSFTNDQNLLDNFHKADRRGRSAPFNL
FT                   VLTETGAASAIAKALPDLKAKITGNSIRVPTPDVSVAILNLQLHREATKDEVLEHLRQE
FT                   SLTGALSRNLDYTAATDAVSSDFIGSRAACIVDANAAIVDGDTAILYVWYDNEFGYSCQ
FT                   VVRTVQYLSGVEYPIYPTVDAAAVAGAIA"
FT   CDS_pept        293973..294377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48521"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR44"
FT                   /protein_id="BAH48521.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLEQADSQIPW
FT                   TGVFADFARPPRAAPKPETTGETGDGVWAIYTVDGDGVARVEQVYATELDALRAHKHNI
FT                   DPHRSVRFLPYGVTVSVLDQQEESTPRETE"
FT   CDS_pept        294628..295134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48522"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR45"
FT                   /protein_id="BAH48522.1"
FT                   /translation="MSGTDPPPLVVVPPGSGHTGDLGPIGVEFKLWGRDTGGVLSVVEH
FT                   PFPVGALVPPHLHTREDEFSIVTQGAIGFRSGDREAVLESGGYITKPRGEMHAMWNAGT
FT                   VPARMIEIISPAGFEHCFLEMSELIAAGGPDVTQIAAVAERYGLQFGEPDWLPDVIARY
FT                   SLTPP"
FT   CDS_pept        295445..295885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48523"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR46"
FT                   /protein_id="BAH48523.1"
FT                   /translation="MAHVQRFDHIGITVADLDSATAFFVGLGLEVEGTGSVEGEFVETV
FT                   CGIPGAHCEIAMLRPPGGGSRLELSAFVTPDHVPGSPTAMANELGLRNVSFEVRDLQAA
FT                   VDAVAADGYGLIGGIGEYENSVRMAYVRGPEGIIVSLFEQIG"
FT   CDS_pept        complement(296134..297174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48524"
FT                   /db_xref="GOA:C1AR47"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR47"
FT                   /protein_id="BAH48524.1"
FT                   /translation="MDPSAAPAVKVTHGAPAVMDTAPVMLTKRTCFSAISMVILAVAGL
FT                   LVATPGNSAAAPPAWRYTMVAFSNTSDRDMDVYESGDGTGFQPVGLSAFRPPSGLVRDP
FT                   SIFRNADGLYYLTYTTGGGANIGFARSSDRINWTPLGNYPVPFCCALMPGTGDGTGSAS
FT                   PPGFSGSAGFRDGPSLSPFVTKAWAPEWFVDGDRVNVILSLSTGGGFVPYLMTALEPSL
FT                   RLWSPPVPLAGIGADHIDTTVVKVGATYHAFTKNETKKVVEHAVASSVTGPYSFVPAGN
FT                   WGSLVEGPALAQLPNGAWRIYLDAYTEGKYLYSDSTDGLRTWSPVQELPGLSGTARHFG
FT                   VMTEPA"
FT   CDS_pept        complement(297356..298519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02780"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48525"
FT                   /db_xref="GOA:C1AR48"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR48"
FT                   /protein_id="BAH48525.1"
FT                   /translation="MRRFSLWLRGKPTVADSMLAAILFTLEVFVFTASGDRSPWVQLVL
FT                   GFLLCLPIAWRRKYPRAAAGAVLVMSITITFISYSIGDLDAEHPGLLALAVSLYTLVAY
FT                   VDRRTAAVYAVGLVVDSALSIWLLEQELLAAGLFSVLVFALSWITAEFLGARRAYDEEV
FT                   AARLVVADYDRDRRAEDAVAAERTRIARELHDVVAHAVSVMIVQADGASYALTSNPDIA
FT                   KQALTNIASTGREALAELRRTVSLLRTEPATDDMPQHGTAGLARVVDMMRSAGLPVELE
FT                   LTGELDDISPAVSLGVHRLVQESLTNVLRHAGERPRAKVRVRRRETDVLVEITDNGNSS
FT                   GQFSLGSGNGLLGMRERVAVLHGTLEAGRQTDGSWRVTAELPLELED"
FT   CDS_pept        298566..299333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48526"
FT                   /db_xref="GOA:C1AR49"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR49"
FT                   /protein_id="BAH48526.1"
FT                   /translation="MNAGDWALLLTAATAAGWVDAVVGGGGLILIPALFLVAPQLTPQA
FT                   ALATNKLTAFTGTSAAVVTFARRIPMNWRLLVPAGLLAAVASALGAATVSRIDKDVFIP
FT                   LIMAVLVGVAVFVTIRPQLGTTLAKDPPTRRKVVAVVLLSAGLLGFYDGLFGPGTGTFL
FT                   IISFATFLGTEFVRSAAMAKVINLGSNLGALVFFAATGHVLWALGLSMAVCNVIGAVTG
FT                   SRMALSKGAGFVRITLLIVVIAMVIRLGWQQFG"
FT   CDS_pept        299356..300876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02800"
FT                   /product="TldD/PmbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48527"
FT                   /db_xref="GOA:C1AR50"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR50"
FT                   /protein_id="BAH48527.1"
FT                   /translation="MTAPRQVDPEFLALPLRSLADAALTAARAAGASHADLRVHRLASQ
FT                   SLRLRDGEVQSAVDTDELGFAVRVVVDGTWGFASHAELTPATAAATAEQAVAVARALRG
FT                   LNREHVELADEPVYSDVHWVSDYDLDPFEVAASEKISLLGEYSRRLLASDGVDHVTAGC
FT                   LQVKEQTFYADLAGSSIVQQRVRLHPQLEATTVDQSAGVFETMRTLAPPVGRGWEYVAG
FT                   DGVWNWTDELTRIPDLLAEKVKAPSVVAGPTDLVIDPTNLWLTIHESIGHATEYDRAIG
FT                   YEAAYAGTSFATPDKLGTLRYGTPIMRVTADRTERHGLATVGYDDDGVETQSWDLVADG
FT                   ILVGYQLDRAFAPRLGLARSNGCSYADSPHHVPIQRMANVSLQPDPDTDRSTDDLISGV
FT                   EDGIYVVGDKSWSIDMQRYNFQFTGQRFYRIRGGRLDGQLRDVAYQATTTDFWGSMDAV
FT                   GGRSTWQLGGAFNCGKAQPGQVAAVSHGCPSALFRGVNVLNTRTEGGR"
FT   CDS_pept        300873..302234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48528"
FT                   /db_xref="GOA:C1AR51"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR51"
FT                   /protein_id="BAH48528.1"
FT                   /translation="MIAPQQLVEQVLARATVDETIVIVTDASEASLRWAGNSMTTNGVS
FT                   TSRSWTVISIVRSGQDAKVGIVTSASVDAADIDGVVRSAEISARAATPASDAMPLLTGT
FT                   GTDERWEDSAQRTEIGAFEQLAQDLSMGFDGDDQLYGFAHHQLHTTWLGTSTGIRRRFV
FT                   QPTGSVEINGKRGDASAWVGTSTKDFTDVAGVKLLQDLSTRLDWAGNRVELPAGRYETI
FT                   LPPSAVADLMIYLMWTMEGRAAEEGHSALSAPGGTRIGEKLSALPLSLYSDPAALGLEY
FT                   APFVIAGASSESVSVFDNGMDAGRVDWIRDGTVGALAYPRSAAKEFGAEATVPGDNLIL
FT                   DAGGSVSLDQMVAETERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVENGKVTGAVNN
FT                   FRFNESPLDLLRRVTQAGATERTLPREWKDWFTRTAMPSVRVPDFHMSSVSKAL"
FT   CDS_pept        302454..302660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02820"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48529"
FT                   /db_xref="GOA:C1AR52"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR52"
FT                   /protein_id="BAH48529.1"
FT                   /translation="MHSDTRIRETLHGHTKVTGRFALADVALTTFVCLVCATGIGIITG
FT                   SVLAAATGGLIVVLATALMVAAV"
FT   CDS_pept        302657..303004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48530"
FT                   /db_xref="GOA:C1AR53"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR53"
FT                   /protein_id="BAH48530.1"
FT                   /translation="MTAPSTQRSTTIQEITVSNDVLEAAPPAHSIPHRHPDGREVLATA
FT                   KGILIATRGYGDAEAFDELLDVSRHHHVSVLRAAKSLVELATRRQTCPSVTTPAPSYAL
FT                   EFTEWTTLLAR"
FT   CDS_pept        complement(302973..304160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48531"
FT                   /db_xref="GOA:C1AR54"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR54"
FT                   /protein_id="BAH48531.1"
FT                   /translation="MTSQLSSSHRYAALDVMRGAAILGTLATNIWIFTNVEGLVGYVNG
FT                   TGKATGGWAPVQVVLQQFAQGKFLGLLTVMFGIGLVIQQRSAERRGQRWPGGYPWRAAL
FT                   LMLDGALHFLLFTEFDVLTGYALTGLIVAFILTAGIRAQRTWIVCAVAVHAAMLALLVA
FT                   ALYSAPAREPQPLSPNPYADGSFWDLIVFRADNVLLFRLEVLFILPLSIALFLVGARLY
FT                   GARVLDPDRGVLRRRLMVAGLAIALPLDLALGLFGGDAGLILGRYGTAPIVALGLLAAI
FT                   AHRYADGRAPGAPGRALSGVGRAALSCYVLQNILCSIVCYGWGFGLAARLDGTTVVPAT
FT                   IALFGAVSATLIVVSRLWLRRFDRGPLEWLTHRAYQRLTRADRDGVTAPAASSIP"
FT   CDS_pept        304240..304824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02850"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48532"
FT                   /db_xref="GOA:C1AR55"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR55"
FT                   /protein_id="BAH48532.1"
FT                   /translation="MPKLIDHDRRQQEIAEAVWRVIQREGIGAVSVRDVAAEAGISSGS
FT                   LRHVFASKAELLAYSMRLVATRVRERAQAHASITDPWQRALAVLDEVLPLDDRRRCEME
FT                   VNLALVAESPAHPLLKDIALDAQRQLRGACAAILTGLAKRGLLAPDIDVDTEAMRLHAL
FT                   VDGAAMHVLLGDTDTPETAQRMIAEHLRALA"
FT   CDS_pept        complement(304882..305535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48533"
FT                   /db_xref="GOA:C1AR56"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR56"
FT                   /protein_id="BAH48533.1"
FT                   /translation="MPSETRHSEGRPYVVAHVAVALDGATTGFEPDVGRFYELAATWRE
FT                   DVTLVGADTIVAQEQALAAAPRPGPVGDGPLLAVVDSRGRVGDWVWDALRDAGHWSEVL
FT                   ALHAEATPPRGDGRSVHELVTGTERVDLAAALKILGRRAGVEVVRVDSGGALLGALLGA
FT                   GLLDEVSLLVHPCLPGVRNNRLWHGTAPAAIRFDLIASRAFDDGVVWLRYQPVR"
FT   CDS_pept        complement(305572..305796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48534"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR57"
FT                   /protein_id="BAH48534.1"
FT                   /translation="MSPEQAHLIDVDRAFFIGDAADRAALEADPMFTSLPIYRDGRVTF
FT                   FADSEDPPVGAALSQSTILSLPYAIDQVL"
FT   CDS_pept        complement(305803..306606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02880"
FT                   /product="putative iron-siderophore binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48535"
FT                   /db_xref="GOA:C1AR58"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR58"
FT                   /protein_id="BAH48535.1"
FT                   /translation="MPTEHDLSAVRGFIRIRRERSAAVTFVALLLGVWLLAACGSATGE
FT                   RDSGAAPGDTYTVEHVYGTTEVPRDYERVVSVGYTDDQTMLAVGVKPVGMVDQYPAGGS
FT                   PDRNISWPWVEDLWAGTVPEVVMTNGESLNFEKVAALQPDLIVGVYSDITEGDYQRLSA
FT                   IAPTVAWAPDVADPFVAPWQDTARQIAKALGKEDEAEAAITEITDGMAQAVADHPEFGG
FT                   RRAVAFSWYDASLAPFASTDVRGKLLTDLGYRPVAEIDQAAGDKF"
FT   CDS_pept        complement(306683..308050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48536"
FT                   /db_xref="GOA:C1AR59"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR59"
FT                   /protein_id="BAH48536.1"
FT                   /translation="MNVPRRDAHAVVIGGSIAGLLASRVLADYFDTVTIFEKDHLVDSA
FT                   EPRMGVPQGRHVHSIWKRGLSLMEESFPGLTSELIEGGSAEVEMTKDFAWYHRGVWKLR
FT                   VPSGIFITCQTRPFLEWQIRRRVCQISNIDLVDHCHVKRFVTDATAQRITGVAVQSRRA
FT                   GATEETVSADLVVDASGRGSRTPRWLEELGYGRPDMSVIDVDVGYATRFYARPPQEDCP
FT                   WKALIVAPTPPDGTRLGVIFPVEGQRWIVMLGGWNGDHPPRDEDGLLEFARNLEAPDIY
FT                   TFMREAEPLTPIAGYKFRANVRRHYERMRRFPGGLIVLGDSLCSFNPIYGQGMTTSALD
FT                   AMTLRECLDRAVHRGESLDAMAHHFLKRVPRRLDAPWRLAAGEDMNWPGTQGDAPFGTP
FT                   FMNWYFGRVHALAARDPQVLVRFVRVANMIDSPVRIFHPRVLAPVLTRSTRVAPSP"
FT   CDS_pept        complement(308247..308642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48537"
FT                   /db_xref="GOA:C1AR60"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR60"
FT                   /protein_id="BAH48537.1"
FT                   /translation="MGRVTTEFDRVSSAKYVLLTTFRKDGTPVATPLWAAADGDRLLMW
FT                   TVTDSYKVKRIRRNPEVTVAACDARGKPKGPEVPARAVILDVADTDHTRDVIARKYGIL
FT                   GWLTMKGSLLRRGKTGTIGLAVTADDR"
FT   CDS_pept        complement(308660..312262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobN"
FT                   /locus_tag="ROP_02910"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="protein synonym:cobalamin biosynthesis protein"
FT                   /note="protein synonym:hydrogenobyrinic acid a,c-diamide
FT                   cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48538"
FT                   /db_xref="GOA:C1AR61"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR61"
FT                   /protein_id="BAH48538.1"
FT                   /translation="MILLLSTSDTDLLSARASGADYRWANPARLLVEEDLPGLLDGADL
FT                   VVVRILGGKRAWEEGLDAVLASGLPVVVLGGEHAPDAELMECSTVAAGVSAEAHNYLAE
FT                   GGADNLAQLHHFLSDTVLLTGHGFEAPVHLPSWGVAPFAPDADAGRPTIAVLYYRAQHL
FT                   AGNTRYIEALCDAVEAAGGTPLPIFCASLRTAEPELLTTLRRADAMVVTVLAAGGTKPA
FT                   GVSAGGDDEAWDVAALAALDVPILQGLCLTSSRESWEANDDGLSPLDVATQVAVPEFDG
FT                   RLITVPFSFKEIDADGLSTYVPDAERASRVAGIAVRHARLRHIPAAERRIALMLSAYPT
FT                   KHARIGNAVGLDTPASAIRLLTEMRAAGYDLGPADGPDSVPGLAARDGDALIHALIAAG
FT                   GQDPDWLTAEQLEGNPIRISAARYREWFSALPAELREGVEEHWGPAPGELYVDRSQDPA
FT                   GEIVIAAMQFGNLVLMVQPPRGFGEKPVAIYHDPDLPPSHHYLAAYRWIAADAAAGGFG
FT                   ADAVVHLGKHGNLEWLPGKTLGMSASCGTDAALGDLPLIYPFLVNDPGEGTQAKRRAHA
FT                   TLVDHLIPPMARAESYGDISRLEQLLDEHSNISALDPSKLPAIRQQIWTLMRAAKMDHD
FT                   LGLEERPEEDVFDDMLLHVDGWLCEIKDVQIRDGLHVLGEAPRDDAEVELVLAMLRARQ
FT                   MWGGEQNVPGLREALGLSEDGDESRTRVDEIEQQAHALVQGMHDADWNPDAADTLTADA
FT                   TVAKILRFAATEVVPRLRETDNEIAQVLHALDGGFIAAGPSGSPLRGLINVLPTGRNFY
FT                   SVDPKAVPSRLAWETGQAMAESLLDRYKSDHGEWPRSVGLSVWGTSAMRTSGDDIAEVF
FT                   ALLGVRPVWDEASRRVVNLEVIDLEELGRPRIDVTVRISGFFRDAFPHVLALLDDAVRL
FT                   VAAVDEPAESNFVRAHAQADLAEHGDERRATTRIFGSKPGTYGAGLLQLIDSKSWRGDA
FT                   DLADVYTTWGGFAYGRGLDGAPAADDMRTAYRRITVAAKNTDTREHDIADADDYFQYHG
FT                   GMVATVRALTGKSPEAYIGDSTRPESVRTRTLSEETSRVFRARVVNPRWLEAMRRHGYK
FT                   GAFEMAATVDYLFGYDATTNVVADWMYEKLAESYVLDEQNRKFMEQSNPWALHGIAERL
FT                   LEAAERDMWEHPEQQTLDGLRQVYLETEGELEGD"
FT   CDS_pept        312468..313601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobG"
FT                   /locus_tag="ROP_02920"
FT                   /product="putative precorrin-3B synthase"
FT                   /EC_number="1.14.13.83"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48539"
FT                   /db_xref="GOA:C1AR62"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR62"
FT                   /protein_id="BAH48539.1"
FT                   /translation="MVDSRSRPDACPGALQVHQAADGALARVRLPGGVLTSTQLQTLAE
FT                   SARDLGNGEIELTSRGNAQLRAVRDPLEFARRLAGAGLLPSETHERVRNILVSPLTGRI
FT                   GGLTDLRDLVGVLDRSLCGDAALADLPGRTLFTLDDGRGDVSALGGDFGVHAVSESEVA
FT                   LILAGRDSGVRIPTSDSAHVLVGAARAFLELRDRHWRLSEIADGVERTLSALTLAPTAD
FT                   PVRGFDEHRPPIGWLDQPDGNVTLGGGLAFGVLDARLAEFLAAVEKPVIVTPWKSVLLC
FT                   DLDEWSAEQVVRVLAPMGLIFDENSPWLNVSACTGQPGCEKALADVRTDARDAVASGEL
FT                   PVEGRQHWSGCERCCGRPKGEVTDVVATETGYRVEER"
FT   CDS_pept        313626..314252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="ROP_02930"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.99.61"
FT                   /note="protein synonym:precorrin isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48540"
FT                   /db_xref="GOA:C1AR63"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR63"
FT                   /protein_id="BAH48540.1"
FT                   /translation="MIEYIRDGAEIYRQSFATIRAEADLSAFPEDVSQAVVRMIHASGQ
FT                   VDLVDDVAFTPGVVKAARAALADGAPILCDAQMVAAGVTRKRLPADNEVICTLRDPRVP
FT                   VLAEQIGNTRSAAALELWGGKLEGAVVAIGNAPTALFYLLDMIESGAPRPAAIVGGPVG
FT                   FIGAAESKEALIEHPSGLDYLVVRGRRGGSAITAAALNAIASEVE"
FT   CDS_pept        314249..315751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobIJ"
FT                   /locus_tag="ROP_02940"
FT                   /product="precorrin-2 C(20)-methyltransferase/precorrin-3B
FT                   C(17)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /EC_number="2.1.1.131"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:cobalamin biosynthesis protein
FT                   CobIJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48541"
FT                   /db_xref="GOA:C1AR64"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR64"
FT                   /protein_id="BAH48541.1"
FT                   /translation="MSSEERSTGKLWGVGIGPGDPELVTVKAARIITEADVVAFHSARH
FT                   GKSISRAVAAPYLRDGQIEEHLVYPVTTETVDHPGGYQGAMDEFYEEASQRLAAHLEAG
FT                   RSVALLAAGDPLFYSSYMHMHKRLAQRFEAEVIPGVTSISAASAALAMPLVEGEEILTV
FT                   LPGTLPRGELTRRLRETDAAAILKLGRTYPAVRQALKDSGRIDETWYVERASTTRQKID
FT                   HADDVSDSDVPYFSIAIVPSPSNARREDAPPQGELVVVGLGPGDQSWTTPEVQHELSLA
FT                   TDLVGYGPYIDRVPERPGQRRHSSDNRVEAERAAMALDLAKNGARVAVVSSGDPGVFAM
FT                   AAAVLEVAAEEQWRGVPVRVLPGMTAANAVASRVGAPLGHDYAVLSLSDRLKPWDVVAQ
FT                   RISAVASADMAFAVYNPASKSRTWQVAAMRDLVLEHRSPDTPVIIGRDVAGPQESVRVV
FT                   RLADLDPAEIDMRCLLIVGSSMTTVVENEHGTRVFTPRRYPG"
FT   CDS_pept        complement(315768..316664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48542"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR65"
FT                   /protein_id="BAH48542.1"
FT                   /translation="MTSAEKRIRDVFADAGCTGWLHARRVGTPAGEVGVGADDLVVLAS
FT                   VYKLPLLVALCRAFESGELSPTATVRVNPADCTPGPTGVSTFRDPVVLSWRDLALSMMT
FT                   VSDNAAADLVLGQVGLESVERALSDLGLTNTRIIGGTADAHHRLVIDAHAHTTAEAFAA
FT                   LADNDEAWTVSAYDPSYASATTPREMTSLLDAIWAGRAVPGAQGGFVRQVMSAQIWQHR
FT                   IRSGFPHSGVDVAGKTGTIGAIRNEVAVVTFPGEIPVAVAVFTRAARTDPVLPVVDAAI
FT                   GHAARIAVTELRSGSVD"
FT   CDS_pept        complement(316661..317554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02960"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48543"
FT                   /db_xref="GOA:C1AR66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR66"
FT                   /protein_id="BAH48543.1"
FT                   /translation="MVGMDLLRHLSFFVAVAEEGHFGNAASRLGMTQPPLSQGVRRLEQ
FT                   RLGTELIQRSARGVGLTDAGRQLLPRARLLVADAARFEDEAQRIAGGRDAVVRWGVPHS
FT                   VADGVVVRCVRALRDADEAHETRVVTTTASTTELVDAVRAGSLDVAVVEHPALLTGLGS
FT                   GPVIKLRRWVVVPDDHPVSAAKKAQVRMLRGLTLATGPRSDNPPAHDLFVDLWRVRGLD
FT                   PDIVIASGQRELLTRVSAGGHFGVTATPPTVMPGVAWVDLLREDLSLRVRIVWRSGADV
FT                   ASSAAALDRVLIRADR"
FT   CDS_pept        317703..318656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02970"
FT                   /product="class A beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48544"
FT                   /db_xref="GOA:C1AR67"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR67"
FT                   /protein_id="BAH48544.1"
FT                   /translation="MLTHRNHPKPRRTGRRGVVALALALPLLAGACTATAEQTLPATSE
FT                   STAPDHESLDAKIEALEAQYATRIGVTAVDPQTGAVYSHRGDERFAMCSTFKAYASAAV
FT                   LRKIEDGSTSLDKTVMIEPADLVENSPVTAAAVGTPMTLGQIAEAALTQSDNTAGNYLL
FT                   REIGGPQAITALARDVGDASTRLDRWETELNTAFRGDPRDTTTPTGLAHGFRALLLGDA
FT                   LDAASRGQLLDWMRASKTSDKRMRAGLPPGWTAADKTGGGGFGTANDAGVAWSPDGSPI
FT                   VLAVLTDSLTNQEDAQGNSQAIADTTTAVIAGLTAP"
FT   CDS_pept        complement(318631..319458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02980"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48545"
FT                   /db_xref="GOA:C1AR68"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR68"
FT                   /protein_id="BAH48545.1"
FT                   /translation="MELSRTFEWRGRSVAWDRFGNGPAVVMCHGTPWSSQLWWPFAHAL
FT                   AAEFSVYLWDMPGYGQSSKDGAHDVDLGVQGELLADLLRHWNLDAPHVVAHDYGGAVSL
FT                   RAHLVHDARYASLALVDVVALRPWGSDYFRLVAGNADVFAAQPTSVHRGALEAYIAGAS
FT                   HRGLTPAQMAVLTAPWLSEQGQVAFYRQIAQADERYTDEIQDRYTSIDLPVAVVWGRDD
FT                   AWIPVDRGEELARLIPGATLEVIDGAGHLIQFDAPVVLAVSLHRWLTAQSNPR"
FT   CDS_pept        complement(319529..319882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48546"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR69"
FT                   /protein_id="BAH48546.1"
FT                   /translation="MNAATDRQWAVRDAVLRWLLAKVTEGYRSPILDADAIGETVGWAP
FT                   SPLTRDEVADASNYLYREGHVTGVPVMGIGIPRPMLTVAGRRVAKAGRSLRPANCRHEV
FT                   DGGHSVLETGLLQ"
FT   CDS_pept        complement(320326..320688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03000"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48547"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR70"
FT                   /protein_id="BAH48547.1"
FT                   /translation="MTGANTHDSTMLQPLVAAIPGVKSRRGPRRRKPRKLRADKGYDYD
FT                   IHRRWLRERGIVPRIARRGIERNDRLGRYRWKIERTIAWLTGYRRMTIRYERHGEHFAG
FT                   FLHLAAALTCFKKLPT"
FT   CDS_pept        complement(320775..321134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03010"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48548"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR71"
FT                   /protein_id="BAH48548.1"
FT                   /translation="MVDELSLRLVPDALWEIVEPLIPPFVARPQGGGSAPADDRAVFTA
FT                   IVYVLTSGCAWRHLPPSFGVTVPTAHRRFSAWVRDGVFEKLHREVLDRLGSAGELDWTA
FT                   AILDAASVRAKRGAH"
FT   CDS_pept        complement(321359..322498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03020"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48549"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR72"
FT                   /protein_id="BAH48549.1"
FT                   /translation="MAGKVVKRAFKYRFYPTEVRADQLARTFGCTRYVYNRALAERSRA
FT                   WSKEGRRVSYADNSTMLTRRKREAETAWLAEPSKGPLQESLRQLQGAFDKFWRIQARYP
FT                   QFKRKGRSKDSATYFSNCLTFRGGQIRLAKQSEPLDIRWSRPLPEGATPSQVTVSRNAR
FT                   GEYHISILVEDTIPELDRTDRVVGLDAGITSLYTLSTGEKIPNPRHERRDRERLAKAQR
FT                   VLARKQKGSRNRAKARLKVAKIHGRIADRRRDYLHTLSTRLVRENQVIAIEDLSVRNMV
FT                   KNRSLSRAISDAGWSEFRSMLEYKADWYGRVVAIDRFHPSSKTCSVCGEVVSAMPLKVR
FT                   EWTCRCGVVHDRDVNAARNILAVGLAVAACGDGVRPPRT"
FT   CDS_pept        complement(322793..323206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03030"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48550"
FT                   /db_xref="GOA:C1AR73"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR73"
FT                   /protein_id="BAH48550.1"
FT                   /translation="MREETAHGHRRDHRRHNEDGRAPRVQRFATEFADGVGQQSVSALH
FT                   YYEQLGLISSTRRSGNQRRYECHMLRRISLIVVAKRLGIPLADVGIVFETLPADRMPSI
FT                   RDWQRVSKLWRVQLEDQRKRIDRLEHELTGCIG"
FT   CDS_pept        323261..325357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03040"
FT                   /product="putative drug resistance efflux protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48551"
FT                   /db_xref="GOA:C1AR74"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR74"
FT                   /protein_id="BAH48551.1"
FT                   /translation="MICAIGPSMEVLLVGRAVQGLGGGLLAGLNYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVAAAIAVIAPRALPRTGRVRG
FT                   GRTRPGHVTRSAHPGDDRDQCGGDPRQPHPHADPDRSGSRLRRSVPGLGAAITAPGAAA
FT                   VDVPPGVVPEVDLPHHRGPRVRNRVRGLHTAVRSTARRIGAVRRGVPRRHDVGRLVGDH
FT                   DLQFRHLPTAGKDGGHAHRTARPRRRLAPHGGALARRRRTRRGDSVGRRAGRRRCGHRT
FT                   RLPAPDGRRHAEHRRRAGGRQGGGRAQHGRVDRDGCRVRGRRCAGQSRRTLDPRLRETA
FT                   LPRSRRHRNGRRVHRVSRDPGARRSALGPRREVVRATENVVGTGELRRMPAVRDAATVR
FT                   PQSLDRRLGPGDVVRVGCQRGVDHGYLLVRQGQLPGHPHLAGKPSVVPHALGAVRQRRP
FT                   VDRGRDPGRPAGIDEPGPGVCQRHRGSSGAGVAAIVADPEREPRDGSGASDVVHGHDGL
FT                   GRFDESNHRDTWDVGGRVPHLLGRFGFREHQPAQPGQAADRVEVALPVRGGCVVDPHPA
FT                   RIPFEPPRGATATVVLRGERQAVLEVDDQRIGAGGRRRGENLVPDRGDQKPASRHRDDD
FT                   LAALRCHDAHAVLSSAIPRSLRVTAGRRTRRSGVRRTCPGTASSGAAPPRAVRLRSRSP
FT                   RRPG"
FT   CDS_pept        323562..324362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03050"
FT                   /product="putative drug resistance efflux protein"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48552"
FT                   /db_xref="GOA:C1AR75"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR75"
FT                   /protein_id="BAH48552.1"
FT                   /translation="MCAGGEPVPATSLALLTLATIAISVAGILGNRTHMLILIAVGVVF
FT                   VVLFLAWERRSPRRVLPRSTYRRGSSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGLAP
FT                   FAAGFLGAMMSVGWSVTMIFSSDISRPRAKTAAMLTGPLVLAAGLLLTAALWRDDAGLA
FT                   VVILWAGVLAAAGAGIGLAFPHLMVAAMQSTDDAQEGAKAAAGLNTVELIAMAVGSAVA
FT                   GVLVNLGAPSTLASARLLFLGLGVIATVGVFTAYRATREPAGRR"
FT   CDS_pept        complement(324359..325195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03060"
FT                   /product="putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48553"
FT                   /db_xref="GOA:C1AR76"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR76"
FT                   /protein_id="BAH48553.1"
FT                   /translation="MSIVTAQRSEIVVAMARSWLLVPAVGNEVLAAAAASGADALVIDL
FT                   EDGLPFAAKDDGRGCAAGWLERNPGWVRINDATTPHWQRDLDAIRGLPGLRGLMLSKTE
FT                   APEQVRDSAADIPGVPVVALIESAEAVVAVDDIARTAPVARLAFGIGDYCRDTGAGRTP
FT                   MALAYARSRLVNASRAARIAAPIDGPTLAHGAESVRDDARLAREMGMTGKLTLANEQVP
FT                   VINTALAPDSDDISWAESTIERLGSDGSRVTHGGHPPQLARAHDILRRADHFASRA"
FT   CDS_pept        complement(325326..325613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48554"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR77"
FT                   /protein_id="BAH48554.1"
FT                   /translation="MQKKSARRAAALAGILSAPLVLGATVGAGTASADPWHVGPVYRAE
FT                   TSGEGAEYFCGKAAALEQTSGVVIVPCTFDSATAVWYRVVFNPASWGFDF"
FT   CDS_pept        complement(325681..326391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03080"
FT                   /product="putative resuscitation-promoting factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48555"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR78"
FT                   /protein_id="BAH48555.1"
FT                   /translation="MPRPQARRGLSQMTTRNMEKRTFGWIALIGAAATVLLGLGAGTAL
FT                   GAPHDWDEVAECESGGDWTTDTGNGFYGGLQFTPETWKANGGKGDPSEASEAEQIRVAE
FT                   NVLKTQGPGAWPVCGQYLKKGGTAPVEVPPVTPAPAPDVVETPEVVETPDAVETPEVVE
FT                   TPDAVETPDVVETPDLAEAPDAVETPAPVETPTTAEDPATVKAAAQEALDSARALAAQN
FT                   GSSEVFEERAAAPR"
FT   CDS_pept        326989..328005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03090"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48556"
FT                   /db_xref="GOA:C1AR79"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR79"
FT                   /protein_id="BAH48556.1"
FT                   /translation="MTPLSRLVSAAALGTVAVLALAACSEPAAADSEQAGAGTLTVYTS
FT                   EPQAKIDALVAAFTAETGIDVEVFRAGTGDLTARIEAERTTGTIGADVLLAADAPTFEG
FT                   YKTAGMLQQYTPADVNALNPDVVDPDGYYVGTRIIPTVIAYNTAAVDAPPTAWKDLADP
FT                   KYRGKITLPNPDVSGAAAFNTAVWLSTPELGEGWLEALAANDPVVAESNGPVGQAVAAG
FT                   TQPVGIVVDYLVRELAAKGSPIALTYPTDGIPYISQPAGIFTDSDDAEAARKFVDFLVS
FT                   KQGQELAVEQQYLPVRGDVGTPDGAPALSDLALLTPDLQEITKIQDDAVRKFNGLVG"
FT   CDS_pept        327989..329656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03100"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48557"
FT                   /db_xref="GOA:C1AR80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR80"
FT                   /protein_id="BAH48557.1"
FT                   /translation="MVSSVRTVSSNAARALPGQRFDPVGAVRVALWLFAAAVIVAPLAT
FT                   VVSLGFGGNHIAQLIDGGIAGAATHSAVSAGLSAVFAVALATVMALLLDRTDLPGRGIL
FT                   RLILLSPLLIPPFVGAIAWTGLLGPSGLVNRFWAERFGGPLWNIYGGDGVVFLLTVHSY
FT                   PLAYLIIAAALRKVPGDLEQIARIGGASPWRAMRTVTLPLLRPALLAAFTLTAVSNLAD
FT                   FGIPALIGLPERYVTLSTMVYRYIQSGTVDRPLEVVSTIGVVLLLLAVLAVFVDRRLSR
FT                   RSRQLDGPVTAPQPLPLGGGRIPVGTLAWTVGLALTGLPIFALASQALLPAPGVPLAWD
FT                   NLTLESIAAAVTAPGTVVGVQNSLLLAVGAGIVCAVAGLVLGVLTTRTRSRDNASLDLL
FT                   AMLPQAVPGLVIAVGWLIVGRYTGLFDTRWVILCAYVTAFLAIVVQAVRAPLSTTPASL
FT                   EEAARASGASRLRTLRDVPVAMTVPAAATGGVLVALTAVRELTMSVLLVAPGTQTLGVS
FT                   IFNLQQAGDYNAASALSLLVTIVGIAGLGLFAGTRAGR"
FT   CDS_pept        329684..330787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03110"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48558"
FT                   /db_xref="GOA:C1AR81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR81"
FT                   /protein_id="BAH48558.1"
FT                   /translation="MSAITLTGVDLHYPDGTTGLSGVDLDVRDGEFVALVGPSGSGKTT
FT                   LLRTVAGFLAPTAGLVRLGDEVVADGTRAVPPDKRGLGMVFQQHAIWPHRSVGRNVAYP
FT                   LEVAKVPRARRAERVADVLDLVGLPGLAKRDPATLSGGQRQRVALARALVAQPRALLLD
FT                   EALSALDEPLRDRLRLELRTLTRAQNLTVVHVTHDRAEALALADRVVVLDSGRIQQVGT
FT                   PEELVQRPRSAFVAKFLSDASLLPGTVSEHGFSSTDGGVHVSRDRLADRSSGTGILAVL
FT                   PSDIEVTSTESAGTARGIVMSSLFGRDASDVVVSCRGAKFRCAVRGTRPAVGDRVGLTI
FT                   RRALFYPAPSKTAPPAHGAATLAGAPR"
FT   CDS_pept        complement(330811..331437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03120"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48559"
FT                   /db_xref="GOA:C1AR82"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR82"
FT                   /protein_id="BAH48559.1"
FT                   /translation="MGGIGQQAAAVTSLAFVVAGLAVVAGRRRDAPTVTYGLLVVAVGV
FT                   GSLIQHGPDPPWQGYAHDIPIATVLAYIAVDAASDRFGRRMSPGWWLVVPLLMIPVVAA
FT                   GPTASTIVQALLAAVAVGLCLERARVRPELRRTTIVAAVLVASGALLGAVGDRTSICRP
FT                   DCLLPGHALWHVLAAAGLWRLAPTIGRPRARQRDGGTRSPGETGR"
FT   CDS_pept        331533..332267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48560"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR83"
FT                   /protein_id="BAH48560.1"
FT                   /translation="MGDTAVDAVAIYHATAANRRGTPWVALDYDVEPGSRHTLLQNLAG
FT                   RGWRNPSPAFDGVDDLPSAVLSLHSADGRTLLIEDGTDVLFEGVVVPPHGWLEHVRMLG
FT                   AVGVIAGAGITAAPDWQRQLPRLARESELLGSTATVTFSSAFGREDFHAFAYEVVSALR
FT                   PALPAEALHDAGFALEDDRPHRAVLEVLDSAVQHRVAVPARIVDMLERRAVDRTSFGWR
FT                   DARTLKRLLRKVHTDGRAPAGR"
FT   CDS_pept        332390..333790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48561"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR84"
FT                   /protein_id="BAH48561.1"
FT                   /translation="MSRSVPGDGSDDPGHMAYARVRAGQVNAVQAALGDHTGRLEWPRE
FT                   QIEHYRTARLRALLSHARERSPFHARRLRGLDPSTATVADLASLPMMTKQDAQDEWDAI
FT                   VTTGDLDRARAERILAEQQWFSYTPNDEQIFSSGGSSGVRGVYVWDWQFYVSAACLAWR
FT                   VQAREERMVPMRPSSRLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEILAAV
FT                   AAAHPTHLVGYASVIGRLARAALSGDLQVRPVRVSTNSEPLLDEDRQAIDEAWSVPIHN
FT                   LWGSTEIGVQAVGCGQGEGLHVCEDEVVLERVDAGGAPVAADAPAVRTLATGLANRTFP
FT                   FIRYDLGDQVTLLPGTCPCGSAFVRVADIGGRRDDDFRYGTKTVPASTFRYVLGADPRV
FT                   SEYQVRQTVDGAEIFAVGDPDVARLTSAVAAALRRQGLSDPQVRIEVVDHLQRHQASGK
FT                   LQRFIALR"
FT   CDS_pept        333927..334244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03150"
FT                   /product="putative chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48562"
FT                   /db_xref="GOA:C1AR85"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010958"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR85"
FT                   /protein_id="BAH48562.1"
FT                   /translation="MTDSDSGAVTEDATGAVSDGTDLIRVHAEIARLDAEILDAVNRRL
FT                   VLAQLAARTRVESGAPMVALGGETDVIRRYQDELGPRGSLLALELLRLARPPFSSTYRT
FT                   R"
FT   CDS_pept        complement(334379..334873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48563"
FT                   /db_xref="GOA:C1AR86"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR86"
FT                   /protein_id="BAH48563.1"
FT                   /translation="MTNKRISRLRGASVDYAIAAFRVVIGFLFFCHGTSTLFAWPTAPH
FT                   SGHTAAVGAWPSWWGAVIQLVCGAALFLGLGTRIAAFLASGSMAYAYFWSHQPDGALPI
FT                   QNNGELSAIFCWALFLMIFLGGGALSLDRLIAHGVRTARVDDEAAAGEPGSTDELREVN
FT                   A"
FT   CDS_pept        335041..335976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48564"
FT                   /db_xref="GOA:C1AR87"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR87"
FT                   /protein_id="BAH48564.1"
FT                   /translation="MLSMRDFRFSFNIFGFDSRDALLDRCRLGESAGYDTVFAADHLGA
FT                   PAPFPLLVAVAGATGLRVGTLVLNAPFWNAALLAREIATTDVLTDGRLEVGLGAGHMKW
FT                   EFDAAGVEWKAFGGRVEQLSELVDGLRTCFTTDFAELPEDRTVPRPLQRRGFGGSGPPL
FT                   IIGGTGDRVLRIAAAHADIVGVAGTFQIPGRPPGTFRLATADEAAERIRFVRTHAGARA
FT                   ERIEWHLLVQLVVETDDRRAAANEIAERLGGTMSVDDVLGTPYVLVGTVEEMAGQLRSH
FT                   RERYGFSYITVHEPYLEVFAPVIRRLREQN"
FT   CDS_pept        complement(335988..336374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48565"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR88"
FT                   /protein_id="BAH48565.1"
FT                   /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNPGMPALAIPGRHE
FT                   VDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCVSMFPGSLAGCIIGTPIGAIT
FT                   GAIVGMGQGNPRAAQAIQEYINTP"
FT   CDS_pept        complement(336502..337290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03190"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48566"
FT                   /db_xref="GOA:C1AR89"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR89"
FT                   /protein_id="BAH48566.1"
FT                   /translation="MTTMGYALSDSATMLRRNLRHMIRYPSVTVLLVGMPIVLLLLFVY
FT                   VFGGTLGAGLGDPAGGRGAYIDYVAPGILLMTVASAAQGTAISVATDMTEGIIARFRTM
FT                   AIARVSVLTGHVIGSMIQTLISLVLVVGVAVLIGFRPTAGIGEWVAATAVLAMFAFALT
FT                   WLSVAFGLVSKSVETASNLPMVLILLPFLGSGFVPTDSMPAGLRWFAEYQPFSPVIETV
FT                   RALLLGGPVGSSAVLAVGWSAGIALFGYLWAKRLFNRRVN"
FT   CDS_pept        complement(337287..338252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03200"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48567"
FT                   /db_xref="GOA:C1AR90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR90"
FT                   /protein_id="BAH48567.1"
FT                   /translation="MMTASITTRSAITTTGLRKSYGDKLVLDGIDLDIGEGTIFSLLGP
FT                   NGAGKTTMVQILSTLVAPDGGDVRIAGHDLTREPDAVRSTIGVTGQFSAVDNLLTGREN
FT                   LMLMADLHHLRRDAGRARATELLARFDLVEAGAKPAGSYSGGMRRRLDLAMTLVGDPRI
FT                   IFLDEPTTGLDPRSRRAMWQIIRELVADGVTIFLTTQYLEEADRLADRIALLDGGRLVA
FT                   EGTPEQLKRLVPGGHITLQLPGVRELDAASRLLGDAPRDEESLTLQVPGDGSVHSLRAL
FT                   LDRLDHASIEVENLTVHTPDLDDVFLALTERATTRKESVR"
FT   CDS_pept        complement(338249..339127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48568"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR91"
FT                   /protein_id="BAH48568.1"
FT                   /translation="MPTFSTPAPISATVELVVGDARITATDRDDTVVDVHPSDGSRESD
FT                   VRAAEQTRVEYSAGRLLVKAPKQRGLGLFGKAGSVDVTIALPTGSEFEGEASVATFHGA
FT                   GRLGACRVKTSAGDVHLGDTGPLDVHTGAGAVTVDHVAGDADLSTGSGKLRAGAIDGSA
FT                   VIKNSNGDNWIGTIAGGLRVKTANGDISVDDARADLAAATANGDIRIGQVTRGAASVET
FT                   GHGRIEIGIRSGTAARLDAHTSFGKVHNHMDSVDRPESTDDKVDVRARTGFGDIVIRRV
FT                   DTQESTSRKAQ"
FT   CDS_pept        complement(339177..339695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48569"
FT                   /db_xref="GOA:C1AR92"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR92"
FT                   /protein_id="BAH48569.1"
FT                   /translation="MDLTPYVASLRHELAVAAAAGGEDARALAERLTAPLESGVRLALL
FT                   DALSAAAGEITRDLAPGSVDLRLRGREPTFVVTPAPVEQSFEEPAASGPGTSSPRIPEV
FT                   EDGAMTRINLRLSQDLKDRVEEAAREAGLSVNAWLVRSAAAGLESDGGSGRSERRAPRS
FT                   NDRFTGWVR"
FT   CDS_pept        complement(339798..340847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03230"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48570"
FT                   /db_xref="GOA:C1AR93"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR93"
FT                   /protein_id="BAH48570.1"
FT                   /translation="MSDNSVRTPHASADAEDDDLARARDGDDAAFTRLVGPLRRELHAH
FT                   CYRMLGSSHDADDALQDALLRAWRGVAKFEGRSTLRSWLYTVATRTCLDAVESRGRRAL
FT                   PVDLGPSSDRAVVGDVPLTEVAWLGPYADAGLVAGVAGPAARYEQREAVELAFVAALQH
FT                   LPGNQRAALLLFEVLGFSAAEIAAVMETTTASVNSALQRARAIVANKIPSVTQSRTLRE
FT                   IDDAHLRALVAGYSTALERGDADALVALLTEDVTWSMPPMGHWYRGLAAVTDFAVRVPL
FT                   TGCGSWRHLPVGANGQPAVAFYLWDEDAGTHLRWSITVLTLRGTKIAELTSFIGPEHFE
FT                   PFDLPQSMP"
FT   CDS_pept        complement(340889..342160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03240"
FT                   /product="putative S12 family peptidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48571"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR94"
FT                   /protein_id="BAH48571.1"
FT                   /translation="MRRPRDRGVLTHVRADNLGERFTARRDIGDGDRGFGFGAQFHRSG
FT                   RVPGGGRCCRRGVDDARRGGTAPHPSGKRRRGGRHTTELGADTPPDAQTRFRIASNTKT
FT                   LTAALTVLLAQDGKLRFSDPVSTYVADVPGGENITIAQLLTMRSGLYNYTSAPELAAGL
FT                   DSDPAKAWTPQEVLTIAFSRPPEFPPGTSYEYSNTNYALLGLIAEKAGGRPLAEQFRER
FT                   LLGPLGLNQTSLPAADDTAVPDPYSHGYMYGESAYALVDEPYPADMQAAARAGTLQPLD
FT                   YTNQNPSYATAAGGAISTADNLATWIRALVSGEVLNPEYQQQWRDSLQPEDPDAPDGQQ
FT                   YGYGISYQRFGPDASMYYHGGELPGFNSFIGYDPDNDVTLVIWANLTLSPEGETTANAL
FT                   LPTVLDEIYAGMSLAPTPAPSPTR"
FT   CDS_pept        complement(341845..342351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03250"
FT                   /product="putative S12 family peptidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48572"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR95"
FT                   /protein_id="BAH48572.1"
FT                   /translation="MGSRARIRKRSASWCRPSARCSNHGAEAVMATMRDSPAEYVRDRR
FT                   TGVDRFRTLRATRIAVLAACGALVIAGCSPTSEPTTSENGSLPAATSATGTAASGSALN
FT                   SIDPAAFQAAVDAAAEELMMPGAVVQLRTPQGNVDAVVGTPRNWERTHRRMRRPVSGSR
FT                   RTPKP"
FT   CDS_pept        342408..343517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03260"
FT                   /product="putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48573"
FT                   /db_xref="GOA:C1AR96"
FT                   /db_xref="InterPro:IPR006045"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR96"
FT                   /protein_id="BAH48573.1"
FT                   /translation="MRELLPTAEAVPRQPSDTEGTSMSTRRSIHNTSLTDGEIVEQSDL
FT                   GSITRVTADTFPILQGLSIKRVLINPGAMRTPHWHANANELTYCLSGTSLVSVLDTGSA
FT                   FSTFTVGAGEMFHIDSGSLHHIENIGDEVAEFVIAFRSERPEDFGLGAAFGAMTDAVLG
FT                   NTYDLDASDFAALRRNTADRALAARIGDPVVPPAAKFSDAHKFAVEEQNPVLSLAVGSA
FT                   HLARVQFWPALKDLSMYSLRIREDGMREPHWHPITAEMGYVRRGSARMTVMDPDGTLDT
FT                   WYLEQGDVYFIPRAYPHHIEVVGSDDIHFLIFFDQPTPGDIGYRASVSAYSREVLAATF
FT                   DTHIGDLPNFPFTPADPLIVTRNNPLDDR"
FT   CDS_pept        343947..344276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48574"
FT                   /db_xref="GOA:C1AR97"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR97"
FT                   /protein_id="BAH48574.1"
FT                   /translation="MDALRDRGEMEAQNLRQKFKEWLAALVHEVVHSNAGVGAGLEGIR
FT                   AALTGKNPVWAAIKALVSGLSGKAKFGLILLLVVALLLGPVLLVILLLVLLVAVIVAAV
FT                   RAATQ"
FT   CDS_pept        344567..345274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48575"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR98"
FT                   /protein_id="BAH48575.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKVLANSPEFAKISDSVREELVSAAKAAAVTAASQRINKLNNRLLSGGGEAVSDV
FT                   GDTVDDTVGGVGNSVGKLSSLGKLGRKRRGRSKDEEYDESEVDEEPDEQYAEEDEDYEE
FT                   PEEEEPSDDEDEPPRRKRPAARRRASSNGSSRPTSRSRSAKSDEDDEEAPARGRRTRAK
FT                   ATTDSAPVRRGGR"
FT   CDS_pept        345271..346437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48576"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR99"
FT                   /protein_id="BAH48576.1"
FT                   /translation="MSTMTNAAKKLREAAPGDGNGSSGVLQDALQKLVGTVTEKALSSV
FT                   TDKVQNASGRLTDYAEGGGGGLLAAVTGSEKLAEGESPIKSAVSGGWESAKQMAKDTAS
FT                   DVKEAVTGGGGSKGKKLKLTNIVETLDVGVPVQLAYNQWTQFADFPSFMKKVERVEQES
FT                   DEKLEWKAQVFLSHRTWEASIIEQVPDERIVWHSKGAKGYVDGAVTFHEVTPDLTRIVL
FT                   ILEYHPKGLFEKTGNIWRAPGRRARLELKHFGRHVMTQSVLHPDEVVGWRGEIRDGEVV
FT                   EPDEDETQQDEDETQPDESGELEETDDNEDEESEEEEEEPEQEESEETDEDESEDTDED
FT                   EETPPPARRGRPRKTAASSEERAAPKRRGRPRKTAAKKAAGSRQGARQ"
FT   CDS_pept        346434..346844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpA"
FT                   /locus_tag="ROP_03300"
FT                   /product="putative gas vesicle structural protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48577"
FT                   /db_xref="GOA:C1ARA0"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA0"
FT                   /protein_id="BAH48577.1"
FT                   /translation="MTAIQPAGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSLV
FT                   GIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGSVTEGGAKSKTKGAL
FT                   EAAGDKLGDILGGGQEEPERERVSRKSSRGDK"
FT   CDS_pept        346841..347632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpF"
FT                   /locus_tag="ROP_03310"
FT                   /product="putative gas vesicle synthesis protein GvpF"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48578"
FT                   /db_xref="GOA:C1ARA1"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA1"
FT                   /protein_id="BAH48578.1"
FT                   /translation="MMSTSEKSNDAPDEPRTSGVYVYGIVPADVEAEEDAVGVCDGPVA
FT                   IVTHGDIAALVSEISVDRPLGKPEDLQAHAHLLDGTSGVAPVLPLRFGAVMTDEDAVEK
FT                   ELLEAHADEFAAALKELEGRAQYVVKGRYVEEAILREIIEENQQAGELVDAIRDQPEET
FT                   TRDARMALGEIISNGIEAKRDEDTRTVVEALESLSDSVNVREPTHEEEAAQVAVLVEVA
FT                   RQEDLEKAVGELAERWDGRVEMRLLGPLAAYDFVVTQKPEG"
FT   CDS_pept        347636..347887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48579"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA2"
FT                   /protein_id="BAH48579.1"
FT                   /translation="MGLMSFIVTLPLAPVRGVISLAELIQRQVEEELHNPASARRALEE
FT                   LEDARASGEISAEEEEQAQQAILDRMTGTARPNSPEKE"
FT   CDS_pept        347894..348184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpO"
FT                   /locus_tag="ROP_03330"
FT                   /product="putative gas vesicle synthesis protein GvpO"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48580"
FT                   /db_xref="GOA:C1ARA3"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA3"
FT                   /protein_id="BAH48580.1"
FT                   /translation="MAEEEPPPLPAPEIAEIATRDVAKLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLALYEVVLDLDGELLSYRRTRRYIRGVGDSGSAQS"
FT   CDS_pept        348181..348588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpJ"
FT                   /locus_tag="ROP_03340"
FT                   /product="putative gas vesicle synthesis protein GvpJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48581"
FT                   /db_xref="GOA:C1ARA4"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA4"
FT                   /protein_id="BAH48581.1"
FT                   /translation="MTVVGGGASNLPQSSGGGFGGGHQSTNLGEILERVLDKGLVIAGD
FT                   IQVNLLDIELLTIKVRLVIASLETAKEVGIDWWEHDPWLTGKNSDVELENRKLRERIAE
FT                   LESDRSVRPAVEDADTVEVEASRQERDDDRR"
FT   CDS_pept        348575..349354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpL"
FT                   /locus_tag="ROP_03350"
FT                   /product="putative gas vesicle synthesis protein GvpL"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48582"
FT                   /db_xref="GOA:C1ARA5"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA5"
FT                   /protein_id="BAH48582.1"
FT                   /translation="MTADDGVWLYSITTDSVDDAQLAEVTGVAGEPVRAVASAGLVAVV
FT                   GTVSLSEFGQEPLQRKLEDLDWLAATARAHDAVVAAVTRRGPTVPLRLATLYLDDDRVR
FT                   VLLTERREEFGATLRRVTGRSEWGVKGYGDAKILSQDVKEEPSPTGAAGKGTAYLLRRR
FT                   AELSAQQDVERKAADHAGEIHAALLEQAVDGLRRQVTDPVLTGKRAWMIFNGTYLVDND
FT                   RIEGFAALVTALDTERPGITLELTGPWPPYSFAGIDG"
FT   CDS_pept        349358..349567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpS"
FT                   /locus_tag="ROP_03360"
FT                   /product="putative gas vesicle synthesis protein GvpS"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48583"
FT                   /db_xref="GOA:C1ARA6"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA6"
FT                   /protein_id="BAH48583.1"
FT                   /translation="MSEMVPTEDTRRIALVDLLDRVLGGGVVITGEITLSLADVDMVRI
FT                   SLRTLIASVSALVPDPAEQDSADG"
FT   CDS_pept        349560..349892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpK"
FT                   /locus_tag="ROP_03370"
FT                   /product="putative gas vesicle synthesis protein GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48584"
FT                   /db_xref="GOA:C1ARA7"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA7"
FT                   /protein_id="BAH48584.1"
FT                   /translation="MAESEPADSDAPSEIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQALRRVEHGDLTDDQIERIGTTLMLLEERMAELRDHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
FT   CDS_pept        complement(349919..350113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48585"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA8"
FT                   /protein_id="BAH48585.1"
FT                   /translation="MNMGKKIRHRVETAEGAAKKAVGRATGNAHLEAEGSKEQARGNAK
FT                   QMGDKVKDAGKKIKNALKH"
FT   CDS_pept        complement(350205..351263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03390"
FT                   /product="putative S-adenosylmethionine--tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48586"
FT                   /db_xref="GOA:C1ARA9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARA9"
FT                   /protein_id="BAH48586.1"
FT                   /translation="MTRAGSDSVTEFRFVLPQRLEASGPPEERGLLRDSVKLLVSDRGN
FT                   LVHSTFHDLPHFLRSGDVVVVNASATLAAAVDGTVDTVGPVVVHFSTELEGGEWALEVR
FT                   APGLVSGALDSVGAGVRIRLSRGAVATLHEPWPRGSTRLWRASIDGVADVAAELLATAG
FT                   RPITYAYIHDRWPLGYYQTIFGRTGGSAEMASAARPFTHPIVTELATSGVVTAPILLHT
FT                   GVSSPERGEPPIPERYDVPEHTARLINDRRAEGGRVIAVGTTVTRALETRATPDGLAVA
FT                   GGGWTNLVLSARRPARVVDGLITGWHAPGASHLMLLESVVGAAAVRRAYDEALARGYLW
FT                   HEFGDSALLLRR"
FT   CDS_pept        complement(351260..351967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03400"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48587"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB0"
FT                   /protein_id="BAH48587.1"
FT                   /translation="MNGTRTALITGGSTGLGRASALALAERGWEVIVTGRRVEPLDRVA
FT                   ARGSAITAVLGDVTDPWHRERITEAIAERRRLDLLLNNASALGPSPMPALTRYPEDALA
FT                   QVFATNVLAPIALIAALIGPVRAAEGTVINISSDAAVEAYAGWGGYGAAKAALDHATAV
FT                   LAVEEPDLAIYAFDPGDMRTAMHQAAFPGEDISDRPEPETVVPALLRLLDTRPPSGRYR
FT                   ASDFAVANTGVSS"
FT   CDS_pept        352224..352529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48588"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB1"
FT                   /protein_id="BAH48588.1"
FT                   /translation="MRSAIAAAAALAAFSAPGIAAAAPNLHGDPNTPGTQVQVESEPGD
FT                   SNSYTCGAVGVAGAGVGSNSSGGAGSVNGAYFGPGPVQGGCVGSDGSVYFPTGNAE"
FT   CDS_pept        complement(352820..353278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48589"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB2"
FT                   /protein_id="BAH48589.1"
FT                   /translation="MTTSDRQPEGTSPAGNVETPAEAPASAVEGTESPAGTTESAPGAA
FT                   TPPAAEAPPSAQDADTSVGQTLFAEDELSVLRLRWDEVQSGFVDDPRECVQKADGLVSD
FT                   VVDRITTGFSEARSRLEEQWARGEEGSTEDLRLALKRYREFFQRLLEL"
FT   CDS_pept        complement(353275..353862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48590"
FT                   /db_xref="GOA:C1ARB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB3"
FT                   /protein_id="BAH48590.1"
FT                   /translation="MPVWGWILIAVLVVIAVLAIIASRSISSRKRTERLKGRFGPEYER
FT                   TVGEVGDQGAAEKELAARERKREKLDIVPLPPEARAKYADSWRTVQIEFVDNPSSAVAA
FT                   ADRLVIHVMRERGYPIDDFDQRAADISVDHPKVVENYRTAHGIYLAQEQGDIGTEDQRE
FT                   AFVHYRELFEKLLETDENNDEPNKDEPKETRA"
FT   CDS_pept        353991..355025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03440"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48591"
FT                   /db_xref="GOA:C1ARB4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB4"
FT                   /protein_id="BAH48591.1"
FT                   /translation="MTVRIGIVGYGLGGRYFHAPFIEAAEGITLGGIVTRSADRAAQAA
FT                   ADFPGVPVFASLGELIDSGVDAVTITTPPQTRRELVLEAVGRGVHVVADKPFAPDVAMA
FT                   RELVAAGDEAGVLLSVFHNRRYDADIRTLKSVLPRLGDIWRVESHFDLDGADTLEAGPT
FT                   GGLLRDIGAHVVDQVLWLLGPAERVDAHLDYVDRPEGRTDAGFVVNITHRSGVYSTVSS
FT                   TKVNHFEGRRLRAFGSAGSYVADGTDVQAQALFAGTRPVDDPTGWGLERPERWGVLHTA
FT                   EGPETIPSQRGAYQDYYREFAAAVAGAAPQPVPARTALGTIAVLAAAREAAETGRTVVV
FT                   APAD"
FT   CDS_pept        complement(355041..355844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03450"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48592"
FT                   /db_xref="GOA:C1ARB5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB5"
FT                   /protein_id="BAH48592.1"
FT                   /translation="MPFIESGGDRIDYTVHGDGRSSNVILLAGFKAPATSWRYQIPSLI
FT                   GAGHRVVAVDLPGHGTAPAMPHGTTMQTRADQVHALLEELDLQDAAMIGGSMGGNTIWS
FT                   YVDTYGTGRLRAAVVVDQTPRMLNTPDWEYGFYGYGGDEADTFFADGIPSTGHGTPIWR
FT                   RGMRLVRFIAAMGRVDWKLSQPELALLNDHAQRDWRPAIRSSGLPVLFVAGSESELWPP
FT                   AHAEVAAALAAKGASTVIPRAGHATNMERPESFNTAVAEFLDSAR"
FT   CDS_pept        356425..356874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48593"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB6"
FT                   /protein_id="BAH48593.1"
FT                   /translation="MAQLAASAEPEVRAQLDAKIAVLDEHRTAVGLKRGKINRELAFHF
FT                   ARQTADYAAAAGATVIAVLDLTTLEARGHGRVNNNRAAQSARRKAVTALAHTAAGVGIA
FT                   VVSVGPADPPRGVRVATHPSHAPAAITPRGVQVAGSAATATTSPE"
FT   CDS_pept        357283..357660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48594"
FT                   /db_xref="GOA:C1ARB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB7"
FT                   /protein_id="BAH48594.1"
FT                   /translation="MDVGSTHSDRTLEMHTSLHHEASHASNRSGAVNTLRRVPLRNRFV
FT                   TVVAAAALAVVPVGSATAVAAAPELPATTVSAPTIPGDRGDNGDGPRHDRQRDQRQERR
FT                   DQGMTLDELLVGWNSSQIHQF"
FT   CDS_pept        complement(357651..358133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48595"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB8"
FT                   /protein_id="BAH48595.1"
FT                   /translation="MTIDDIIDFVEGLDDVLTLRPVPGDGSPEISWGDTFFYYSPDGVV
FT                   PTTTQPFATIVTKNYPGDEDSRLDRAGAFRVNIHAGKEAFLATLGRAPREPGPAHTDAG
FT                   ASDTVIAHPVYGSAAWLAIVNPGPRTGRLTRELLCTAHALARSRYERRADAVRRQN"
FT   CDS_pept        358211..358960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03490"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48596"
FT                   /db_xref="GOA:C1ARB9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARB9"
FT                   /protein_id="BAH48596.1"
FT                   /translation="MPKFRTVDVARRAGYSVQQIRNLERAGVLPPATRTATGFRVYTEV
FT                   QLQSALAYRELAVAVGPVEAKRIVRSVHTCPAAATVALLDAAHARLHTERAELALAKDA
FT                   AAVISAEQIEDVRASDWMSVAELAAALGVRTSTLRHWDTEELVIPDRKAPTRERRYSPS
FT                   QVRDARIVHQLRKAGYRIAPLRAVMAQLRRPAGSGDIGVALAVRDETLTGRSRALVDAT
FT                   AALAGLLPPSGVSPRATAPQPENRSRR"
FT   CDS_pept        complement(358911..359582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03500"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48597"
FT                   /db_xref="GOA:C1ARC0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC0"
FT                   /protein_id="BAH48597.1"
FT                   /translation="MALARAGLIEEESTMSERTPSGRTPSRWEEITAADPGHSAWYVER
FT                   FRAMEAKGQDIVGEARLVDAMLGRGGRVLDAGCGLGRLGGYLHDAGHVVVGVDVDPVLI
FT                   GVAEEDHPGPTWLVGDLAELDLPSRGVAADFDVIVCAGNVMTFLAPSTRESVLAGFAAH
FT                   LAPTGRLIVGFGADRGYEFPQFMADAGANGLTVDLLLSTWDLRPFTDDSDFLVAVLSRA
FT                   D"
FT   CDS_pept        359666..360085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48598"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC1"
FT                   /protein_id="BAH48598.1"
FT                   /translation="MPESPPDRVQITDRLHVVANLLDTRDWPGFAATLTEDVVAYGRTG
FT                   PAAVVARVRSHLDVCGTTQHLLGNIRIDLDGDTARTTSYFRAFHLGLGDRAGASYECLG
FT                   EYRDQWRRGPSGWLLSGRVIDVRAEIGDRSVIAPR"
FT   CDS_pept        complement(360099..361187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03520"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48599"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC2"
FT                   /protein_id="BAH48599.1"
FT                   /translation="MNARMRAFGVAVTVAATVLGACAAPPPGDDAAKKVYFFLPNTTTT
FT                   RFVERDEPLFTDFLELFAPKATVTVRNAEGDPARQQSQVESAIADGAAVLVLISADARF
FT                   SGGALTAAADANVPVVLYDHDAVGGPAEVQVIFDPLEVGRRQGSRAADLIAAMPGDGLK
FT                   IARVEGNLGEYGTRQFQLGQNEYLQPLIGSRKIRVVCETAIDDWDPAEGQAFAEECLTR
FT                   ENNDVDLFVTMNDDLAGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQGTLDNTIFK
FT                   NLSDQAKVAAQLTTSILHGADLPENMINGTIDNQYMAVPTVFLPVQNITQDNLHVVVNS
FT                   GFYTWQQICAPDPDSAVCREHD"
FT   CDS_pept        361226..362704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03530"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48600"
FT                   /db_xref="GOA:C1ARC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC3"
FT                   /protein_id="BAH48600.1"
FT                   /translation="MPGVGIPTGVDGYACSSMLSVFSGTDRRTLSAGMEEERVFDQDRG
FT                   TVSSGERDTSPADEHLLKESLLVEPEIRRRPWREFLESTPGRLSVLAVVLVAVALTAGV
FT                   VTSAVIGARQQRMETLRAHTEPLADAAQNLFSSLSIADAAATSSFIAGAIEPLAVRDRY
FT                   NQAIGDASNALVTASYGVTSGDVGSLRLLTEMSRHLAVYTDLVATARSNDSAGNPVGVA
FT                   YLGTASALMQDTILPLAERLYSDQAGAVADTQSHTARLPVTAIVVASAGVVVLAVAHAY
FT                   VAHRSRRRVNPGLACATVLLAALVVWIVVAGLLSTSASERARLDGAEPLAAVTKARILA
FT                   QQARADETLGLLRPGFDPTGSDYTRHTDALAAILNSDASPDAVDVPAIDDASAAFEGWR
FT                   SAHRELQRRLADGDFQGAADIAVGPGSTASTAQFRTLDESLEDAIIALRADELDAMRES
FT                   YRTMAALAVGAVVLAVSAALAVIAGIEPRVSEYH"
FT   CDS_pept        362704..363693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03540"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48601"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC4"
FT                   /protein_id="BAH48601.1"
FT                   /translation="MVRPFRARRPGITRLLGGLAFGTVLIAGCGSPDAPTPMFSGDFTE
FT                   FPASVGARIIEPSESPPPDGQPSSCAPTVSLRPGIAGAGGALGEIRARGSLVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPAKVEFRPLGSGDGAEMLAHRDADMIVR
FT                   PVALPCESPQDVAFSTVYLETPRRLVVRVGSGISEPADLARRRVCTHDDPASVSALSRI
FT                   APKATIVAVPDWDDCLMAIQQRQVDAVVGAALLAGLVAQDPNLDIVGPDSDSARYAIAL
FT                   APGRDDLVRFVNGTLERLRTDGTWTALYDRWLSPLGPAPAPPSPDYRD"
FT   CDS_pept        complement(363713..364126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48602"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC5"
FT                   /protein_id="BAH48602.1"
FT                   /translation="MELVERAVSADIDAAARAVITAAAAEASRHADEIIGTGPLPGTAE
FT                   WDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTRQS
FT                   AHERWGARTTALLDPMGTGLPQTVADDDPEVAR"
FT   CDS_pept        complement(364203..364961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03560"
FT                   /product="putative epoxide hydrolase"
FT                   /EC_number="3.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48603"
FT                   /db_xref="GOA:C1ARC6"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC6"
FT                   /protein_id="BAH48603.1"
FT                   /translation="MGGVRFRSPSTGRSIRAVLFDTFGTVVDWRTGIASAVAGYAERHS
FT                   LTLDAAAFADRWRDRYQPSMEPIRSGAREFVTLDILHRENLDVALRELGVDPTEHDSGE
FT                   LDELSRAWHELTPWPDSVPGLTALRSDYIIGPLSNGNTSLLLDMAKNAGIPWDVIIGSD
FT                   INRIYKPHPRAYLHTARLLGLDPGEVMLAAAHNDDLDAARAAGLATAFILRPLEHGSHQ
FT                   TSDLAPTGSWDISATDIPDLAAQLRAASRG"
FT   CDS_pept        complement(365051..365494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03570"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48604"
FT                   /db_xref="GOA:C1ARC7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC7"
FT                   /protein_id="BAH48604.1"
FT                   /translation="MTSTPPATGAFDATPAPTDGTTKKARVAGLVVSALAVLFLLFDSL
FT                   IHIANTQMVREAMAELGFAENLNRVIGVVLLVCLILYIVPATSILGAVLLTGYLGGAVA
FT                   TNLLTEQPIVSTTLFPIYVGVFVWGGLYLRDPMVRSIMPVRRT"
FT   CDS_pept        365700..366161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC8"
FT                   /protein_id="BAH48605.1"
FT                   /translation="MDGLVKLVIEATDLPGSSCPPGANFPGYDNIHVAVQRRGTPGDLL
FT                   DLHPGDATTARWVLECGTTPTPTGLDITGPYIQGRPGARFVYLSWGTVDGDGGFDMFRR
FT                   AKLMWDAVDPATANAAASAGRITARLGLTDARGNPLCAAVRPPLVEWSA"
FT   CDS_pept        complement(366234..367667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03590"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48606"
FT                   /db_xref="GOA:C1ARC9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARC9"
FT                   /protein_id="BAH48606.1"
FT                   /translation="MTGRTANARRMSLRTLLWLAIGILVALFAVSAAFSVYGRLVVRAS
FT                   EDVLSERLLPAQRAVSDLTTAYVDQETGQRGYVLTGDPRFLEPYDAGRSAAAASLSDLT
FT                   ALLGGDAEASATLDAVVEAANTWTSQASEPEITARRNDAIAQDQVVAMTATGKELFDGL
FT                   RSELQELNSLTDERVTEQVDRVRSAQILANVATAVAFVLAVGTAIISGYLTRRLLTQPI
FT                   ERLVADISAVAEGDYERKIGTDGPREVSMIGGAVDTMRNSLLTQNRLLVQAEHERTRHD
FT                   EQTRMAADLHDLTIQRVFGLGLALTSVARRHPRLTADLDPLIDETDSIVRGLRAVIFDL
FT                   QMGSASLTNGTASLSAAVGEIVESSTAALGFTPDVCLDGPVDLFSGHDAGPELQAVLRE
FT                   ALSNVARHAHATSCRVMVAADDDRLTLSVTDDGTGIGEDAVRGHGLANICNRAAQLGGR
FT                   AVIRDGAPGTVVEWEVPAS"
FT   CDS_pept        complement(367798..368220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48607"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD0"
FT                   /protein_id="BAH48607.1"
FT                   /translation="MGTGGRAARVEDVHESALGMPHVTVTYGPADNPVYQVGGKSFVFF
FT                   RTPRPDATDPDTGERYDDVIVFWVPSDADKQALVRDHTTPFFTTSHFDGHLSVLLRGSR
FT                   VGELSRHELVELVQDAWLSRASARRAATWLSAHPPA"
FT   CDS_pept        complement(368345..368800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48608"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD1"
FT                   /protein_id="BAH48608.1"
FT                   /translation="MNSIMTLSDLTALTGLDVFDYLDQEVLVPVVDGMQAQGDLIVIPY
FT                   SIVAELVTPNHWTRSENVPLSGVELLRSAAGGNPHSLVADEGMCTWSTPVDDPRRLALG
FT                   ILDTRVTAYLIHPEHGATGIAPGRYVVGRQRERSVGRSFERTQFVVD"
FT   CDS_pept        complement(368834..370066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48609"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD2"
FT                   /protein_id="BAH48609.1"
FT                   /translation="MSATPRRSKARHRATFIDNTDHSAEYMFGVGAVRDAWLGHGLCAR
FT                   PSDRAAAESAVETLYRRAGFRDPEFVWVPSPPAGSDLIAAEGLATTLSFAGDGADCVSA
FT                   RMATMLSESRKRMDALIARGRSDWPNERRAIEIARAQPPDHSARVGISPNAIIRAAVWD
FT                   SLRTTLFDGVAAAIRTLMPAAVGGVSWYGQQEAHRVAYYDTYRRFGLARFHSVDAELLD
FT                   VHTALTGATGWWWAFDSTCVMAERPIALHAEPIPGRVHNEHRLHHLDAPALEFGDGRSL
FT                   FVQNGTIVPDWVVLEPTVERIAGERNVEVRRCAIERIGWDTYIDSAGLALIGRVDDPGN
FT                   IGHTLQLYATSDGRGRIEHILLAVNGSPERDGRRRRYGIYVPTRISSALDAAAWTYGLD
FT                   GADYARLVRRT"
FT   CDS_pept        370305..371009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48610"
FT                   /db_xref="GOA:C1ARD3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD3"
FT                   /protein_id="BAH48610.1"
FT                   /translation="MTSSNYSAPPNDGSRHRTGPADALKGELPVTDSVLSYTDHGRTDE
FT                   MTLIPDRSPIVIGRSAYADLSLPTDPDISRLHATIERIGIHWTITDDGLSRNGTFVNGT
FT                   RLQGRQTLHPGDVIQVGESLLTYHGEPGTDCGITHIGDTVDPDIVLTPAQHTVLTELCR
FT                   PFHDGTDHPIPASNRQIADALHLSTETVKTHLRALFSTFHIEDLPQNQKRSRLVTLALT
FT                   NGVLDAAAPSDF"
FT   CDS_pept        371130..371561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03640"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48611"
FT                   /db_xref="GOA:C1ARD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD4"
FT                   /protein_id="BAH48611.1"
FT                   /translation="MDPTFVIVGGATGALTAYVLPLWLIRSGRGPRLAAKREVSTAIDT
FT                   GALPPDADIWSWRPRLVESRQTVARGRWVMLAAGLLMSFVTLAHAVGEGGTLLTWVFVG
FT                   SAALSLVGAFGMHRQVRRADSLLAAISAGPTARPNFGAR"
FT   CDS_pept        371680..372369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48612"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD5"
FT                   /protein_id="BAH48612.1"
FT                   /translation="MRRVVRAFWGPRPEPVEALAGRWRLTLERVSQLLPVGGEWRQVHA
FT                   SEPDTACAPDELTAVLLVAQDTEAWSDRTGTGLRLVCTGEAGWAVELSGVAGGTPQFLL
FT                   QSLVMTVEAPEDAVVPESELLAMLAAVWEPDFGDVTDDDILDALEDDAGFVVGDPVVGR
FT                   FGYLCSARAVLIPDGLEASGPAVPDGGVLLHIAASGEIDTVVRVYERLRDAGALAPLAR
FT                   PLDRPTL"
FT   CDS_pept        complement(372400..374430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48613"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD6"
FT                   /protein_id="BAH48613.1"
FT                   /translation="MEFPMLSKGQNLSLPADVEQIDVVLGWTESDVEVDASALLLNVDG
FT                   KVRSDADFVFYNQPESTDGSVRFLGASGTEEGAQARIAIDLSTVPEDVHTVALGGSVAA
FT                   GGFGDLGKLALRVVDGAGHTLAEYVTADATTESAFVFGEVYRRNGDWKVRAVGQGWESG
FT                   LAGLATDFGVDIADDPDPELTESADAPSDRENSDGAVPTGSTGDAPQLVPELPTTPAAP
FT                   RKTATRGVRTTKRVVKKSKPLVFGLAEQDTWQPARLFSVIGVGAGEEQERRATSALIAT
FT                   MQAVRPFARAVCARVGAPAGTFEGYVEVAYARGETKVIPDAVLKVARGSRVWTGLLEVK
FT                   TGSGKLKKEQLENYLDVARKKKYDVVVSLSNDVPASAGELPVEVDRRKLAKVALRHLSW
FT                   AEVAHEARMLLSHGGIDDDLQSWVLAEFLRYLDHPRSGAVEFVDMGRHWVTVRDAVTAG
FT                   TLRAGDEKALTVADTWVSLSRHLALRLTAELGVTVKHVLPRRHSTDPAARNAAVAERLA
FT                   GDGVFEAVLRIPETAGDLVVIADVRTNKIRCRTTVEAPNEGTSGRRVSWLLKQLRDVPG
FT                   DVQVEAVFSERGNEACEHIEAVRVDPKVLTVGRSGDIVSFCLEQSFPMGGRRSGTAASF
FT                   ISSVTSSADGFYGTVVQQLREWVPAAPKQTEQPRAAAPEGE"
FT   CDS_pept        374905..377454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03670"
FT                   /product="putative LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48614"
FT                   /db_xref="GOA:C1ARD7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD7"
FT                   /protein_id="BAH48614.1"
FT                   /translation="MDSVWPLIGRDQELRRIWATIEGSGDDSGVLVAGGVGVGKTRLAS
FT                   AAVAILAKRHAVRWVTATASTRTLPLGAFAQWAPISQADPMKVLHTVIEALTAGDKPVV
FT                   VAVDDVHLLDDLSVVVIQQLVQRGLARVVLTLRSTEPAPDTITTLWKDGFLNRLDLDPL
FT                   RENDTERLLSTVLAGPVAPATAAELWNLTRGNVLFLRHLVCQERDAGRLVSDVGTWRWS
FT                   GEPVVSPTLAKLITGQLGSLTDDTAEVLDYLAIGEPVDGTVLEMLTSPHAVKEVHSRGL
FT                   IDMTSDNGDIAVRLSHPLYGEVRRSTGNLLQLRRLRGRLATALSTRADPTPAALLRRAS
FT                   LTLESELPSDLELYLVATATALRLHDAPLALRFADAGHISDSGFQAAMLHYWVLTNVGR
FT                   AQDAFALLEALDQNTLTIEERQRLSVMRVGTLCWSLGDPEQARRELAIAKQAPESHESP
FT                   ELAAFEVLLESVQGRPEHAIAAGNVLYQAAPSDMAFVLTSCALVIAHGYSGNAANVFPL
FT                   TERASALVATSSDASALEYGIVYFHIEAMFIAGYLQAAEQVMTQFVEYAANTPGTIGLF
FT                   VSLLHSYVDLSRGRLSAALEVLNRADREFRTTTYDRSAVVSCRIYLILALSHRGDGKRA
FT                   AELVRDLDTLNPYGFLRSACTLAKAWAAAAQDMIADAIRLARKAAAIAADRGHFGQELM
FT                   CLQAGSQFGDRTTAHRLNELTALVDGPRVHAAALHANGLNSVNGETLAEASRRYEEIGD
FT                   LVAATDASAQAGTLFREQQHHGSALTAIERARTLAGTHRGLDTPALRRATETKPLTRRQ
FT                   REVVALVSQGFTNKEIAERLGVSIRTVEGHRYHARLR"
FT   CDS_pept        377542..381390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48615"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD8"
FT                   /protein_id="BAH48615.1"
FT                   /translation="MQLEKRFEAMGRPSPRMVRPDCSSKRPHGGVTMNSDKHLKHLGEL
FT                   AVAVGIGLAVAPAGTAVAAPSVGDSSTSSSSDSSDQTSSDGRAADRSTDGASSDRTSSG
FT                   TSRTDSDSSSDGSRSSTTGDSTTDSQSTSGTDSQSTSGTDTQSTTDTESTSATSSDDVN
FT                   GSGATTPDISSTVNDGSMPDSGTTAGESEQAGSSSDATAPTAIDASGAAIAPADRPQER
FT                   ADTELSDSPASPAPVQGHDSAPQGSDPAPTPPTTPVTGSSGAALDPIMAEDPAARGPVP
FT                   NAPAAIQDAVPATASAPEITTIDGATALTGIASDTKADASQVVTQALAPSLPTAAVDVA
FT                   SSVVSKVLGALGLRPFLSNDPQVPIESPTFWALAAAWCRRQEKVFTADANPTLAAAPVT
FT                   TSEPIESVAVTSTASTLTSTASTGTSSTSTAGPTVGAPDRSTGVVLGSINTSGDQLGYT
FT                   VTGQPSRGTVTVDETGGFRYTPTQAARQVAALDPSADYTSFDSFTVTPTSGQTSTPVTV
FT                   QVPVSAARMQVAQSTTVGSNPSGAVFTGTRTYVANQGSKSVSVLDTNDTVVGTVTVGTS
FT                   PTGVAANPAGTRVYVTNSGSGNVSVIDTATNTVVATVKTGTTPSAVAVNPAGTRAYVTN
FT                   SGSGTVSVINTATNTVVGSPIKVGITPNAVAVSPDGTRVYVTNRSSNTVSVINTATNTV
FT                   VATIRTGTTPNAVAVNPTGTRAYVTNRANNTVSVIDTATNSVVTTVAVGSQPTAVRVSP
FT                   DGSAAYVVSNPDRLTVIDARTNTVVSTLSIDSPTESGDHSIALSADGSRMLVTDATDGR
FT                   VRAVTLTHVNSEPTMSWTADAPRPSDGAVVVTLVDPRDPDGDPLTFTNTAPGSGSVVSD
FT                   GMTFTYTPTAAARDLALQTPGEDADHFTIALADGQAVTNIVVTVAISPTEVPDILEVES
FT                   TTIAVGSGPTGVVTAEDRIYVVSDEGFVRVIDPETNTVVGAPIEVDWASSNIAATSTSV
FT                   YVNSPYTGAISVIDTSTGTVVDTIWVDPAPDYQGYSLAQELAVSPDGTRLYASGEDGTV
FT                   SVIDTATNTVIASQLLGSYSSLEVSADGRYLYGTSGATVSVIDTASLTRTAEITVGPEW
FT                   DLTRTSSEFADVSHSVTVVNGNRLYVTHHVSTVERATGSFSNGQFITDSQGRLWRVTGG
FT                   YGLVSVIDIDPASATYGSTLDTVRLTGDAQDLALSPDGGRAFVTAGDGRTIAVIDTATN
FT                   TVVGTFVTDGEGAVTGPYGPLRTVSISSDTLYVTDYNDGAMYAVTGALDGAPAAVLT"
FT   CDS_pept        complement(381477..382016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48616"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARD9"
FT                   /protein_id="BAH48616.1"
FT                   /translation="MADASLRITRLRTLIEHPRTGDTERAAAQRMLDRILSKSRSRYDT
FT                   SDRTYGARHDRVGRHAGLSRIADEIRDDIALARVVFSTPTLPGQLAAPDPIGDAPPGIT
FT                   YTVETPHDAGIVITINDVPADWGWISAGGVEAVSPALRALAGELAKLMDGYNHYGAHIG
FT                   RRFFGRIRVGGETLIW"
FT   CDS_pept        complement(382108..383130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03700"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48617"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE0"
FT                   /protein_id="BAH48617.1"
FT                   /translation="MTQVRKSRQGARPWIRYLVGIVAVVVLAGCAAPDPLTPTVSGTYT
FT                   TRPMTNGAQIIPPTNNPPPEGPSPESCGALASLRPGPQPPPGQMPPGGALAEIASRGRL
FT                   IVGVDQNTNPFSFRDPTTGTLQGFDIDVAKEITKDIFGDPAKVEFRLLTSAGRFSALEQ
FT                   NDVDVVVHATAITCERARRVGFSTEYFRAFQRILVPRGSDITGPADLAGKRVCTFVDTT
FT                   SLPTVQRVAPEATIVAVPDWDDCLVTMQKRQADATSTSDALLAGLVSQDPHFQIVGPPM
FT                   EGEEHWGLAVNKYKDDLIRFVNGTLDRMRSDGTWMRLYDRWIAGSLGPIAGPPPATYRD
FT                   "
FT   CDS_pept        complement(383130..384485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03710"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48618"
FT                   /db_xref="GOA:C1ARE1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE1"
FT                   /protein_id="BAH48618.1"
FT                   /translation="MQEGRMFHRGDHVAIETPTLDEGLLVEPEGRRPWVEFLTSTPGRL
FT                   TVLGVALIAVVIAAGVITSAAVGARQQRVEVLRTHTEPLANAAQALYSSLSIADAAATT
FT                   SFISGGGASTGAEQFTQAVGDASNALVTATNGVSSQDAESLALLSDVVRNLAEYFNLVA
FT                   TAQANDRAGNPVGVAYLSDASALMQDTILPLAEQLYVRQAEAVAETQTHTAQLPAAAFT
FT                   VTAAALVALVLAQLYLVRKSKRRFNPGLAVASLLMAGLLIWLIAGSLVSTSASEHARTE
FT                   GTQPINTVARARILAQQARADETLALLQRGADTQSEVDYTRHSQALSDELTRQLDSAHG
FT                   DVAADDLRDAETAREGWLAAHRDIEIALERGDYPTAAAIAAGSGSGTSAAKFAVMDAAL
FT                   RDAIDRLRDDEAAAVTDAYRSMSSLAIGSMIIGVSCGFAVGGGIWPRLNEYH"
FT   CDS_pept        complement(384585..384842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48619"
FT                   /db_xref="GOA:C1ARE2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE2"
FT                   /protein_id="BAH48619.1"
FT                   /translation="MVWAALLVAVLLIEGPPARVVVAGATAVGVLVVQLAGVRPRLTRR
FT                   SDRVLAGEDVPRSHAHYVYIGLEVAKVVALLVTGVLLLGV"
FT   CDS_pept        385015..385887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48620"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE3"
FT                   /protein_id="BAH48620.1"
FT                   /translation="MSSRGSAAEWASGQVHAVRDDPDARLELSARTYHGPVGNAPRHLP
FT                   FRRAALSFMRWQVGRGVLAALDASPPGSPWWRAVNERLLRDGCEAVARSGGMGGTPSSQ
FT                   AVDLWMLFVADPTARTWYRAHNASIVSAYLDHRGLAESESRPERFFLNVVLLRVLFAHA
FT                   LVAAPRLALGRLAPAGPLLGDPRLSMTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNLGE
FT                   LLDYGLIGPRLQQLYEWSAAELDEPRLLGCIRDGSPTYAWSYTDREVWHPARPAATIRA
FT                   VRRFVPARR"
FT   CDS_pept        386029..386925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03740"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48621"
FT                   /db_xref="GOA:C1ARE4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE4"
FT                   /protein_id="BAH48621.1"
FT                   /translation="MADQYACQDPTTQYPDPDREHQPEIPHPGLTADMVTTPDHGEKTY
FT                   RGSGRLDGRRALITGADSGIGRAVAVAFAREGADVVVSCLDAEEPDARETVRLVNGAGR
FT                   RAVVATGDITSEDHCQTLVDLTVREFGGLDILVNNAAFQMVQTGGIADITTEQFDRVLR
FT                   TNLYALFWLCKKSVAVMEPGSTIVNTSSIQGMNPSPGLLDYATTKAAIINFTKGLAADV
FT                   AKRGIRVNAVAPGPIWTPLIPATMPADGYRKFGEDVPLGRPGQPAELAPAYVFLASNES
FT                   SYVTGEVLGVTGGIPFT"
FT   CDS_pept        complement(386963..387706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48622"
FT                   /db_xref="GOA:C1ARE5"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE5"
FT                   /protein_id="BAH48622.1"
FT                   /translation="MENSTPVTPPIRLDDLIEAIKKGHAEAPLEQLTDAVLAAEHLGDL
FT                   ADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRFTP
FT                   RARQVVVVAQNEARAASNSEILPQHLVLGLLTDPDGLGARAIAAQGVDLDTVRHAATAT
FT                   LPPAVEEIPALIPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGVLAGL
FT                   GVDKAAVEENIAANLAAIVAARTEE"
FT   CDS_pept        387818..388210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03760"
FT                   /product="putative PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48623"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE6"
FT                   /protein_id="BAH48623.1"
FT                   /translation="MASRSRDRCSMHIEKDLVAASATPLVLGILAEGESYGYAILKRVN
FT                   DLSGGRIQWTDGMLYPLLHRLERLGLVSASWGASDSGRRRKHYTITAKGREMLAERRAQ
FT                   WDVVADALSQVWRSVQLPPAPAEGWS"
FT   CDS_pept        388201..389556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03770"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48624"
FT                   /db_xref="GOA:C1ARE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE7"
FT                   /protein_id="BAH48624.1"
FT                   /translation="MVVMDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISD
FT                   LSAAGLETDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLIPAAPDGDRTRPTREL
FT                   FVVLGFAVGAALALEAGLATLDEQDLARNLSLFILPFLAGYFAWKRKVTLRLAAALVVP
FT                   FVLAAVLLNVFPFVSNGSTEVIAAIHAPIALWFAVGVAYIGGQWRSDRRRMDFIRFTGE
FT                   WVVYLTLLALGGGVLIGLTVNAFDALGLSVEWVVEDWVLPFGAAGAVIVAAWLVEAKQN
FT                   VVENIAPVLTRVFTPLTTLMLLVLLIAFATTGSVVDVDRNLLILMDLILVVVLGLLLYA
FT                   ISARDPYLPPDLFDRLQFVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLL
FT                   VNLTWSAVLILGFLRGRREFGSTENWQTRYLPVFGVWAALMVGVLPPIFDFT"
FT   CDS_pept        389673..390662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="ROP_03780"
FT                   /product="putative rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48625"
FT                   /db_xref="GOA:C1ARE8"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE8"
FT                   /protein_id="BAH48625.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKEPHRALAIGS
FT                   EARSLVGRTPIGITPVRPLRDGVIVDLESARAFVTAIVKRVSPARRYGVRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPLEPRAHLVVDIGGGTSEITA
FT                   ICFGGILSHRSCRLAGDELTNALYQYLRAEHNIVVGELTAERAKLGAPDTDEGQSLVVE
FT                   GRDAVTGRARFVTLETEEIVDALRPTTTGIVHTLTECLEDLPPQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEEAFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSS"
FT   CDS_pept        complement(390663..393500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03790"
FT                   /product="rod shape-determining protein/penicillin-binding
FT                   protein"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48626"
FT                   /db_xref="GOA:C1ARE9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARE9"
FT                   /protein_id="BAH48626.1"
FT                   /translation="MQDGKHESDPWIVGAAIVLVVLGLLNLTATGMTGHAVRHLLFAAA
FT                   GLAIMWVVSRLRVSDLRTFGWAVFGVATLLLAAVPLAGVATKGAQRWLNFGVFTVQPSE
FT                   LAKLALILVPASMLAGGFTLARFLATLGIAAVPVTLVAVQPDLSTAVVLVATAGFMLIL
FT                   ARVPLLPLVPLFVVGIASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQANIAIG
FT                   SGGLWGLARDPLYDVRAQFLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWRAALAA
FT                   RTARTREAALVAAGIGGLFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIVGFAAIG
FT                   LVLAVRRDGVARPLWAPDPGRRRRPRGMSAGTMTMIAALVAMSVFAWQVQHDRGAEYRA
FT                   MSDAQMMRCIRLPAERGLIVDRNGVPLVVNVAEYAVAVVARMFEDSDDDARNRLAALLV
FT                   KSPNELSDLIDAGGEGETQVAVGRVAPDQARRIVDARIPGVLVVPSGRRQYPYGAVLAS
FT                   ILGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYVDPSGNPVATG
FT                   ERVDPVRGHDLRLHLDIGVQTLATDALTEAMRTSKGDLGAAVVMDARTGAVLALASVPG
FT                   ADNNVYGPPADLVALTAQSQTPGPSPLVNHATQTAVPPGSTFKIVVASADMQYPVLSPD
FT                   AVIETGAAYTYGGHTFRNWQPMGPNNLLGAIQWSDNVYFYKLGELLGPEKMADVASQLG
FT                   AGRRSGIDLPGESEGFLGTPENVGSIGATWYPGSTLLMGIGQGTVSATPIQVARWTSGI
FT                   ATGAMVTPQLAAAYGPELISIPTAAPQRLAFADRLDPVRAGMRASAAAGTAGQLANLPV
FT                   PAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPEIVVSVLVRGGGFGSATSGPVVKKILE
FT                   HYFPRPPAPAPAPGR"
FT   CDS_pept        complement(393517..394515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48627"
FT                   /db_xref="GOA:C1ARF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF0"
FT                   /protein_id="BAH48627.1"
FT                   /translation="MSDSGHLMIEYGRGAVSGQDVNEAVAGLFRSIASNCRGSALPDRL
FT                   HESLVETTDLDALLQSVRLAIAPDLDPAEEERKRCQLARLVAATKGRPRPDGPTVEERA
FT                   AGEKPPPVAAGSTLASPGWFPPVRNPWHRRRRRPSRRQGALGVVAILILFAAVVAAPRA
FT                   WSELRRGWDAVLNPVNAEEQNQIRPVSPPPPEPPVGLPTPAMSDAGRVPPPVDVGAPGS
FT                   AGPITLVTATRANGECGPGQACAIRVDVHLDPAATVDAVTWRVNVYDRCSGEVRAGGDV
FT                   SERVQPGSQQVYGVVRTDLPAGAALAVAAITSAPATAASEPLLMPAENARC"
FT   CDS_pept        complement(394940..396454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03810"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48628"
FT                   /db_xref="GOA:C1ARF1"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF1"
FT                   /protein_id="BAH48628.1"
FT                   /translation="MSRWWPLAAAAVLVVVLALGRVVPVWPGLLHLVALPPLDQFADLR
FT                   LLLVRTDSWPQFLVLLAVVSAVRILLMAWMLGGLDSRRIRFATAFYATAFGPVLLASCA
FT                   DATAYAMLYSRAFWPAVALVAVVVWILGPVPWQGGAGLRAAMGRAWRRGLRIEVMVPYC
FT                   AAILALGALADRVPALTVLLVPVSAAATGLTVWAMDRAPLRRPVAALAAVLVASTVVSV
FT                   AFVPTRAYDYPEPGPRQAGSLLVMSGIDSRSGEGTMYRADVQRLGYECEQVYYFSYAGT
FT                   GGGQPRRNAGCPIRTGAPYEPADTQRPVGEQVALFAEQAANLQRPLTVAAHSHAGWIAW
FT                   EAVAAGRARVDVLILVGVFPETPLGFPPPDVERPGRVFGDLLRWAVPAIEVAFFPFDPD
FT                   TPAARQLLGEAGSAQAVLGETLPEEVRVLSVASVADLPLMPHGWRLDVERNGCPVRAAH
FT                   SSLPVSAAFDDEVIRFLNHRDPLPCPAWRDWGAVVMRALGVPPSGR"
FT   CDS_pept        396589..397110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48629"
FT                   /db_xref="GOA:C1ARF2"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF2"
FT                   /protein_id="BAH48629.1"
FT                   /translation="MTFPGGIGEDDHLMDGSEVGSHRSLMTFDQFEDIFRVAASIGVVR
FT                   DDFHRFDDVVTGKLYDLLLVAQSDAAAQHRNVIELTDLPITRGLQENIGLFRELGPHLR
FT                   AGPILERLTDYPPLGGALATDTRSGLPDITGGLSVALARTFRIVYPELRTLRARTTHWA
FT                   LVSTLVDLYL"
FT   CDS_pept        397297..397695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48630"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF3"
FT                   /protein_id="BAH48630.1"
FT                   /translation="MNSTKTRIAAAAATGAAIGLGMFMAQSATAVAAPAQATSPQVVSP
FT                   DSGLSPYKVEVRDRIGCANAWPMVACDAPDEDVPPQVTLVEPGTTLVEPGGTSLFGPAS
FT                   ATIHQVNYPLEPDDGVISHSLDPDMPWM"
FT   CDS_pept        397978..399447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03840"
FT                   /product="putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48631"
FT                   /db_xref="GOA:C1ARF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF4"
FT                   /protein_id="BAH48631.1"
FT                   /translation="MTTERVMGSKAADQECQDCGYEPELKRTLGSFQVFAVSFAFISVA
FT                   VGIFGTYDDVLRDAGPVGIWLWVVVALGQILVALVIAQFAARIPLSGSSYQWASRLANP
FT                   KVGWLFGWLTFCYLALGVVTVDNAMASSALMPLFGMQPDEGTARVITLVVVLVQAVLVV
FT                   FSTRLVGLITSGAVGLELVIVVVLAIGLFVAVPITGEGSVGNLTSRGVAEGAPNYFAVG
FT                   GGLMAATIMGLATLVGFDSAANMAEEAKDPFRSVPRAIVGSVVAAAVLGLVFLIALTIA
FT                   IEDVPRISDSDTPVAAILRDQLGPVMERTLLVAIAFAFFGAGMVTLATCSRMVFAMSRD
FT                   ARFPAHRLMRRVNPRTQTPIPATILIVVVGVVLMAALPGGALLELLTVGTVISAVLYGG
FT                   IVVLYLAVRTRLDRKEGAFDLGRFELPVAICALVWSAFVVFVIVSPSTALTSILIAVGL
FT                   LLAGGVYFTYLLIFKRDVLDTEPGDADVFAH"
FT   CDS_pept        399431..400870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03850"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48632"
FT                   /db_xref="GOA:C1ARF5"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF5"
FT                   /protein_id="BAH48632.1"
FT                   /translation="MSSRTDRAAQHLTTTANVLTGDVVRPGDSGYEEARVGWNRLYSRY
FT                   PEAIVFCCDTQDVVNAVRWAREEGIALRARSGRHSLDGWSSLDGGLVIDVSRMKDIVID
FT                   ESARTATVGTGLTQMETVAALGQHGFAVPTGSEGGVGLGGVILGGGFGLLTRSMGMACD
FT                   NLLAAEVVVADGARSAKVVEATEHRNSDLLWACRGGGGGNFGIATSYTLRLHELSNVTF
FT                   LVARWSGHGDLADLLRAWQREAPVADNRLTSALEADSTAVELSALLYGGSRRELEDQLR
FT                   SLLAIGSPEVTVTEDAWPTVYGDVDRGPNDVPFWKFYSQFVTRPLPDEAIDLIVRFMDN
FT                   TPSPPSNFFCSSFGGAVRHAPPGGSAFPHRDALFYCEPGAAWNDPALNSAALGWAADFW
FT                   RALRPYGDGAYVNVPNAAASDWEREYYGSHRERLREVKATYDPENVFNFEQSVPLSPAD
FT                   PSRALRWGDGGQPKSQGQGSP"
FT   CDS_pept        400884..401225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48633"
FT                   /db_xref="GOA:C1ARF6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF6"
FT                   /protein_id="BAH48633.1"
FT                   /translation="MDSVEHDLTDEQWSALTEAWGGCAYCGATDKPLQRDCVQALSRGG
FT                   RYTLDNIAPACGSCNASKCNDEVTGWLRRKRLDERAFLLRHIEIKSALARRFPAEPDPA
FT                   IEMPDTAAP"
FT   CDS_pept        complement(401256..401885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="ROP_03870"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="protein synonym:UMP pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48634"
FT                   /db_xref="GOA:C1ARF7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ARF7"
FT                   /protein_id="BAH48634.1"
FT                   /translation="MGTVHLIDHPLVQHKLTMMRRKDASTNSFRRLANEISALMTYEVL
FT                   RDIPMQEIEIETPLEVTTGRVIDGKKLVFVSILRAGTGILDGMLTIVPGARVGHIGLYR
FT                   DPRTLVAVEYYFKMPGDLHERDVVVVDPLLATGNSAVAAVERLKECGPKSIKFVCLLTC
FT                   PEGVAALDKAHPDVPIYTAAVDRQLDEHGYILPGIGDAGDRIFGTK"
FT   CDS_pept        complement(401903..403168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48635"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF8"
FT                   /protein_id="BAH48635.1"
FT                   /translation="MSVTGVGPVLDVGRADGAAAALRTTTAVRERAQLLVRRAREGGSR
FT                   WFDVDDGALQTAAGEVVDVTHARYPDLKIPFHSRWRHFEAGGVDRKAELDARLAALDAP
FT                   GRARAMIDLAVVSVLLDAGAGPDWQYREEASGQRFARSEGLGVASWHAFLGGLFSSDGA
FT                   QPLRVDAAGLRGLDADRLAQAFQVGPSNPLVGLEGRVLLLRRLGEALAVQPDVFGLHGR
FT                   PGGLFDLLVAPQVPGAATVAAHDILSQLLTSLSGIWPAGNAIGTEPLGDCWPHDSVDGP
FT                   GLTRGWVPFHKLSQWLTYSLLEPFQWAGVQVVGLDALTGLPEYRNGGLLLDTGVLRLRD
FT                   PGWAARSWAAGDELIVEWRALTVALLDELAPLVRARLDVDAREMPLACVLEGGTWAAGR
FT                   ALAQRTRGGLPPLSVVSDGTVF"
FT   CDS_pept        complement(403165..404436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03890"
FT                   /product="putative GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48636"
FT                   /db_xref="GOA:C1ARF9"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARF9"
FT                   /protein_id="BAH48636.1"
FT                   /translation="MSAEPVAATPDNPAGHIRLTSHSGGVGAIPVHWGAPTASERGPVV
FT                   GTTTNRAHRNVIGTHSGSYSIYRALAVASGALSRHHKADLTNTAPTNAVGPYPQWSEPG
FT                   KIVSLDPWGATVAEVFAAELAAGHDIRPSIAVTKAHVILPEIMDAIQKGRLHPDGRFLL
FT                   PSGAALVTKAAIEPVWHLPGVAERFHCSETDLRRVLFEETGGMYPELVTRSDLEVFLPP
FT                   IGGQTVYIFGDARDLADPAVELTARVHDECNGSDVFGSDICTCRPYLTHAIEECIQGAQ
FT                   RGGVGLVAYSRKEGRALGEVTKFLVYNARKRQVGGDTADQYFARTECVAGVQDMRFQEM
FT                   MPDVLHWLGVRKIHRLVSMSNMKYDAITGSGIEVGERVDLPADLIPADARVEIDAKMAA
FT                   GYFTPGAVPDAEELAKVKGRELDE"
FT   CDS_pept        404636..405997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48637"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG0"
FT                   /protein_id="BAH48637.1"
FT                   /translation="MDLRTQDEADDVFTRGDALQASVPSRAHDHAATGAGRPDVLNFVE
FT                   ADNEGRLTHLVPLRIGRMIASPFAFFRGAAGLMAADLAASPVTGLTAQLCGDAHAANFG
FT                   LYGTPDGQIVMDINDFDETLPGPWEWDLKRLAASLVLAGREGGVSESGCVEAAEDAVKS
FT                   YRRTMRDLAELPFLQSWNALPDKSVLARAKADALLDDFDKAAQKARRNTSEKVAAKWTA
FT                   HFENHETGIRRRRFVDDPPILTHVDRATADAVTDGLERYVDSLRESRRNLITRFVVSDV
FT                   AFRIVGTGSVGLRSYIALLHGNRDEVLVLQLKQARPSALAAYLPVDEPKHEGKRIVHGA
FT                   RLVQAESDILLGWTTIDGLPYIVRQFRNLKGDIDPTGLEQDHLDDYGRLAGALLARAHT
FT                   RSLDPRALAGYFAGDTELDEAIGRYAVRYADQTEADHAELVAAVKSGRMAAEPA"
FT   CDS_pept        complement(406017..406367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48638"
FT                   /db_xref="GOA:C1ARG1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG1"
FT                   /protein_id="BAH48638.1"
FT                   /translation="MESLALASAVVEQLAPVATKSRRTRTGRTVQDVVPAPSIHLRVAV
FT                   TWVSIFPLVTLGMTVMTLSGPITATWPTWLRALSLTGVVVPTAVYFVVPRILAVALRWL
FT                   SWRRRRSAATPG"
FT   CDS_pept        406476..407075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03920"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48639"
FT                   /db_xref="GOA:C1ARG2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041467"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG2"
FT                   /protein_id="BAH48639.1"
FT                   /translation="MAWDTERTKRLLLEAGAEEFSAFGLAGGRVDRIAAKAGVNKERIY
FT                   QYFGKKEAFFSAVVESELTASLDAVELSGEGVSAVADYAGRRFDYQRSHPAFTRLLFWE
FT                   GLELEKPVAEETRRKHAQTLVAGAQQATGLSEADAQELLITVITLVDGWGTLQTADRLF
FT                   SPPPSRRDDRDSRRREFIVMTVEAATDAAIARTDRT"
FT   CDS_pept        407121..408218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chaA"
FT                   /locus_tag="ROP_03930"
FT                   /product="putative Ca(2+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48640"
FT                   /db_xref="GOA:C1ARG3"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG3"
FT                   /protein_id="BAH48640.1"
FT                   /translation="MAFGWRSVAAEWPLVIPPVAVAVLGVTWGRHIGTVVVLAVAVVLV
FT                   GAVLAAVHHAEVVAHKVGEPFGSLILAVAVTVIEVGLIVTLMISGGPATASLARDTVFA
FT                   AVMITVNGIAGLSLFVGSRRYGVALFNAEGTGAALATVASLATLSLVLPTFTTSRPGPE
FT                   FSSAQLIFAAVASLVLYGMFVLTQTGPHRHFFLPVIADEPETGDRSSAPPTGRMAGVSL
FT                   ALLVVALCAVVGLAKVESPAIEDAVEDAGLPQSIVGVVIALLVLLPETLAAVRAAQRNR
FT                   IQISLNLAFGSAMASIGLTIPAIAVASIWLDGPLLLGLGPTQVVLLAITVVVGMLTVVP
FT                   GRATRLQGGVHLVLLAAYVFLSVNP"
FT   CDS_pept        408297..408824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48641"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG4"
FT                   /protein_id="BAH48641.1"
FT                   /translation="MRTASWVSAATAVLLGATAAAAWRKANLADQARHEAEAALEAALG
FT                   QLEAMTRIAEAAQQALPRPLEVEFDVQRIRGPVDRFRLHNVGTGIATDVRFVVDPAEEQ
FT                   NRRVPTPQWLHEGAVTLLPKEWADFSASALSPVAGSWRIVFPAFVTVIHDGAGTPQRVD
FT                   LPTTVTEDGVIG"
FT   CDS_pept        complement(408864..409382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03950"
FT                   /product="putative PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48642"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG5"
FT                   /protein_id="BAH48642.1"
FT                   /translation="MDERPLNATAASLLGFLHEGSKTGWDLVVTAQERIGKFWSITTSQ
FT                   VYRELAAMERAGLIEAGERGARERKPYTLTDEGRRAFAEWIQREPGPENIRYPLLLTVA
FT                   FGAHLPPDRLADMVDSHRAAHERQLAEYERDAAVHESNRFALATLDFGIVYERAVLDWF
FT                   DLVADRLRQ"
FT   CDS_pept        409487..409969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48643"
FT                   /db_xref="GOA:C1ARG6"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG6"
FT                   /protein_id="BAH48643.1"
FT                   /translation="MQYADNIRISDSERDQVVAELGRHLTAGRLTIGEFDQRAAEVYRS
FT                   TTRQQAHQVLRDLPSAAPTVAAASVTTPPTRPARRRIPGHQKIEWLAWAVAGGINIAIW
FT                   GIVSLATGAMIYAWPVWVIGPWGLVLLGRTVLGRESGCSKFTDALRDDRMRAVASR"
FT   CDS_pept        410014..410415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48644"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG7"
FT                   /protein_id="BAH48644.1"
FT                   /translation="MKRVVQSRIVSSVAPRSLSHPCTPPGRASQRARTPSMASGTRPRR
FT                   SRSLGCARPGSGAKQHRSGRGGRHLQDVHEPVPRIEPVAYGYAAQNRPGTPESAEARKG
FT                   DQRRRDQARHSLQPTAWGPARTRNRYTPR"
FT   CDS_pept        410516..410857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48645"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG8"
FT                   /protein_id="BAH48645.1"
FT                   /translation="MPAPMNAQPMTCGDYVTATFARDFVAEGFDHDTVERIHRGLFDEW
FT                   THALAQSGLFSNGTVAAALDSWQDDPHSLLTALLANADEITLKRYDLVWEALERSAHAG
FT                   SADAVVEYA"
FT   CDS_pept        410875..411147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48646"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARG9"
FT                   /protein_id="BAH48646.1"
FT                   /translation="MSPRSPPRPGPTSAAPTTPTTPTNETMSTNTYPTIETIRIGQYGH
FT                   ECRYCGHAVAKDGPGYRHTTTGQFRCDPTSRALQEARLSDSLVRS"
FT   CDS_pept        411153..411407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48647"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH0"
FT                   /protein_id="BAH48647.1"
FT                   /translation="MNAPAMQLLPPRDGLADYRDAVDALRALETHGSLRADPRTALLFD
FT                   SLTDDLIEAAQTNEAGDTMSQREVFAMIDFAISRPRPSL"
FT   CDS_pept        411582..412307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04010"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48648"
FT                   /db_xref="GOA:C1ARH1"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH1"
FT                   /protein_id="BAH48648.1"
FT                   /translation="MTNDRSESPQSRPKPGGTRRRLPWLLAAAAVAVVGAVAIGAYVLT
FT                   AGSDDARKAHDFAPSADNPDPSLGIEGIVTVDYPPADHVQAPQRVAYEESPPFGGAHDQ
FT                   YWATCTGIVYPEAIRAENAVHSLEHGAVWVTYDPDHLSADDVTALAAHVDGVPYTLMSP
FT                   YPGLDSAVSLQSWGHQLRLDDVHDQRIADFLTALRQNPNTYPEPGATCSTVRGGFDPAD
FT                   PPPFDPSAPGPDAVPVDGN"
FT   CDS_pept        complement(412526..413383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04020"
FT                   /product="putative nucleoside hydrolase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48649"
FT                   /db_xref="GOA:C1ARH2"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH2"
FT                   /protein_id="BAH48649.1"
FT                   /translation="MFGNCTERQAASNALTVLSVAGLRDVPVCIGRPRPGPPPATPSAH
FT                   GLDGLGDRGHRPPPDARPAPGSAVEQLFRAAEERPGAVDLLCLGPLANIAAAVTRDPRI
FT                   LTRFRAVTIMGGMGPASRRGAEAAVQPHFLAKGDTNTDHDPAAAAVVAAAPGPITWVGM
FT                   NVTGRLRLAWADVVARSAPGKVATFVRDITEDYHRHCTTTYRAEHPVYTSHDSVAAAVM
FT                   LDPAAVLSAIDAHPQVLREDGRSSVWGVARARGTVHRFVIDVDYRSIRDRIAATLDADI
FT                   SRSD"
FT   CDS_pept        complement(413485..413850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48650"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH3"
FT                   /protein_id="BAH48650.1"
FT                   /translation="MTNKAVVSLTTGLEDAEKVTVAFLVAVGAAEQQRQTLMFLTKEAV
FT                   RLALDGTIQGVACEGCPPLPDLAARFENAGGTYMVCPICFEAKHLDKDALVSNAELAGT
FT                   VPMWKWIGDEGAVTFSY"
FT   CDS_pept        413977..414891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48651"
FT                   /db_xref="InterPro:IPR008585"
FT                   /db_xref="InterPro:IPR038128"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH4"
FT                   /protein_id="BAH48651.1"
FT                   /translation="MFEERPSQQISIVRLEVRRSRSTSANVAEHVGIHPRLLAGIGAEP
FT                   RQQVRVSREGTTALFTLVPGNGAGGIDTVQVTDGGCRRIGAESGHAVVLDLRCIDPTMS
FT                   EAEAEVEGEFIERLEDDGRHHRLAVLAPHGGAIESHTDRQAEQVYASLGSRDSTLWTCK
FT                   GWRPVGNAYRAWHISSGDLSVRSFPLLRSLAARRFRWAVSFHGYRGDDVLIGGRAPARL
FT                   KSEVLDAVATALDGTGIRVRVADPGERYSGESASNLVNRLTVGAAGGIQIEQPRSARTL
FT                   YGQAIAAAVGEVCESWIAADSGR"
FT   CDS_pept        complement(414935..416215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04050"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48652"
FT                   /db_xref="GOA:C1ARH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH5"
FT                   /protein_id="BAH48652.1"
FT                   /translation="MQSGALFGRYRLDRSLSVDENGEVWAAFDTVTARHVTVRALPRDA
FT                   SEDDEYCDRFVREAGLAAHIRNPHVVPIHDFGQIGNRLYLATPLTGGTNLRTILQASGP
FT                   MEATRAAGVVEQLASALEAVHATGLVEQGVTSGNVVVTDGGLVQLTDVGLPAAAGAAAG
FT                   VPSLSTVLYECLTGGQFASNGRELPSSKFSTLPVGMQAVIARGTAADPGRRYRSPSDLA
FT                   TAAARAAATGPQASADPAPETPPNGRNRRLLLAGLALAAIIAVAIVGGVIIGSQSSSPD
FT                   VVVPVPASSAAGPTSATSSTAAANPTAAEQVPPAAEAPVQDEVPPAETPAPQSPVLPVP
FT                   APAPAPAPAPAPAPAPAPPAASAPQVLPCYPGYEHTPPPDGPCLPPGSPPVPAPAPAPA
FT                   PAPQVLPCYPGYEHTPPPDGPCWAPGP"
FT   CDS_pept        complement(416349..416843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48653"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH6"
FT                   /protein_id="BAH48653.1"
FT                   /translation="MRRAGKILAGIGMATVITATGQGIAVAAPEGTTESVTTLQVPPIG
FT                   MSPVLAAYFTVDAVTGRVPGVVRFRTVSECYVLNPISADTCIPGPGNAMRANAVRVHWL
FT                   NMNTGATGAVTIPIGTAGSTDSPRPEIDVATGSGRIVVGTMAPAEYPQALLPGFGTFDV
FT                   P"
FT   CDS_pept        417021..417203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48654"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH7"
FT                   /protein_id="BAH48654.1"
FT                   /translation="MRTALCNALFAAFDHRICCGRIPEWTAHVGQTWDTYDIAPWNLYN
FT                   VIWRIQNWIRCGIRD"
FT   CDS_pept        complement(417234..417623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48655"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH8"
FT                   /protein_id="BAH48655.1"
FT                   /translation="MKVTATATRRGGSWVVKVPGVEGAVTEARRLDQISAMVAEAVHLV
FT                   EGVRAEDVEVELDYDIGDPAALMEARAAHWQVESAAHAQECAARASRAAVAHLRRSGLS
FT                   VRDIGVILDLSPQRVSQLDRAGLHA"
FT   CDS_pept        complement(417765..420794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04090"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48656"
FT                   /db_xref="GOA:C1ARH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR030605"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARH9"
FT                   /protein_id="BAH48656.1"
FT                   /translation="MADFDPDATQAASVRAVGHGIVAELDAAGFAGAEEVGRGGFGVVY
FT                   RCLQRSLGRIVAIKVLTSDLDSENRERFLREGYAMGGLSGHPNIVNILQVGVTETGRPY
FT                   IVMHYHPRDSLAVQIRREGPLPWPEAISIGVKLAGALETAHRTGTLHRDIKPANILLTD
FT                   YGEPQLTDFGIAHIAGGYETATGGFTGSLAFTAPEVLNGESPTARSDVYGLGATIFSLI
FT                   AGRAAFERKTGEELVAQFVRISTQTVPDLRAQGIPDGVCAVIERAMAPNPFARPASAEE
FT                   FGHELQAAQRHIGLRSDAMALAPLEPAQPGQAHPAADAGGYRQIRFEDSDGQRRFFAST
FT                   EQIQPDSHPSAPFWPPTGPSPWPPPEARGRSGPARGRRRGILIVLALVVTLVLAGGGYL
FT                   VFREATGPGTAGPIAQDGGEPPAVDPTAAWRPVGDARVARQQTATTVADGTIWVFGGLD
FT                   DNGVSARQEGYDPAIDTWKAGPDLPVPLNHAMAVTYNDEPVLIGGWQAKGQNLTAVASA
FT                   RVMAMRDGRWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVSPTEVFDGTKWTTVA
FT                   HIPTSREHLAGVSDGKYFYAIGGRDLASDQNTAAVERFDPVAGTWATLPGMPTPRGGLG
FT                   ATFIDGRIVAVGGEEPTRVLSTVEAYDVVAGSWSQLPALRTPRHGMAVGAVGNTVYAVG
FT                   GGIKPTHAESTAVSEALQIAPRKTQWAPAWRPLRDAPIARQQTATAVADGTIWVFGGLD
FT                   NVGSTAKVEGNDPAIDTWKAGPDLPVPLNHAMAVEYGGELVVLGGWVPEGPNLTGKTSD
FT                   RVLALRDGNWVDLPPLNVPRAAGAAAVVGDRIVVAGGQADGELVASTEVFDGTKWTTVE
FT                   DIPTSREHLAGVTDGKYFYAIGGRDLASDQNTAAVERFDPVAETWATLPGMPTPRGGLG
FT                   AAFIDGRIVAVGGEQPTRVLSTVEAYDITSGTWSALPPMPTGAHGMSVAAVGHTVYAIG
FT                   GALRPTHAESTATAQALDFW"
FT   CDS_pept        complement(421047..422453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48657"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI0"
FT                   /protein_id="BAH48657.1"
FT                   /translation="MESLPDSGMLLAVLEHSPALVFVSEFVSGRIVYVNPAGVGVLGFG
FT                   DAVHAYSRTTAELFTDVGLVQAREVESALADRGEWTGLTEFRHFVTGEPIPMLISTFVL
FT                   EYAETGPSVIGSIAQDRRGAEDDEQRLQRALGESAYRAREQQAIADLSQLAVGGDLDEL
FT                   LSAAAGAAAALMGVHCSSIARVSDDGELTVLAYRGPEPCPKTFAPGPGSQPGYAAADGS
FT                   VIVCTDRVHETRFSTAGMSGRGLQSGVCVPFGSDAVWGVLTAHSRRPREYTDRDLTFLR
FT                   SVTAVLSAAIRRIEAEAALVHQSLHDPLTGLPNRTLARRRLDEALDAVPRGGPRVALLL
FT                   VDLDDFKTVNDSLGHAVGDDALIVLARHLRSAVRPGDTVARLGGDEFVVVCEHVAGAAE
FT                   AVAIAARIAGSFADLNRARSLEWPISASIGVALSDPEGTREELVRRADAAMYRAKAAGA
FT                   GGYALYDDTF"
FT   CDS_pept        422636..423124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48658"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI1"
FT                   /protein_id="BAH48658.1"
FT                   /translation="MGMRRARWPAFAPPTASGTAVHGPTILASGTHLTLDLLGIVAFSS
FT                   GIHVRLALTATGRTAERAHHETRLLSDPADPDTQWSYLSVLLQLGSVVGVADPYLPRSG
FT                   SPRKWGGVPAYRTEPNYWLGTCTRPHDIMISAGWPEIGLGPTCLTALLEPSPSTVTSD"
FT   CDS_pept        complement(423159..424436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04120"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48659"
FT                   /db_xref="GOA:C1ARI2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI2"
FT                   /protein_id="BAH48659.1"
FT                   /translation="MAESSVLPADLGGSPDLERIVLEHAYRGAHLQLALRGVLVLFIAL
FT                   TLVFVPPTNDANVCVAVLIGYALWTVGLAMWTRRGGPGPVNAIWLALFVDLAVIGSLTL
FT                   LTGIAAQQSWTADILTNGLFVIPLLACTQLRPGVCASVVVPTVLVFLAASWATMASNEE
FT                   PWSSILLSTMALAILSAGAVVLSRIQRSRVLTIGHLVHDRTALLAELMGLEQRERRALS
FT                   EQLHDGALQFVLAAKMDLDDLTGGADPEAVDRITHALTESATLLRATVSELHPTVLDRV
FT                   GLARALGDIVRSAQARGGFDVDLQTVEWDDDLRTSADDVLFSAARELLSNVVKHARART
FT                   VRVELSRTGGHAVLDVTDDGCGISREAIDRSLSRGHIGLTSHELRVVAAGGSFSVRPGP
FT                   RSGTVARIEMPFEVVTASDSLTISAH"
FT   CDS_pept        424683..425597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI3"
FT                   /protein_id="BAH48660.1"
FT                   /translation="MTRIRRRSAVALASIAGASVLLLAACTQDASSIDGTESAAPGATS
FT                   ESPAAEPAVDGVDAKQYASSDPATETYGFVTPSGKWLCAIIPAKQLAGCASHPTAGPLG
FT                   VPGTPQIASPNGGPPAEADLIAIEAGKEPNFQNWNQALFPGNANVLPYDTTLAVDGFSC
FT                   NVQFSGVSCREDATNKGFTVSTNGYKFEFTPLPMSVPSASPPPIAPTAAPLPQQARGSN
FT                   QCGPITYPETGKPATVVIVKGTLRCDEAHTMLTKYFTGRDKSEPVYSFDGWECRLAGDP
FT                   ESAEIGYTINCTDDNGNSVVAQP"
FT   CDS_pept        425694..426011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48661"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI4"
FT                   /protein_id="BAH48661.1"
FT                   /translation="MQPPNDQAGTWEGSWLAAMTVIKSAQRVFTPDNRPPSELIPLVEP
FT                   LSRLGDALRATPPDPEESRRRAADLVADRDLITWACRPDQPRDIRELGATLAFLSMKLT
FT                   T"
FT   CDS_pept        complement(426036..426950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04150"
FT                   /product="putative exodeoxyribonuclease"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48662"
FT                   /db_xref="GOA:C1ARI5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI5"
FT                   /protein_id="BAH48662.1"
FT                   /translation="MRIATFNINGIRAAQRRGFEEWLGDRAPDVVSLQEVRARAAAIPS
FT                   GVFGRYHLAYDEGEFAGRNGVAILTRHAPLAVRTWSGTALVQAPGETHLERVELDPQPL
FT                   ARGLGEFANHGRYIEVDLADAPITVVSMYLPKGGLPAHLQKPGRMRDAPDGGARYDRKM
FT                   RFLSAFARQLTRSRRTARARGRELLLMGDLNIAHTRHDVRNWRRSNQAEGYLPEEREWF
FT                   DSIVSPRTLVDVVRRHHPGVDGPYSWWSWLGQSFVNDVGWRIDYHLATPHLARAAVTAG
FT                   TDRDPAADRRMSDHAPVVVDYDF"
FT   CDS_pept        427108..428667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48663"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI6"
FT                   /protein_id="BAH48663.1"
FT                   /translation="MRIARIRRGVASSALAVSVVLGVATSPAPAIASAETYVFDDVGST
FT                   AVPRADCGPGSLPETGMQGDVPAEDRNNGRSTQGYRCNMSLIGGLQDRGGGLLSVTYDH
FT                   CSYTSTFFPGNLLDPDTPGVQVLDVSDPAQPVLSTTLNEPAMLGGTWESLKVNKARKLL
FT                   AATAVPAAAGTGYFSVYDISDCAHPRLLNRGAGTDVTMPLPFLSHEGGFSPDGNTYWVS
FT                   GPAPGFLTAIDIRNPAEPRITWQGLHGLGGHGFGITPDGNRMYLSNLGGITVLDISAVQ
FT                   RGDPYPTVPQLATYLWTDGFFNQHSIPVTYGGKPHIFTVDETGGGGIKVFDVADPAHAD
FT                   IVQKVKLEIQLPANTAANLRSSQGGSVFSYDPHYCVVDRPSDPTALACSWESSGIRVFD
FT                   IRDLDDIREIAYYNPPAQTGKNLQLTNSPHALSSLIGVSLFDFVPLARAVFEGKADPRV
FT                   AFGPRAGMVAFGDLSADWCFSPPEFHGNQIWTSCSDNGFMALQLDESVYQAPANQDSTY
FT                   GQ"
FT   CDS_pept        428657..429310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48664"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI7"
FT                   /protein_id="BAH48664.1"
FT                   /translation="MASDTRRSRFRRPVVLLLCAVLLGAGGVAAGMWLQSAREQLVGRV
FT                   QLSPADVGFAQDMSVHHEQAVLIAQTLPRDVDPQIRVIADQIVVAQTSEIATMRGWLNL
FT                   FDEAFTTAHPMQWMHGSDHVMSEQGGAPMPGTASTSEISRLAGLRGADAEALFLQLMIR
FT                   HHQGGVEMAEAAIHAVASEPIRRVARGMIRDQSNEIAVMTALLGTRDAKPLPHP"
FT   CDS_pept        complement(429421..429750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48665"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI8"
FT                   /protein_id="BAH48665.1"
FT                   /translation="MSATIRSLVIPVSDLDAAKAVYTALLGEPHTDQPYYVGYNVDGFE
FT                   VALNPGEEGGGPVAFADVEDLDAARATLLEAGATERSAPRQVAAEARVCVLADADGNPI
FT                   GLRGK"
FT   CDS_pept        complement(429868..430602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04190"
FT                   /product="type II thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48666"
FT                   /db_xref="GOA:C1ARI9"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARI9"
FT                   /protein_id="BAH48666.1"
FT                   /translation="MKWIRCFQASPNASGVLLCFPHGGGTASAYRTLAEALFPRIELLA
FT                   VQYPGRQDRIGDEMMSDIGAIAEQVVCESTPPAGSRLAVFGHSMGATVAFEAARRFEQQ
FT                   DHALAALFVSGRTAPSVVQPTTLHLERDQALLDDMRRLGGADSNVVQMLVENPDLAEMV
FT                   LPSVRNDYRAVETYRYRPGPDVSCPIVAIRGDSDPSVSGTDMRLWSKFTTGSFDTREFS
FT                   GGHFYLDDHVDEIASLVGSRFD"
FT   CDS_pept        complement(430705..431088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48667"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ0"
FT                   /protein_id="BAH48667.1"
FT                   /translation="MMTPPDEYVSVRYLVDDVAAAIDFYTSHLGFTLHTNPAPAFADVT
FT                   RGSLTLLLSGPASSGARATPADNAGAGRNRIHLIVGDLDDEVTRLRDAGVTFRSDVVVG
FT                   PGGRQILLADPSGNLVELFQPAT"
FT   CDS_pept        complement(431396..431770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48668"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ1"
FT                   /protein_id="BAH48668.1"
FT                   /translation="MEWSVARVAGDDRDTAGPSAAADRGSSGSGYRPSLESAPNPTPRR
FT                   AVRQLRCLRLRSHRRSTFCDRRSRYRGARTLYCPPNEEHWHGAGTDSFMEHLAMLDNAD
FT                   DPATTTTWLEHVTDDEYLAE"
FT   CDS_pept        432016..432723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mspA"
FT                   /locus_tag="ROP_04220"
FT                   /product="putative porin MspA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48669"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ2"
FT                   /protein_id="BAH48669.1"
FT                   /translation="MTDISTSRFGYKRFTRTVAVAGIAALAMVMGNGSASAGVDNSSSV
FT                   IDARGNRIEVVQGDTQYQTVPPLDGVPTSVEFFHNGYAGVAITGPNSEEFEGTQLTVGY
FT                   QIGYPVALAGATIVLNTPGLGFAIGSSNGIDIGFGPMGFESLGLSAGTNAELAGDIIPS
FT                   QELDIDLEPGGITTVPILEGQEFDGSAAVVRMQGVHGSISGAIGPVTIRPYAMAVTSNG
FT                   DTVMTYGVPQKLN"
FT   CDS_pept        complement(433001..433489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04230"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48670"
FT                   /db_xref="GOA:C1ARJ3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ3"
FT                   /protein_id="BAH48670.1"
FT                   /translation="MGDRIPPPLDNLLEGNIMTSVNLSKQHPSVYKSLMKLDADVKAAL
FT                   ETAGVDPLLVELVKIRVSQLNGCAFCLRMHTRDALAKGETTDRLAVVAAWWEAQYFSEK
FT                   ERAALALAEQVTALSVPERRAWDDGSLTDEQVSAISWLATVMNAWNRVAVTSHYPVTP"
FT   CDS_pept        433889..434269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48671"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ4"
FT                   /protein_id="BAH48671.1"
FT                   /translation="MTSIKTRTAVAAAAGVAVGLGVLMAQGATAGAAPAAEVAPDAVSP
FT                   YTVQVRDRIGCADAWPMVACDAPDEDRPPQVTLVEPGTALTQPGGTDLFGSSSAPFHAA
FT                   NYPLEPDDGVISHSLDPDMPWM"
FT   CDS_pept        complement(434764..435630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04250"
FT                   /product="putative aminopeptidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48672"
FT                   /db_xref="GOA:C1ARJ5"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ5"
FT                   /protein_id="BAH48672.1"
FT                   /translation="MLGVSYGTLIADRYARRYGDHVNRFVLDSVVGPGPDGRDDWHAFG
FT                   LRQAEALLSQRETMIGWWAQHAERFGLGSDPVAVRRNYDVARHLPPSGRIGADEFDRAV
FT                   YRALGRTERWQPLGDALARALHTGDLQTLEAVVPGIDDERRNSEAANRTVVCADSTETL
FT                   PPTAILAGRSALRELDPQPIVTGLEAEVCAFWPMDRPTEPMPAAQPEVGAHLLLVAGTH
FT                   DPVTPVTDAERRHRQWPGSGLITSAQTWSHGVFASQRIDCVDEAVADFLLGASASVRQC
FT                   TGPGLPR"
FT   CDS_pept        complement(435688..436338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04260"
FT                   /product="putative aminopeptidase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48673"
FT                   /db_xref="GOA:C1ARJ6"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ6"
FT                   /protein_id="BAH48673.1"
FT                   /translation="MVFPYGDLRPFAICLSARTSAAVALAFALLIGGSAPLSAALPTLE
FT                   NTSGGDGGRATLHFGPCSAITGTDDLGMQGLECGTLLVPLSSDDPGAGTVHLAVSRLRA
FT                   TDPAARRGMLLVNPGGPGGAGLEYAATKGAKLPQRVLAAYDIIGFDPRGIGHSVVSRPN
FT                   TGQPPSSLNCGPMGGNFDRPVPPTKDLTALPALAATAGDCAAAIGPHAADFGT"
FT   CDS_pept        436411..437697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48674"
FT                   /db_xref="GOA:C1ARJ7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR040570"
FT                   /db_xref="InterPro:IPR041472"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ7"
FT                   /protein_id="BAH48674.1"
FT                   /translation="MAHLLLVESWVGAMGTLLPRAVAELGAEFTFLTRRPEHYPQSAPD
FT                   GLPHPLRLGRGVVTAETNDPATALAAARTLHADTPIDGVLTSCDYYLPLAARIAAELGL
FT                   PGPTPAAVVAACNKALTRAALDRCDVPGPRHVTVPADDQQRLRTGAEMVGFPLVLKPTD
FT                   LCAGMFVRRVEDWAALDTAARDLLRFEVNARGQRREPVVLLEEFLEGPEFSVESWIRDG
FT                   EVHTVGVTDKSLGGASGFVETGHMFPADVGDQDHARLVAAAEAAIRAVGLDHGVVHTEL
FT                   RLTAAGPRIIEINPRPAGNQITELIRHVTGIDLPRIAVELALGREPALPTVPNGQRGGS
FT                   RALSAAVSMLVPARAGILTGIEGTEAVAADPAVIAATFKAPGHRTTVGVDNNSYLGSVI
FT                   ALSHEQSGARRLAEGLLSAVSARYEEPAP"
FT   CDS_pept        437694..438536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48675"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ8"
FT                   /protein_id="BAH48675.1"
FT                   /translation="MTPGAKTNAHTGPAAALLDRYRTDPALIPPAAVMVSTAFTTFQGV
FT                   RHSGRSAGYRNQVISLRVGGATGSCAVEPGSVDPDVIHACAGVPVAELLRHDELAVRVA
FT                   ALDSYLAHQRPHAFDSRADTVHVAPGDSLQRSLARARAVTGLLDAPRQGRVLVIGVVNS
FT                   LLACLRERDLRYVPCDLKGGKTEWGEPIVTEFADGLDDCDAVLASGMMLGNGTLDRLLE
FT                   LVAASGRAVPVALFAQSGAAVARELLGHGVDALSAEPYPFFWLTGDTSTIHLYRAQPR"
FT   CDS_pept        438533..439606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04290"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="protein synonym:O-acetylserine (thiol)-lyase"
FT                   /note="protein synonym:O-acetylserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48676"
FT                   /db_xref="GOA:C1ARJ9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARJ9"
FT                   /protein_id="BAH48676.1"
FT                   /translation="MTVIEPRWRVGHSPLVRITTPVPRRHPGYFAKIESLGLGGLKARS
FT                   ALSMLVGARRRGELRPGARVVESTSGTLGVGLAYVAQSLGHPVTLVVDGELEPAMRNLL
FT                   RALGATLEIVERPHPEGGWQQARLDRLSRILATDAGAYWPNQYDNPDNAAGYHGLADEI
FT                   VAGLAAVGIDRADVLVCSVGTGGHSSGVGLRLRQVWPGLRIIGVDALGSKIFGQPAGRR
FT                   LMRGLGSSVHPGNVRYEMFDEVHWVGPREAVHACRALARGGFHTGGWSTGAAATVAGWA
FT                   AAQGSGSVVTIFPDGPDRYLRTIFDDDWCRGRGLLDPPRTQPHEIDDCRDHTECWTRCQ
FT                   SVLAPHSLAGDGTKAAG"
FT   CDS_pept        439603..440634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04300"
FT                   /product="putative dipeptide epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48677"
FT                   /db_xref="GOA:C1ARK0"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK0"
FT                   /protein_id="BAH48677.1"
FT                   /translation="MRLTWSVSTLELTQPFRISRGVMASRAAVTITLVGADPTIVGRGE
FT                   VVTSPYADLSLDRIEAQLAVIHGHCGDDGADLDPVLAEVHPAVAAAVWSAVAEHRARAG
FT                   GRSLAAHLGVPLPDTVPISRTVGIGTPRSMAVEAARLAADGVRLLKVKTDADRTESARR
FT                   LAAVAAAAPAAELIVDPNEAWTAASALGVLADTQGLPVTALEQPLPAGDRDGTRELRSR
FT                   TDIPLIADEAVHTLTDLDRLDGLADVVNIKLPKCGGIYRAQEIAIAAGERGLEVMLGCL
FT                   VCSSLGIAPAVHLASLARWCDLDGHLLLARDPWTGLGGEDGVLRPSGVAGLGVRRREED
FT                   DPR"
FT   CDS_pept        440631..441887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04310"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48678"
FT                   /db_xref="GOA:C1ARK1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK1"
FT                   /protein_id="BAH48678.1"
FT                   /translation="MTETHSGAGTLALLRSFPRSVQLLVLNQYGVNTGFYMLVPYLSMH
FT                   LTGNLGLSLTITGLVLGIRTLSQQGLFLVGGTAADRLGPHRVIIAGCALRSVGFAVFAF
FT                   GTSVPLLLLASILSGLAGALFNPAVRSYIAVAEPRRRAEAFAVFNVFAQAGALSGPLIG
FT                   TALLAVDFRTVALAAAVIFAALTAAQLRLLPAHPVKPAESTVLRGWGVVLADRRFVLFT
FT                   LAMFGMFVLQTQMYLVYPVLAGRITEWAGAVAVLFLSTTVFSLLFQVRITRWFAGRTSR
FT                   GTAIAVGLALMSGAFVVLLPVLWADPGRVVWQVVLALGALVLSALILESGIMIAQPFVM
FT                   ELIPAYGDSRISGTLFGMFYLVSGVVAAGGNALIGYGIELGNGWPGALVCITLGAASAA
FT                   GIWLLQCRRLLAEPAGVKA"
FT   CDS_pept        441884..442720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04320"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48679"
FT                   /db_xref="GOA:C1ARK2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK2"
FT                   /protein_id="BAH48679.1"
FT                   /translation="MTATEARNLLTDNPELYEARFPDPDHAAGRFVDDVLGAHLPPAMS
FT                   GHPERPVTVLDLGCGTGRDLGFLADRGYRCLGIDQSSAMVEFAQRRYPGVSASVGDLRN
FT                   FQLGETVDAVICLDSSLLYCHTDDELESCLRCCRSHLRTGGLLVAEMRNGAFFLGSTDL
FT                   LDGPRRSSFEWQGRTWRAETTLWIDHAAQLLRRRRQWQIPDSAAELVQTSAWRLLFPLE
FT                   LTGHLRRAGFTVRAMFDTPGPRAEAGWPTGSERDPLTRVGEGTMSGDRLHVIAEAI"
FT   CDS_pept        442783..444360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04330"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48680"
FT                   /db_xref="GOA:C1ARK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK3"
FT                   /protein_id="BAH48680.1"
FT                   /translation="MNPVPRSPLSPLPYLSRRSFLGLGAAATGAVLIGACSTGDTGTQV
FT                   TSTPRDGGRLRAVFAGGGAQEVLDPHKTNLYADVARSNALYDKLVEYGDDLGPVPRLAT
FT                   AWRPNADATTWTVQLRPAVFHDGRPVRAADVLYSYQRILDPKNALRPRASLEVIDIARS
FT                   RQVDDRSIEFVCTRPCGDLANVLAAFGAYIIPEGTTDFTAPIGSGPFTFVSFAPGRSFV
FT                   AARFGDYWDGPPHVEQLEILTAPDETARINALLGGQVEYADDLGVTSARTYETDARVQI
FT                   LRSPRSAMSGFAMKVDRPPFDNLDLRRAMFALTDRDELVSTVLGSTGVVGNDLFGKDTK
FT                   YYATDLPQRSLDLDDAKTLIRKAGAQNTTIELQTTGATNGFVEAANILAEQAARAGLTI
FT                   DVKVGEGSTYWTRTLDEGVLSSFRSGAMPIETHLAQRMLSTSSKNYTQWRRPDFDALFA
FT                   TASETTDEAVRARAYRDMQSQLYTEGGLLVWGFSDGLHGLAPNLAGMARSAPSNTLGYA
FT                   RFDKAWLS"
FT   CDS_pept        444357..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04340"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48681"
FT                   /db_xref="GOA:C1ARK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK4"
FT                   /protein_id="BAH48681.1"
FT                   /translation="MILTRYAGMRVALGLAQVLGVLVVVFLVASVLPGDAAVVIAADDA
FT                   DPARIAQLRETLGLDRPLLVQLGDWLAGLPRADLGTSAVSGRPVAEILSAALVPTLTLA
FT                   ALALAVLIPLAVGLGVAAAVGRGRRVDRTISGVVVALYAVPEFALAIVLVAVFAVGLGL
FT                   FAPTAVGAGGPLLWQPELWVLPVAVLVIRPVCSLSRLVRASMITTLESDYIRHTLRLGV
FT                   PGRRVVWRHALPGSLTPAAAHLARVADWLLGGVVVVEAVFALGGLGQVLVSAVSSRDIP
FT                   LLMGLAALFAVITVAVNTIADIVAFRLTPTAGGTS"
FT   CDS_pept        445304..446140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04350"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48682"
FT                   /db_xref="GOA:C1ARK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK5"
FT                   /protein_id="BAH48682.1"
FT                   /translation="MTAPGRVLSRLPRQRYLVGLLLTAIPLLIAVLGPLIAEPAGRGPA
FT                   FTLGENWLLGTDSEGRDVLNQLLLGGRSLVSVATAAVLVTYLLAVPWGVAAATTRRRIV
FT                   DEALMRPLDLLLSLPSMLLLLLVVALTGADTLVLAVTVAVLLFPDAARMVRASALHAAH
FT                   TPAMEALGLQRETWWRRNIGYLGRSLLPVLAADAGLRFVGAIYLVASASFLGLTADSTG
FT                   TDWAVMIDRNRSGIALVPWGVVVPAVMIIALAMGVNLLFDAGARAATDHSSPKDPE"
FT   CDS_pept        446137..447576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04360"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48683"
FT                   /db_xref="GOA:C1ARK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK6"
FT                   /protein_id="BAH48683.1"
FT                   /translation="MTDTVQELHTRPSVIRVRGLTATTRDRTLIAGIDLDIPGGLVTAI
FT                   IGSSGSGKTTTALALMGEHRPGVTLSMDCRDTAGARFGYVPQQPSSVLSPFLRIGAVLR
FT                   DIERAARRAGHKVSVPDALQRAGFPSDPVMLRRYPHQLSGGQQQRLVIAHALLTNPTCL
FT                   IMDEPTTGQDPANRAAVLDEITRLSRQGLTVVLLTHDLDAVRAVAQKVIVMAHGHIVEA
FT                   GDAGVLDGSVHEQTRALVDAQSRLRRHRPSRHPSGRRGTRLTVDAVTADFRKSSILHDF
FT                   SLSLDPGECVALVGPSGCGKTTAARVIAGLHQPAAGRVVLDGCALAGATRRRTRQQVAA
FT                   IAYVFQDAKAAFDPYRSVWEQIVRGPLQLRGATHAEATAAAGTALDQVGLDKRIARQRP
FT                   YALSGGEAQRAAIARALAVAPSVLMCDEVTTGLDTVSQRRVLDILSELTRARNVSLLMI
FT                   SHDAAVVHAVADQVVDMAGAH"
FT   CDS_pept        complement(447612..449822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04370"
FT                   /product="putative cation-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48684"
FT                   /db_xref="GOA:C1ARK7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK7"
FT                   /protein_id="BAH48684.1"
FT                   /translation="MSADPVASDTPTGLAVISDAAGRMRVHLPWLRASAGRAVAIEDAV
FT                   AKISGVRAVHAYPRTGCVVVWYSPRRLDRDELLDTIAAGEQTPWSLVPDRSPRSAEVGN
FT                   ADIVRMAIGGAALILLGIRRYGLRRAPLLGPSSRLFATGATIFTGYPFLEGALRTLAGN
FT                   RSAGTDALVSAATIASLVLRENVVALTVLWLLNIGEYLQELTLRRTRRAISDLLKGTQD
FT                   TAWIRLADASEISVDIDSLQVGDEIVVHDHIAIPVDGVVVDGDAIVDQSAITGETLPIA
FT                   TSVDHLVHAGSVVLRGRLVVRATAVGNETTIGRIISQVEQAQDHRAPIQTVGENFSRRF
FT                   VPASFGLSALTLVLTRDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGS
FT                   HLEQAGRVDAMVFDKTGTLTIGRPIVTNVVAFEPEWTPERVLAYAASSEIHSRHPLAEA
FT                   VIRSTEERHILIPPHEQCEVLVGLGMRTWADGRTLLLGSESLLREENVQVSAEAAEWVR
FT                   SLQQLAETPLLLAVDNILVGLISLRDEVRPESLDVLSRLRADGIRRIVMLTGDHPMTAA
FT                   TVAAELGIDEWRAEVMPDDKLLVVRTLQAEGHIVAMVGDGTNDAPALAAADIGIAMGLA
FT                   GTDVAVETADVALASDDLRRLLDVRDLGAHAVALIQQNYAMAIAVNAIGLLVGAGGVLS
FT                   PVLAAILHNASSVAVVANSSRLITYQVQQPMPSRRRAGPASN"
FT   CDS_pept        complement(449824..450108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48685"
FT                   /db_xref="InterPro:IPR009963"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK8"
FT                   /protein_id="BAH48685.1"
FT                   /translation="MALHILLVKAASTVVTGAVGVAAYNAARKVVAKAPLHEAAVTATA
FT                   WGLRGARKAEEGAESARLKVSDVVAEARGRIGEEVPPPPDPEIGHGHNH"
FT   CDS_pept        450281..450436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48686"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARK9"
FT                   /protein_id="BAH48686.1"
FT                   /translation="MHRLDLSGARLDPSDSRQFAAAAAIELEAGRRDPYRQLSRIFHLV
FT                   GRKGPN"
FT   CDS_pept        450482..451993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04400"
FT                   /product="drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48687"
FT                   /db_xref="GOA:C1ARL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL0"
FT                   /protein_id="BAH48687.1"
FT                   /translation="MRSERSASLGVFMKTASPRTHYQLTFTVLTIGVGAFALLQSLLMP
FT                   VLPTLESALGTTQADVTWVLTAYLLSASIFTPVMGRLGDMHGKKRVFVLALAALAVGSL
FT                   LAALATSLPVMIAARAIQGIGGGVLPLAFGIIRDEFPEEKVAGAVGVIAALTAVGAGLG
FT                   IVLAGPIVTVLSYHWLFWIPLIMVVLAGAAAQMLIPESPVRTAGKINWLTALLLSGWLV
FT                   TLLLGVSQAPAWGWGSPIVVGLLVAAAVIVVTWVAAEARSSNPLIDMQMMRVRSVWAAN
FT                   LLALLMGVGMYAAFGFLPQFLQTPTAAGYGFGASVTESGLMLLPLSVGMFLLGLASGRL
FT                   AARLGSKCLLIAGSVVSAIGYFVVAFAHQTETEIYLATSLIGIGFGLAFSAMSNVVVAA
FT                   VPSEQTGVASGMNANIRTIGGSLGAALMASIVTAGASAEGVPPESGYTHGFVVLGTAVG
FT                   LGAVAAMFIPAMKRGDITRLEESTALRHPELAMVAGGTLVGDEPE"
FT   CDS_pept        451990..452634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04410"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48688"
FT                   /db_xref="GOA:C1ARL1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL1"
FT                   /protein_id="BAH48688.1"
FT                   /translation="MKSDVKVQGNEKALRRDAAENRQRLLDAAATVFSERGLDVGVDEI
FT                   ARVAGVGIGTLYRRFPTKDALVSELVRQVFDDFLAVANEALSAPNGEGLEQVLYGTGAI
FT                   LASNRGCLSRMWNDDETRILRDEYRRILFELLARAKQHGRIREDATDADLDLIFWSVRG
FT                   VVATTRGVTDTGWRRTMAIMIAGLSPGADTLDASPMSAQHVAQIIDNMSAR"
FT   CDS_pept        complement(452661..453962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48689"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL2"
FT                   /protein_id="BAH48689.1"
FT                   /translation="MAEIRVSASEVRLALSRFERFAGLHGNVAVPMPLIRGAEVIADPF
FT                   ANIRGVRAPGLGIPRRLCIGTWRGRGVRSFVAARAGVPAIRVRTLGRGAGAEFDELIVT
FT                   VSDPGHVVAQIRDVLDPGRVRAVEREVRFRSGDGTLLAGTATVPAGAEGGPAAVILTGS
FT                   GRLDRDGDHAKLPIGVSRALADALARAGVASLRYDKRGVARSGGDYLSTGLSDNIADAA
FT                   AAVDWLRTTGGFGRSSIAVIGHSEGACLAVALGADRGVDPAAVVLLACPAVTGRQVLQW
FT                   QSGEAVDGLPSAVRVVLRALRIDVKERQRVALEKLSRTTTDAARMGGRRVNARWFREFL
FT                   DFDPKPLLRENLAPVLVITGAKDVQVDPEDLAVIAELVPGGADTVQVPDLTHLIRRDAD
FT                   PPSLRAYRRLVRDAVDPEVLSLVADWTAGHLRRV"
FT   CDS_pept        complement(454130..454615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48690"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL3"
FT                   /protein_id="BAH48690.1"
FT                   /translation="MPVTNVSQDTDALTLTITAEFAAPRARIWQIYADPRQLEKVWGPP
FT                   TYPATVVDHEFAAGGRVTYFMTGPEGEKYAGYWNIISVDEPTGFTFTDGFADADFTPIE
FT                   SMPVSTNEFSFAEKDGSTVATYVSTYATAEGLQKVLDMGVVEGSSQAIGQIDDLIKG"
FT   CDS_pept        complement(454619..454960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04440"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48691"
FT                   /db_xref="GOA:C1ARL4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL4"
FT                   /protein_id="BAH48691.1"
FT                   /translation="MSETDEDRADALFHALSDRTRRDIMRRVLAGEHSVSALAAKYDMS
FT                   FAAVQKHVAVLHKAGLLVKRRSGREQLATGDVEAVRAVSSMLAELEQVWRGRISRIDEL
FT                   IATEPLRKE"
FT   CDS_pept        complement(455356..455670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48692"
FT                   /db_xref="GOA:C1ARL5"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL5"
FT                   /protein_id="BAH48692.1"
FT                   /translation="MRRASSGVEGNGMFGTGLGAMVGLLVVALLVVPVSFGVAARADAK
FT                   ARRLSESPASDANEGLSVAVAEMTGRCDQWRQLATQAWLICGGASLVAVVVVGVLICVG
FT                   "
FT   CDS_pept        complement(455804..456010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48693"
FT                   /db_xref="GOA:C1ARL6"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL6"
FT                   /protein_id="BAH48693.1"
FT                   /translation="MYGVHRHRRGSQEPLHVKERVVMARISKKSGADLLDALRVSVIGT
FT                   VVCAGLVMGVIVVTMWNFPVPGV"
FT   CDS_pept        complement(456609..457211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48694"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL7"
FT                   /protein_id="BAH48694.1"
FT                   /translation="MMTRLQVAIAVIVGYWLGRTHHTKPGMMLAAAGAGRLAGSPQEMV
FT                   DHAAKLLQASPEFAALDESVRGQLLDAVRVAAVTAGTARADVDTDIDRLLPSGSDDALR
FT                   TAEDLAEDTAALVDDIPAAAPVEDVPDDIDADIDIDTDNDAQADDAPTADDGNAAAPAP
FT                   STAEVRTWAREHGFPVSDRGRLRAEVWEAFAAAHPER"
FT   CDS_pept        457418..458605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04480"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48695"
FT                   /db_xref="GOA:C1ARL8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL8"
FT                   /protein_id="BAH48695.1"
FT                   /translation="MTEGRSGRAAAAHRRMRPLYAAGFTTAFGAHAVAANLAFDLEDPA
FT                   GSLLYLGLLLALYDGAEVLLKPVFGTLADRIGARPVLLGGLIGFAAASVFFVVVGDSSW
FT                   LWLARLGQGVAASAFSPAASALVARMTPKAAHGSAFGTYGFYKGLGYTIGPLLGGALVW
FT                   LGDLTLLFAVMTALAVTVAAWAARVVPALPPLPRNRQTVLDLARRLSDRTFLRPTLALA
FT                   FATSALSVGVGFLPVAGAAAGLGSVATGAAVSVLAACAALVQPRAGRALDAGRISAGPG
FT                   TALGLLITATGLGCAMLPGLLGVLLAALAIGTGTGLITPLAFASLAGSTPDERMGQTMG
FT                   AAELGRELGDAGGPLLVGGIAAVATLTVGFGALAALTLVAGAVTAAAGSARAGQP"
FT   CDS_pept        complement(458644..458910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04490"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48696"
FT                   /db_xref="GOA:C1ARL9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARL9"
FT                   /protein_id="BAH48696.1"
FT                   /translation="MVRSPLTPQQRAAGKRLGAYLRQARGDRKPAEVAHAASISPETLR
FT                   KIETGRLATPAFTTVAALAAVLAVPLEDLAQICLPELNLQQTG"
FT   CDS_pept        458994..459779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="ROP_04500"
FT                   /product="methionine aminopeptidase"
FT                   /EC_number="3.4.11.18"
FT                   /note="protein synonym:peptidase M"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48697"
FT                   /db_xref="GOA:C1ARM0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM0"
FT                   /protein_id="BAH48697.1"
FT                   /translation="MEDERVLELKTPREIEAMRTTGAFIAELLDDLQSRAAVGVNLLDL
FT                   EHRARHLIKDRGAVSCYWDYAPSFGRGPFHNVICLSVNDAVLHGLPHDYTLRDGDLLSM
FT                   DIAVSIDGWVADSARSLIVGTPHAGDQRLIEATERALDAGIDAARPGRRLGDISAAIGA
FT                   VATDYGFPVNTEFGGHGLGRTMHEDPHVSNQGRAGRGLVLRPGLTLALEPWFARGTDKI
FT                   VYDPDGWTIRSADGSRTAHSEHTIAITDGDPLVLTRRSA"
FT   CDS_pept        complement(460014..461186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04510"
FT                   /product="putative epoxide hydrolase"
FT                   /EC_number="3.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48698"
FT                   /db_xref="GOA:C1ARM1"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM1"
FT                   /protein_id="BAH48698.1"
FT                   /translation="MPRPASDVQAFEAHATDAELDDLRARLAAVRLPETETVFRDAPDP
FT                   RRWEQGVPLADLVEVVNYWRTGYNWRSFEARLDRIGQFRTTIDGLGIHFLHRRSARADA
FT                   TPLIVTHGWPGSIAEFVDVVDELADPTDADAPAFHVVVPSLPGFGYSDKPATTGWGIEK
FT                   IATAWVELMGRLGYSRFAAHGGDWGGVITTVLGGRFPAHVLGIHTTTAQAPPGLTTDGL
FT                   TAAERKWTEDTRDFWRHHAAYAKQQATRPQTIGYSLVDSPVGLLAWILDKFAEWTDTED
FT                   SPFETISRDRILDDVTLYWLTRTGASSARIYYESHNSLDPELRVDVPSAISVYPRDIEK
FT                   CPRVWAQERYRQIVRWRSPETGGHFPSLEVPEYFVRDLQEGLAAVLAADR"
FT   CDS_pept        461290..461877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48699"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM2"
FT                   /protein_id="BAH48699.1"
FT                   /translation="MRAGFPDFRLGNVLATSFTGTLSERHGNAVERIPTPHRLVDWLAA
FT                   NGLVVDFCTTTQLELARELRESIHAASTAVASQDDLPASAVRVINDCSIRGRAAAILTP
FT                   EGNRRWRLSSPSCVEDALGVIAADAISIIAGERDGKFALCASPTCRAAFFDTSQSRTRK
FT                   WCDMNTCGNRQKKARFNANHRKNPDAPRAPRI"
FT   CDS_pept        complement(461915..463267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04530"
FT                   /product="flavin-containing amine oxidase"
FT                   /EC_number="1.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48700"
FT                   /db_xref="GOA:C1ARM3"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM3"
FT                   /protein_id="BAH48700.1"
FT                   /translation="MMDCDVVVIGAGLAGLTAARALTAAGRRVRVLEARDRVAGRNLGG
FT                   RLANGVAVEMGGQWIGRTQTEVLALAGELGLETFPTYDEGAAVTLYKGKVTRYSDETFG
FT                   LSEEAAVEVGRLQHELEELAETVSLSAPWTSPDAIELDRKTLDEWLRANTDDPEVRAFW
FT                   DAVVPALFSAAPAEMSLLHFLFYIKSGGMIDALVATTGGAQELRVVGGTHQISERLAAE
FT                   LGDVVRLNSPVHTITHDDSEVRVDFDGGTVTAAHAIVAIPPTLAGRLRYRPALPGSRDG
FT                   LTQQIPMGSVIKIQIAYPRPFWRESGFNGFAFNLDDELSVTLDNSPTDGSCGVLVGFFE
FT                   GPHARSAARRTPAERRAAVVATLVKLFGPDAGEPIDYLEQDWMAEEYTRGCYGGRLGAG
FT                   VWTQYGAALAEPIGRLHWAGAETSDIWNGYMDGAVRSGRRAAAEVLAQLNS"
FT   CDS_pept        463379..464017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04540"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48701"
FT                   /db_xref="GOA:C1ARM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM4"
FT                   /protein_id="BAH48701.1"
FT                   /translation="MAYVKASEREEQIVAAAIREFSETGVPGTTLRAVAGRAGIPLGTL
FT                   HYVFPSKERLLRAVIATVINEIAETLRAELEADKGVEHALRHGVGNFWKKLVTSRVGLQ
FT                   IMQYELMTYSLRSDSDGDLAQLQYERYSALVTDFCEQAAQAAGERCAVGFDSLGRIALA
FT                   QVDGLILQYIAKPDPDRARRDLDHALNMLVLYADPQPVTRTKAPKAETA"
FT   CDS_pept        464175..465545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04550"
FT                   /product="putative flavin-containing amine oxidase"
FT                   /EC_number="1.4.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48702"
FT                   /db_xref="GOA:C1ARM5"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM5"
FT                   /protein_id="BAH48702.1"
FT                   /translation="MTQHPTGSSNDEQAPSRKTTVAVVGAGMSGLIAARALQRQGLDVL
FT                   VLESADRTGGRMMADTSALGSRFDLGGQWIGHGHHRFSALAAELGTTVFPMHTPKRPTV
FT                   VRHGRTLSAVSPSTLLASAALVVWQIRAKRGAPKRWNSTTVQEWLNSLPSAGARRLLEV
FT                   LVEVSTTADLERFSMDAFAKMIGYQGGLSTMLSTNGGAQESLIVEGAGTLTDRIAAELG
FT                   PRVLTGSRVTSISRDGHGVVLRSPTALVRASKAIVSVPPPAAAAIAFDPPHPAGRHRLE
FT                   QNTYMGSVYKAVAVYRQPFWRSTTDAEFMFLDHPGFAVFDTSPPGGPGHLCVLVGGREA
FT                   RELDGLDEAGRRRAILGPVAAAIGSPEILRPASWHEKSWHLDEHAIGGYSALPTAGNPE
FT                   GAFPFPSDPIGDIHWAGTETASEHAGYIEGAIESGERAAREVIQALRHTTAAVIRSQ"
FT   CDS_pept        complement(465612..466115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48703"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM6"
FT                   /protein_id="BAH48703.1"
FT                   /translation="MANQTRWSWPAVGVALIAVAAVTWLAAVVIADVRRAPDAECLAVD
FT                   STVTDLIASRPVADPIEPVDAVAVRDPWTRSSGSVPFDNYYAIAMEFRSSDGSISHGVW
FT                   GLGTDAAPAEGRALTAHADNALGAPFVSVDQLARQSTLWPDTAMFFPEDANAVREARRC
FT                   LTFQ"
FT   CDS_pept        466296..466913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48704"
FT                   /db_xref="GOA:C1ARM7"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM7"
FT                   /protein_id="BAH48704.1"
FT                   /translation="MDGPVARAFDSAARRFLEVSAAATGHYDAPGLGEWSVRDLVGHTS
FT                   RSLSTVETYLDAAGEDPGAVELTDAVAYYLAIADALSDTAAVAQRGREAGAALGEDPMG
FT                   ALSALVARVPERVRASPSTALVRTPFGTMTLQGYLPTRTLELTVHTCDLAAALGVDADV
FT                   PREAVAETFAVIGGLAAVQGTAPAALLALTGRSPLPAGYSVL"
FT   CDS_pept        complement(466983..467465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04580"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48705"
FT                   /db_xref="GOA:C1ARM8"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM8"
FT                   /protein_id="BAH48705.1"
FT                   /translation="MEIVVRAAVLFLFLWVITRVVGRSTVGELSTFQLVLYVVMGDLVQ
FT                   QGVTQQDYSVTSAVLAVGVFALLTLALAWANARFPRVRGVTHGVPVIIVRDGIPDLDRL
FT                   RTERMSLDDLMADARQKGIRRFDEIELAVLETNGRVSFFTRTGHTDAGAPEQPGIA"
FT   CDS_pept        complement(467465..467995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48706"
FT                   /db_xref="GOA:C1ARM9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARM9"
FT                   /protein_id="BAH48706.1"
FT                   /translation="MRPSDRIPASVFDDVREYARTPAVAWLRRAAVALLALIVAFGAVG
FT                   LLGVRSGTAYAEGGGYALTLTYPRVARAGLDVPWDLTVRKPGGFSEPVVIVVDSDYFDM
FT                   FETQGWTPEPSAETSDALRTYMTVDPPPGDTLTLGFDAYIQPSSQLGHSGSVSVSEKGV
FT                   DVATLEFTTWLVP"
FT   CDS_pept        complement(468621..468992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48707"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN0"
FT                   /protein_id="BAH48707.1"
FT                   /translation="MWRNAHVPSYLLGMPPRYHVTSVLNRASIFRYGLDFSRMGAARGI
FT                   AGSSGPEQKGCFLAADEWERDWFVRMNNTGGAVDVWEVHGINDDDLIESPEGHYFFPGV
FT                   IAAAKLRLVQRDLPPSRNY"
FT   CDS_pept        469176..469505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48708"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN1"
FT                   /protein_id="BAH48708.1"
FT                   /translation="MHRSTAGGRFGPVRLIERDSDFAVVFAADTTRWVVLVQAGGDSPK
FT                   ASVILGVPNPGVGFGRSLRASYLQRLTVHRSGDPSVARKPPEFGWMALAGIAAEGVSQF
FT                   EVRSS"
FT   CDS_pept        469686..469955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48709"
FT                   /db_xref="GOA:C1ARN2"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN2"
FT                   /protein_id="BAH48709.1"
FT                   /translation="MATKDSQPQLKDQEMYEELREMGDSKEKAARISNAAAARGRKNVG
FT                   KSGGKSQSYDDWTVDELEKRAKELGLKGYSKLNKKELIDELRNH"
FT   CDS_pept        470033..470398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN3"
FT                   /protein_id="BAH48710.1"
FT                   /translation="MQKVLTFAAGAAVGFVLGTRSGRQTYEKMRHQSLELWHNPTVQEK
FT                   VSEATDTVKDKAPQVQHKVGELAKKATHRHTDTHSTTAPTNGASLGDAPTPPPAAPTPT
FT                   DAETTTGVPPTRGESAG"
FT   CDS_pept        complement(470435..470932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48711"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN4"
FT                   /protein_id="BAH48711.1"
FT                   /translation="MGTRTPWHPVPHHPGVLPSAPLCARRCGAGSDSAYAKYPQSIDAV
FT                   AAEYRLTGTRGADFWGNSVTSTADTVTFLEAKTTDPSSPILGWMATAAPVAVDGTRQNG
FT                   GTGALPSVTGTKWGWSDDGSSVVASASFGPDFSVAANTYGTAEQHTSDVLGAFGLEPTP
FT                   PA"
FT   CDS_pept        complement(470944..472236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48712"
FT                   /db_xref="GOA:C1ARN5"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN5"
FT                   /protein_id="BAH48712.1"
FT                   /translation="MTRKDRDRLSADDAHILGLESAVISGHTLKLVVLAPAPGPLDIEA
FT                   LRTAVAERLSSQPRATERIDTSGAQPRWTAATAFDICDHVRRREEAGCTSRADLWRAVS
FT                   TLMSEHLDHERPLWTFDLIGPLGDGREAIAVRIHHAMADGIGAVRFLDDVLWDRHADPA
FT                   PRESRPGVRAESTKHSRIDEVLRMPAAMRRELGHRGSRSPFDRPISAARELAFTVAPLS
FT                   ELKAIGASRPTRATVNDVLLGIVAGGLRSWLSTGDAALPRLRAQVPVSLHHRNEEARVG
FT                   NRDSFLNIDLPLAEADPLIRLDRISAETSKRKHLDDADELFDLFHALGRVKGVGAAAQR
FT                   LAGSAREFSLAISNVPGPPLPVSVSGRRVERLFSSSEPAVHHALRISAISCAGIVGIGL
FT                   CTDPEALPDVARLAMAMEDSYTELRDATSTP"
FT   CDS_pept        complement(472333..472947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04660"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48713"
FT                   /db_xref="GOA:C1ARN6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN6"
FT                   /protein_id="BAH48713.1"
FT                   /translation="MAGRRGWGGSPPGTDEEASRRIVIAAVDLISRKGTAISIADVAES
FT                   LGVIRQTVYRYFPSTDSLLRAAAIAAVDGFLDRLTQHVAGIEDPAEAVVEAVIYTLNEA
FT                   PRVPQLGIMLSGSHSHTEGITSEEALAFGMTMIRRFDVDWERHGYGEHTLRELVEYQLR
FT                   TMQSFFISPGNPPRGQDELRAYLRRWVGSAVAVTGSPASAG"
FT   CDS_pept        473194..474144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48714"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN7"
FT                   /protein_id="BAH48714.1"
FT                   /translation="MSDLHPRKMDFAFDEQDVPFLWNPDNPAWSSMSNAISFLAIGFEK
FT                   MIVKAIMQAKPLMTDPEVAEEAVAFMRQEGHHSTAHRQHVKALIRRYPGLQNTLDAVIG
FT                   EYDLLTEATSLNYRLAYTADLEATFTPVFKLMLDNDATLFRPGDDRVASLFIWHFVEEV
FT                   EHRSSALVIFDSLVGEELYRMRMAPSIFTHVMKVVRIACAGFNQHVPLRERKVDAMSMF
FT                   ATHRTKQKLLTAFAPYLSKGIMPRAFDHLPRGEQLTALAGVVRSQMPKHNPTHEKLPAL
FT                   ADEWFTRYDAGFDCTRWYTAESSEQRTEPAPAVVN"
FT   CDS_pept        474144..475301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48715"
FT                   /db_xref="GOA:C1ARN8"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN8"
FT                   /protein_id="BAH48715.1"
FT                   /translation="MADLCSPTFDQLSTALGFSCAEAGGLVEVRSPLALENWTLPVLEL
FT                   TIVLGSVLALVFAVLRWRRNGDPTTLALWFGATAYLFVIEPPLYFPAAFGIEEHVDTMF
FT                   AHNVFTVDFLWGRLPLYIIAIYPLMATLAFELVRMLGVFRKYGVLVGAVCVGFVHHAFY
FT                   EIFDQLGPQLRWWEWSTTNPVNQPMFDAVPLPSVVVFAALWPMSLAMCVQFFVGRHADR
FT                   GRKFTGLELAWRTIVIGLLASAGTFILPLPATVLGMESTTVRGVFYAAELAVVALVAIP
FT                   VLVRQWSRLRGGTSDVPSYSNDFVRAYSVVYLGVMGMLWLTALPDYFAAVDGVTSNGDP
FT                   IGNIWYTIVCFAIAVLCVAATFTVPRNSVNGHGAVSGERTPDAVR"
FT   CDS_pept        complement(475911..479861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04690"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48716"
FT                   /db_xref="GOA:C1ARN9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARN9"
FT                   /protein_id="BAH48716.1"
FT                   /translation="MEHAARATYREHRSDPFPLSAAQHGLWFAQQLAPDVPICIAQYVD
FT                   IRGPLDVELFREVALVAGHEYESVFLRLIDVDGEPHQVIDPPADAAMGVVDFRGASDPM
FT                   AAAETWMHDNYTARVDFEHDHLCESSLLCVGDERHLWYSRIHHVALDGYAAMTLVNRVA
FT                   ALYTAAVEDRALEPNRAADLHTLHRLEEDYRASHRFTSDRDYWAERLHRRTNGASLTDV
FT                   EAPPAAHSLTVRAALSPDTVARLEDTGGRPGATAAAALIAAFACHLSRRTGQEEVLVDI
FT                   PLSARTTAVLRRSSGMLANVAPLLVQVRSGDTVGDLVARVQHELMGAMRHQRGNVEDIL
FT                   RDLGVSAESRRISGPMVNVMLFDQDLTFGSLTGDFRILTTGPVPDLSVNVYRSGTPAST
FT                   IVEFEANPYRYREDELRSHHAAVVGLIDDVLAADPDTPLAAIGVADVGRLTPVVGGLSV
FT                   SEVSLPELLAAAVAVDPDAVAVVCEGRGLSYRELDEASNRLARVLLGSGVGCESVVAVA
FT                   VGRSVESVLSVWAVAKTGAAFVPVDPGYPVGRIEHMVADSGVVVGVTLSGSVAVLPGGV
FT                   RWVVLDDVETVEWLSSVSAGPVTDGDRGAPVRVGQAAYVIYTSGSTGLPKGVVVSHRGL
FT                   ANVVASQRAGFGGGVGARVLQCASPSFDASVFELVWAVGLGGRLVVVPPTVYGGEELAR
FT                   ILVSEGVTHAVLTPTALSSLDPSGLEALGALVVAGEVCPPELVARWAPGRSMFNAYGPT
FT                   ESTIMSNASDGLVVGESVTIGGPVRGFGELVLDARLRPVPVGAVGELYLSGPGLARGYR
FT                   NRVGLTSARFVADPFGVPGQRMYRTGDVVRWREGAGGGLVLEYVGRADFQVKIRGFRVE
FT                   LGEIESALLGYPGIDHAVVHTSGDRLAGYVVPVAGSDLDTSAVLAHARTRLAPHMVPAT
FT                   VTVLDAVPVTANGKLDRAALPEPDFTAGRAEYRAPRNATEEMVAAAFAGGLGLDRVGLD
FT                   DNYFALGGTSLTATSVIARIAEDAARAVPVQWIFTHPTPEALAHMIATAPEDARAGDTA
FT                   DRSLDVLLPLRTTGTGSPVFCIHPAIGLAWCFTGLVQYLGDRPVYGLQSPALTDPDLRI
FT                   DSLQELAGRYVDRIRSVQPHGPYHLVGYSVGGQIAHEMAVQLTGAGDEVATLTMLDTHL
FT                   AGGLDRTAEKPTMAALLAEFGAVVPRDGDDATTTERAVEVLRRTGGPFAAVTADDLDAV
FT                   HRVFTQTVDLALAHRPSTPSGVDLLYFGAADSVDAPTGVSAWRQHITGEILVHHVPAAH
FT                   QQMTSPEALAGIGPVLAHHVLLADKPMRVVSS"
FT   CDS_pept        480170..480505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48717"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP0"
FT                   /protein_id="BAH48717.1"
FT                   /translation="MRSVTFAPAAARHVGRRMPVSGQAMGSGTENRMRRREIPVPRADS
FT                   MTESGTERRPTIALPMARAVPKQQDSSHADRIFASSRFEFFSGVSRSAVLRDDPRPKGV
FT                   VERCRHR"
FT   CDS_pept        480511..480765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04710"
FT                   /product="putative WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48718"
FT                   /db_xref="GOA:C1ARP1"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP1"
FT                   /protein_id="BAH48718.1"
FT                   /translation="MQRHDTELWQWRLSARCHEEDVEIFFPADAERRNARFEREDLAKE
FT                   FCRGCAVVEECLAYALDTGQQHGVWGATTPGERLARLDR"
FT   CDS_pept        complement(481075..481248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="ROP_04720"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48719"
FT                   /db_xref="GOA:C1ARP2"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP2"
FT                   /protein_id="BAH48719.1"
FT                   /translation="MAVPKRRMSRANTRSRRAQWKAPVPALVTVTVGGITHRVPRRLVK
FT                   AVQSGLIDSRDL"
FT   CDS_pept        complement(481378..481500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ROP_04730"
FT                   /product="putative 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48720"
FT                   /db_xref="GOA:C1ARP3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP3"
FT                   /protein_id="BAH48720.1"
FT                   /translation="MKVRASLKSLKNQPGSQVVRRRGRVYVINKQNPRFKARQG"
FT   CDS_pept        complement(481836..481997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP4"
FT                   /protein_id="BAH48721.1"
FT                   /translation="MVNNRHPAKNRTGTWNAVVVPPGSGGRFAVAVADEQSGIAMAATD
FT                   AAAQATIE"
FT   CDS_pept        482495..482872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48722"
FT                   /db_xref="GOA:C1ARP5"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP5"
FT                   /protein_id="BAH48722.1"
FT                   /translation="MLNSEISNPVRSTRSFLDRRRGPSDRELVTTAKAVLITRRGYSDA
FT                   QAFDELLDVARRHHLSVQGAARCLIDLTSNTGHLTSRRPVTFPEWEGLRGQPSGHHRRP
FT                   SQRMDSLQGRHHPHLATQIRP"
FT   CDS_pept        482978..483736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04760"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48723"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP6"
FT                   /protein_id="BAH48723.1"
FT                   /translation="MTRGTTPVSIQREPELAGQTVVLIGGSAGIGLETARRARTEGAEV
FT                   ILTGRNPDKLESAAADVGARHTAAFDANDPAALRTFFEGLPTPIDHVLVTAGGPRYAPL
FT                   LEMDADQVRRELSDHMVLGLEVARSAANKTRPGGTLLFMGGTGGRRIGHGLGIASAATA
FT                   ALPPFTAALALELAPVRVNLIAAGFVDTPLSASLLGDRLDERRNELRTKLPIGRVVGAA
FT                   DVAALAVHIMCNTALTGATYDIDGGQQFVF"
FT   CDS_pept        complement(484082..484750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48724"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP7"
FT                   /protein_id="BAH48724.1"
FT                   /translation="MAVGATRRRPRRRMPIVYARSSTFDAHPSFIDEGIKHVRDTVMPA
FT                   LADIAGSAGMSLLVDRGSGRCIATSSWTDDEALRASEAPVRQLRDRMAEVFHATATVAR
FT                   WDIAALHRDHRSHHGAWVRVAWLDVEPGHLDRVIDVYKMSSLPAMHELAGFCSASLLVD
FT                   PAAGRVVSSMTFDSAPAEAGARDAVESIGTSEIRESGARLLEVGEFELAIAHLHVPEMA
FT                   "
FT   CDS_pept        complement(484823..485035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48725"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP8"
FT                   /protein_id="BAH48725.1"
FT                   /translation="MTQQGAVGGIQADPDDIAGTEPVGLRETASSLTADAIVWPDPSPL
FT                   DSWWKRVVIDHATALAEGEPSARPE"
FT   CDS_pept        complement(485032..485361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48726"
FT                   /db_xref="GOA:C1ARP9"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP9"
FT                   /protein_id="BAH48726.1"
FT                   /translation="MIEDSTEPSLTPVPSPTRLIPRRRPDGRELLGTAKGILIAGRGCT
FT                   DAQAFDELLDVARRHHLTVLGAARSLVELAAGPSPRPRRADTARFDEWEQLVAQLPPRR
FT                   HAQAS"
FT   CDS_pept        complement(485723..488263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04800"
FT                   /product="UvrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48727"
FT                   /db_xref="GOA:C1ARQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ0"
FT                   /protein_id="BAH48727.1"
FT                   /translation="MPTPDPGPPAEPSPAREFAGIEVFDASEHNLAHVDVFIPRDCIVA
FT                   FTGVSGSGKSSLAFGTIYAEAQRRFLESVTPYARRLMDQVGAPRVGDITGLPPAVALQQ
FT                   ARGHTSARSSVGTLTHISNVLRMLFSRAGTYPPDAAELDSNAFSPNTPEGGCPTCHGLG
FT                   RTHDVDVDALVPDPSRSIRDGAVAAWPGAWLGKNYRDILDTLGIDVDRPWSELPAHQRE
FT                   WILTTDEQPTVTVSPIRDPGKMVRDYQGTFSSARTYVLHTFATTKSATQRAKVSRYLLS
FT                   RPCSACDGKRLRPEALAVRFAGLDIADATALPMSELATALDAAVGSRDAAADDATDRAS
FT                   EALVDNLLGRLRGLSELGLGYLSLGRSTTTLSPGELQRLRLATQLQSGLFGVLYVLDEP
FT                   SAGLHPADTEALVAAVRRLRAAGNSVFVIEHNLDIVRAADWIVDVGPDAGEHGGRVLYS
FT                   GTVDGLAETPESVTRRYLFEPREHRPEPAQPSRWIELSGITMHNLRDLTVRIPLGVLTA
FT                   VTGVSGSGKSTLVSRVLTDVVAQHLGVDDEPGPDTVGDDADSTAVLADGRDTTASTVVS
FT                   SHGLGHIDRLVRVDQTPIGRTPRSNLATYTGLFDVIRKLFAAHPTARERGYSPGRFSFN
FT                   VTGGRCDECEGAGAITIGMLFLPEASAPCPVCAGARYNTETLEILVDGRSIADVLAMTA
FT                   DEAGDFLNHVPAAKKSLDMLVEVGLGYLRLGQSATTLSGGEAQRVKLASELQRIRSGHT
FT                   LYVLDEPTTGLHPADVDRLMVVLRRLVAAKNTVVLVEHDMSVIAAADWMIDLGPGGGDN
FT                   GGRVIASGQPVTVAATADSATAAHLGRHLAPANG"
FT   CDS_pept        complement(488352..489518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04810"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48728"
FT                   /db_xref="GOA:C1ARQ1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ1"
FT                   /protein_id="BAH48728.1"
FT                   /translation="MSKELPGQASVVVIGGGVIGASIAFHLAESGVSDVVLLEKDELAC
FT                   GSTCKAAGGVRASFSNEANIAIGLRGLEVYSRFAQEYHQEIDFSRDGYLYLLSDQENVD
FT                   IFTESVALQNRHGVPSRMITPEEAQKISPLINTDGLLAASWSPQDGKATPESVVMGYAA
FT                   AARRHGARIVRHCAVTDIESTGGTIAAVVTERGRIATGTVVCAAGAWSAEIGAMVGVNI
FT                   PVVPVRRQIAFTEPLSELPESSPSLTIDFPSNFYFHPEGKGLLLGWSDPNEPAGFNLEF
FT                   ELEDWLMGLGAIAETRVPAVLDYGISTGWAGLYEVTPDRNQIIDRSTEVDGLLIATGYS
FT                   GHGFLMGPATGEIVRDLYHGREPGYDISSFALGRFAQSSIGAGETNIV"
FT   CDS_pept        complement(489567..490715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04820"
FT                   /product="putative glutamate dehydrogenase"
FT                   /EC_number="1.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48729"
FT                   /db_xref="GOA:C1ARQ2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ2"
FT                   /protein_id="BAH48729.1"
FT                   /translation="MFELIDEWGPEKVVCVSDSRTGMRGVLVIDNTARGMGKGGTRMST
FT                   TVSVGEVARLARNMTWKWAGVDLFYGGAKAGIWADPTASSKEAVLRAFVRALRNEVPEE
FT                   YVFGLDVGLTEKDAAIMLDEVGGRGGAVGTPHALGGLPYDQLGVTGHGVAESADAAAQT
FT                   LGLSTGSLSVSIQGFGAVGAASAKRLAELGATAVAVSTSRGGIHNPDGLDVAELLTLRE
FT                   QFGDALVDHYSDAKPLAAGEELSVTADILIPAALQDVIDTDLARTLPARIVVEGANLPS
FT                   TPEAQAVLFDRGVTVVPDFIANAGGVVAAAVAMDARFSGIRPEPAAVFDNISNTLRAST
FT                   IDTLEASKAQGRTTHEVARTTAQERVREAMVLRGRAPRNAAF"
FT   CDS_pept        complement(490749..492305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcd"
FT                   /locus_tag="ROP_04830"
FT                   /product="piperideine-6-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48730"
FT                   /db_xref="GOA:C1ARQ3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ3"
FT                   /protein_id="BAH48730.1"
FT                   /translation="MSTAVADTIALPTTDELRTLARTSLQRCGVDPAVLDTTGATNTVT
FT                   ARTPVTGEALFDYPAAGAADVEAAIDAAHDAFLRWRTVPGPVRGFLIKCLGELLTEHKD
FT                   DVANLISIEVGKIRSEALGEVQEMIDICDFAVGLSRQLDGRTMPSERPGHRLMETWHPL
FT                   GVVGVVSAFNFPAAVWSWNLALAIVCGDAVIWKPAQLTTLTAAACSALFDRAARESGAP
FT                   ANLNVLVSASAADTQALIDSPKVPLISATGSERMGEQIAPRVAARFGRAILELGGNNAA
FT                   IVTPSADLDLATRGIVFAAAGTAGQRCTSMRRIIVHRDIADELVGRICEVYRRLPIGDP
FT                   FADGTLVGPLIDGKSHANMTEALDKAVAQGGQILAGGARRPSSDNSYYVEPAIVRMPAQ
FT                   SDIVRDETFAPILYVLTYDTFEEAIALHNDVPQGLSSSIFTTDQREAERFIAADGSDCG
FT                   IVNVNIGTSGAEIGGAFGGEKTTGGGRESGSDAWRAYMRRATNTINYSRELPLAQGVNF
FT                   G"
FT   CDS_pept        complement(492306..493754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48731"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ4"
FT                   /protein_id="BAH48731.1"
FT                   /translation="MPITQQWELRAEFARRLSHLYGKEVPAYTALLEVSRAVNDTVLSN
FT                   LGAGAQRLGSTARITAERHGAIRVGTPQEMAQVARVFAAMGMYPVGFYDLREAAASSVP
FT                   VVSTAFRPTDPDELARNPFRVFTSMLVPSDRRFFSAELQQRLESFLAQRRLFTAELLVL
FT                   ADRATEYRGLNSGDAEMFLTLATAAFKLSTEAVDRAWYRELEQVSSVAADIGGVTSTHI
FT                   NHLTPRVLDIDDLYARMERRRIDMIDTIQGPPRWAGPDLLLRQTSFRALAEPRVFREAD
FT                   GSVEKGSLRVRFGEVEARGIAATVRGREVYDRLTGEIEQAVREAAATAPVSAEVRNEIA
FT                   AALWNQQVPATEQGLALHDLAYFTYRVDTDKQRNGTVPGRSLQDLIDQGWVRPEPIVYE
FT                   DFLPKSAAGIFQSNLTSDGHKDTTQSMTDIDAAWMEGVLGRTLHDPYALYDGIRRVSLD
FT                   HVASQLGIRGPIDVPAPIATRGVK"
FT   CDS_pept        493924..494841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04850"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48732"
FT                   /db_xref="GOA:C1ARQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ5"
FT                   /protein_id="BAH48732.1"
FT                   /translation="MNMSLGHLVTLRELARRGTMVAVAEELGYTAGAVSQQIAALEKAV
FT                   GSQLVTKVGRNVVLTDSGVVLAEHAVKILSAEQTALDALRAVHDDVAAPLLLGTFGSTA
FT                   AALLPPVVAAAQREYPHLALSSRELDVDEAATAVQRGQVDVAFGLDYPNSPMPRTPDIE
FT                   MITLRSERFGLAVSPGSYGIRTECTIDLCEAAEWNWILPPAETQFGRAIRIACRQEGFE
FT                   PIARHEIVDTAVSLALAAKGLGAAPVTDMMIRLNSSVPIVRVDLEQEIGRRIVLLRLAR
FT                   SETRPTVRAVTEIVRAVVNTAETR"
FT   CDS_pept        complement(495130..497994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04860"
FT                   /product="putative FAD-linked oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48733"
FT                   /db_xref="GOA:C1ARQ6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ6"
FT                   /protein_id="BAH48733.1"
FT                   /translation="MLGTCSMLRMISAESLAAELRRSGVGDVLSDGTTRAAYSSDASLY
FT                   RVRPLVVARPRRAEEVAAALAVCRREGVPLTSRGGGTSVAGNAVGTGLILDFSRHMNRV
FT                   LSIDPDAQTATVEPGTIQTVLQQAVAPHGLRFGPDPSTFTRCTIGGMIGNNACGSRTLG
FT                   YGRTSDNVTGLHVLTGTGESLQLGSAGEVTASPALRALQQVTRGGLATIRTELGQFGRQ
FT                   VSGYALEHLLPENRFDVTRMLVGTEGTLAVATQATVRLVTEPAHRVLVVLGYPNIAAAG
FT                   DATTLVLKFDPTACEGIDSRIVDVVRERRGPDAVPPLPAGAAWLFVEVVGDDLDDTIAA
FT                   ARQVGRDCGAVDSLVVTEAGRAAQLWRIRADGAGLAGRSPAGLPAHAGWEDAAVPPAML
FT                   GNYLRDFDALMDEYGVTGLPYGHFGDGCLHVRIDWPLDRPGGSGIFREFLVAASRLVAG
FT                   YGGSLSGEHGDGRARSELLPLMYSPEAMKLFAAVKHVFDPDNVLNPGVVVDPRPVDADL
FT                   RIPAAPLLRRNLALAYHHDDGDFTQAVHRCTGVGKCRADNTATGGVMCPSYQATREEKD
FT                   STRGRARVLQEMINGTAVEGGWRSPEVHDALDLCLSCKGCSSDCPTGVDMAAFKSEVLH
FT                   QSYKGRLRPASHYSLGWLPRWAKIAGHAPGVVNAAMRIPGIGPLALSAAGVDRRRSIPP
FT                   FAKQTFRSWFQATEHDRATTGDPVLLFVDSFTNYFTPEVGHATVRVLEAAGYRPQLTDR
FT                   QQCCGLTWISTGQLTAAKKILGRTVDALSESAAAGMPIVGMEPSCTGVLRSDAAELLGR
FT                   AAAEPVADATRTLAELLTDRGWEPPSLDGTSVVAQPHCHHHSVMGWSPDAQLLEKAGAQ
FT                   VQRLGGCCGLAGNFGVEKGHYEVSVAVAEQQLLPAVAAADADTTILADGYSCRTQLSDL
FT                   TDRRGDHLAQLLAARLDADRTRRD"
FT   CDS_pept        498029..498754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04870"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48734"
FT                   /db_xref="GOA:C1ARQ7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ7"
FT                   /protein_id="BAH48734.1"
FT                   /translation="MADEALELEPLAPFPGRRMEQAIAAVRAAIDDGRMKPGVKYSVYQ
FT                   LAEGLGISRTPVRDALLRLEEVGLIKFEARQGFRILLPEPREIAEIFAVRLALELPAVR
FT                   RAATADDPALPDALLQQQRLMRDAAAVGNEHQFAHHDLGLHDLILDAADNSRARAIVKT
FT                   LRETTRLLGANTADKTRTLTDIDDEHTPVIDAIIAGNPDKAEAAMRRHLENTGRLLVAQ
FT                   ALRTEASDKSVDEIWSAVV"
FT   CDS_pept        complement(498816..499004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48735"
FT                   /db_xref="InterPro:IPR009317"
FT                   /db_xref="InterPro:IPR037205"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ8"
FT                   /protein_id="BAH48735.1"
FT                   /translation="MNRTDLPQTLRRSSKEVQAAFATAHETAVRRYGEGEEAQRAAYGE
FT                   LKQSYELVTDHWVPKQD"
FT   CDS_pept        499221..499475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48736"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARQ9"
FT                   /protein_id="BAH48736.1"
FT                   /translation="MPVSPHTLLQHVQDRTTDLRRWLDTGENTATLTAYLRDEPVDHRW
FT                   LSTYRRLTHDLLRAVDHACPPREPHDAPTPSVGRQSDLQ"
FT   CDS_pept        499472..499678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48737"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR0"
FT                   /protein_id="BAH48737.1"
FT                   /translation="MNDDQRRALEHVRDTCAMLHCFLTTHSSDRPPERVRTATFEQLTD
FT                   DLLDAVTSAQNVGVPEQRIFDSM"
FT   CDS_pept        499675..501162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48738"
FT                   /db_xref="GOA:C1ARR1"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR1"
FT                   /protein_id="BAH48738.1"
FT                   /translation="MTDDLHRPGRKSECGAGPAYGRLCLVILTISTTARPATDLGYLLH
FT                   KHPDRVQEFTQSCGVARVFYPEANENRCTVALLLDVDATRLARSSGRSADYALGQYVND
FT                   RPYAVSSLLSVALADVFRTARAGRCTLQPELAATPIPLEISLPALPCSGGPELAEQLFT
FT                   PMGWTVEARPVRLDDAFPEWGDSRYVRLTLRGDIRLADALNHLYVLLPVLDDAKHYWVA
FT                   SDEVDKLIRAGGSWLAEHPERTLITRRYLRHQTALTRSAFERLAELGDDVAEQLEPPVD
FT                   EEPGNDTVAAAPPLNVIRREAVLGALGELDARTVIDLGCGSGQLVSALLDDARFTEIAA
FT                   ADVSTRALSIAARRLQLDRMPERRRERLQLFQAALTYTDSRFAGYDAAVLMEVIEHIDP
FT                   PRLTALEQVIFVTARPGHVIVTTPNSEYNVRYPDLVGMRHRDHRFEWSRAEFRSWAGNV
FT                   CQVHGYTADFRPVGDDDPEVGPPTQMAVFTRAGGAHD"
FT   CDS_pept        501155..503692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpA"
FT                   /locus_tag="ROP_04920"
FT                   /product="serine/threonine protein phosphatase PrpA"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein synonym:phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48739"
FT                   /db_xref="GOA:C1ARR2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR2"
FT                   /protein_id="BAH48739.1"
FT                   /translation="MTDISVPALSLVVLVGVSGSGKSSFAAQHFAPTQVLSSDFCRGLV
FT                   ADDENDQSATSDAFDVLLYIAGTRLRRGLLTVVDATNVQREARKALVDLAKSHDVLVDA
FT                   IVIDVPDDVAIARNATRPDRDFGPHVIRRQHKDLRRSLPKLGREGFRRVHVLTGVEAID
FT                   SATVSIEKAWTDKRDLTGPFDIIGDVHGCRSELETLLRELGWQLQPDGAGAHHPEGRTA
FT                   VFVGDLVDRGPDTPGVLRLVMGMVAAGTALCVSGNHEQKLSRALHGRNVTTSHGLQASL
FT                   DQLAAESDDFRKSAHAFIDGLISHYELDGGNLVVAHAGLKEAYHGRASARVRSFALYGD
FT                   TTGETDEYGLPVRYPWAHDYRGRAFVVYGHTPVPETEWINNTICLDTGVVFGGRLTALR
FT                   YPGKDIVSVPAEQVWFEPARPLDTASARPGHRTQRDPTLLSIDDVRGTRHIDVRYNKGR
FT                   IKVREENAAAALEIMSRFAVDPRWLVYLPPTMAPPATSNLDGYLEHPVQAFAEFAAAGV
FT                   GEVVCEEKHMGSRAIAVVARDAATAAERFGVTDGSSGIVYTRTGRPFFDDPATMSELVA
FT                   RLRTACTPLMDDLGSSWLALDCELLPWSAKAGELIRTQYASVGAAAGAALPDAITALER
FT                   AAARGLDVADLLTHNRTREANARLFREAYARYCWPVTGLDGVRLAPFQILACEGRATAV
FT                   TEPHSWHLAKLATLDDPLVAGTRHQFVDLTSDESRHAATTWWSQLTDAGGEGMVVKPLG
FT                   PTPAELAHRRIQPGIKVRGREYLRIIYGPDYTENLDVLRDRSLGRKRSMALREHALGLE
FT                   ALTRLTEGDPLWRVHETVFAVLALESEPVDPRL"
FT   CDS_pept        complement(503696..504322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04930"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48740"
FT                   /db_xref="GOA:C1ARR3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR3"
FT                   /protein_id="BAH48740.1"
FT                   /translation="MANARTQPGETVRESYSARSQEYADLFGSMTSTHPSDRALVRSWA
FT                   AALTGPVLDAGCGPGQWTDFLAACGVAASGIDLVPEFVERARVRYPRLSFDVGDFEAVD
FT                   AAAESLGGVLSWYSLVHHSPQDIQIPLAEFARVIRPGGGLLVGFFEGATVDTFDHAVTT
FT                   AHRWPVAELSEQLVTAGFEVTETHTRTGSGYRPHGAITARRQITR"
FT   CDS_pept        504330..504488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48741"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR4"
FT                   /protein_id="BAH48741.1"
FT                   /translation="MIVDRALDMPNPLGVSPHLASTIAVGSLGLRATTRLRPLLGHSLW
FT                   RSRSQKN"
FT   CDS_pept        504522..505031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48742"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR5"
FT                   /protein_id="BAH48742.1"
FT                   /translation="MLIYSMSVEEDGFIADREGGFGWTVPTRSTRQRPSQCPARRGAAN
FT                   DPSMTSRFSSNLVRGIIVATSVLTAACSSGGAERSAPLVGVETSTAPATPDTPGTLPTA
FT                   NELTALYNTALDYDVPLSDRVNLIQGVDEADPRLAQKFVQEEMTVAFHAVLDRGDGSLL
FT                   AFGNPS"
FT   CDS_pept        complement(505465..506919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_04960"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48743"
FT                   /db_xref="GOA:C1ARR6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR6"
FT                   /protein_id="BAH48743.1"
FT                   /translation="MDLDNVLEQAAVAKGEFARQTPQQRYAQLTGIADRLDATADELVP
FT                   VAMTETHLPEPRLRGELRRTTMQLRMFAEEARTGEFLDARIDDPDPDFGSGPRPNIRRM
FT                   KMPIGVVLNFAASNFPFAFSVAGGDTASALATGCPVIVKAHEGHPKLSELTGRLVTSAL
FT                   DDAGAPAGAFHLIEGRDAGVDALRDDRVDAATFTGSVRGGLFLAGIASERPRPIPFYGE
FT                   LGSINPVFVSQAAIDARGQAIAEGFVESFTLGSGQFCTKPGIVFLPAGHGLEDILTTRV
FT                   GEKRTGELLTDAITSGFADRLREIGDQIGGRMLVEPTAIDGCHQPALLSIDYPTFVEHA
FT                   DNVLTEAFGPFSIIVEYTDVKQLTDAATRLHGSLTISLHVQEADADILDDLRRVVERRT
FT                   GRILLNEWPTGVSVTPAQHHGGPFPSTTSPLHTAVGTAAVERFLRPVSFQNYFDSWLPE
FT                   PLQDSNPWNIPQKRSAAGQSQIWGRG"
FT   CDS_pept        complement(506937..507695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="ROP_04970"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="protein synonym:phosphoriboisomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48744"
FT                   /db_xref="GOA:C1ARR7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR7"
FT                   /protein_id="BAH48744.1"
FT                   /translation="MYTTETPQDAAKYAVGRAAVERYAHDGAQLGLGSGTTSAWFVRAL
FT                   GEKVAEGLDIVGVPTSTATRDLALSVGITLIDLNDLDRPLDVTLDGPDEVDHDGDMIKG
FT                   GGACLLWERMVAEASLKMVCIADDTKLVERLGSFPLPIEVIPFGWKATRRSISALFRDL
FT                   GYTDIDIVQRQRDGQPVVTDSGNFILDAHMVAITDKALLDTNLNWIAGVVENGLFTGIA
FT                   HEILIASPDGAAKLIELPHRRAARIPQWRK"
FT   CDS_pept        complement(507719..508372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gph"
FT                   /locus_tag="ROP_04980"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48745"
FT                   /db_xref="GOA:C1ARR8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR8"
FT                   /protein_id="BAH48745.1"
FT                   /translation="MSTTQTKFTAVVFDLDGTLVDSSEDIAAAMNEALSGHGDRRVTVR
FT                   QVADALGGGPRALVEQCLRAAGLPVTAPTVDDVLRTYSERYRANPAQKTRLVDTAAVVL
FT                   AELDARGIQLGVCTNKRTPIAHAVLDALGLGAIIGAVIGSDATDGPKPDPRHLTDTIAA
FT                   LGASGSTVLYVGDTDIDRDTATAAGIRYAHVSWGHPDVDADFRLDSFDDLLTLI"
FT   CDS_pept        complement(508369..509901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="ROP_04990"
FT                   /product="putative xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="protein synonym:xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48746"
FT                   /db_xref="GOA:C1ARR9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR9"
FT                   /protein_id="BAH48746.1"
FT                   /translation="MTTAARVHLGVDIGTSSCKVVAVDHTGAVMTTAVREYPLFSDRHG
FT                   WSEQDPHDWWAATDACIREVTAQLPRRGDEIVAIGLSGQMHGLVALDDTGTVIRRAILW
FT                   NDQRCEAECVAITDTVGGPHSVLDATANRLITGFTAGKVAWLRDHEPEVFARIHRIVNP
FT                   KDYLRLRMNGRFVTDVSEASGTGLFDVANRKWSPAMLDAVGVSESMLPEVVESPERTGV
FT                   LLPEIADAWNLRPDVEVYGGGGDAVVQTASMGITQRGDIGVTLGTAGIVAAVSRTCPDN
FT                   VTGSVQVSCYNQPGFWHVMGVSLSAAGGLQWLADVVHQLPGAQDVSFTELIDLAKEVPV
FT                   GADGLLFLPYLAGERSPHYAPSASGAMVGLTRMHGLGHLVRAVIEGALLNMRQILESFA
FT                   DLGIPCDRIIASGGATRDAFWLQAMADVFGTEVVTMTGSSEGGAYGAAIVSGVGAGTWE
FT                   SFDDAYGHLQVSSRHVPRTAEAARYTRIFEGYRNLFGHFTDVFGDIDIARKT"
FT   CDS_pept        complement(509898..511379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05000"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48747"
FT                   /db_xref="GOA:C1ARS0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS0"
FT                   /protein_id="BAH48747.1"
FT                   /translation="MPAELTTPERKAHAMTITTLNNYIDGGWVPSETTFKALNPADEKV
FT                   IAEVPASTATDVDAAVTAARRAFADWRHVNPTVRARYLHTIGDIVKSRERELAEAITTE
FT                   MGKTIGEATGEVDKLAKAFHFYAEEATRIHGEVIPNDVDGFTSTVVHEPIGVIGAITPW
FT                   NYPLELVGWKLCAALAAGCTIVIKPSQYASLSPALLFGCIDAAGLPPGVANLVLGGGET
FT                   GPAVAGHPGFDKLAFTGSTATGAKIARGVPAAKPLTMELGGSCPMIVTDRADIDAAVAG
FT                   AARRGFRNAGQICIAINRIYVHETVYSEFVDRLTATVSELTVGNGMDPTVDVGPMATRP
FT                   GLDVVDQHVRDAVARGATVTTGGTRIETLAPGNFYQPTVIAGCNPDMLVMHEETFGPVV
FT                   GVMPFSDLKNAVDLANGTEAGLAAYVYTGDLAQAHDLGRLLDFGNVAVNNVDAGIMNAP
FT                   YGGRKGSGFGVEHGKAGLEGYLQYKHLRIRYGTGQ"
FT   CDS_pept        complement(511364..512323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05010"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48748"
FT                   /db_xref="GOA:C1ARS1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS1"
FT                   /protein_id="BAH48748.1"
FT                   /translation="MPDMRMVITDHNFSGEDFERAAAKDLDADFALFHATTEAEAIDAV
FT                   SGADVALVNFAPMTAEVLAAMNPNGVVVRYGIGFDNVDLDAATRLGVRVCNVPDYGADT
FT                   VADHAVTLTLMLLRKVAQFDRALAAGGWPSATELAPIRSTGETTVGLLGTGRIALAVAK
FT                   RLQPFGFDLIAHDPYANPDVAADHGITLVDLDELFRRSHALSLHAPATADTRGIVNADN
FT                   LAKMPFGSFLVNTSRGALVEQDAVLDALDSGALAGVGLDVFHPEPLAPDHRLRTHPNAV
FT                   LTPHAAFYSEQSLRDLQRLAAEEAARAIRGEPLRCPLN"
FT   CDS_pept        complement(512316..513503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48749"
FT                   /db_xref="GOA:C1ARS2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS2"
FT                   /protein_id="BAH48749.1"
FT                   /translation="MNLIDQHAAVLPTDAANATLVGRVHDDAIGGPCIVTLRSGAVVDI
FT                   TDAFPTMTDLLESPDPVKAVRSAVGTRSWPIADVLASSLTARTTAPYLLAPVDLSVLKA
FT                   AGVTFATSLLERLIEERAGGDPEQADAIRGDFERLIGSTLSSIEPGSEDAARLKEDLKS
FT                   RGQWSQYLEVGLGPDPEVFTKAPVLSAVGCGSEIGVAQVSSWNNPEPEVALAVTSTGRI
FT                   VGAMLGNDVNLRDVEGRSALLLPKAKDNNASASLGPFIRLLDESFTLDDVRAAEVRLQV
FT                   LGEDDGFVLDDVSYMREISRDISTLAEYTVGDAHQYPDGIVLYTGTLFSPTHDRGGEGM
FT                   GFTHHIGDVVRISSPKLGTLVNRVNHSEKAQRWEFGLRSFIANLHGRGLVGKVGA"
FT   CDS_pept        complement(513558..514274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05030"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48750"
FT                   /db_xref="GOA:C1ARS3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS3"
FT                   /protein_id="BAH48750.1"
FT                   /translation="MRGLNGMVVAVTGSAGGIGEAVCARLIDEGATVYALDRSTSPLGE
FT                   STIVDITDPEAMGQVVADIVDREGGVDGLVAAAGVVEDDIAAEEMTLDQWDRTLGVNLR
FT                   GLFITNQAFGRRMLGQGAGTIVNISSMSGNHVVNVPQKQCAYNASKAAVTALTKSLASE
FT                   WADRGVRVNAVSPGYVATPLLARKAHQFQQWLDATPQHRMAEPSEIAAAVAFLLSNESG
FT                   YFCGSELVADGGYSLR"
FT   CDS_pept        complement(514297..515343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05040"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48751"
FT                   /db_xref="GOA:C1ARS4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS4"
FT                   /protein_id="BAH48751.1"
FT                   /translation="MTVQRAPGRPAGAFKRIFTDYGIVIALIAIIGFFSVMRPDTFPTV
FT                   ANFGSILQANASIMFIAFGLMLPLIVGHFDLSVAAMAGFGGVLATGLMSNGTVSQWPLA
FT                   VLIVVVVAVVVGLINGFLVAYLNLNALVVTLGTQSVLFGAILWYSKGAVIYSGIPQSFK
FT                   DLGQDRPLGIPLPFIFAVAVGIVLWYVLYYRPVGRRLYAIGGSRDAARLTGIKVDQLTV
FT                   GAFVGGAVLAAVGGVLQVAQVGSAAPTSGSEFLLPAIAACFLGETSIRRGYYNVWGTMT
FT                   AVVLVAAGTTGLFMLGAQTWVQPVFNGVVLVGAILAAKVGVLKTRARKARPPATTAPPT
FT                   PTVVAAAH"
FT   CDS_pept        complement(515372..516958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05050"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48752"
FT                   /db_xref="GOA:C1ARS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS5"
FT                   /protein_id="BAH48752.1"
FT                   /translation="MVPDQETRTAMTSNDSSPTPSIEIIALSKEFGVNRVLDNVNLEFR
FT                   PGSINALLGANGSGKSTLIKLLAGYHTPTSGTIRVHGDELALPADPTVLHDAGVRFVHQ
FT                   DLGLIESMSIADNLALALGYEKRAATINWRRQRATAVADLAAVGLDDLDPRALVGALGP
FT                   VQQTLVAMARALRGLQPGRGVLVLDEPTARLPNAQVDELLTRCRLLRDQGIALIYVSHR
FT                   LDEVFAMADRVSVLRDGRLVFDDVIAATDDQHLTQIITGGATTDETADHPAPARRVVDP
FT                   GTPPKLALRGVCGTFVQDVDLDLRPGEVLAVTGLVGSGRSELGRLIFGSQAITAGEVRL
FT                   RGQQLRRISPKLSIERGIGYVPQDRKQSAIPSFTLADNLCLASLDKHMSAGLLSAESER
FT                   TVTASAIERLDVRPADPERLLGELSGGNQQKIVLGKWLELDLDVLILDEPTYGVDVGAR
FT                   KTILEAVLEQVGRRQLSVLLLDSDIDLVARYADRVLVMRRGRIATELVGAEITTERIAA
FT                   ASYAVQDLSTA"
FT   CDS_pept        complement(516962..518074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48753"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS6"
FT                   /protein_id="BAH48753.1"
FT                   /translation="MTGCSAAPSDRSAVDPAARNAAVDKAQRGAAELLDAGLHDNHWTG
FT                   PETSPPPRQGLEITIIPEQMASTGSSRPAKAIESEVKKLGWVPKISDGQGKPEVQLNAL
FT                   NTAVDEKVDAVILIFVDTTRVQSALQRALAAGVKVVTLGSLKNTPDTVPDVSFDWVRAG
FT                   ESIAQYAVWKSGGDLGMLQMRNADLYIVVNGQYKGSQSYLDAPGNCPGCDVVTQDWSLA
FT                   TFEDPTIGPAAQAVATRLANPQLNWVSCFDSCLFRVSNGLNRAGFSGKVSGAGFDCNPE
FT                   NLDIIRAGGVQKVCFADPREWLAYAAIDNINRMTNGLPAFNFTESIPVALFDKDSLSQL
FT                   APDRSAELETKGWQGNYDFRAKFEQLWGIG"
FT   CDS_pept        complement(518345..519046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05070"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48754"
FT                   /db_xref="GOA:C1ARS7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS7"
FT                   /protein_id="BAH48754.1"
FT                   /translation="MSETTRSRQRLSDAVAQTLQDEILSLTAGDRLPTEAELAERFEVS
FT                   RTVVREATRLLVQRGLVTVSPGRGMTVATVDGSVIAEQYGLLLRLSEGTFEQLMELRLV
FT                   LEVEMAALAAARHNDGHLAELTRLNERLRSADPSSPEFLDADLAFHEQIAQASGNPFFP
FT                   LVMRPVNDYLSDSYSAGAGYPSEAGHTVQEHLEIAEAIAVGDPARARFAAENHLRRIVR
FT                   NRASLTSRKRK"
FT   CDS_pept        520024..521454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05080"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48755"
FT                   /db_xref="GOA:C1ARS8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS8"
FT                   /protein_id="BAH48755.1"
FT                   /translation="MDMLLAGEWRGAADGRTETVQSPFDGHAVDTVPVATAADAAAALD
FT                   RAEIGARVLRSMPAHERVAVLMRAADLADQRAEDIAQTISAETGKPISEARGEAGRSGS
FT                   IIRLAAFEGSQLYGSTLPLDANPGTGLEKVGFTLRQPCGIVVAITPFNYPALLVLHKIA
FT                   PALAAGNAVVLKPARTTPLTALKLAECFVDAGLAPESLSVLTGPGAALGDILVTDPRVR
FT                   KVSFTGSTATGTRLASIAGIKKLSLELGASCPVIVLPDADIELAASAVAAGGYINAGQV
FT                   CISVQRVIVDSRVEADFLDALVPKVEDIVMGDPANADTKLGSLISETEAIRVHSAIAEA
FT                   ALAGAKVLTGGDREGAVVSPTVVAGVDPTSPFSRDELFGPAVAVSSAPDIESAIALAND
FT                   NDYGLGAGIFTSDISATTRAMRQIDAGNIHINWTPLWRADLMPYGGLKGSGIGKEGVRS
FT                   AVEEMTEEKTVILHGRPW"
FT   CDS_pept        521502..523454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05090"
FT                   /product="putative
FT                   3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase"
FT                   /EC_number="3.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48756"
FT                   /db_xref="GOA:C1ARS9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARS9"
FT                   /protein_id="BAH48756.1"
FT                   /translation="MTPLSTHKTIRLTTAQAVVKYLAAQYSVADGERRRLIPAALGIFG
FT                   HGNVAGLGQALDELSDDLPFIQGRHEQYLAHIATAYAKASRRRATLAVTASIGPGALNL
FT                   VTAAGLATINRLPLLLLPGDTYATRHQGPVLQQLEHASEADLTVNDTFRPVAKFFDRIT
FT                   RPEQLLTALPQAMRVLTSPTDTGAVVLSLPQDVQSHAFDFPIEFFEPRDWRIRRPLPDP
FT                   AEVEAVAAQIREASRPVIIAGGGVHYSDATAALEALAEQAGIPVVESFGGKGAVSRDEW
FT                   WQVGGIGLEGNFASNKLVKQADLVLSVGTRLTDFVTGSQSIFENENVRFAALNVVDADT
FT                   RKQGATGILADARLGLEALTTALAGHTTSDTWQQTVRSAKADWAPIRAAALDPDTAFEP
FT                   AQHPHAPVTGAVLTQPQLIGLMQEHARSGDTIIAAAGGPPGDLQKVWDATGNRNVHLEF
FT                   GFSCMGYEIPAAMGVRLAEGNRGQRIVTFIGDGTYLMAPTELVTAAQEGLDVTIVVSEN
FT                   HGYQVIHRLQMNRNGREFGNEFRYRTDGDIIADGGDKARLEGEYLKVDLRQIAEGLGAT
FT                   AIRATTAADVRAALIETREVSGPVVIVVPTVPHVDLPGGDVWWDVAPAEVSNQEWVQTL
FT                   RADYDNAVGRQRWFG"
FT   CDS_pept        523484..524272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05100"
FT                   /product="putative 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48757"
FT                   /db_xref="GOA:C1ART0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART0"
FT                   /protein_id="BAH48757.1"
FT                   /translation="MNNTTPLDGGTLRRRLADGETTVGTFVGMASSTAAEVCAAAGADW
FT                   ILLDLEHGSGSEDALRDGILAAGAYGVPTVVRVESGERIRIGRVLDQGAAGVMVPRLDK
FT                   PDQVADAITHLAYPPHGDRGVATYNRSCRWGMDRSVLLAEEQAALGVIQIETLAALDAV
FT                   DEIAAQAGVDVLFVGPLDLSFALGVPLQFDSPVFTAALGRVLEAAHQHGKTAGILAANA
FT                   ALAAGYVELGFRFVAVGSDSTLLAAALTDAFATARPEQTT"
FT   CDS_pept        524354..525565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05110"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48758"
FT                   /db_xref="GOA:C1ART1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART1"
FT                   /protein_id="BAH48758.1"
FT                   /translation="MSTPRTVGVGLISVGWMGQLHARAYRDVPIVYPELGVTPKLVIAA
FT                   DTADSRVEFAKNVLGFAEGTTDYREVLAHPDVDVVSICAPNFLHAEIGIAAAKAGKHFW
FT                   IEKPVGRSYAETSAIETAATEAGVITSIGYNYRHAPAVEHARTLIAEGSLGRITNVRAT
FT                   FFSGYANEPNGALSWRFDRELAGSGVLADLFSHATDLCQYVVGPIAEINALTSTVYTER
FT                   PKLEMGSGTHFAVIENGEMGPVENEDYAAALVRFGAQGPGSGAVGTIEASRVIVGPECG
FT                   YQIEVYGTEGSVKWDFERMNELKVCLGRTNPEQGYLTVNASPKHGDYSRFQPGPGNALG
FT                   FDDLKTIEAKKFLLAVTGGPQKNSNVHDAASAAAIVTAAETSAATGQWQKLDDIAGTTA
FT                   SRTV"
FT   CDS_pept        525609..526541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05120"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48759"
FT                   /db_xref="GOA:C1ART2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART2"
FT                   /protein_id="BAH48759.1"
FT                   /translation="MSTSISTQLFVGLGPLNRELVDPYLAGHQQLALDPTEEQLAVAEA
FT                   AIVRAAFTVDAALLDRMPALKVLARTGVGTDLVDVAEAHRRGIPVVITPGSNTVSVAEG
FT                   VFAHLLSLVKRLPTLTTLVRSGRWGERGGVTVGDLEGATLGIVGFGRIGRKVAQIAEAF
FT                   DLNVRAYDPYAEIPDRYRCASVDEVLTSSDFVTLHAPLTAENHHLINEVRLAAMRPGAI
FT                   LVNCSRGALIDLDAAHAALRAGQLAGLGLDVFDPEPPQYHPVFDHANTVLSPHLMGFTD
FT                   RAMALTIRAAVEGAVAVLDGRAPAAVAAP"
FT   CDS_pept        526538..527530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idh"
FT                   /locus_tag="ROP_05130"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48760"
FT                   /db_xref="GOA:C1ART3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART3"
FT                   /protein_id="BAH48760.1"
FT                   /translation="MTVRVGVIGVGVMGADHARTLHRSVSGAQVTVVTDFDAARADTLA
FT                   HELSARTVATATELIAAPDVDAVVIASHDSAHAEQVAACLDQRKPVLCEKPLAPSVDEC
FT                   RDLVTKEDALGLADPLVSVGFMRRFHHPYVALADEVRSGSIGTPLLVRNSHRNVSAYPG
FT                   GDSASTITNSAIHEIDITSWLLGSPIVEVGWHAPRSTSYDSSRQDPQVLMLRTADGALT
FT                   VVDVFVNARYGYDVRCEVVGETGAVSLAAPHTLSIDSSLRSASMYPKDWRPLFADAYRR
FT                   QLQAWIDALIAEVASPLATARDGLRATQVAAALIDSMNNDGATTKVDYH"
FT   CDS_pept        527588..530992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyc"
FT                   /locus_tag="ROP_05140"
FT                   /product="pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48761"
FT                   /db_xref="GOA:C1ART4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART4"
FT                   /protein_id="BAH48761.1"
FT                   /translation="MTFSKVLVANRGEIAIRAFRAAYELGAGTVAVFPYEDRNSIHRLK
FT                   ADESYQIGEEGHPVRAYLSVDEIVSAAKQAGADAIYPGYGFLSENPDLAAACAEAGITF
FT                   VGPSAEVLELTGNKARAIAAAKAAGLPVLASSEPSADVDELLAAAETMQFPLFVKAVAG
FT                   GGGRGMRRVAERAQLKESIEAAAREAESAFGDPTVFLEQAVVDPRHIEVQILADGQGNV
FT                   IHLFERDCSLQRRHQKVIELAPAPNLPEELRAKICADAVAFAKEINYACAGTVEFLLDT
FT                   RGNHVFIEMNPRIQVEHTVTEEVTDVDLVQSQLRIASGETLADLGLSQDKITLRGAALQ
FT                   CRITTEDPANGFRPDTGRITAYRTPGGAGIRLDGGATLGAEVGAYFDSMLVKLTCRGRD
FT                   FETAVARARRAVTEFRIRGVSTNIPFLQAVLDDPDFKAGRATTSFIEERPELLTLRSSA
FT                   DRGTKILSYLADVTVNKPHGERPSAVYPRDKLPQIDLSTPPPDGSRQKLLALGPEGFAK
FT                   ALREQKALAVTETTFRDAHQSLLATRVRTSGLLDVAGHVARLTPELLSIEAWGGATYDV
FT                   ALRFLHEDPWYRLSALREAVPNICLQMLLRGRNTVGYTPYPEKVTRAFVEEATNSGIDI
FT                   FRIFDALNNVDQMRPAIDAVRETGTSVAEVALSYTGDLSNPHEKLYTLDYYLRLAEEIV
FT                   EAGAHIIAIKDMAGLLRAPAATTLVTALRKNFDLPVHVHTHDTPGGQLATYLAAWQAGA
FT                   DAVDGASAAMAGTTSQPALSAIVAAAAHSEHDTGLDLQAVCDLEPYWEALRKVYAPFES
FT                   GLPAPTGRVYTHEIPGGQLSNLRTQAVALGLGDKFEEVEAKYAAADRMLGRLVKVTPSS
FT                   KVVGDLALHLVGSGASTEEFKDNPAKFDLPDSVVGFLRGELGTPPGGWPEPFRTRALEG
FT                   RGEAKPEVPLSAEDEKALAGTSAERRATLNRLLFPGPTKEFLEHRDKYGDTSQLSANQF
FT                   FYGLRRGDEHRVRLAQGVELLIGLEAISEPDERGYRTVMAILNGQLRPVSVRDRSISSE
FT                   IPAAEKADKNNPGHVPAPFAGVVTLAVTEGQHVAAGDTIATIEAMKMEAAITAPRGGTV
FT                   TRLAIGSVQQVEGGDLLAVVATTDAAE"
FT   CDS_pept        531041..531937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48762"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART5"
FT                   /protein_id="BAH48762.1"
FT                   /translation="MTTTQTPALLAACWTSAGDVMPARGSDLSPVPIRERIEAVARTGY
FT                   TGFGLTRPDLVAARETVGLGEVAKMLADNGITQVQLEWITNWWTTGDARAASDEVRRDL
FT                   FEAAPVLGVDNIKVGADDDGVPVSRDLLVEQFDALASDGAGVGVKIAFENTPFSHHIKT
FT                   TEQAAQFVKDVDNPNGGLILDIWHAFRGGTDYDTLPQLVPARFVFGVELDDGWSTVRGT
FT                   DLEDTFDNRVPCGEGEFDVPKFINAVRRIGFDGPWGIEHMSEEFRQLPVADALARARTG
FT                   ALQCFARADEQAAGKRS"
FT   CDS_pept        532336..533148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05160"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48763"
FT                   /db_xref="GOA:C1ART6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART6"
FT                   /protein_id="BAH48763.1"
FT                   /translation="MPEGRKIERNTVATLLNEKVVLVSGGTQGVGAGVVRAAVREGARV
FT                   AFTGRRAEAGKALAAELEATGAQVRFFQADLADPGEARDSVTRTIEEFGRIDALCNAAG
FT                   LTTRGTLLDTTPELFDQHIAVNLRAPFFTMQGAVADMVERKAPGTIVNIISIAEHGGQS
FT                   YLAPYVAAKAGLAGLTRNAAYAHRFDRIRINGLDIGWTETEGETATQQRFHGADDNWAA
FT                   EAAAKVPMGKLGQVDEIADMVVFLLSDRSGVVTGSVINWDQTIIGGHD"
FT   CDS_pept        533148..534155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idh"
FT                   /locus_tag="ROP_05170"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48764"
FT                   /db_xref="GOA:C1ART7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART7"
FT                   /protein_id="BAH48764.1"
FT                   /translation="MGSTIGVIGLGRIGAFHADTLAQLPGVDGLVVTDERPDVTASVAA
FT                   KFGARAVENAAAVFAAGVDGVVIAAATPAHAPLILAAVDAGIPVFCEKPVAFTADESYQ
FT                   VVERLKTSTVPVQIGYNRRFDPAFAAARAAVASGELGWLHTVRSTTLDPAPPPADYVAA
FT                   SGGIFRDCSVHDFDIVRWVVGHEVTEVYAAGSNQGDSIFADCGDVDTATTTLTFENGTL
FT                   GVVSNTRYNPRGYDCRLEVHGSQDSVVAGWDASAPVRNLEAGITFPDGPPHRFFMDRFT
FT                   AAYRAELGAFLDVIAGTAPSRCTAQDALEVAWIAEAAALSLSQHRPVQMSEVRR"
FT   CDS_pept        534152..535015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05180"
FT                   /product="putative inositol catabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48765"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART8"
FT                   /protein_id="BAH48765.1"
FT                   /translation="MIRIAGAPISWGVCEVPGWGHQLGSERVLTEMRDAGLEAAEIGPE
FT                   GFLPADPQELAATLASYDLEAVGGFTPVLLHDPDHDPVPDITGALAAFTAAGAEVLVLA
FT                   AITGTDGYDSRPDLDDAGWKTLLSNLDRLHDVAADQGIRAVLHPHVGTMIEKNIEVERV
FT                   LDGSSIPLCLDTGHLLIGGTDPLELARAAADRITHTHLKDVDAEFAARVQAGELTYTDA
FT                   VAQGMYTPLGTGDVDVAGVVRHLVASGFDGWFTLEQDTILTGEPEGEGPVADVKTSAAF
FT                   LRSLQL"
FT   CDS_pept        535012..535992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05190"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48766"
FT                   /db_xref="GOA:C1ART9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ART9"
FT                   /protein_id="BAH48766.1"
FT                   /translation="MTPLRIGVLGASRIAELAIVKPAQILGHRLVAVAARDRGRAETFA
FT                   QTYGVERVLDSYEALIADPEVDVVYNPLANAFHAPWNRKAIEAGKAVLTEKPFARNAAE
FT                   AELVRRLARERDVPIMEGFHYLFHPIIRRIFELLADGTLGDLQRVEVVMRMPEPKPDDP
FT                   RWSLDLAGGAVMDIGCYGLHVHRQLGRFAGGEPAVVTARAVERSPGVDEACDIDLVFPS
FT                   GATGSSINSMTSDRFEMTLRLVGDRGEAFAYDYPLQSGDDRITITTDTGTVVEHLGTRS
FT                   TYTYQLDAFAQHLADGTAFPIDVDDAVTTMELVDSVYRAAGLPLR"
FT   CDS_pept        536146..537174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05200"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48767"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU0"
FT                   /protein_id="BAH48767.1"
FT                   /translation="MDTHNGPNASVPRKLPSRATALALSVAAAVLLAGCSSTGGKPEST
FT                   GGGMASGTADTPRATIAMITHEVPGDTFWDLIRKGAETAAAKDNIELRYSADPEAPNQA
FT                   NLVQSAIDSRVDGIAVTLAKPDAMAPAVRAAVDAGTPVVAFNGGMDQYKSLGVPQYFGQ
FT                   DEKLAGISAGQRLTADGAKKALCIIQEQGQVALETRCAGVIEGFKGQTEILNVNSKDMP
FT                   SVEATITAKLQQDPSIDHVVALGAPIALTAVQSKANANSSATIVTFDTNAALVDAIKAG
FT                   DVQWAIDQQPFLQGYLAVDSLWLYLNNRNTIGGGMPTLTGPAFIDQSNIDSIAEYAQAG
FT                   TR"
FT   CDS_pept        537229..538287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48768"
FT                   /db_xref="GOA:C1ARU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU1"
FT                   /protein_id="BAH48768.1"
FT                   /translation="MSTQQDLDLSSHKVVHDERVKEQKRLQRLLLRPEIGSLFGAIAIF
FT                   VFFMIVAPPFRSPEALATVLYASSTIGIMACAVALLMIGGEFDLSAGVAVTTSSLAASM
FT                   IAYNLHLNLWAGAALALVVSLAVGFFNGYLVMKTKIPSFLITLSSFLMLTGINLAVTKL
FT                   ITGQVATPSVSDMQGFDSAKKVFASSFTIAGVSVRITVLWWLLFTAVATWVLFKTRIGN
FT                   WIFAVGGNQDSARAIGVPVTKVKIGLFMTVGFAAWFVGMHLLFSFNTVQSGQGIGNEFL
FT                   YIIAAVIGGCLLTGGYGTAIGAAIGAFIFGMTNQGIVYAGWNPDWFKFFLGAMLLFAVI
FT                   ANNAFRNYAAKR"
FT   CDS_pept        538293..539108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48769"
FT                   /db_xref="GOA:C1ARU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU2"
FT                   /protein_id="BAH48769.1"
FT                   /translation="MSTIEQMPVDTEPGGGGKIPLIELKHVGKQYGNIIALEDINLRVR
FT                   AGEVTGVLGDNGAGKSTLIKIIAGLHQQSSGELLVDGEALTFDSPKEALSKGIATVYQD
FT                   LAVVSLMPVWRNFFLGQELRSGPMRSLDSNGMRATTQEELHKMGIDLPDVDAPIGSLSG
FT                   GQRQCVAIARAIFFGARVLILDEPTAALGVKQSGMVLRYISAAKEQGFGVVFITHNPHH
FT                   AYMVGDHFVLLNRGRQKLDCTYDEISLEELTQQMAGGDELEALTHELRR"
FT   CDS_pept        complement(539191..540225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05230"
FT                   /product="putative LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48770"
FT                   /db_xref="GOA:C1ARU3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU3"
FT                   /protein_id="BAH48770.1"
FT                   /translation="MAHSRYKVREIAQQAGLSEATVDRVLHNRAGVREGTRAEVAQAII
FT                   DLDKQRSQLRLAGRKYLFDVVMQAPTRFSGAFQEAVEAELPALAPAVVRTRFHFRETGS
FT                   VPAMVEVLDKLAKRPSHGVIVKAPDTTEVADAIDRLTEEGIPVVTYATDVPSSNRVGYV
FT                   GIENRAAGETAAYLLEQWLRDNPASVLVTLSSNAFRGEEEREMGFRGALRRSGSVGGMG
FT                   SQRTLIDISESEGLDSTVEQLVLDALERNPGIEAVYSIGGGNMATVRAFEKLGRSYRVF
FT                   IAHDLDSDNRQLLREKKISAVLEHDLRFDANLACRMLIQSRGGLSGVTTVMSPIRIITP
FT                   YNMP"
FT   CDS_pept        540651..542087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="ROP_05240"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48771"
FT                   /db_xref="GOA:C1ARU4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU4"
FT                   /protein_id="BAH48771.1"
FT                   /translation="MTTPAQQNPERHKVVVIGSGFGGLFATQGLHRADVDVTIIDRTTT
FT                   HLFQPLLYQVATGILSEGEIAPSTRTVLKDQANARVLLGSVTDIDLAAQTVTSQCDDTT
FT                   TVTRYDSLIVSAGAQQSYFGNDHFAEHAPGLKTIDDALEARGRILHAFEKAELIDDPVE
FT                   RARQLTFVVVGAGPTGVELAGQIAELAHRTLDGTFRSISPTAARVVLLDAAPQVLPPFG
FT                   AKLGTAATRTLQSKGVEVELGAIVTDVDEHGLTVKDADGHTRRIEAACKVWSAGVSASP
FT                   LAKQLAEQTGAPLDRAGRISVGADLTLPGQPNVFVIGDMMSRDQLPGVAQTAIQGGRYA
FT                   ARHIAREADGTSLPQDRAPFRYRDKGSMATVCRFSAVAQVGRFEFSGFIAWLLWLAVHL
FT                   VYIVGFRSRIATLLSWTSSFLGSGRGQLTTSEQQIRARSAVTSRQGQSERPSPALMPDE
FT                   LGSPSHDPVAHEAASAIRVS"
FT   CDS_pept        542120..542404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48772"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU5"
FT                   /protein_id="BAH48772.1"
FT                   /translation="MSERIGAELIDFGLRWAPFGGPCDDDLLVEFGMTSGTYYNRLARA
FT                   LRMRPAVQGGEAAHRSLLDMCYRQEPRSGGFEASTSDPPTPTTSTSPSK"
FT   CDS_pept        542428..543921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="ROP_05260"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48773"
FT                   /db_xref="GOA:C1ARU6"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU6"
FT                   /protein_id="BAH48773.1"
FT                   /translation="MSNVITHWLDGKSFTGTSGNTAPVTNPATGEVTGQVALASVEDSR
FT                   AVIDAAAAAFPAWRDTSLAKRTQIIFKFRELLNERKGELAEIITAEHGKVVSDALGEVS
FT                   RGQEVVEFACGIAHLLKGGMTENASTNVDVHSIRQPVGPVGIISPFNFPAMVPMWFFPV
FT                   AIAAGNTVVLKPSEKDPTAAIWMAELWAEAGLPAGVFNVLQGDKTAVDELLTNPAIKAI
FT                   SFVGSTPIAQYVYATGTAHGKRVQALGGAKNHAIVLPDADLDLAADAMVNAGFGSAGER
FT                   CMAISALVAVGDIADELVAKIKERTDTLKIGDGTKDSDMGPLVTKVHRDKVASYIDAGE
FT                   HDGASIVVDGRTVQANGGKDGFWLGPTLIDHVTTDMSVYTDEIFGPVLSVIRVDSYDEA
FT                   LELVNSSQFGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFGGWKNSLFG
FT                   DTHAHGAEGVHFFTRGKVVTTRWLDPSHGGLNLGFPQNN"
FT   CDS_pept        544103..545518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05270"
FT                   /product="putative myo-inositol transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48774"
FT                   /db_xref="GOA:C1ARU7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU7"
FT                   /protein_id="BAH48774.1"
FT                   /translation="MLTDSGRATAATSSSTRSNRPSKRLGLIAFIATFGGLLFGYDTGV
FT                   INGALEPLKEDLGLTALTEGFVVSILIFGAAFGALIGGRLSDRYGRRHNILLLSVVFMT
FT                   GTLGCVLAPTWEVLAAFRFVLGLAVGGASATVPVYLAEMSPAERRGSIVSRNEFMIVSG
FT                   QFAAFVINAVIFNIWGEHDSVWRYMLLVAVAPAIVLLLGMLRMPESPRWLISQGRHDDA
FT                   LMVLQQVRTPEAAQAEMAEVEALAEEEKLTQVGGPIDLSVKWIRRLMLIGIGLGVFQQF
FT                   TGINSVMYYGTQLLADAGFSSSAAIVANTLNGLVSVLGITIALKVMNKVNRRTMLFVGF
FT                   ALITIFHLLIGLSAVLLPDGTVKAYCILVFVVLFVFSMQGTIGPLAWLMLAEIFPLKIR
FT                   SFAIGVCIFVLWIANALVALFFPPVVAAIGIAMTFFIFAGLGLLALIFTTQVPETRGRS
FT                   LEELEDDFREKYS"
FT   CDS_pept        545546..545902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48775"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU8"
FT                   /protein_id="BAH48775.1"
FT                   /translation="MTVLVAVTDTPEGAQALIAGKEEAERLGTTLLVLNLSLSEFPPTE
FT                   LAIADEADILDRSGRQARDPAVTVLDLIQERPDIERLVIGVKRRSRVGKALLGSISQRL
FT                   ILHSPVPVLAVKNE"
FT   CDS_pept        complement(546153..546680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48776"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARU9"
FT                   /protein_id="BAH48776.1"
FT                   /translation="MRKSLLIVALIASWSVAGAVPAGAAPMQPSWSGEYSLKRFAATKT
FT                   GTSLAARQWEPDFADTYRFETSCTDDSCVATVTDGPTPANPTLPLPPRYIWDGTSWVHT
FT                   YDWEWDCYQGEGVPKVWAPAHSVAYYTPQPDGTLTGSWRTDIDGGPCEGSVIMDVAAYP
FT                   VEPPPGPFGSSW"
FT   CDS_pept        546965..547594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48777"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV0"
FT                   /protein_id="BAH48777.1"
FT                   /translation="MSTSETWTADFANRAARRAAEPDPDWSRGCRRHPAVARLGCLRRC
FT                   YAPPVSRPWVGTGPTPYLCICVCREALRLELMVVTVAEVVALRYYRALADGGGDALPAE
FT                   VSNRILDDERHHVPFQSRRLSTGFAHTPAPARAAIGRIWRALAFAVAMVVAWNHGPALR
FT                   VLGVTRRTFVSDTKRLFDNAAAEAMHTQRNRPPHACQSAVLRGSGP"
FT   CDS_pept        548077..549159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48778"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV1"
FT                   /protein_id="BAH48778.1"
FT                   /translation="MLDDAATGRFAVVPVVARSVGAGFGVAWIEREVSVVGVRVETVGE
FT                   GEPIGLDDVDTRVRWLLDLISGAEAQMLSRLWQPATFDVLAAGVDRQGRKLATQGHVAA
FT                   ARLGWTPHYPDGVYVPSRVTRVVTAQVMASLRTLAFRDTAIASLSERFDPATGRIAPPT
FT                   AAADWMPPGFARGVRRQLIARARRDGDAVPSGRLRITDMQAPPQTSAMARLSAADRQLA
FT                   QLTVAERELVLTVKLPTTPAPTGRAQWRSVRLTAAIPAHLHGRAITDWHLPTLVLDKKG
FT                   LLLRCAATELVPSGDLGSATVAVGWIGPRPRSVPPPSPPTARRGWSRTFGVSRTTTAAS
FT                   GPNSPACRPKASCCTARPPG"
FT   CDS_pept        549132..549869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48779"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV2"
FT                   /protein_id="BAH48779.1"
FT                   /translation="MLHRKAARLTQLATNAEPEARTQLEAKIAVLNEHRTAAGAKRVKI
FT                   NRELGFHFARQTADYATAAGATVIAVEDLTTLETRGHGRVNNNRAAQSARRKAITALAH
FT                   TAASVGITVVSVPARGSSAQCPGCDAPLARPDGYHTAWCSGCRVGGNRDHIAGVNLAKR
FT                   ALLGKGKVTRRRGQMPAVRVAEHAPVRRSRDKTGPTPRRPRHRRVRRSLPTVTPRAGVT
FT                   PKQICSCTSSVGVGHGPTRTTSR"
FT   CDS_pept        550113..550691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48780"
FT                   /db_xref="GOA:C1ARV3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV3"
FT                   /protein_id="BAH48780.1"
FT                   /translation="MTATYTFDVFSSLDGYGGVSGGDWGGYWGKQGPELLDHRLALYDS
FT                   EQRMIFGANTYRAFAQMLASSTEESEVRDPWVTRMRSLPATVVSTTLEGPLDWPDATIV
FT                   SGDAVDIVARLKQESDVPLRSHGSLSMNRALMAAGLVDRLQVTLFPVITGKTGDDPIFQ
FT                   GAADFDLELLENRTLDGDIQELIYRPTLH"
FT   CDS_pept        551055..551804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05340"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48781"
FT                   /db_xref="GOA:C1ARV4"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV4"
FT                   /protein_id="BAH48781.1"
FT                   /translation="MASDIFGVSGRAMTDALIAGERDPKVLAQMARARMRAKIGLLEEA
FT                   FNGHFDEHHRFLLARMLGRIDAIDVDIAAVDDQIEAHLAPFTAAAERLDEIPGIGPVAA
FT                   ADIIAEVGLDMSRFPTAGHLCSWAKFSPGINSSAGKSKGNGSTGHGNRYLARALGEAAV
FT                   VVGRTDTFLAARYRRIARRRGKKRAIVAVGRSILVIVWHLLQNSDARFRDLGPEHFTRH
FT                   INPDTKKRNHIRQLEALGYTVTLAPAA"
FT   CDS_pept        552196..552636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48782"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV5"
FT                   /protein_id="BAH48782.1"
FT                   /translation="MTFKRMDHVSVIVDDLESAIAFFVELGMEQEGGAQIEGPWVDRVN
FT                   GLDDVRVDIPMMRTPDGHGRLELTKFHNPTAISAEPENAMGNTLGLRSVMFAVDDIDAT
FT                   VAGLRARGAELVGEVAQYQDSYRLCYLRGPAGIIVALAEELG"
FT   CDS_pept        552720..553472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48783"
FT                   /db_xref="GOA:C1ARV6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV6"
FT                   /protein_id="BAH48783.1"
FT                   /translation="MADPMHFEAHAEIYGEARPPYPPALWDYLHGLGVLERGRRALDIG
FT                   AGTGQATGPLLAAGLDVTAVEPGPRLAARLRRAHPDAVVINERAEDVELPDSGFDIAIA
FT                   ATSIHWIDLDIVLPKIHRALTPDGKFLVWRNVFGDPETRTPFRERVARIVQDRGASPRV
FT                   GPDPDDVAALSEELTRSSLFSVDVVRTFRWNIELNDRQVFRLFSTFSDWTSEEADRAAA
FT                   AVRELGGTVVEHYTTWLVALTPTPATTR"
FT   CDS_pept        complement(553572..554459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05370"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48784"
FT                   /db_xref="GOA:C1ARV7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV7"
FT                   /protein_id="BAH48784.1"
FT                   /translation="MAAWKLAPILTAGNTVVIKPSEQTPLTTLEFAELVGDLLPAGVLN
FT                   VVTGLGATVGAGLTEHPDLDMIALTGSVGSGKAVARGAAESLERVHLELGGKAPVVIFA
FT                   DADLDDAAVSLRAASYWNSGQECGAACRILVHESVADAFVDKLVAQVATLVVGDVEIGP
FT                   LVSKAHYDRVAGYLERAAQQGITAAIGGSGLDGPGYFVAPTVLVGVPDGAECAREEIFG
FT                   PVVTVETFTDEDDAIRRANDVPFGLSASVWTENAPSQPRCRRPHRRRNRVGELPSRPRE
FT                   RGPLGRLQRIRLRA"
FT   CDS_pept        complement(554509..554940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48785"
FT                   /db_xref="GOA:C1ARV8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV8"
FT                   /protein_id="BAH48785.1"
FT                   /translation="MIVSDDLPPSQHYIGGEFVAGEAGSFTDIVDPATETVIARIPEGT
FT                   TADVDRAVAAAVAAKPDWARLVPRQRSEILHRIADRLEQNSEILARIESANTGKPFEVS
FT                   NDDVAGTVDTFRFMAGAFTCHHLPLRGRLRREPPLAHPP"
FT   CDS_pept        complement(555099..556592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05390"
FT                   /product="sodium/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48786"
FT                   /db_xref="GOA:C1ARV9"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARV9"
FT                   /protein_id="BAH48786.1"
FT                   /translation="MPEIDWAELLTTLADGIWGPMAYVVLGLGLAYTIAMKGIQFRRIP
FT                   DMIRQLREHSEGEGGLSSFQALVLALGSRVGVGSIAGVATAVGGGGPGALLWMAVTGLV
FT                   GCTVGYAEATLAQVFKRQVEDEDRQKAGEDIGGMPYYIKYGLKLPKVAALIAFLGLVGY
FT                   GFMFPGFQVSTIASSAQLAFGLPSWVPAVFVTALIALVIFGGTTRIVKVTQTLVPTLAI
FT                   GYLVLALAVIIANLESVPDAIKLIVNSAFGIDPVLGGIAGAAVAWGVRRAVFASANGIG
FT                   EATFAAAAARTSHPGKQGLVQTFSIYIDVLLICMATGLMMVVSGQYNVSDGSGGHLVEN
FT                   LPGVEAGPNWVQKSIDTLAPGWGAGFIAVAVFLFGFTCLLLYYYVANSNLLFLLNGRKG
FT                   PVPRLILKLGTLAIVFVGSVVNAGIVWAIGDIGLGMIAWINLACLVLLFPLVYKVYRDF
FT                   EQQKKRGLDPTFVPKSLGIEGADFWEESSAATVTADRKD"
FT   CDS_pept        complement(556596..557489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05400"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48787"
FT                   /db_xref="GOA:C1ARW0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR005264"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW0"
FT                   /protein_id="BAH48787.1"
FT                   /translation="MSKQLSGVLTALTTPFDADEQIDVKKLQVVVDRSIKAGVDGVVAA
FT                   GSTGEVGALSSDERLRLVDTVIEHADGRVPVIAQTGATTTAEAIRLSRAAEKSGADVLM
FT                   LITPFYEPLSTEETVTYIKDVASSVELPIMLYNIPAVTGVNLNPGTVRSLAEEVDNIRY
FT                   IKDSSANWEQALQLIHHHSDVIGTFIGWDSYIYSALVEGAAGVMAGAANVVPDEIVAVN
FT                   RLIADGDLHGALGKWRDLYPVIDSMISVPFISAVKAGLALQGEPVGAPRRPTAELPAEQ
FT                   VERIGRALKKLADRSG"
FT   CDS_pept        complement(557535..558929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05410"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48788"
FT                   /db_xref="GOA:C1ARW1"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW1"
FT                   /protein_id="BAH48788.1"
FT                   /translation="MRDVVVVGAGLAGLSAGWRLRHWDTLVLESDERVGGRIRSERRGS
FT                   YWLNWGGHVFAGPGSSTEALLNEAGVMSVDIPGSLQALSMNGKFLRKGHIATYPFRIPM
FT                   SLSARVATMRAGMKVVAGVGKYTGVVRKRAGESGAMRQQRIYDFANDESFLDFVGDLPE
FT                   DAAALFKTTVTRSAGNMDQISAGAGIGYFSLVLGFGQGLSRGIVGGPSTLTEALAASLG
FT                   DRVQLGAAVHEVVHKKDSVIVRYRQDGRDHEVEARTVVLATTADVSHRVGVDLPDDLRD
FT                   ALSQVKYGPHVSSAFLTDEKTKQPWDDIYAIAAPKRSFAIALNQASIVRGSESVRQPGG
FT                   SFMTFSPAALGQALLDKSDEEVVQTHLADLEQILGPGFSDTVVEAKAARWKNASPYSFP
FT                   GRAKLQPTLTRGAGRVFLAGDYLGTLYTETSITSGFSAAQEVTSVLATHRQTRHSSPVV
FT                   AQAASA"
FT   CDS_pept        complement(559359..559751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48789"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW2"
FT                   /protein_id="BAH48789.1"
FT                   /translation="MRFVAAVSDGFGKARIASLGTADAPAKRGASRRVGGSAGLAAMVE
FT                   PGALQIQERRALGICSLLPAGDVVPNGSRTSVKFRRSAVGVLVVEKMGGRAIAPNQQLF
FT                   IGETRRRSFVELRDRDVLHELQRDTQ"
FT   CDS_pept        complement(559726..560559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48790"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW3"
FT                   /protein_id="BAH48790.1"
FT                   /translation="MGTSRLGDVELTYQLRERGERVVLVHASAFASWYDPLIEQLTAYS
FT                   TLRYRRRLRKSDSGVYRALTVAEDAGTCVSVMDHVGWDAAHIVGHSYGALVALQLATEN
FT                   PGRVGSVALLEPAIRGVASSEQIIVALQPVIAAYRSGDKAAAVDGFLRHVCGDGYRGVL
FT                   DRMVPHAFDDALEEADLFFQSELPAVQQWSFGAAESERITQPVLNVLGAESAPRFVEGS
FT                   ELLQSWFPRAERLSVPKAGHLLMVQNPTAVARGLKDFFSRHPIDQVGSALRRRSL"
FT   CDS_pept        complement(560631..561458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05440"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48791"
FT                   /db_xref="GOA:C1ARW4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW4"
FT                   /protein_id="BAH48791.1"
FT                   /translation="MTIADFALRTALQQRYWDPALTEPAQWNPVLEALHSHRSVRRYLP
FT                   DPLTDETLDVLVSAAQSAATSSNLQAWSVVAVRDPDRKARLAALAGDQAHIVEAPVLLV
FT                   WLADFARVRQLAGDRGAPIEGADFLESSYLGFIDAALAAQNAVTAAESLGLGTVFIGAI
FT                   RNKPEEVAAELGLPPHVFAVFGLVVGQPHPDADAQIKPRLPRQAVLHHETYDLPAQRDH
FT                   IDAYEGRIAAFYGAQELEHSWTARVLDRLASAARLNGRDRLKESLIRLGFPLR"
FT   CDS_pept        561638..562378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05450"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48792"
FT                   /db_xref="GOA:C1ARW5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW5"
FT                   /protein_id="BAH48792.1"
FT                   /translation="MTERVIVVTGAGSGIGRSIATGLLDAGHRVVLTGRTREALDQTAH
FT                   GNDHALVVPADVTSPQSVHNLFAVVAERFGRLDVLVNNAGTFGPSGAVDEIEPQDWDQT
FT                   VATNLTGVFLCSREAVRMMKSQTPRGGRIINNGSLSAHTPRPASVAYTATKHAVSGLTK
FT                   SIALDGRDHDICCSQIDIGNAETAMTAGIGQSARQADGSMRAEPTFDPRYVADAVTRLV
FT                   ELPLDVTVPTMTIMAARMPFVGRG"
FT   CDS_pept        complement(562381..563634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05460"
FT                   /product="RNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.49"
FT                   /note="protein synonym:reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48793"
FT                   /db_xref="GOA:C1ARW6"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW6"
FT                   /protein_id="BAH48793.1"
FT                   /translation="MTARPALSPEIARRLAAVATDGAWTRAGLVLRFEETGVPDAGRIA
FT                   IRLHDLMPTPPIGGIDSVHRLLSELPLIAPPEPIVDEVSGNDWKFDVPQWSRTAAVAEA
FT                   VGLTPTELDWFADSGGWLRTKAPPLQHYRYRIRSDNRLLEAPKERLREVQRRVLRTVLD
FT                   RVPPHVAAHGFVRGRSVHTFAAPHAGHEVVLRVDLRAFFPSVSRTRVQAVFDALGYPAR
FT                   VSRVLAGLCTTSTPPGVLAQLPFDTASRLRGAHLPQGAPTSPALANLVAHRLDRRLTGL
FT                   ARTHRVAYTRYADDLAFSGSDLAVDRLIHAVGLIVADEGFSVHPGKTRVMRAHRRQHLA
FT                   GLVVNTRPQAARAEYDAVKALLFNCVRHGPDSQNRDGRPHFREYVYGRIAWVGESNEGR
FT                   KRSLHALAARVDWTEQRL"
FT   CDS_pept        564241..565353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48794"
FT                   /db_xref="GOA:C1ARW7"
FT                   /db_xref="InterPro:IPR031928"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW7"
FT                   /protein_id="BAH48794.1"
FT                   /translation="MRGVARGSKRKGNPDADLPGDDAPADLAAVRRDDALIDAIAGDGP
FT                   VATDSPEQYELALLLTNWRADIVSTPMPTGPLLDDVIAAIDASDNARSARSAARGKLRL
FT                   LRPIAGAAAAIAVVMGGATIFSYNAEPGDPLWSVKSVVFSQQADSTVAQIDTTTQLQEA
FT                   ERLIAAGDAESAKNLLDGAADRAGGVRDADKRNELDVWRAKLAAELEKIAPTTPPATTT
FT                   PGTTTTDTPTQTTSSPATVPGTEPLPGTQLPPDLQLPGLPPNSMPPLPTTTLPPETLPY
FT                   ISPEPTITMVPPPQAPLPEPSDNPITQPPPPEPSDNPITQPPPSEPSDNPITQPPPPEP
FT                   SDNPATQPPVEQPPPQEPSSEPLAPPVPTS"
FT   CDS_pept        565468..565740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48795"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW8"
FT                   /protein_id="BAH48795.1"
FT                   /translation="MSTPADLDEQVTKVRDALHALRRTLLDLERTYADLDANKLDVDAP
FT                   GDPTTAPETLESAVDALRAAQDTLGIADADLEVAKRHTSRLTPRG"
FT   CDS_pept        complement(565979..567364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48796"
FT                   /db_xref="GOA:C1ARW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARW9"
FT                   /protein_id="BAH48796.1"
FT                   /translation="MHRMRRMDRSVAVRHPRRGERHMTDIIDYADKVWKGEANQNAYHH
FT                   GDLRTEGMHCIAEGTYMWPAFGNVYVFPTKAGLFVYDTGDRRTAEDLFAATRRISEQPV
FT                   HTAVYSHGHVDHVFGMEPFDTEARERGWTRPTVLAHENVTRRFDRYKETRGYNGIINQR
FT                   QFQAPNLVWPDEYRYPDVTFADQTTLAVDDLQVQLHHARGETDDAAIAWIPDRKILCCG
FT                   DFFIWASPNAGNPQKVQRFAHEWARTLRWMADLGAEILLPGHGLPVLGADRIRTTLTDA
FT                   AELLEILHGRTLEMMNAGATLDEVVHSVAAPGELLRKPYLAPSYDEPEFVIRNVWRLYG
FT                   GWYDGNPAHLKSAPRADLAREIADLGGGAAQLAERARALLARGEHRLAGHFAQMATDAD
FT                   PQNRDSHQVRVDVFGQLEQGATSTMAKGVYGWAVAESRAFLDGSDHATELKAKTAGRAR
FT                   WAF"
FT   CDS_pept        complement(567432..568661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05500"
FT                   /product="putative CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48797"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX0"
FT                   /protein_id="BAH48797.1"
FT                   /translation="MRTAPEGTRDDLQGTIARIRRSVQRMARTTIDRYIAASPLYTQTA
FT                   VPEHLHRESAHTVRSMFEVCLQSITDESIDVADAMRENIERGTERVAEGLPLREYMRCW
FT                   QIGFDVLSEELERELGTDHGLFWFAFRRAHVTFDGMLREVISAYEIHAHDLIAAQDRNH
FT                   APTIDALLRGDGWVFDAPDSVPAEPSIMLLHIGDTLAEGSGDRNTRSLAATRKVRAIRA
FT                   HLARAVPGLWLIDVRPRHARILMHPPIGALDPLAVDLARVSGAPVTIAIEDATSIEDLP
FT                   RAGTTAAEVLDIAVRSGRTGTVSRMSDVALEHHFAHTSASLPVLLERCAPLRSRPDLVH
FT                   TLRVYFTSNLDRRATADTLVVHPNTVDNRLIRVRELTGLDVHVTTELLTLAVAVSAATV
FT                   HPDAGADHPQ"
FT   CDS_pept        568812..569990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05510"
FT                   /product="CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48798"
FT                   /db_xref="GOA:C1ARX1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX1"
FT                   /protein_id="BAH48798.1"
FT                   /translation="MPDSANAPDDLPLAGIMVVDFGQYIAAPGAAQALADLGADVLKIE
FT                   GPGGDQARGIGVYGEAIMRAYNRRKRSIVLDLKTEVDLRHARVLIARADVVIHNLRPGV
FT                   MEKLGLSADEIHELNPTVILAAVSGFGTDGPSRRRPGLDIAAQAETGMMSVTGEADGDP
FT                   QRVGFPLVDHATSYVVTQAVLSALFRRERTGLGDDIDVSLLDVAIDLQCVNWGEYSITG
FT                   VAPHRRGNGQPTAAPAADVFPTADGSIVISAYTEQRFAQLCGLAGQPDLPSDPRFVDNP
FT                   SRVAHRGELLAALAPFFAGLDTEAALAALTSVGIVAGAVRTYDLVPSAPDVIASGIFAT
FT                   GSTGDGHTYSIPGLPYRSRSTPRTADAGRVPELGEHSNEIVAHYRLGEYSLT"
FT   CDS_pept        570046..570840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05520"
FT                   /product="putative MFS transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48799"
FT                   /db_xref="GOA:C1ARX2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX2"
FT                   /protein_id="BAH48799.1"
FT                   /translation="MSLQNPQTRAEGGDLVADPELDSPRVRRRGWIITLMLMAFMLINF
FT                   ADKVVVSLAGVEIKTDLGLSNQQFGTAQSAFFWLFAVGAVALGSLGGRISARWLLAGLV
FT                   GLWVLSLAPMTTTVGFGVFLACRMVLGFAEGPAGALSQQIAHTWFSPKRRSLPASVVIM
FT                   GASLGPLIAAPVLTWIIQSYSWHAAFLVLMVAGVMWLVAWLFIGGEGPAGNAGAGTGNQ
FT                   AVTLPDTVPVRLLWTRPTVIGVAIFSFCSYWATALKVSWLPL"
FT   CDS_pept        570841..571383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05530"
FT                   /product="putative MFS transporter"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48800"
FT                   /db_xref="GOA:C1ARX3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX3"
FT                   /protein_id="BAH48800.1"
FT                   /translation="MREGLHYSANATGLLITLPFAAAVILTFLAGLISTRLSLAGRSSR
FT                   TARALFAAGLLAAGGVCMIGFTALPVGAIQMVLIALAFSLNTAAWGLAFSLLSDVVPAK
FT                   QRGSVMSITVAIYSLGGVAAPLLIGSLVSGAADTAAGYGRGFVIVGVIMLVGALTAAVL
FT                   VNPERDATTIAAHHPNT"
FT   CDS_pept        complement(571759..573165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48801"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX4"
FT                   /protein_id="BAH48801.1"
FT                   /translation="MDAHIVLPTIDGQSFASLRRRATPRAERYALGKRLRQETPRSALG
FT                   EWRAPDDRPDVVDQIGVSHQGRVESLIPVRVGRMAASPYGFLRGTAIVMAQDLAGLPAT
FT                   GIQPVICGDSHLGNFGFYASPERDLVLDLNDFDEAHPGGWEWDLRRLTASIWVAGRQNS
FT                   ATESQCESAVQSCVATYREHVRWLAEQPLLARSFERLDLDRLHTTASDESLRHEITRAA
FT                   ERARRRVSDRALPRFTEQDETGRRIVEEPPLITRVSKAEAERIAAGLDEYLTTLPSHWA
FT                   RLLSGYTVVDVAHKVVGVGSVGLRAYVVLCEGSSADDVVFLQLKQARRSVVARFVHGES
FT                   AWHDHQGRRVVEYQQALQTVSDPLLGWTTVEGRQYYVRQFRNMKGAVPIDNLSAAALTD
FT                   YAGICGRLLAKGHARTSGASMISGYVGKSDTLDVALSRFAHAYADQTERDHATLVDAVK
FT                   RGKLPCEPLT"
FT   CDS_pept        complement(573571..574827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05550"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48802"
FT                   /db_xref="GOA:C1ARX5"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX5"
FT                   /protein_id="BAH48802.1"
FT                   /translation="MNAISSAGERLTFGAPSSPWLRVGQVGAALAAGMGIGRFVYTPVL
FT                   PLMEAQAGLTPSAGAALATANYSGYLVGALAGIAIPGVMRSAATMRISLLALTVTLALM
FT                   PVASNETSWGVLRFIAGVASALVFVLAVGAMHSHLGGQAAHLSGWAFGGIGAGIALSGF
FT                   VVLVLRTMSTWESVWWAAALLTAICTFAAWTLTPQPRATAAAGERRKSPEQGVRSFGAL
FT                   FVSYLLEGVGYIIAGTFLVAAIDRTAGSIAGSGAWVLVGLAALPSGPLWASLGRRWSRP
FT                   ILLVIALTVQAVGIALPAAADGVWPALVSAFLFGGTFLGISQMSLAIGADLQIPRAVAI
FT                   LTSGYSLGQIVGPLVVTPLLSDGYHLALLVAAGIVLAAALAAAALPVLTWGLPKRAGAT
FT                   ATGAWSDCRSRYRTPPRGG"
FT   CDS_pept        complement(574873..575772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05560"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48803"
FT                   /db_xref="GOA:C1ARX6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX6"
FT                   /protein_id="BAH48803.1"
FT                   /translation="MDIGDLSFFLAVARAGGISRASKELLTVQSNISSRIRALEDELGV
FT                   ELFRRHARGVTLTNPGERLVPYAEHITRLVREVTQVVGDDRDPSGRLAIGSMETTAGLR
FT                   LPGVLAAFSEDCPRVDFTLTTDTTDALTTQVLEHRLDGAFVCGPVRHPDLISEQVFIEQ
FT                   LVLVSGVRIAGLDSVPADGRRHKVLVLRAGCAYRARLERLFEQHGLPGPDILEFGSLEG
FT                   ILGCAAAGMGVTLLPLGVVTASPLASALKVHHLAPADSRAETLFVRRKDSTTTPALSRF
FT                   LFHIHESSRPASLTSVAR"
FT   CDS_pept        complement(575754..576806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05570"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48804"
FT                   /db_xref="GOA:C1ARX7"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX7"
FT                   /protein_id="BAH48804.1"
FT                   /translation="MFDLEEDLRIAIVGAPMAGGPSTPELAAAVSSTGGLGFLAAGYKS
FT                   VDAVRREVDAIRALTDAPLGLNLFVPGRPLADRAAVEAYRERLRPLAERRNVVLPEVVD
FT                   HDDDAFDAKVGLAVELAVPVVSFTFGLPPRDVVDRLHAAGTAVVATVSDVDEARSAAER
FT                   GVDAICMQGVDAGGHRATLDPDAEPDPRSTRDLVEAARSAVDTPLIAAGGIATGGDVAA
FT                   ALAAGAVAVQIGTALLGADEAGTKPAHRAALHDDRFTDTVVTRAFSGRPARGLVNDFIS
FT                   DFDTYAVTAYPQVHLLTSGLRSAAAAAGDPHGLALWAGVGYRTARSAPAGEIVRDLWSE
FT                   ARGFSWTSAT"
FT   CDS_pept        576935..577804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05580"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48805"
FT                   /db_xref="GOA:C1ARX8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX8"
FT                   /protein_id="BAH48805.1"
FT                   /translation="MTIELRHLRAVVAVAEAGSFTAAATALHITQPALTRTVQQLETSL
FT                   GVRLFDRTSRALALTEDGAGFVEKVRVILGDLDSAVALYTTRSLALGFSWLLPDPWAQQ
FT                   VIDDVEKNSRATVVPRRCDDPIAALNNATVDAAVVRRDVPGDEFVQHPLFEEQRIAAVS
FT                   AASPLASRETIDWAEFGTLPLVINTLSGTTSEDLWPNHDGPVVTCSNFDEWLELIAADR
FT                   GVGTVPEVARRRVTHRNVRFIPLVGAPPAVVRFVYRRNRVTPLLRVLRDAAIRNSPPPH
FT                   GATVRQPR"
FT   CDS_pept        complement(577792..578478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48806"
FT                   /db_xref="GOA:C1ARX9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARX9"
FT                   /protein_id="BAH48806.1"
FT                   /translation="MTGPSRYGAIAFTAPVAERQKATGSIHWYGRRRAQGENVGRPDEL
FT                   DTRVTALIRSTDSFFIATVTPSGWPYIQHRGGPPGFVHVPNSSTITLADYPGNQQFVTI
FT                   GNLDENDRVALFFIDYPTRTRVKVYGRADIVERADDPELIERILATPDGVGRAGCDRAL
FT                   VVHVEALDRNCTKNIPPKYGEARMRESLALARKGLQDEVDALKSRNAALEREIAQLRGG
FT                   SDGQRG"
FT   CDS_pept        complement(578475..579914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05600"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48807"
FT                   /db_xref="GOA:C1ARY0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY0"
FT                   /protein_id="BAH48807.1"
FT                   /translation="MASQSVSPPVPVSGVPKSSLRKIIAASSVGTLIEWYDFYIYGSLA
FT                   VVFSGMFFPEGNGTAALLVTIAAFGTGFVVRPIGAIVFGRMGDRVGRKKTFMTTLLIMG
FT                   GATTLLGLMPTYDHIGILAPILLVTLRLLQGLAIGGEYGGAVVYIAENSPTEKRGALTS
FT                   VLQTTATGGLLLSIGVIVLCRVGLGEAAFTSWGWRIPFLLSAVLVLFSLKIRMKMHESP
FT                   VFEEMRKSGNLSRSPIRDAVAHKPAFALLLVVLFGVTAGLGVAWYTSQFYTLYFLQTIL
FT                   KIDFLTANVSVGIALVIATPFFVVFGKLSDKHGRMRIILCGLVFSAAGYLPLFAWIRHA
FT                   AVHGDQFQMVLALTVQVIFVTMIYGPTAAFLSELFPPQIRYTGLSLAYHLGTGVFGGFT
FT                   PLVALSLNTATGNVLAGLIYPIAVTAITALVFVLTLRRGVDSPIVRRAWKQIDSEYTAE
FT                   SISATAEQPRGSVPAPEAATS"
FT   CDS_pept        complement(579972..580961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05610"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48808"
FT                   /db_xref="GOA:C1ARY1"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY1"
FT                   /protein_id="BAH48808.1"
FT                   /translation="MSLQNRFTEKFGIEHPIVLAPMDYVSDWRLASAVAEAGGLGLIGG
FT                   GYGDESWLHDQFDQVTTAAVGCGFITWSMAQQPRLLETTIDYRPAAIFLSFADPAPHAP
FT                   AIRAAGIPLICQVHDLDQARRAVEVGASVLAAQGGEAGGHGTGARSTFTLVPEIADFLR
FT                   RQAPEVMLLAAGGIGDGRGLAAALALGADGALVGTRFWAAEEAAIPRAAQRRALRASGD
FT                   DTIRQSAFDIVREKPWPTRYTGRVLHNGFIRRWHGDEPGLRDALREKQEQFLVAVKAEN
FT                   YDVANLIVGEVIGQIDRVDSVASIMDDMVGTAAAILGRSSRDLAAIGS"
FT   CDS_pept        complement(581181..581921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48809"
FT                   /db_xref="GOA:C1ARY2"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY2"
FT                   /protein_id="BAH48809.1"
FT                   /translation="MTIERLLTTHFPDDPVMDAAFASALLRRTGRDPNAPGLVRIYSPA
FT                   RTLSFGRLDAIRPQFPAAAAAARRHGFTPVVRGAGGRAAAYHEQTLVVEIFSRDTEGII
FT                   GARPRFERITPRIAAVLRSLGVDARIGPVPGEYCPGDWTVNGEGRVKLAGTAQRIVAGA
FT                   WLFGFELVVSDSNPVRAVLTDVNAALELDFDPGTAASLTDMNPGVTLEQVRAAILAETG
FT                   GLHERAADPGLLDEAANLRDAHVA"
FT   CDS_pept        582148..582585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48810"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY3"
FT                   /protein_id="BAH48810.1"
FT                   /translation="MLLRSSVVALPCAVAAVLSASPAQATPSSGVTAQILFETTVPAVA
FT                   GSSAGTDLTLRRIEIASGGTTGWHYHDGPVYAFVESGVLSRTLQDCTKAVTTAGQAITE
FT                   DHGSDHVHEGSNLGTEPLVLLAFYTQPEGKPLSEDAPAPAC"
FT   CDS_pept        complement(582605..583345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobK"
FT                   /locus_tag="ROP_05640"
FT                   /product="precorrin-6X reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="protein synonym:precorrin-6A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48811"
FT                   /db_xref="GOA:C1ARY4"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY4"
FT                   /protein_id="BAH48811.1"
FT                   /translation="MSRILILGGTGEARALAAALADVPGVEAVSSLAGRVRDPRLPAGE
FT                   VRIGGFGGAAGLAEWLCAHPVDAIVDATHPFAAQITRNAADAAHRRGIPLVVLRRPEWA
FT                   PRPGEHWHTAPDLARAADLLPGLGTRIFLTIGRQGVDVFAGLHALWFLIRAIDPPDVAM
FT                   PPQSTLLLARGPFAVAGETALMREHRIDVLVTKNSGGGQTDAKLDAARALGIPVLMIRR
FT                   PPLPSATATVDDVAGAVAWIGALA"
FT   CDS_pept        complement(583348..584097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="ROP_05650"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48812"
FT                   /db_xref="GOA:C1ARY5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY5"
FT                   /protein_id="BAH48812.1"
FT                   /translation="MTVYFIGAGPGAADLITVRAQRIIATSPVCLYAGSLVPQELLAEC
FT                   PEGARVIDTARLSLDEIVALLIEADAAGQDVARLHSGDPSIFSAVAEQVRRLESAGVAH
FT                   TVVPGVPAFTAAAASLGRELTVPGVSQSIVLTRVSTLSTAMPEGEDLRSLGRSGATMVV
FT                   HLGAHRIDQIAEELIENYGRDCPAAVVAFASRPDEIVLRGTLATIADQVKAAGVTKTAV
FT                   VIVGKVLAAEGFPDSYLYSATRERTTH"
FT   CDS_pept        complement(584094..585329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobL"
FT                   /locus_tag="ROP_05660"
FT                   /product="precorrin-6Y C5,15-methyltransferase"
FT                   /EC_number="2.1.1.132"
FT                   /note="protein synonym:precorrin-6Y methylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48813"
FT                   /db_xref="GOA:C1ARY6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY6"
FT                   /protein_id="BAH48813.1"
FT                   /translation="MTDPIVVVGIGADGWDGLSPSARREIEVADVVMGSGRQLALIPET
FT                   PALRVAWPSPLVPALPGLFEQHHGRRVCVLASGDPMFHGIGVTLVNLLGAERVRVIPHP
FT                   SSATLACARLGWAAHETPVISLVNRPVDALLPELADATRLLVLSRDEHTPAAVADLLTG
FT                   RGFGPSRLTVLGELGGPDESRLDGTASVWSHGPGPRLNVIAIDCRAESGAVRLTRLPGL
FT                   PDAAFTGDGQMTKHEIRALTLCALAPAAGELLWDVGGGSGTVAIEWMRTHPRCRAVTFE
FT                   RSAARVDQIEANASALGVPSLTVFGDAPAAFEDVPPASSVPDAIFVGGGVTQDGLLGEC
FT                   WSRLRVGGRMVANAVTAESEALLLQWFSKCGGQLRKFQVYRGEPLGGFTAWRPQLPVAQ
FT                   WSVTKQSKGDAA"
FT   CDS_pept        complement(585326..586099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05670"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48814"
FT                   /db_xref="GOA:C1ARY7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY7"
FT                   /protein_id="BAH48814.1"
FT                   /translation="MSLGSKKNSGQPDEGVVLLLGGRSEIGLEIASRLAPGRTIVLAAR
FT                   RSTELAAERQSLLDAGASAVDCVEFDADDLDSHEKLLRSVVDTHGPLSVAVLAFGILGD
FT                   QARAERDARHAVAVVHTDYVAQVSVLTHLATLLREQKSGRIVVFSSVAGVRVRRANYVY
FT                   GSAKAGLDGFASGLGDALHGSGVSLLLIRSGFVIGRMTEGMSPAPMSSTPGQVADAVVR
FT                   GLYRGASRVWVPGRLRPVFFVMRLLPQAIWRRMPR"
FT   CDS_pept        586130..586543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48815"
FT                   /db_xref="GOA:C1ARY8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY8"
FT                   /protein_id="BAH48815.1"
FT                   /translation="MDRTPSTPIRLPDAALAFLGEYHLGTLTTLRKNGTPHVVAVGFTW
FT                   DQEHGLARVITNGSSQKALNAERGGYGAVSQVDGPRWMTLEGPARVLTDPESVADAVAR
FT                   YAARYRQPRVNPTRVVVEIAVSRVLGSAALRHD"
FT   CDS_pept        complement(586503..587261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05690"
FT                   /product="glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48816"
FT                   /db_xref="GOA:C1ARY9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARY9"
FT                   /protein_id="BAH48816.1"
FT                   /translation="MESVAPKVTVVVPTYNERDNLPKIVELLAALDIPNLHVLVVDDNS
FT                   PDGTGEVADTLAQSGPIPVGVLHRTVKDGLGRAYVAGMTRALSEGADIVIQMDADLSHP
FT                   TEAIPRMVETLTTTDAAVVLGSRYVAGGAVASDWPWHRKALSAWANFYVNAILRLRVKD
FT                   ATAGFKAWHADTLRAIDVEGVQSNGYAFQVEMNYRTVQRGMTIAEVPIRFEERTDGVSK
FT                   MSLAVQLESARVPWKLRFSRDAAQPSRVRG"
FT   CDS_pept        complement(587390..588529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="ROP_05700"
FT                   /product="putative Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="protein synonym:prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48817"
FT                   /db_xref="GOA:C1ARZ0"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ0"
FT                   /protein_id="BAH48817.1"
FT                   /translation="MSSLGASTSRFPTTIYADRIARAGALARDAGLDGLLITPGPDLRY
FT                   LLGSRAESFERLTCLVIPANGDTASVVVPRLELAALTESATSDLGLTVRDWVDGVDPYA
FT                   LVSGLLPSPARTAVTDAMPALHLIPLSEALGALPILATEVLRELRMVKDDAEIDALRRA
FT                   GQAIDRVHARMGEFLKVGRTEAEVAADITAAILEEGHTEAAFVIVGSGPHGADPHHEVS
FT                   ERVVESGDVVVIDIGGPVEPGYNSDSTRTYSMGEPDPGVAEKFAVLEEAQAAAVALVRP
FT                   GVTAEAVDAAARDLLAAQGLAEVFVHRTGHGIGLSVHEEPYIVSGNSIELTEGMAFSVE
FT                   PGIYFRGEWGARIEDIVVVTADGCEPVNTRPHGLTVLPG"
FT   CDS_pept        588557..589522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05710"
FT                   /product="putative 5'-3' exonuclease"
FT                   /EC_number="3.1.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48818"
FT                   /db_xref="GOA:C1ARZ1"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ1"
FT                   /protein_id="BAH48818.1"
FT                   /translation="MRVMTGPLLLLDGASLWFRAYYALPDSITSPDGRSVNAVRGFTDM
FT                   VAALITKHQPSRLAVCLDLDWRPAFRVEAVPTYKAHRVAEDTGGAEEEVPDTLSPQVPM
FT                   ILDVLAATGIATAGAEGLEADDVLGTLAATETRDAVIVVTGDRDLLQVVTDDPVPVRVL
FT                   YVVRGLAKAELLGPEEVAAKYGVPADRAGEAYAELALLRGDSSDGLPGVKGIGEKTASS
FT                   LIMQYGSLAALRAAAVDPESDMAKGARAKFAAAADYLDAALPVVRVVRDAEVELSREDT
FT                   LPAKPVDADRLGRLADELGIENSVGRLTAAMKKVAAARVP"
FT   CDS_pept        complement(589550..590245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05720"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48819"
FT                   /db_xref="GOA:C1ARZ2"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ2"
FT                   /protein_id="BAH48819.1"
FT                   /translation="MSGPYGPNDPNGQWAQGQQPGQGNPDQSGGQYGAPQYGQQPPAQP
FT                   WGQQPGQPQQPGQPQWGQQPQQPGQPQWGQQPQPGQLGQPGPGQWGQQPQQPGQPQWGQ
FT                   QPGQPQQWGPAPGQQQWGQPPSSGKSKLPLIIGGVVALLVIVGIALVLAFTVFGTDTLD
FT                   QKAAEDGVERIVTDSYGAENVSGVTCPSGQEVKKGNSFTCSLTVDGEKKQVTLTFTDDK
FT                   GTYEVSRPS"
FT   CDS_pept        complement(590348..593083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05730"
FT                   /product="putative helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48820"
FT                   /db_xref="GOA:C1ARZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ3"
FT                   /protein_id="BAH48820.1"
FT                   /translation="MTTGDTTGGTELDVFSAQLGFVLDPFQINACRALEGGHGVLVCAP
FT                   TGAGKTVVGEFAVHLALAAGRKCFYTTPIKALSNQKYAELVRRYGKDTVGLLTGDSSIN
FT                   SDAPVVVMTTEVLRNMLYADSAALRGLSHVVMDEVHFLADRFRGAVWEEVILHLSEDVR
FT                   LVSLSATVSNAEEFGAWMETVRGDTTVVVDENRPIPLWQHIMVGRRLFDLFDTRARSGD
FT                   ARNDLVVDQDLVRHVKQRQALERADSWEPRGRGRRGGGRGYSSDFRPLPRPEVISRLDD
FT                   EGLLPAITFIFSRAGCDAALAQCLRSRLDLTTPEQVAEIRTIVDAHTGELPKADLEVLG
FT                   YWEWRKALERGLAAHHAGMLPAFRQTVEELFVKGLVRAVFATETLALGINMPARTVVLE
FT                   RLVKYNGEAHAELTPGEYTQLTGRAGRRGIDIEGHAVVLWQPGVEPVDVAGLASTRTFP
FT                   LRSSFRPGYNMTINLVDRMGAAESRALLERSFAQFQADRSVVGLTRGIERNEAALTTLR
FT                   ERLGGEDGEYFEYARLREELSSRERSLERAGRTERRDAAVASLVALRRGDVIAIPVGRH
FT                   SGLAVVLEPDRDPTDPKPLILTEAKWAGRVSAGDFPEPARSLGSMRLPRRFDHHTARVR
FT                   RDLASALRSTGIVAPGRRKRKKSGAAADDAEIARLRRAIRQHPCHSWPDREQLSRIGER
FT                   YNRLARETETMRQKVAATTNSLARTFDRILSLLAERDYVSAGEHPDATEHGTRLSRIYC
FT                   ESDLLVAECLRQGVWKGLGPAELAAVASAVIFESRREGDTVESGGPGALRHALDETVRV
FT                   WRELRADEIRHKLPPTREPDFGFAAAIYHWASDNSLVEALIAAGDQGRALSAGDFVRWC
FT                   RQVIDLLEQVRSTSPDPEVGKAAGRAVAAIRRGVVAVDAA"
FT   CDS_pept        complement(593102..594142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ROP_05740"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48821"
FT                   /db_xref="GOA:C1ARZ4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ4"
FT                   /protein_id="BAH48821.1"
FT                   /translation="MRIPFDPRHSKRRTNPDGTMSLVDHLYELRTRLLLSVLAIVVTTA
FT                   VGFFWYSHQIFGIESLGELLRGPYCSLPESSRADLSNDGSCRLLATGPFEQFMLRFKVA
FT                   LTAGVVLACPIWLYQLWAFITPGLYAKERRYAIGFVVSGAALFIAGAVLAYVVVAKALH
FT                   FLLTIGDNVQITALGGAEYFGFIINLLIIFGVSFEIPLLIVALNFVGILPYAKLKAWRR
FT                   GLIFALFVFAAIATPGQDPFSMLALAFALTLLFEIAVQIARINDRRKARRTEQEWGALD
FT                   DDEASTIAAPADLNESFDVAAATVPESAGRFRRSRKSGKSGAANKNDAASTTGSNTPGQ
FT                   DFSDTL"
FT   CDS_pept        complement(594214..594495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="ROP_05750"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48822"
FT                   /db_xref="GOA:C1ARZ5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ARZ5"
FT                   /protein_id="BAH48822.1"
FT                   /translation="MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKSEVKE
FT                   MQNDNSTPAPTAQQSAPAELPVADTTTAPVTPPAPVQPQPQHTEPKSA"
FT   CDS_pept        complement(594568..594834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48823"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ6"
FT                   /protein_id="BAH48823.1"
FT                   /translation="MGRERVGAEIRDHGLRLTDLHGSDIEVGASDIAFDTGPGTAAPVN
FT                   ARLVALIREAEAGGNRQWSGEALLADLRSQRGPRKPAGKRQRS"
FT   CDS_pept        complement(594841..595821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pafC"
FT                   /locus_tag="ROP_05770"
FT                   /product="proteasome accessory factor C"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48824"
FT                   /db_xref="GOA:C1ARZ7"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ7"
FT                   /protein_id="BAH48824.1"
FT                   /translation="MSNRLSSRLSRLLNLVPYFIANPGMSAAEAAAELGVTTTQLMSDL
FT                   NQLWVCGLPGYGPGDLIDLSFSEESIEVTFSAGIDRPLRLTSTEATALLIALRSLVEMP
FT                   GMVDPSAAHSAIAKIEDAAGTAAARAAVTPASERAAVEDVAEDPVAAAVRSALHRRRAL
FT                   HLTYYSASRDRVTERTVDPVRIVLVDNHSYLQAWCRQAEGVRLFRLDRIDAATELDEAS
FT                   TPPAQALVRDSNLELFSGDASLPQARLHIGADCVWVLDYYPMDVATVAADGSVEATMSY
FT                   GALEWMARLVLGFGSGITVLGPPELVHEVRRRAVEALSAYEAVEA"
FT   CDS_pept        complement(595818..596810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pafB"
FT                   /locus_tag="ROP_05780"
FT                   /product="proteasome accessory factor B"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48825"
FT                   /db_xref="GOA:C1ARZ8"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ8"
FT                   /protein_id="BAH48825.1"
FT                   /translation="MPTSKIERLMNLVICLLSTRQFLTAEKIRESVAGYADSASDEAFS
FT                   RMFERDKNELRDLGVPLETGQASRFSTVEGYRINRNAYELPDIDLDQEESAAVAVAVQL
FT                   WESPELTSAAQGALLKLRAAGVQVDPDSAATPITAVPARTRGSEPALGKLLAAVDAGRA
FT                   VHFPHRGALNEPYTERTVEPWGVVTAHGRWYLVGHDVDRGAVRTFRLSRIGDDVTEFGP
FT                   SGVVHKPADVDLRDIVDRVTGSGEVTGTATVWVAEGRAQELRRLATTAEEKRVNERSGT
FT                   VLRIPIHSRDWIARLVAGHGADALVLDPPELRHDVLTKLKDAAGEGVTS"
FT   CDS_pept        complement(596858..598216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pafA"
FT                   /locus_tag="ROP_05790"
FT                   /product="proteasome accessory factor A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48826"
FT                   /db_xref="GOA:C1ASP4"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="InterPro:IPR022279"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP4"
FT                   /protein_id="BAH48826.1"
FT                   /translation="MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSN
FT                   VFLRNGARLYLDVGSHPEYATAECDNLIQLVNHDRAGERVLEELLIDAEQRLAEEGIGG
FT                   DIYLFKNNTDSAGNSYGCHENFLVARAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKA
FT                   ATFCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSESTTML
FT                   KVGTAALVLEMIEAGVSFRDFALDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQRE
FT                   YHARAVEHLQNRDPDPQVTQVVDLWGRMLDAVETQDFAKVDTEIDWVIKRKLFQRYQDR
FT                   HGFELADPKIAQLDLAYHDIKRGRGVFDVLQRKGLVKRITEDETIEAAVDTPPQTTRAK
FT                   LRGEFITAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRSVDERVERLIASM"
FT   CDS_pept        598293..599756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48827"
FT                   /db_xref="GOA:C1ASP5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP5"
FT                   /protein_id="BAH48827.1"
FT                   /translation="MNRHLHRIHRVDEIVFGRSADLRPSGVDRAMRFLSHAADKGVLWW
FT                   CVAALLGLVGGRARRGAVRGLLSLAMASGLANGILKPVFPRRRPPARAWTNVLRGVPIP
FT                   RSSSFPSGHSASAAAFTTGVALESPAAGAALAPLAAAVAYSRVHNGVHWPSDVLVGLML
FT                   GGAVASGTRRWWAVRTEDPAELGPAVDAPALPGGEGLLVLVNQESGPDTVDPSEEIATA
FT                   LPKAHVRALDTDRDFAEQLDAWVAETNPRALGVCGGDGTVVAVASAAARHTLPLAVFPG
FT                   GTLNHFARDAGVPEISDTATAVETGHAVLVDQAVVHTDVAEPAPFLNTASLGGYPDAVR
FT                   LREKWQPRYGKWPAACAAMIRILAAATPLAVTLDGRPVNVWMLFVGNGRYSPGDQVPMS
FT                   RPAITGGLLDVRYVRADRRASRPRLLFAAVTGTLGSSRVYVRSLVPRLTVRVNGAPVAL
FT                   ATDGEVVTDARRFEFRTVPGAIAVYRPQS"
FT   CDS_pept        complement(599747..600526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcA"
FT                   /locus_tag="ROP_05810"
FT                   /product="20S proteasome alpha-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48828"
FT                   /db_xref="GOA:C1ASP6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022296"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP6"
FT                   /protein_id="BAH48828.1"
FT                   /translation="MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAEN
FT                   PSTALHKVSELYDRLGFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANAYA
FT                   QTLGTIFTEQPKPYEVEICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTTEPI
FT                   ATAMRESYRADLDLEAAVGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRRAFRR
FT                   IAGAALEQLVPAAPAAASESAPEPKPDTETKPADPQD"
FT   CDS_pept        complement(600523..601407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcB"
FT                   /locus_tag="ROP_05820"
FT                   /product="20S proteasome beta-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48829"
FT                   /db_xref="GOA:C1ASP7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022483"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP7"
FT                   /protein_id="BAH48829.1"
FT                   /translation="MTADRPALRTGDGDTRLSFGSNLSSFTEYLRGHAPELLPENRIGH
FT                   RSHSTRGGDGMESGDLAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDE
FT                   YSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAMQGL
FT                   AVVPLLVGYDLDADEEARAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKIYSPD
FT                   SDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARR
FT                   IVAERTEEGGSAR"
FT   CDS_pept        complement(601404..601598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05830"
FT                   /product="putative proteasome accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48830"
FT                   /db_xref="GOA:C1ASP8"
FT                   /db_xref="InterPro:IPR008515"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP8"
FT                   /protein_id="BAH48830.1"
FT                   /translation="MAQEQTKRTGGGDEDDTPGGDGAAGQERREKLAEDTDDLLDEIDD
FT                   VLEENAEDFVRAYVQKGGQ"
FT   CDS_pept        complement(601768..603267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05840"
FT                   /product="putative proteasome accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48831"
FT                   /db_xref="GOA:C1ASP9"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="InterPro:IPR022366"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP9"
FT                   /protein_id="BAH48831.1"
FT                   /translation="MQRIIGVEVEYGISSPSEPSANPILTSTQAVLAYAAAAGVPRAKR
FT                   TRWDYEVESPLRDARGFDLGRLSGPAPVIDADEVGAANMILTNGARLYVDHAHPEYSAP
FT                   EVTDPLDAVIWDKAGERVMEAAARHASSVPGAPRLQLYKNNVDGKGASYGTHENYLMSR
FT                   ATPFSAVINGLTPFFASRQVICGSGRVGIGQSGDEAGFQLSQRADYIEVEVGLETTLKR
FT                   GIINTRDEPHADADKYRRLHVIIGDANLAEMSTYLKVGTTALVLDLIEAGVDLTDLQLA
FT                   RPVTAVHHISHDPTLRATVALADGRELTGLALQRIYLDRVDKFMSAEGNDDPRVADLLE
FT                   KWAMVLDLLERDPMECAHLLDWPAKLRLLEGFRNREGLNWSAPRLHLVDLQYSDVRLDK
FT                   GLYNRLVARGSMERLVSEQAVLDAVDTPPTDTRAYFRGECLRKFGADIAAASWDSVIFD
FT                   LGGDSLVRIPTLEPLRGSKAHVGELLESVETAKELVDELTN"
FT   CDS_pept        complement(603342..603719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48832"
FT                   /db_xref="GOA:C1ASQ0"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ0"
FT                   /protein_id="BAH48832.1"
FT                   /translation="MALPRSIARFNRVVTNRVSRHVASILPGFAMVEHRGRKSGKSYHT
FT                   PVNVFVVDGRYRFALTYGARSDWVRNVVAAGGCTIVTRRRTVHLTDPRIGTDGTHSWAP
FT                   PGVRTVLEAISADQYLECSPG"
FT   CDS_pept        603803..604351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05860"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48833"
FT                   /db_xref="GOA:C1ASQ1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ1"
FT                   /protein_id="BAH48833.1"
FT                   /translation="MDSAPNTPPGTDEVVAVFDSAGRPVGSAERSRVYAEGLWHASAGV
FT                   LVRSGDGKRLYVHRRADTKTVFAGHNDCLAGGVVDPGETPEEAASRELAEELGITGVGL
FT                   TPIARVAWDGRWQGLRLRCHLYAYEAHWDGPVVHQASEIASGWWWTPHELVTHLHDPEW
FT                   PFVPDTRALLEDYLVARDR"
FT   CDS_pept        complement(604420..606195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arc"
FT                   /locus_tag="ROP_05870"
FT                   /product="ATPase ARC"
FT                   /EC_number="3.6.-.-"
FT                   /note="protein synonym:AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48834"
FT                   /db_xref="GOA:C1ASQ2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASQ2"
FT                   /protein_id="BAH48834.1"
FT                   /translation="MSSTENPDSVAAARELEALRAEASALRRQLAESPEQLREMESRVD
FT                   SLSIRNTKLMDTLKEARQQLIALREEVDRLGQPPSGYGVLLGVHDDQTVDVFTSGRKMR
FT                   LTCSPNVDAETLKLGQTVRLNEALTIVEAGNFERVGEISTLREVLDDGQRALVVGHADE
FT                   ERIVWLAEPLATVFEESERESVAYDAESPTRKLRPGDSLLVDTKAGYAFERIPKAEVED
FT                   LVLEEVPDVHYDDIGGLGRQIEQIRDAVELPFLHKDLFHEYELRPPKGVLLYGPPGCGK
FT                   TLIAKAVANSLAKKIAEARGQDSKEAKSYFLNIKGPELLNKFVGETERHIRLIFQRARE
FT                   KASEGTPVIVFFDEMDSIFRTRGSGVSSDVETTVVPQLLSEIDGVEGLENVIVIGASNR
FT                   EDMIDPAILRPGRLDVKIKIERPDAESAQDIFSKYLVETLPVHSDDLAEFGGDRTACIR
FT                   VMIERVVDRMYAESEENRFLEVTYANGDKEVLYFKDFNSGAMIQNIVDRAKKYAIKSVL
FT                   DTGAPGLRVQHLFDSIVDEFSENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKNAS
FT                   ASRAIDTESNTGQYL"
FT   CDS_pept        606379..606882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48835"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ3"
FT                   /protein_id="BAH48835.1"
FT                   /translation="MIIRKPLNGRSFTGRSAVAVGAVVFALGMSACSSDDASDTAAATS
FT                   AATSSAAEAAVAAPTSEELLGTLQLLVDPARPVDEKTVVVVDGDERRPNLEAMTAAMAN
FT                   YPVSFTVTDVQVEGDTATANVAIVSPHGTAAPTAWTWENVDGVWKVSDESTCTLLGMAR
FT                   AGCS"
FT   CDS_pept        complement(606931..607785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05890"
FT                   /product="putative tRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48836"
FT                   /db_xref="GOA:C1ASQ4"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ4"
FT                   /protein_id="BAH48836.1"
FT                   /translation="MVGRETRPSGPFRVGDRVQLTDGKGRHYTVNLEAGKEFHTHRGGI
FT                   LHDDLIGTDEGSVVKSTNGTPYLALRPLLTDYVLSMPRGAQVIYPKDAAQIVHEGDVFP
FT                   GARVLEAGAGSGALTCSLLRAVGPEGRVISYEVRDDHAEHAVRNVETFFGERPENWDLT
FT                   IADVAEFDAEAAGGPVDRVVLDMLAPWDALPAVSKALVPGGVLVVYVATVTQLSKVVEA
FT                   MREQECWTEPRSWESIVRGWHVVGLAVRPEHRMQGHTAFLVSARRLAEGTVTPKPQRRS
FT                   GKG"
FT   CDS_pept        607881..608786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48837"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ5"
FT                   /protein_id="BAH48837.1"
FT                   /translation="MSISESPAPVTKGSPSQPGDTSATRRRPALSPSRAGDFKQCPLLY
FT                   RFRAVDRLPEAPSRAQVKGTVVHAALETLFGLPAAERVPARAVDLVRPSWERLLDEAPD
FT                   LIDLVPVDQRESFLDEARSLVTAYYQLEDPTRFEAESCEQRVETELADGVLLRGFVDRI
FT                   DVAPTGEVRVVDYKTGRAPREMSESKALFQMKFYALVLLRTRGIVPAQLRLLYLASGTV
FT                   LTYAPDEDELLRFERTLSAIWKAILAAGVTGDFRPKPSRLCDWCDHKSLCPSFGGTPPP
FT                   YPGWPEGPAEDAPGFEEIVE"
FT   CDS_pept        608783..609619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48838"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ6"
FT                   /protein_id="BAH48838.1"
FT                   /translation="MSSESYYVPVGSEALGAPTPGSDQKVVVERFASTDLTISVWADTM
FT                   QHGAPPSALLVRALERCAAREDARLTRVVVEILGPIPIAELEVRSWVQRPGRRVELVVA
FT                   ELWTVGDRPRAVARGSAWRMETVDTSDAVHVVDPPLEPRSTGRDGAFGGIWNSGYLTTL
FT                   DWRWIAEMGCEGPGKLWAKPRPALVLGETMTPLERLFAIADIANGVGSKLDPAQWTFLN
FT                   TDLTVHIFRVPEGDWVGVSSETSIGPDGVGMCAGVLYDETGAVGRIAQTVQVRARP"
FT   CDS_pept        complement(609668..610519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="ROP_05920"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48839"
FT                   /db_xref="GOA:C1ASQ7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASQ7"
FT                   /protein_id="BAH48839.1"
FT                   /translation="MLRVAVPNKGSLSESAAEILSEAGYRRRTDSRDLTVLDPSNQVEF
FT                   FFLRPKDIAIYVGSGELDLGITGRDLARDSGAPVAERLSLGFGRSTFRYAAPAGKDWKV
FT                   EDLAGLRIATSYPNLVRDDLSARGIEASVIRLDGAVEISIQLGVADAIADVVGSGRTLR
FT                   QHNLVAFGDTLCDSEGVLIERAGSPADDSARNQLVERVRGIVFAQQNLMLDYDCPKTIL
FT                   DDALKITPGLESPTLSPLADENWVAVRAMVPIKGHNGVMDELADLGAKAILASNIRSCR
FT                   AL"
FT   CDS_pept        complement(610567..610848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="ROP_05930"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48840"
FT                   /db_xref="GOA:C1ASQ8"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASQ8"
FT                   /protein_id="BAH48840.1"
FT                   /translation="MKEWVLVKTFESLFAELTERAATRPEGSGTVAALDAGVHSQGKKI
FT                   LEEAGEVWIAAEHESDEALAEEISQLLYWTQVLMVGKGLKLEDVYRHL"
FT   CDS_pept        complement(610874..611767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05940"
FT                   /product="putative pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48841"
FT                   /db_xref="GOA:C1ASQ9"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASQ9"
FT                   /protein_id="BAH48841.1"
FT                   /translation="MAGAPLPVRGGLGPDRIRMPAGLGARTVAEFLVDTYPDERAHWLS
FT                   LIDAGDVVDEHGRVVDRGTRYAPTRFVYFYRDPAPEIPVPFEIDVLHRDDHLVVIDKPH
FT                   FLATIPRGAHITETAVVRLRRALDLPDLTPAHRLDRMTAGVLVFLIRPEDRRAYQELFV
FT                   SQQVTKEYEAVAGHDPALEFPRTIRSRIVKEHGIMTATEEPGEPNSETVVDLIESRDGR
FT                   ARYRLLPKTGRTHQLRLHMSSLGLPIEGDNYYPDFRRSEPGDFSTPLRLLARAIEFTDP
FT                   RSGRVRRFESRRTLGW"
FT   CDS_pept        complement(611769..612626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48842"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASR0"
FT                   /protein_id="BAH48842.1"
FT                   /translation="MAVPKIVLFYVFTPLADPEAIRLWQYTLAEAHDLTGRILVSEHGI
FT                   NATVGGDIRDVKRYVKGTRSYAPFKDADIKWSDGLGNDFPRLSVKVRPEIVTFGAPGEL
FT                   KVDADGVVGGGTHLAPEEVHRLVEGRGDDVVFFDGRNGFEAEIGRFRDAVVPDVSTTRD
FT                   FVHELDSGKYDHLKDKAVVTYCTGGVRCEVLSSLMRSRGFGEVYQLDGGIVRYGEAFGD
FT                   TGLWEGSLYVFDKRMTIEFSDQAKTLGRCTRCGGPTSRYENLPDDRGRELVLVCAGCTE
FT                   NRAG"
FT   CDS_pept        complement(612642..613334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05960"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48843"
FT                   /db_xref="GOA:C1ASR1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR1"
FT                   /protein_id="BAH48843.1"
FT                   /translation="MSEAFDGLAGVLWDMDGTLLDSERMWDVAVRELSLHLGGPMTEET
FT                   RLKTIGASSANALGVIFDALGLDRDPAALADAKEWMFTRVEELFGDGIPWRPGAHDALR
FT                   TARAHGLRSALVTNTERRLTERALETLGRHHFDHSVCGDEVPAGKPHPDPYLRGAELLG
FT                   LHPSQCLAVEDSPTGAASAQAAGCVVLVVPCEIPVADGPGRVFRDSLEGLTGSDLAEAW
FT                   AQPSGVRL"
FT   CDS_pept        complement(613327..616896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="ROP_05970"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="protein synonym:5-methyltetrahydrofolate--
FT                   homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48844"
FT                   /db_xref="GOA:C1ASR2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR2"
FT                   /protein_id="BAH48844.1"
FT                   /translation="MSAPFHSALLDALNQRVVIGDGAMGTMLQAADLTLDDFLGLEGCN
FT                   EILNDTRPDVLKEIHRAYFEAGADAVETNTFGCNLPNLADYDISDRIRELAEKGTRLAR
FT                   EVADEMGPGRDGMGRFVLGSMGPGTKLPTLGHAPFAILRDAYAEAAMGMIDGGADAILV
FT                   ETCQDLLQVKAAILGSQRAMETLGSRLPIITHVTVETTGTMLLGSEIGAALTALEPLGI
FT                   DMIGLNCATGPAEMSEHLRHLSKYSSLPVSVMPNAGLPQLGPNGAEYPLTAEELAEALS
FT                   GFVTEFGLGLVGGCCGTTPEHIRQVADAVRLVEKAARNPVHESGTSSLYTAVPFEQDAS
FT                   ILMIGERTNSNGSKAFREAMIAEDYQKCLDIAKDQTRDGAHMLDLNVDYVGRDGAADMA
FT                   ALASRFATSSTLPIMLDSTEPAVLQAGLEHLGGRCAVNSVNYEDGDGPDSRFQKIMRLV
FT                   KEHGAAVVALTIDEEGQARTAEHKVRIAERLLEDITVNWGLDESDIIIDALTFPISTGQ
FT                   EEVRRDGIETIEAIRELKKRHPRVHFTLGVSNISFGLNPAARQVLNSVFLHECTEAGLD
FT                   TAIVHASKILPMARIPDEQRETALDLVYDRRREGYDPLQKLMELFEGVSAASARESRAQ
FT                   ELAALPLFERLERRIVDGERNGLDDDLTAAMEEKPPLAIINETLLSGMKTVGELFGSGQ
FT                   MQLPFVLQSAEVMKAAVAYLEPHMEATDEDGKGRIVIATVKGDVHDIGKNLVDIILSNN
FT                   GYDVVNLGIKQPIATILDAAIEQKADVIGMSGLLVKSTVVMKDNLQELNAKGVAEKFPV
FT                   LLGGAALTRSYVENDLAEVYEGDVSYARDAFEGLHKMDEIMAVKRGGAPDPDSPEAIAA
FT                   REKAAERKARHERSKRIAEKRKAAEVPVELPERSDVATDIAVPSPPFWGNRIVKGVSLS
FT                   DYSGLLDERALFLGQWGLRGQRSGDGPTYEELVETEGRPRLRYWLDRLSTEGILAHAAV
FT                   VYGYFPAVSEGDDVVVLTDPTPDAEERFRFTFPRQHRDRFLCVADFVRSRTEAKETGQV
FT                   DVFPMQLVTMGQPIADFANELFAANAYRDYLEVHGIGVQLTESLAEYWHQRVREELVLP
FT                   GGHNVGEQDPSEVSGFFDLAYRGARYSFGYGACPNLEDRAKMVALLEPERIGVKLSEEL
FT                   QLHPEQSTDAFVLHHPEAKYFNV"
FT   CDS_pept        616948..617889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48845"
FT                   /db_xref="InterPro:IPR008492"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR3"
FT                   /protein_id="BAH48845.1"
FT                   /translation="MSSSEFPVTPAGPDDDTPDTADDGATDSGVPVLRDPVLVAAFEGW
FT                   NDAGDAASGAVEHLELTWDAQPLAELDSEEYYDYQVNRPTVRQVDGVTREIVWPATRLS
FT                   VCSPPGSDRDVVLLRGIEPNMRWRSFCEDLLELIDQLQINTVVILGALLADTPHTRPVP
FT                   VTGSAYSSEAAERFKIEQTRYEGPTGITGVLQDACVRAGVPAVSFWAAVPHYVSQPPNP
FT                   KATVALLQRVEDVLDIEVPLGELPSQADDWQEAVTEMTADDEEIGDYVRSLEERGDAET
FT                   DISEAISKIDGDALAAEFERYLRRRGPGSFGL"
FT   CDS_pept        617886..619037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_05990"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48846"
FT                   /db_xref="GOA:C1ASR4"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR4"
FT                   /protein_id="BAH48846.1"
FT                   /translation="MTRNSSESLRSSLQRTALYAGGFLGPFGGGVVASILPEIGDDLGV
FT                   SASAAAGSLTAYLLPFALLMLVSGTLGARWGQMRTVRIAYGVYLLSSLACFAAPTLPLF
FT                   LGARVLQGCSNSFTTPLLLAALAASTPKKHLGRALGIFGAFQAAGQSSAPLVGGLAAEV
FT                   DWRLAFLVIALVAAVLGLVGVPDSPPAEPGAARPRLRDALTPSVLRIGVVALLGWGALG
FT                   GLSFLVAFRAEDVFGLSPTQRGLLLTGFGVAGILTARLVGGVIDKFGARAAVLIGAFGG
FT                   AALVAAAGTVSLLPVVAVAWFAAGTAGQFILVGVNAAVLGSPGPNRGGAVSVVQALRFT
FT                   GNALAPITLTPVYAVSPAAGFLLPALLLAVLAPLLMPRDRPPA"
FT   CDS_pept        619449..621614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="ROP_06000"
FT                   /product="nitrite reductase large subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48847"
FT                   /db_xref="GOA:C1ASR5"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR5"
FT                   /protein_id="BAH48847.1"
FT                   /translation="MLIVATGSNTFFPNMDGLREHDGRLARGVFGFRNIADTNGMLQMA
FT                   QAHDDVSAVVIGGGLLGLEAAYGLRTQGLTVDVVHSPGHLMNQQLDERGGSVLRAEIEK
FT                   LGVGVHTSMRTTAVLRDDAGLVTGVSFVDGSTLDADMVVVTAGIRPNTELARAAGLVVE
FT                   RGIVVDDQMRCEDEGSVYAVGECAQHRGETYGLVAPVWEQAVILADVLTGSDPEAAYVG
FT                   SRTTTQLKVAGVDVAAMGVKGPETADDEFVQYYEPRSGTYKSLVVRDGKLIGATLMGDI
FT                   SKAGFLTQAFDGKVPLPEERISMLFDVGTPAAATSVADLPDDLQVCNCNGVSKGDLVAC
FT                   VHSGAKTLTDVCATTRAGKGCGSCKGLVADIVACAAGGELEADPSADWYVPCIPMSKPE
FT                   LTAAIRERDLRAVSQVFAELATDANEDASAKMPLASLLRTIWGPDWVDERGALFINDRV
FT                   HANIQRDGTFSVVPQMKGGVTTPDQLRRIADVADKYRVPLVKVTGGQRIDLLGIKKEDL
FT                   PKVWGDLDMPSGFAYGKSMRTVKTCVGTDFCRYGLGDSTSLGIALEERFQGLETPAKLK
FT                   LAVAGCPRNCSEALCKDFGVVAVGDGRWEIYVGGAAGAHIRKGDLLATVESPDAVVELG
FT                   GRFIQYYRENAKWLERTYDFVPRVGLEHLQALLVRDEEDIVTGLDERIQTAVDGYRDPW
FT                   KERSAPKSPAQFAPSLPLLPLPQVPVR"
FT   CDS_pept        621611..621937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="ROP_06010"
FT                   /product="nitrite reductase small subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48848"
FT                   /db_xref="GOA:C1ASR6"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR6"
FT                   /protein_id="BAH48848.1"
FT                   /translation="MTALIEGPTEFAVGPVSDLTPGEGRTYVVQDRQVAVFLLSDGTVR
FT                   AMDAVCPHRGGPLADGQIDASGVMCPLHQYAFAFDTGACGSEGVGSVRTYPASVREGSV
FT                   VVHV"
FT   CDS_pept        622061..624247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06020"
FT                   /product="putative acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48849"
FT                   /db_xref="GOA:C1ASR7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR7"
FT                   /protein_id="BAH48849.1"
FT                   /translation="MSTVASPEGRRRSGNHSQAGDRAAGTVFRTDIEGLRAVAVLAVVL
FT                   FHAGVPGIDGGFAGVDVFFVVSGFLITGLLWRDVAADGRVGLAEFYGARARRLLPAGCV
FT                   VLVATAIGAALLLPPLQARAVLGDGIASALYVGNYRLALHGTDYLAADTPPSPFQHYWS
FT                   LGAEEQFYLLWPALIIGVAWLVRRRTRRLDPDRAPSTTPYLVVLTVVAAVSFAVSLDWT
FT                   RTLPPWAFFSLPSRAWELAAGGLVALSVRHWRRLPPVLAAVAGWVGLALIVLACLRLGE
FT                   KTPYPGTAALLPVLGTVLVIGAGCAAPRRGVGRGLSLPPMRAVGRVSYSWYLWHWPVLL
FT                   LAPIVLGRSLDLTDRLAMVMVAVGLAGLTLTLVENPVRFSAPLRRSAPRSLVLGGAVTA
FT                   VAVCAALVLLVARPVPVGHGAAAASLTVSAPAESTTPAIDPRDAAVTDMTAQVQAAVEE
FT                   AAGLQAVPSNLSPPLADAPADKPAVFVNGCVRSWLEVGQDECASGDVTSATTVALVGDS
FT                   HAAMWAPAFEAAAEQHHWRLETMGKVTCPLLDLPLTSPYLGREYSECEQWRGEILERLR
FT                   AERPRLVVLSMSRRYGADFGFSVYGRPWLDSLTGLVTQLRATGAAVLVLGPVPDPQSTV
FT                   PTCLSAHLDDARACSPPRPVAVNDAGVAAEASATAAGGGRYADLTALFCTAERCPVVVG
FT                   NDLVYRDDNHLTLEHAQALSPVIAALADRALAQG"
FT   CDS_pept        624340..624927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48850"
FT                   /db_xref="GOA:C1ASR8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR8"
FT                   /protein_id="BAH48850.1"
FT                   /translation="MTRIPQAELTGIYGAVVKRMSRKMLGDVPDGVGVVWHNRKVTNFS
FT                   FSLGRKIQKWDRCDENLKSFAHMAVASMVGCGFCLDYGYFQAHNKGLDETKAREVPRWR
FT                   ESDVFTPLERDVLEYAEAMTLTPPTVTDDLSARLLGALGPAALVELTAFIALTNFMTRS
FT                   NTAFGIESQGLAASCGLKPLSARPTTRTQPTS"
FT   CDS_pept        complement(624912..625352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48851"
FT                   /db_xref="InterPro:IPR021607"
FT                   /db_xref="InterPro:IPR023159"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASR9"
FT                   /protein_id="BAH48851.1"
FT                   /translation="MGYLHTARSKFTIASWSESVITDIDGEGTTAGDTYYPARGATRAD
FT                   VEYSYSGDIEGTSTVAYLIAYKADAAPVLGLERFEGSIGGHDGTCVFQHLGSQDQGSVS
FT                   ARIEVVPGMGTGGLTDLRGSADLSIAGPGDGGFEFVLSYDVG"
FT   CDS_pept        625418..626218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06050"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48852"
FT                   /db_xref="GOA:C1ASS0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS0"
FT                   /protein_id="BAH48852.1"
FT                   /translation="MPNVPGHPEAIVRPTADASGFEVERIAPRPDLAEFVDYHWLVRWS
FT                   VSKPHRQQVVPQPRVHIGAEDGQLLVHGISRSPFYRTLTGHGHVLGAAFHAGGFRPLLK
FT                   GSLGAISGTVQPGRDLLDGDDRPVAERILAGTDSAEMIDAFERYLLRTDPVPDPTGRQV
FT                   TALVGDAQRRRDIVRADQLAAHAGCSLRTLQRLFTEYVGIGPKWVIQRFRILDAAAAAH
FT                   SGERIAWSALAYELGFSDQAHLTRVFTQVVGTPPATYQRANGLP"
FT   CDS_pept        complement(626237..626449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48853"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS1"
FT                   /protein_id="BAH48853.1"
FT                   /translation="MSSSDTAGETEFPASMGKVSRRELASHGYTRFDQLTMVTAKELLK
FT                   IHGVGPKAIRILEEELAKRGLGFAG"
FT   CDS_pept        complement(626524..627114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06070"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48854"
FT                   /db_xref="GOA:C1ASS2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS2"
FT                   /protein_id="BAH48854.1"
FT                   /translation="MTQELGLDGVIRQRIRGLRVARGWSLDALAARCFLSPSTLSRIET
FT                   GHRRIALDQLVPIARALGTTLDQLVESVDDEDVVIRPMPEQTRGLTTWLLSRERALHGA
FT                   TVAKMRITPERPAGPEHVCVHPGHEWFTVLSGTARLQLGERTILIEAGAAAEFSTMVPH
FT                   SIGAHDGPVEILTIFDHDGERAHLHTADDAPPA"
FT   CDS_pept        627163..628014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48855"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS3"
FT                   /protein_id="BAH48855.1"
FT                   /translation="MTQHSHHHAHHHDEHTPAHETALADLLELDAEIFGSYLDQVAEWA
FT                   GRRVGEAPRRVVDVGAGTGVGSLALARRFPAAEVIAIDRSEVMLERVRAAALGQGMADR
FT                   VSGVHADLNAGWPAVEAADVVWAASSLHEVSDPDRVLRDMYAALNPDGVLVLVEMDALP
FT                   RLLPDDLGLGRPGLESRCHEALARMDWNAHPNWRAHVERAGFGDVEQRSFTSEARPAPQ
FT                   STGRYAHTFLRRVRSALDGQLAADDRDTLDRLLSDDGPDSVLHRGDLTVRGSRTAWTAR
FT                   RP"
FT   CDS_pept        628372..629529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48856"
FT                   /db_xref="GOA:C1ASS4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS4"
FT                   /protein_id="BAH48856.1"
FT                   /translation="MSMGVGLRIGSVVSTAVVASNDPGSPDPVVIVRDTVLHMCPDGTA
FT                   ILGGSAPHTIGDTHTVSGFLPRVGDPAGVAVGDGSRYRAEDLVAGAMRCLLRECEPLPD
FT                   HGGRTGGAPDIMATYPTRWDSAAVAALRDALDYADMSYLSLVSDAEAAAAWFESEIAER
FT                   PGQLVGIYHVDDTGSTVALIRSGVEAGKAFRFSSGGSPTAQIATALGAFGWLPGNLDAV
FT                   VVTGDGLIARDSAAVHGFAATIGEKFDVRCVVGPGPEQTSALGAAIRAAGFNPTTHKVT
FT                   PIGLPPSYDVTEVIDAVVGEPVPSTSPTPTRPATRTQNPATAAAVGASPARASGGTAVA
FT                   TPPEPRAVAQSGEDSDSASRASWLVAAAVGLALVLVAIVFVLFVL"
FT   CDS_pept        629626..631167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48857"
FT                   /db_xref="InterPro:IPR013493"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS5"
FT                   /protein_id="BAH48857.1"
FT                   /translation="MSESGSDPGRSPSGLRAARPAVAPPLRDDRLKLFSFATAEKRAEY
FT                   LWVLRAFDHARANYIVLLHAGDVARILDGLAGDDPAGQLGAGDVTPLLEQLHVWEVLER
FT                   SYDGTRAATLAEYLNRHFVYQFSQAGYQVFRAVEDALAARLDDASLSRLALPDLLADMN
FT                   DLAAANRAADNDLVYRKLNRLDATLSDMAGRAAQFYLTLGDLVRTTEITPETFMSHKDA
FT                   LLTHMREFSSDLSRYAPKLAAAIALVEDSGVEAMVARAAASDERVFLDVEEREADWRSR
FT                   WAGVTHWFVGSEAGPSESERLREGTMSAIAAVLSLLRRVTETRKGGVSRESQLRHLAGW
FT                   FAATPNEDAAHALFRAVFDLGRPRHLSMVHPDADIIPDTRSWWEAQPVEISRTLAETGR
FT                   PPSPGLPARVQRNEGSVRRLREEQLTAQRLRAAAAQSLARGGVYERELDEAETDVLLSL
FT                   LNAALTARVPVSGRVKSSTGSENGVKLTLSPHGESTVVRTARGRLHLDGLQVSVR"
FT   CDS_pept        631164..632552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48858"
FT                   /db_xref="InterPro:IPR013494"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS6"
FT                   /protein_id="BAH48858.1"
FT                   /translation="MKAREISPLALDSYQRAARVILSNHLVTQTYPDRIALPLLRRWAT
FT                   ELREDLMTLFGYRLEVTETTARLFTVSDRLDAGTPAKTATDRTFDRYRYAYLALALAAL
FT                   GRAGNQITLSELADHVAADAAQVEGVDLSTERASDRDAFVDAVGWLAARGAIALADGDA
FT                   GGWAANPDAGEALYDIDRSVVIALFRPPRALQHLRSIRGLLAGADSVTDEDTAETSRTV
FT                   DVKETTRRVRRALVERPVVYAADLDDHELVQLALPRTAADVELLTGLVAERREEGVAMI
FT                   DSSGRLSDVRFPGTGTVAQVALLLAGEIADRVLDPDAAETARMPLPRGRSEDLVEQVDG
FT                   AIPQSGIFDSLAGHDGVEPAEPAPADRLFPVVEDQWITDTVRTLTERFGRTFAAGWQAD
FT                   PDGLGRAALALLERLRLTASVPGGVLALPALARYRGVVVTIRDRTPEIDLFQSSANDSE
FT                   DITA"
FT   CDS_pept        632549..636706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48859"
FT                   /db_xref="InterPro:IPR013496"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS7"
FT                   /protein_id="BAH48859.1"
FT                   /translation="MTSARFRPTRAGIINLWDYRDQEFSFADGRLVLRGPNGSGKTKAL
FT                   EVLFPFVFDGRIEPRRLNPFAGEERTMKSNLLYRGQESAYSYVWMEFCRGAKDDPEAVT
FT                   VGIGMRASRTNDKVTRWYFVADGRVGVDFSLLGTDDRPLTKKQLGEQIGTDSITDRPLD
FT                   YRAAIDARMFGLGVQRYDQLINLILTLRRPQLAKNLDPKGLSQALTDGLRPLDEQLVLE
FT                   AARSFSDMEEVGRALEGLAAADQAAQSFVGVYAKYLRQQARTDVDQLATRLDAVRSGIT
FT                   ALHGAAADRARSQESREAAEERFTVAERALDQANATLDALKRSTAYEGRTQLDDLAQAV
FT                   STLEKSTALQAEKARKAKATLEQRSEEHEKAGDAVTRAVEALAHAEDELHVAAEDAGIT
FT                   WTALPDTARADQLTAALRGHAEERDGDLRAVRAALATVERAATERTRADDAARRGQEQL
FT                   DTAKVAVLEAETAVESARSRCATELRSWWTEQSSLYAEIEAPAALFDALDTALRGIGDE
FT                   DAATLSETLTEQTRDAVDALRMRRQQYDRDAAAAAEAIAEYESVRAAIESEHDDAPPLP
FT                   AGRHDTRSGLTGAPLWRLVRFADGVDAAVAAGIEAALEAANLLDGWVPVDDALPDVESE
FT                   QFLVALPAGDRPTGRTLADVLEVEQDTGVPDDRVRGILESIALESLDPAEGPVGVAQDG
FT                   GYRQGIQRGRHTKSDAEYIGTTARARRRAARLVELDRTLAETRATLDDTRASAEAVAEL
FT                   LTRTTAAARALPRTGSILTALKKVTESAGALRSRTDTATAVGRELDQAIADLSAKEKQL
FT                   RATASTHRTPHVAREIDSLAAAVRHFEKQGEMVQRCRREHGKEVEHTRQSEDRLHEARG
FT                   NAEEYAEEAAVAEEVLAQQIQRLGTLRDTLGAGAEELDRQLEEAHARIEACKKEQRDAR
FT                   KADKDAGEAIGKAEGAYNTAVQTLRLALTETHADAAHLAPYARRDLLELLGVDGGHTWP
FT                   ASAAAWMSAEQLVYRIQNAGQDIPILPPEVDALFRALDSATDSVRVSDSARKSTRTALT
FT                   TALQDFDAQLAAAGQDYRLQWDAPDGLTVVQVQDDEGYSSIGEFAARIASARSDQELLL
FT                   TESERRILEDALLTGLAQQIHERTVDARELIARMGTEMRERRMSSGNTIGVHWVLADNL
FT                   DDSAKAISKLLERDTSALGPDELATMRAHFAHQIRTARAAHPERSYPEILASALDYRRW
FT                   RVFSFTLISGNGTEDRLTVARHSALSGGEQSVSLHLPLFAAAHVMLDSADPHAPRLLAL
FT                   DEAFAGVDDNGRAELLGLSVQFDLDLFMTGFDLWITYGGVPGCAHYDLAHSTAEQSVSA
FT                   TLLVWSDGELLAEHDGTDLAQALGSPLRRRVPTPAEGALEFA"
FT   CDS_pept        complement(636746..637993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshC"
FT                   /locus_tag="ROP_06130"
FT                   /product="cysteine--1D-myo-inosityl
FT                   2-amino-2-deoxy-alpha-D-glucopyranoside ligase MshC"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48860"
FT                   /db_xref="GOA:C1ASS8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017812"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASS8"
FT                   /protein_id="BAH48860.1"
FT                   /translation="MQSWSETAVPSVPGQGPPLRLFDTADRQVRPVTPGRTATMYVCGI
FT                   TPYDATHLGHAATYLTFDLVNRIWRDAGHDVHYVQNVTDVDDPLFERANRDGEDWVVLG
FT                   MRETALFREDMEALRVLPPRDYIGAVESIGEVIEMVEKFVASGAAYVVDDPEFPDVYFR
FT                   ADATEQFGYESGYDRATMDTFFAERGGDPDRPGKQNPLDALVWRAARPGEPSWPSPFGP
FT                   GRPGWHIECSAIALNRIGSGFDVQGGGSDLIFPHHEYSAAHAESATGDRRFARHYVHTG
FT                   MIGLDGEKMSKSRGNLVFVSKLRGEGVDPAAIRLGLLSGHYRQDRPWTEQVLADAHTRL
FT                   QLWKDAAALESAQSATDTIARLRQHLADDLDTPKALDALDGWARRALDNGGSDTNAPTE
FT                   FAAAVDALLGVRLRRP"
FT   CDS_pept        complement(638066..638869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48861"
FT                   /db_xref="InterPro:IPR022292"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASS9"
FT                   /protein_id="BAH48861.1"
FT                   /translation="MPAEESDPLESGELTLIGQITHASNATLVCDAAAGENTVRCVYKP
FT                   VRGERPLWDFPDGTLAGREYASYLVSEQLGWGVIPRTLLRDGPFGPGMVQRWVDTPDRH
FT                   ADDTGGLDLVDICAPDAIPEGWFEILRATDMDGEPVALIHADDPRLQRMAVLDVLINNA
FT                   DRKGGHALEGLDGSVYGVDHGICLHTENKLRTVLWGWAGTDVPGALVVDIAELISSLEG
FT                   DFGARLGEHITSDEVAALYERAVDLLAAPVMPRPNGHRPIPWPAF"
FT   CDS_pept        complement(638873..639466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48862"
FT                   /db_xref="InterPro:IPR021441"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST0"
FT                   /protein_id="BAH48862.1"
FT                   /translation="MSRAIHVFRTPDRFIAGTVGEPGDRSFYLQAVHEARVISVLLEKQ
FT                   QVQVLADRMGLLLEEVHRRFGTDVPPEGAELDDSSPLVTPIDAEFRVGTMGLGWDADAG
FT                   AVVVELLAVSETEFDESVVLDDSEDGPDAVRVFLTPLQARDFSLRSERVIAAGRAPCPL
FT                   CGEPLAPEGHICIRTNGYRRGQSFGLTPEMDEED"
FT   CDS_pept        complement(639592..640290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06160"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48863"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR022492"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST1"
FT                   /protein_id="BAH48863.1"
FT                   /translation="MTVVLLRHGRSTSNTAHTLAGRSPGVELDDRGREQAQAIVARLAD
FT                   VAIEEIVRSPLVRCEQTVEPLARARGLTPVVEHRLVEVDYGEWTGRELKVLLEEPLWKI
FT                   VQQHASAAVFPGGEGLAQVQARAVAAVREHDARLAELHGRDVVWVACSHGDVIKSVLAD
FT                   ALGAHLDGFQRIVAEPASISVVRYTSTRPYVLKMNDTGADLSGVNTPPVSGDGARAEVS
FT                   GSVPGGEVRL"
FT   CDS_pept        complement(640331..641179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="ROP_06170"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="protein synonym:undecaprenyl pyrophosphate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48864"
FT                   /db_xref="GOA:C1AST2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST2"
FT                   /protein_id="BAH48864.1"
FT                   /translation="MMGEAMTWLQAIVLGAVQGLTEFLPISSSGHLRIVSEIFFGDDAG
FT                   ASFTAVTQLGTEAAVLIYFARDIGRIIAGWFRGLFHAEHRSDLDYRMGWYVIIGTIPVG
FT                   VLGFLFKDQIRTGARNLWLIATMLIVFALVIAAAEYYGRKVRPVEDLRAKDGIIMGSAQ
FT                   ALALIPGVSRSGGTISAGLFLGLTREAAARYSFLLAIPAVVASGLFSLPDAFEPAGEGL
FT                   NASGPQLLVATVIAFAIGYASIAWLLRFVVDHSMYWFVGYRIILGVVVLSLLATGVVSA
FT                   T"
FT   CDS_pept        641413..642342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06180"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48865"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST3"
FT                   /protein_id="BAH48865.1"
FT                   /translation="MEQRSVGASGLRVSRLGLGTLTWGRDTDGDEAAAQIAAFVDAGGT
FT                   LVDTSPAYGDGAAQRILAELLDDVVPRTELVLSSSSGINPAGPSRIDCSRRGLVAQLDA
FT                   TLRELGTDYLDMWQVATWDPFTPVDEVAATLDFAVSSGRVRYVGARGYLGWQLATAAGA
FT                   SRSTTLVATQVEYSLLARGVEEELVPAAAHHGVGVFAAVPLARGVLTGKYRNGIPVDSR
FT                   GADEAHAQDVQSYLTDSSVRVVDAVVTAADGLGTSPLAVALAWARDRPGVASAVVGARD
FT                   IAQLTGVLVAEELELPAAIAAALDDVSA"
FT   CDS_pept        642439..643125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuO"
FT                   /locus_tag="ROP_06190"
FT                   /product="putative heme oxygenase"
FT                   /EC_number="1.14.14.18"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48866"
FT                   /db_xref="GOA:C1AST4"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST4"
FT                   /protein_id="BAH48866.1"
FT                   /translation="MTTLNEADAADRGTVGFAERIKAGTDAAHRETEQSRFVGALLAGE
FT                   LTSDGYAELLAQTYLVYRELEDAGRAHAGSPVVSPFLHDELLRVPSLEADLAFLRGPSW
FT                   RDTVSALPATTRYVERLREVAYEWPAGFVAHHYIRYMGDLSGGQIIRRMLERAYGYSTD
FT                   GLQFYIFDEIPKPKVFKDGYRAKLDAAPLSPEDQRRVIDEVNLAYRLNGALFADLEAGI
FT                   DRYLAR"
FT   CDS_pept        643122..644162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="ROP_06200"
FT                   /product="putative hemin ABC transporter hemin-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48867"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST5"
FT                   /protein_id="BAH48867.1"
FT                   /translation="MKSMFRAFTNRSLFAVLVLLLVSVVAVSACSSGAGDNAGGTGGAR
FT                   TAVLDDLNPEPLASAATPALPVTVRSFDGVDVTITDASRIVTADRYGTLTETVFALGLG
FT                   DNVVGRDIASEFPAAQHVPVVTPGGQSLNAEAILDLAPTVILTDTSIGPQAVQDQLRAA
FT                   GVPVVYFDPTRTLDGVPGQITAVANALGVPEQGRELADRTENEIAAARSRAPEGENPLK
FT                   IAFLYLRGTAITMIGGPGSGADSLIDALGAVDAGTASGITQQFAPITSEALIAAAPDVL
FT                   LLMTGGLESIGGIEGLEKIPGVAQTPAGRNQRVVDMQDGVLLSFGPNTGRVLGALADAV
FT                   YPAATR"
FT   CDS_pept        644159..645229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="ROP_06210"
FT                   /product="putative hemin ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48868"
FT                   /db_xref="GOA:C1AST6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST6"
FT                   /protein_id="BAH48868.1"
FT                   /translation="MTVEDLDAPGKSSPRTRTGAVLGGLLIALAVAAVFSACIGQVPTG
FT                   PGEVVGSILHRIGLDLGPMPAHPSGEVTLWEVRFPRVVLAILVGAALGCAGALLQGVFA
FT                   NPLAEPGVIGVSAGAAVGASAAIVVGAFAAGWTVAGAAFVAGLVTTVAVYLLARHEGRT
FT                   EVVTLVLTGVAVNAFAGGLIAFFTFVASPAARDQIVFWQLGSLNGATWSAVAVVAPMTV
FT                   AGIAATMMIAGKLDLLSLGENAARHLGLDVERLRQIAVLIVALLVSSSVAFTGIILFVG
FT                   LVVPHLMRIAVGPGHRALIPASALCGSLVLLLADLGARSLVANADLPLGMLTALVGGPF
FT                   FFWLLRRTRASQGGWA"
FT   CDS_pept        645226..646104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="ROP_06220"
FT                   /product="putative hemin ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48869"
FT                   /db_xref="GOA:C1AST7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST7"
FT                   /protein_id="BAH48869.1"
FT                   /translation="MSPSFHPLRTRVGEALDQNLFRRTDPVPPPRPSGAVTLRAEGIAV
FT                   TRGGRPVLDDVSVDVRIGEVLVLVGPNGAGKSTLLAALSGDQDVHAGSVELDDRDLGEW
FT                   TALEMAQRRAVLPQQNTVGFSFTARQVITMGRSPWARTPRSDDDAAAIAEAVRICDVVA
FT                   FADRPFTALSGGERARVALARVLAQRTETILLDEPTAALDLGHQETVMRLARSRAEQGT
FT                   AVVVVLHDLALAAAYADRIVVLEQGRVAADGPPRDVLSEGLLTRVYGHPVEVIAHPVTG
FT                   ATLVLPRRDHR"
FT   CDS_pept        complement(646115..646510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48870"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST8"
FT                   /protein_id="BAH48870.1"
FT                   /translation="MVSRPPAQVIEEQTVEAPETPTFTVEDISVGPHAHGFGRTAEGNS
FT                   YAFRVRKSTMHVEVYRADVETEVPDPDDVVASARRSVREIDLTDERSIVAVVRDAVSDP
FT                   DSLSARPEDGITVRAVLSRLGAVIDGL"
FT   CDS_pept        646653..647663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48871"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1AST9"
FT                   /protein_id="BAH48871.1"
FT                   /translation="MGRPGARVVASCIGAAFLLVTGCSSNSDEDQAITIAPASAAQSPA
FT                   QSTAPAGVVHPVGLPIDSTTFDPETRTTVVLGGEGNQILLFPVGDFTAAPRTIPLDGAV
FT                   AQVSLAPGGVALLAMNTQVGRLDLRTGEVTFVPADGDVRSVAQLPDGRLAMGLGNGEIH
FT                   IVNTETNESQVIDGLTSVDGLAVVGDSLTALDRGQTSVTAVDVPGSALGVALRAGEGAT
FT                   QLTTDHYGRILVTDTTGDELLAYTTDTLMLRQRFPAGLAPYAVAYDDTADRAWVTLTGT
FT                   NEVVGFDLSSGVGVETARYPTVRQPNSVTVDTVNGDLLIGSATGDGLQQIPTRSS"
FT   CDS_pept        647664..647903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48872"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU0"
FT                   /protein_id="BAH48872.1"
FT                   /translation="MASHSRRLPSGWEIESEDYEYVPLRLPPDVTRVSASMRLALQAEF
FT                   GGWELSRVRLYSDGSRRVLLKRKKTAHHVPDPAI"
FT   CDS_pept        647914..648984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="ROP_06260"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="protein synonym:dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48873"
FT                   /db_xref="GOA:C1ASU1"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASU1"
FT                   /protein_id="BAH48873.1"
FT                   /translation="MYHLLLRVMFRLPPERIHHLAFAAMRLVTRFSPLRQLVGRVLVVD
FT                   DPVLRNTVFGLDFPAPLGLAAGFDKDATGVDAWGPLGFGFAEVGTVTAQAQPGNPAPRL
FT                   FRLPADRALINRMGFNNHGAGNAANHLRQRRAGVPIGANIGKTKIVDAADAPADYTASA
FT                   HLLGPLADFMVVNVSSPNTPGLRDLQAVESLRPLLRAVLDSVTVPVLVKIAPDLSDDDV
FT                   DAVADLALELGLAGIVATNTTIRRDGLNTPDDEVTAIGAGGLSGPPVAERSLEVLRRLH
FT                   ARVGDRLVLISVGGIETVDQAWERILAGASLVQGYTGFIYGGPFWARRIHKGLARKVRE
FT                   AGYSSVADAVGAGAVR"
FT   CDS_pept        complement(649055..649585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48874"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU2"
FT                   /protein_id="BAH48874.1"
FT                   /translation="MSHDPYEALPDLPSFELTSTDVTDGQPLNKEQVSGIFGAGGHDNS
FT                   PQLSWSGFPAETKSFAVTVYDPDAPTASGFWHWAVANIPADTTTLVSGAGDDDGTGLPS
FT                   GAITLKNDAGLSRFLGAAPPAGHGPHRYIIVVHAVDVEILDGVTADSTPAFLGFNLFSH
FT                   AIARAKIQGTYEQ"
FT   CDS_pept        complement(649620..650972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06280"
FT                   /product="peptidase M20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48875"
FT                   /db_xref="GOA:C1ASU3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU3"
FT                   /protein_id="BAH48875.1"
FT                   /translation="MPTTQETPGQGRAEAEVVDLVSSLIRFDTSNTGELATTKGERECA
FT                   EWVASQLQEVGYETEYVESGAPGRGNVFARLKGSDPDRGALLLHGHLDVVPAEPADWRV
FT                   HPFSGAVEDGYVWGRGAVDMKDMVGMILAVARQFKAEGVVPPRDLVFAFVADEEAGGKY
FT                   GCQWLVENRPDLFEGVTEAVGEVGGFSLTVARPDGTDRRLYLVETAEKGLGWMRLTAKG
FT                   RAGHGSFLHGENAVTILAQAVARLGAHTFPLVMSDSVAEFLAAAGEETGLDFDPESPDL
FT                   DGTLAKLGTIANILGATLRDTANPTMLSAGYKANVIPQTAEAVVDCRILPGRQAEFEAT
FT                   VDELIGPDVTREWITKLDSYETTFDGHLVDAMNDAILAHDPGARTVPYMLSGGTDAKAF
FT                   AKLGIRCFGFAPLQLPADLDFSALFHGVDERVPVDALLFGTRVLEHFLLHS"
FT   tRNA            651084..651169
FT                   /locus_tag="ROP_t0010"
FT                   /product="tRNA-Leu"
FT   CDS_pept        651243..652697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48876"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU4"
FT                   /protein_id="BAH48876.1"
FT                   /translation="MGETTTTIDPADLEICLKVLDLAAELDDADPDSVTVQRAVGHLFK
FT                   KLKKRRRIAARDAVSEADRKVVAATATGSPDRIDDETAGIPLTSNADGASAGTLIRPRP
FT                   CYICKQRYTRVDAFYHQLCPECATKSRAKRDARADLTGRRALLTGGRAKIGMYIALRLL
FT                   RDGAHTTITTRFPNDAIRRFKAMEDSSEWIHRLRVVGIDLRDPAQVVALADSVAAQGPL
FT                   DILINNAAQTVRRSPGAYSALADAESGALPSGDLPDVLTFGKTSDAHPAALAGSLSDVS
FT                   VMAGAALSPDAVSSLALVAKSASPDRIDQGLAIDAGGLLPDLAHTNSWVQTVEEVDPIE
FT                   LLEVQLCNSVAPFILVSRLRPAMAAAGARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAK
FT                   AALNMLTRTSAKEMLEDGILMTAVDTGWITDERPHYTKMRLADEGFHAPLDLVDGAARV
FT                   YDPIVQGEQGVDLHGCFLKDYEPSPW"
FT   CDS_pept        652875..653219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06300"
FT                   /product="putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48877"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU5"
FT                   /protein_id="BAH48877.1"
FT                   /translation="MQRREQLLVLHVLDDDPGQDAESDRSALRAEIQATLEGGGVGESS
FT                   WELRTGEHDGDQVSALRALVDNSGADLLVVGTRRMSPVGKFLLERWLQRLLLEVDIPIL
FT                   VVKEEARGSA"
FT   CDS_pept        653307..653717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06310"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48878"
FT                   /db_xref="GOA:C1ASU6"
FT                   /db_xref="InterPro:IPR021218"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU6"
FT                   /protein_id="BAH48878.1"
FT                   /translation="MGSVVFYEVVADATVVAHLTFILYVVCGGFLAWRWPRTIVVHLAA
FT                   VAWGFTGLIVGIDCPLTHLESWARVRAGQDPLPSSGFISHYLTGVVYPESAAGAIQTLV
FT                   ALCVVTSWAGYVVLRTRTRTPLAPTRPGGAEL"
FT   CDS_pept        653753..654997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48879"
FT                   /db_xref="GOA:C1ASU7"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU7"
FT                   /protein_id="BAH48879.1"
FT                   /translation="MTDSARELDLVVYGATGFVGKLLADYLAQHAPDGVRIALAGRSAA
FT                   KLEAVRSALGPRAADWPVLVANSDDAASLATLAGRTRVVATTVGPYAKYGHALAAACAA
FT                   AGTDYVDLTGEVLFARESIDANHERARETGARIVHSCGFDSIPSDLGVHVLHAKVREDG
FT                   AGELTDTTLVVTSLRGGVSGGTIDSLRTQVDVSKKDAASRRLAASPYSLSPDRSKEPDL
FT                   GKQSDMGVVDGKTIAPGVKGWKAPFFMGPYNTRVVRRSNALRDWAYGREFKYREVMNVG
FT                   SSPITPVIAGAVTAGLGAMIAGMALPPTRYVLDRVLPSPGDGPSEEAQRNGHFTVDLYT
FT                   TTTTGAHYTSRVKAKGDPGYRATAVMLGESALSLVLGGDALPDAAGVLTPATALGDVLV
FT                   ARLRDAGMEISARKL"
FT   CDS_pept        655260..656225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06330"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48880"
FT                   /db_xref="GOA:C1ASU8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU8"
FT                   /protein_id="BAH48880.1"
FT                   /translation="MFKLLIFTLVGVGAQLVDGALGMAFGVTATTLLVFSGVGPAHASA
FT                   AVHFAEVGTTLASGASHWRFRNIDWPLVLRLGVPGAIGAFLGATVLSQLSTAAAVPVTS
FT                   TILLAIGVYVLLRFSIRPPAVNDARTSPHTAKFLSPLGLFGGFIDASGGGGWGPITTST
FT                   LLSRGKTAPRTVIGSVSASEFLVSAAASIGFIFGLGSDFFDNIPIIAGLALGGIIAAPV
FT                   AAWLVSRVPATLLGTGVGGIIIITNAQKLFKTFEVTGVVATLGYIALVAVWAGLLVVAW
FT                   RRSRLSAAEAAGDLHRIDTEIDTPSEPETQSLEPSTGEKA"
FT   CDS_pept        656358..658538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcB"
FT                   /gene_synonym="aceB"
FT                   /locus_tag="ROP_06340"
FT                   /product="malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48881"
FT                   /db_xref="GOA:C1ASU9"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASU9"
FT                   /protein_id="BAH48881.1"
FT                   /translation="MTERVEVGGLQVAKVLYDFVNEEALPGTGIDVDGFWSGAVKVIED
FT                   LAPRNRSLLAVRDDLQARIDTWHRDHTGTPDPAEYRQFLTSIGYLVPEPGPFAVSTANV
FT                   DAEITSTAGPQLVVPVLNARFALNAANARWGSLYDALYGTNAIGVDGGAEPGDSYNRVR
FT                   GDRVIAWARNFLDTAAPLRSGSHADAARYTVDGGALAVALADGTSTGLADPGKFVGYLG
FT                   DPAAPSSVLLRNHGLHAEIQIDPTSPIGQTDAAGVQDVVLESAVTTIMDFEDSVAAVDA
FT                   DDKVIGYRNWLGLNRGDLTEELTKGGQAFTRRLNPDRTYTAPDGGELTLHGRSLLFVRN
FT                   VGHLMSTPAILHPDGTEIPEGILDALLTSLCAIHGLSRSEQTGPLDNSRTGSIYIVKPK
FT                   QHGPDEVAFTTDLFGRVEQVLNLPANTIKVGIMDEERRTTVNLAACIHEARERVVFINT
FT                   GFLDRTGDEIHTSMEAGPMIRKAEMKQQTWISAYEDWNVDIGLACGLQGRAQIGKGMWA
FT                   MTELMAEMLEQKIGHPKAGANTAWVPSPTGATLHATHYHQVDVFAVQDELKGTRRAGLD
FT                   QILTIPLAPDTDWTEEQKQEELDNNCQSILGYVVRWIDAGVGCSKVPDIHDVALMEDRA
FT                   TLRISSQLLANWIRHGVVTAEQVVASLQRMAPVVDRQNQGDPTYRPLAPDFDTNIAFQA
FT                   AKELILDGTTQPSGYTEPILHRRRREYKAANA"
FT   CDS_pept        658665..660452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48882"
FT                   /db_xref="GOA:C1ASV0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV0"
FT                   /protein_id="BAH48882.1"
FT                   /translation="MGQHRGESRARGISKGPLIVLGLVVVLVLGVLGWFQLRDRINDQG
FT                   AAAAGACVEGESVLAVAADPDIAPQLQTLADHYAETAPVIRDQCVSVTVTAVASDTVRD
FT                   ALAAGPDGPWDAAAFGPRPALWIPSSSHSVKQLSATGVISGEARPLASSPVVLAVRTAF
FT                   ANAPGTAALDWKDLPSLQSGRDALATLGLPGWGGLGLALPVGPGAESTEMAVEAVAAAV
FT                   TGSSTGPVTEEQARSVPVTSALTDLALGYEASTGAKPATTREALTALAEQGDPATSAIH
FT                   AVATTEQQVYQALRDAPGADITTSMPKGPTPVADHPAAVLAGPAVDETQSRAAAQFAEF
FT                   VRRPEQAQVLADAGFRVEGLARPDDTTLAFPGVESALVPADAAAAAELMQVIRNPISPR
FT                   TSTILLDVSSSMGEREGTSTRLANTTMALAAHVDQSPDSSNLGLWEYSTTLDGSRPYTT
FT                   VVATGPLSAGGFTEGTRRQALDARLARATSATGSSTYTSLEAAYKSAVDGYTPGRTNSV
FT                   LLVTDGANDDSVSRAELLSAIAASSSMSKPVRIDVVTIGENPDLNTLQALADRTGGSLE
FT                   KVTTSDGAALPTAISKLLS"
FT   CDS_pept        660449..661603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48883"
FT                   /db_xref="GOA:C1ASV1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV1"
FT                   /protein_id="BAH48883.1"
FT                   /translation="MTRLLVFAVFLALVTWWLHRRLVRATGLGRPWSVIVDLALVALWV
FT                   LAVIGVGSGEAFDPGWARPPGWAGWVWLGAMFYLVLGLLLVAVVSLLTRLFARVRGGGH
FT                   DEQVDLSRRRGLRIATAVVVVGAVGAAGYGVREAARPRIVRVRVPLQRLPAEFEGVRVA
FT                   LVSDLHVGPARGVDFTRRVVDLVNAERPDLVAIAGDLVDGTVAKVAPDLQPLGDLEAPL
FT                   GVFGVSGNHEFYADDGGRWLDVWDRLGIRTLRNEHATLTRGGAAIDIAGIHDYSSPAPY
FT                   EPDLPAALAGRDPSTFVVLLAHEPRQALEASDLGVDLQLSGHTHGGQMWPLGYLVPLQQ
FT                   PSVTGLDRIGNTVLYTTRGVGAWGPPVRVGAPPEITILELVRAD"
FT   CDS_pept        complement(661646..664498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="ROP_06370"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.4.4.2"
FT                   /note="protein synonym:glycine cleavage system P-protein"
FT                   /note="protein synonym:glycine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48884"
FT                   /db_xref="GOA:C1ASV2"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV2"
FT                   /protein_id="BAH48884.1"
FT                   /translation="MIDAGSRTFADRHVGPNAAELAHILELVGADSLDDLASKAVPAVI
FT                   LDGVTGGIADGLDALPAPVSEHEALAELSALAAQNTVATSMIGLGYYDTLTPPVLIRNI
FT                   IENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGMEVANSSMLDEATAAAEAMTLL
FT                   RRASKSKSPRFVVDADLFPQTLAVVETRAEPLGIEIVVADLSAGLPDGDFFGVLGQMPG
FT                   ASGRIADYTDVIAAAHERGALVAVGADLLALTLLTPPGEIGADACFGTTQRFGVPMGFG
FT                   GPHAGYLAVHTKHARQLPGRLVGVSVDADGDKAYRLALQTREQHIRREKATSNICTAQV
FT                   LLAILAAMYASYHGAEGLKAIALRVAATAHSLAAALRGTGATVVHEHFFDTILVRVDGR
FT                   AADVVAKAKDAGINLRLVDADHVAVACDEATTDDDVARVLAAFGGDGPVAREAGTSVPE
FT                   SQLRGSDYLQHEAFTRYRTETAMLRYLRALSDKDIALDRSMIPLGSCTMKLNATAEMEA
FT                   ITWPAFAGLHPFAPTGDTPGILRIIKDLENWLVAVTGYDAVSLQPNAGSQGEYAGLLAI
FT                   RNYHLSRGDDHRDTCLIPSSAHGTNAASAVMAGMRVEVVACRPNGDVDLDDLRAKIADH
FT                   AERLAAIMITYPSTHGVYEHEIADICAAVHDAGGQVYVDGANLNALVGLARPGRFGGDV
FT                   SHLNLHKTFCIPHGGGGPGVGPIGVRSHLTPFLPGHPLAPELGTAGPISAAPYGSASIL
FT                   PITWAYIRMMGAVGLRRASLTAIASANYIARRLDEYFPVLYTGEGGMVAHECILDLRPI
FT                   TKDTGVTVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESENLEEIDAFCEAMIAIRAE
FT                   IDRVGSGEWTVDDNPLRGAPHTAGCLAAEWNHPYTRETAVFPRGKARPKVWPAVRRIDG
FT                   AHGDRNLVCSCPPISAFEGA"
FT   CDS_pept        complement(664861..665481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06380"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48885"
FT                   /db_xref="GOA:C1ASV3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV3"
FT                   /protein_id="BAH48885.1"
FT                   /translation="MGDRPQENALNLAPGDNVAEPEFSSEEIQPGLFPDDSVPDDLVGY
FT                   RVPIACQIAGITYRQLDYWARTSLVVPSIRGAAGSGSQRLYSFKDILVLKIVKRLLDTG
FT                   ISLQNIRVAVDHLRKRGVRDLAKITLFSDGTTVYECTSAEEVVDLLQGGQGVFGIAVSG
FT                   AMRELTGTIADFPAERADGGESEQSPEDELASRRKNRASRKTG"
FT   CDS_pept        complement(665762..666235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48886"
FT                   /db_xref="GOA:C1ASV4"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV4"
FT                   /protein_id="BAH48886.1"
FT                   /translation="MSEMHVIGVRVEQPQNQPVLLLRETDGERYLPIWIGQTEATAIAL
FT                   EQQGVEPARPLTHDLIKNLIEAFGRTLKEVRIVDLREGTFYADLVFDQNTRVSARPSDS
FT                   IAIALRVGVPIFAEEAVLTEAGLVMPDEREDEVEKFKEFLESVSPDDFKATDG"
FT   CDS_pept        complement(666379..667119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06400"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48887"
FT                   /db_xref="GOA:C1ASV5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV5"
FT                   /protein_id="BAH48887.1"
FT                   /translation="MTAVRQQQAHSGMSIGSVLDRLRPDFPDVTISKIRFLEAEGLISP
FT                   QRTPSGYRRFSIADTERLRYVLTAQRDQYLPLKVIKEQLEAIDRGVATVGAGDSSPRRP
FT                   RALTVAPGEVSPEEFRTDREVRISRDDLISRAGIDEKFLVELTRGGLVVPGPAGFFDED
FT                   AVTLARTARAMSEFGLEVRHLRAFKLAADREAGLVAQIAGPVAKGRDAGARDRAEEMVR
FT                   ELAALSLTLHTCLVKSAVRGALDR"
FT   CDS_pept        complement(667116..667616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="garA"
FT                   /locus_tag="ROP_06410"
FT                   /product="putative signal transduction protein GarA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48888"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV6"
FT                   /protein_id="BAH48888.1"
FT                   /translation="MSENGNDAVYGETPAETTSVFRADFLNELDNSSATQAPEAPVSGV
FT                   EGLPAGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQEDDE
FT                   FQVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPRTTAGGSQIGETSAGA
FT                   GSQ"
FT   CDS_pept        complement(667938..668342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="ROP_06420"
FT                   /product="glycine cleavage system H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48889"
FT                   /db_xref="GOA:C1ASV7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV7"
FT                   /protein_id="BAH48889.1"
FT                   /translation="MSELEIPADRRYTAEHEWVERTGPTTVRVGITDFAQSQLGDVVFV
FT                   QLPAVDEDVTAGESFGEVESTKSVSDIFAPLTAKVVAANADLDGNPELVNSAPYGQGWL
FT                   VELGVDDEAALDAALAEMLDAAGYADLTAG"
FT   CDS_pept        complement(668385..669131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06430"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48890"
FT                   /db_xref="GOA:C1ASV8"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV8"
FT                   /protein_id="BAH48890.1"
FT                   /translation="MSGHEGRHELHGTEPTTSRRSHVVFALLAALLLGGLGIAIVTQVK
FT                   NTGSGDTLDSASPADLLVVLDTLNQREAALRQEIASLEQTLATLQQSGSSGAALDEAQA
FT                   RLTALSIQVGSAPATGPGVTMRITDPNRGVGSEVLLDLVQELRAAGAEAIQVQGADGPP
FT                   IRIGVDSWVSGSAGGVSVDGRKVNAPYGVVAIGDPPTLAAALNIPGGVVDTVARSGGQL
FT                   TIEQSQQVTISALREAKPRQYAQPGN"
FT   CDS_pept        complement(669139..669501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48891"
FT                   /db_xref="GOA:C1ASV9"
FT                   /db_xref="InterPro:IPR009709"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASV9"
FT                   /protein_id="BAH48891.1"
FT                   /translation="MKAALKGGSAIYGVLALIVGIVLGVVFSPQVPDAVQPYLPIAVVA
FT                   ALDAVFGGLRAYLDEIFDSKVFVVSFVFNVLVAALIVWLGDQLGVGTQLSTAIVVVLGI
FT                   RIFGNAAALRRRLFGA"
FT   CDS_pept        complement(669534..670397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06450"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48892"
FT                   /db_xref="GOA:C1ASW0"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW0"
FT                   /protein_id="BAH48892.1"
FT                   /translation="MKRTESGVRRNPVPSLLQSLMNDHLDPGYEGAAEDREHGHSRQTR
FT                   VGRQVWIAIGALLVGLVLSVAYRQATERIPGTEQVRSELLSKVQDAEDRAGALAATRDT
FT                   LSAQADDARATALAGDARGAALLDELRGLEGDAGVEAVHGPGLTVTLTDPAAKPNLSDS
FT                   SQRSVGGKAVVLDRDLQSVVNSLWAGGAEAIAVGDVRIGPSVTIRQAGGAMLVDNQPVF
FT                   SPYVVSAIGPQGPMQTGFVVSDAYLRMSSVAQLYGIGFAVAEADDLHLPAAPAREVRAA
FT                   REAGTR"
FT   CDS_pept        complement(670397..671020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06460"
FT                   /product="putative phosphatidylglycerophosphate synthase"
FT                   /EC_number="2.7.8.5"
FT                   /note="protein synonym:CDP-diacylglycerol--glycerol-3-
FT                   phosphate 3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48893"
FT                   /db_xref="GOA:C1ASW1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW1"
FT                   /protein_id="BAH48893.1"
FT                   /translation="MNSVDRDTARSDRIVTVPNLLSVVRLLGVPLFVYLLLVTHSDGWA
FT                   LAILMISGFTDWLDGKLARILDQSSKLGALLDPFVDRLYVVTTLVTFVVRGFIPWWVAA
FT                   ILIGRDAVLALTLLIYRRRGLPPPDVMYLGKGATFLLMFALPMTLAAQGDWSIATVAQP
FT                   LAAALLVWGTVLYVWTGLLYTVNAVTVARTVPARGSGGDEREAR"
FT   CDS_pept        complement(671153..672211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48894"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW2"
FT                   /protein_id="BAH48894.1"
FT                   /translation="MTFFESLARKLDRTGVDPVVWHAPPPPPLTGVLAPNGVLDGVHRW
FT                   ALPAGEGPEDVAVDHDGRVVTGGNDGRIWRFDSRGDATELANTGGRPLGVEVLDDGRYL
FT                   ICDAERGVLRVDEKGRIDVLADTAVGRPLVACNNSAVGRDGTVYFTDSSAHFTIADHRY
FT                   DLLEHRGTGRLLRLDPRTGETDLLAEGLQFANGVGLASDESFVLVAETGSYQISRVDLA
FT                   GPSQGSTSVWAENLPGIPDNMTSQTHDGLFWVALYSPRMRLLDLLAPYPALRIVAANLP
FT                   EAVQPNPVHAGWVVALDQRGRIVHSLRGGKGSYAPVTGVREHDGWLYLGSLTADAVARV
FT                   PAPPRPHIAAGE"
FT   CDS_pept        complement(672253..672873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48895"
FT                   /db_xref="GOA:C1ASW3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW3"
FT                   /protein_id="BAH48895.1"
FT                   /translation="MMVDGHVLSRERLADALARFEPRIVDPTNRRSAAVVIAVMNDGAD
FT                   GQAVPLTRRPSKMRAHPGQFALPGGGVDPGETGADAARRELHEELGLDVGPSAVLGRLD
FT                   DYVTRSGYVITPFVVWSEQSIASLVPNHEEVAEVFSVGVAEIDAEPRFVEIPESSKPVI
FT                   QWPFRRHLVHAPTGAVVYQFREVALHDRHTRIDGFDQPVFAWR"
FT   CDS_pept        complement(672952..674472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06490"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48896"
FT                   /db_xref="GOA:C1ASW4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW4"
FT                   /protein_id="BAH48896.1"
FT                   /translation="MRLTDYLDKGASLGPSSPCLTMGERTLSYADVQDLSRRVAAALAR
FT                   SGIAAGDKVAVLSGNDPTAFSCVFGISRAGAVWCPINPRNEAAENRDLLDLFDCRCLIF
FT                   QKAFAPLVDRIREQLPLLTTLVCLDGDETYAESFDTWLGAARLDAEPVDDLALIVGTGG
FT                   TTGRPKGVMLTGRNIETMSALTLMSYPFDGRPVYLALAPLTHAAGVLCFPILTLGGQVV
FT                   IMPAPDLGQFLAHIDRDRVTHTFLPPTLIYMLLDHADLETTDLGSLQCFWYGAAPISPT
FT                   RLSEALTRIGPVMAQLFGQSEAPMMIATMAPKDHFHEDGSVATARLSSAGRPSPLVTVA
FT                   IMDGQGILLPAGERGEVVVRSSLVMAGYYKNPVATQEASAHGWHHTGDIGYLDEDNFLY
FT                   IVDRAKDMIITGGFNVYSVEVEQALMAYPGIQDCGVIGLPDEKWGERVVAVVQARAGTP
FT                   IEADALTAFVKARIGSVKTPKEILVWPDLPRSKLGKVLKNEIRQQLLG"
FT   CDS_pept        complement(674504..675625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48897"
FT                   /db_xref="GOA:C1ASW5"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW5"
FT                   /protein_id="BAH48897.1"
FT                   /translation="MTDKKPVIVYGVSGYTGRLVCEYLREFNIPFVAAGRDKKRIQEVL
FT                   DRVPGLDTVDHDVVEVEHTVPALTELFSGARVVSNMVGPFIKYGAVVVEAALAAGCHYT
FT                   DTTGEQDWVLDVQAKFGDQFAEKGLLLSPGVAQMYTTGEIAANIALETPGLDTLDILVL
FT                   WKGFPTYASTQTIFTILKADWYYLEQNRYAKWDPGTTFDVVVPGQHQMALALPWGGTCH
FT                   PVWFKDDPRVANVKAAGGVFDRSVMEGVVATQKMVEEQIKTLPADEQDAALAEIAGSVQ
FT                   AGMPPRENPRVNTSLDSVYASGPLGRAHCVIHGNCNYKQTGLLQAYAAHSLLQQPPKKT
FT                   GLASACQAFGHRELLGILRSFGLVMEPVVTVQN"
FT   CDS_pept        complement(675667..676488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06510"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48898"
FT                   /db_xref="GOA:C1ASW6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW6"
FT                   /protein_id="BAH48898.1"
FT                   /translation="MRRQVGMSVRDLAGRKALVTGGAKGLGAGMAAALADAGAAVVIGD
FT                   VLEEEGRATADSLGKSGVDTGFVTLDVTDDGNWERAVAATVEQLGGLDLLINNAGIEIS
FT                   SLVVDIDPADVRRMCDVNILGVALGLKHGLRAMRPGGAAGAGGSIVNVSSVAATIPFPG
FT                   IAGYSATKSAVDRLTRVAAQEAGKLGYGVRVNCVYPGLVATEMGLGLAADMERLGLWPS
FT                   ADAAVADVIGLTPLGRLGEVADIADTVVFLASDAARFVTGIGLPVDGGMGM"
FT   CDS_pept        676681..677316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06520"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48899"
FT                   /db_xref="GOA:C1ASW7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW7"
FT                   /protein_id="BAH48899.1"
FT                   /translation="MTPVAEKNADRVSRRQVDKFAERRDQLAEAALQTLSELGYARTSL
FT                   REIAQNSEFSHGVLHYYFSDKVDLITHCVRHYKARCVTRYDGVVATAQTSDELKAGFGR
FT                   VLVDSLRGEASMHRLWYDLRSQSLFEESFRADVAAIDKSLENMIWRIVSRYAELAGRTI
FT                   TIAPPTMYAVFDGLFQQSLAGYLSGDDSAADALADNVDQVLALVIPAR"
FT   CDS_pept        complement(677323..677763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48900"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW8"
FT                   /protein_id="BAH48900.1"
FT                   /translation="MAGRFEGTVVIDRPIEEVFEYLAAGVNDREFSPRVQEIVKKTDGP
FT                   PGVGTVFVSTVKDAGMTTKREFEITEFEAPRRIRWAERSTNTVTAKEGGYDLEPSGAGT
FT                   KVTIFNVLEGHGIGRLIAPLALRAARKDAPAFAQRIKVAAEK"
FT   CDS_pept        677762..678091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06540"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48901"
FT                   /db_xref="GOA:C1ASW9"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASW9"
FT                   /protein_id="BAH48901.1"
FT                   /translation="MPASRFRDLPGSDSTRAEAGARSHRRRAVGHRSDAAARTIGETVG
FT                   AFVLIAAVATSRSRYVMATNSPVAEALTSGFQRVLLASSIFLVAAALIALRTGNTRGDC
FT                   TARTK"
FT   CDS_pept        complement(678106..678579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48902"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX0"
FT                   /protein_id="BAH48902.1"
FT                   /translation="MRCRNPGCDRSPVAGRPLAGRARRRLQGAPAPDDTDPVRQSAVVD
FT                   AFLAAARGGDFDALLSLLDPDVVLRADTGEIPAGASPVVRGAETVAGRVLGFARLARFA
FT                   NPALVNGTAGVVAISDGQLLSVLGVTVRQGMIVEIDILADRDRLAGLVVENLD"
FT   CDS_pept        678720..679481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48903"
FT                   /db_xref="GOA:C1ASX1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX1"
FT                   /protein_id="BAH48903.1"
FT                   /translation="MSKAQHVGRLFLVSVLAALAVCGVSVAASAAPPAVTGKILAPALT
FT                   PASGQVVGIAHPVVVRFTSPVPDRALAERGVRITPSTPVPGQFSWIDDRTLQWNPDRFW
FT                   PANTAVTVEAAGARSQFQVGDALVAVANTTTHQFTVSINDQIVQTMPASMGKPGYETPL
FT                   GTFPVIEQFRDMIMDSSTYGVPIDDEEGYRLYVEYATRITWGGIFVHAAPWSVGSQGFE
FT                   NVSHGCINLSTENARWFYDNAKIGDPVIVTS"
FT   tRNA            complement(679570..679646)
FT                   /locus_tag="ROP_t0020"
FT                   /product="tRNA-Pro"
FT   CDS_pept        complement(679733..681160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="ROP_06570"
FT                   /product="GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48904"
FT                   /db_xref="GOA:C1ASX2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX2"
FT                   /protein_id="BAH48904.1"
FT                   /translation="MTEQFTTEFAGDGTWSEESDWEVLDLEDGGDGEAHVPVPTLAVVG
FT                   RPNVGKSTLVNRIIGRREAVVEDIPGVTRDRVSYEANWSGRRFMVQDTGGWEPDAKGLQ
FT                   QSVARQAELAMQTADAILLVVDAVVGATATDEAVAKVLRRSKTPVLLVANKVDDGRTES
FT                   EVAALWSLGLGQPHSVSATHGRGTGDLLDEVLAALPETPREGIPGGGPRRVALVGKPNV
FT                   GKSSLLNKLSGDERSVVHNVAGTTVDPVDSIVELGGRPWRFVDTAGLRKRVSHASGAEF
FT                   YASLRTKSAIEAAEVAILLIDASEPISEQDLRVLSMVADAGRALVIAFNKWDLVDEDRR
FT                   LQLDREVDRDLVRVPWAQRVNISAQTGRAVQKLVPALDTALESWDKRIPTGRLNTWLKE
FT                   VVAATPPPMRGGRLPRVMFATQAGTRPPTFVLFTTGFLEAGYRRFLERRLREEFNFDGS
FT                   PVRISVRVREKRERRSR"
FT   CDS_pept        complement(681157..681846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="ROP_06580"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="protein synonym:CMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48905"
FT                   /db_xref="GOA:C1ASX3"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX3"
FT                   /protein_id="BAH48905.1"
FT                   /translation="MSTSSLIVAMDGPSGTGKSSVSRMLARRLGARYLDTGAMYRIATL
FT                   HVLRKGVDLADPDAIADATVGLPWSIGTDPAGEQVLLDGEDVGEEIRGDAVTKAVSAVS
FT                   AVPAVRELLVAAQRRLACEAGRIVVEGRDIGTVVLPDADVKIYLTASAEARAQRRNAQN
FT                   LAEGRGDDFAAVLADVQRRDHLDSTRAVSPLRPADDSVLVDTSELGIDDVIGRLLLVVS
FT                   ERSGVGQ"
FT   CDS_pept        complement(681843..682895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06590"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48906"
FT                   /db_xref="GOA:C1ASX4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX4"
FT                   /protein_id="BAH48906.1"
FT                   /translation="MKKPARRDGTPDRNNKKQRPTRSETGGRTRSETGGRPDRAEAAHR
FT                   SGRPDATKGKPGRPDPAAKNKRGKPKSAKPQRAQAQAPKISNAKPARHQYADADRPAGP
FT                   PQGDGMRLQKVLAQAGVASRRAAEELISQGRVEVDGRIVIEQGLRIDPENAVVRVDGVR
FT                   VVVQKDLVHLALNKPRGWQSTMSDDLGRPCVGDIVSERVAAGQRLFHVGRLDADTEGLL
FT                   LLTNDGDLAHRLMHPSFEVSKTYLATVSGALERGVGKKLKEGVELDDGPAKVDTFTLLD
FT                   INEGKSLVRVTLHEGRKHIVRRLFDAVGHPVIRLVRTDIGAVALGDQRPGTLRVLGRGE
FT                   VGGLYGAVGL"
FT   CDS_pept        complement(682912..683604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="ROP_06600"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48907"
FT                   /db_xref="GOA:C1ASX5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX5"
FT                   /protein_id="BAH48907.1"
FT                   /translation="MSSAPFDEPDDQGAVDTEPELSDTELAAVLESLLLIVDSPAGAEQ
FT                   LASATGASVNRITETLNRMSAELTARGSGMDLRYAGDGWRLYTRTAYAPYVERLLLDGA
FT                   RSKLTRAALETLAVVAYRQPLTRARISAVRGVNVDGVVRTLLARGLIAEAGVDPDTNAT
FT                   QYSTTELFLERLGLASLADLPALAPLLPDVDLIDDISDSLESDPRFARMNKATASTEEL
FT                   DTGLDTED"
FT   CDS_pept        complement(683601..684461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="ROP_06610"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48908"
FT                   /db_xref="GOA:C1ASX6"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX6"
FT                   /protein_id="BAH48908.1"
FT                   /translation="MVDTQDIPAPPQTEGSHGEDPQAPAGKPGFRVTLRNFEGPFDLLL
FT                   TLINQRQLDVTEVALHQVTDDFIAYMRTLGAEMGLDQTTEFLVVAATLLDLKAARLLPA
FT                   GQVEDAEDLALLEARDLLFARLLQYRAYKQVAQLFGELEAAALRRYPRSAALEDQFTRL
FT                   LPEVLLGVDPQRFAEIAATVFTPRPKPTVGLDHLHDMHAVSVPEQAARMLELLRERGAG
FT                   EWASFGDLVSECEITVEIVARFLALLELYREQSVLFEQPEPLGELLVSWTGEDTHAPVT
FT                   EEDYG"
FT   CDS_pept        complement(684462..685466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06620"
FT                   /product="putative chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48909"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX7"
FT                   /protein_id="BAH48909.1"
FT                   /translation="MGSTAIIERTGDHRTVVTPQPPAAESEHSQPEGDMFDVRQTETAA
FT                   LLDDAAVVVEEELGPTGRPTREVPEPAPLPSHGPAKIVAMCNQKGGVGKTTSTINLGAS
FT                   LAEYGRRVLLVDLDPQGALSAGLGVAHNDLELTVHNLLVEPRVSIDDVLMRTRVEGLDL
FT                   LPSNIDLSAAEIQLVTEVGREQTLGRVLHPVLDRYDYVLIDCQPSLGLLTVNALACADS
FT                   VIIPMECEYFSLRGLALLNDTVEKVHDRLNPRLELAGIVVTMFDARTLHAREVMARVVE
FT                   VFGDLVYDTVINRTVRFPETSVAGEPITTWAPKSTGAEAYRALAREVIHRSGR"
FT   CDS_pept        complement(685626..686294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="ROP_06630"
FT                   /product="putative ADP-ribose pyrophosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48910"
FT                   /db_xref="GOA:C1ASX8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX8"
FT                   /protein_id="BAH48910.1"
FT                   /translation="MPDIGRHEFETLDSRAVYSGAILALRVDHVAMPDGRTAEREVVEH
FT                   HGAVAVVVLDDEDRIVLIHQYRHPVGRRLWEIPAGLLDEPGEDPADAARRELAEETGLA
FT                   ARRWSVLVDVVLSPGFTDESVRVFLAEDLYEVDRPDPEDEEADLEIERIPFDEVVSMVL
FT                   NGTIVNATAASGVMALAAARSRPGGLGELRDVSAPWVDRPERFSERKRARAAGDEAARA
FT                   "
FT   CDS_pept        complement(686308..688077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="ROP_06640"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="protein synonym:UTP--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48911"
FT                   /db_xref="GOA:C1ASX9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX9"
FT                   /protein_id="BAH48911.1"
FT                   /translation="MPQSRTHSRTATKHIFVSGGVASSLGKGLTASSLGQLLTARGMRV
FT                   TMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLSGQANVTTGQV
FT                   YSTVIAKERRGEYLGDTVQVIPHITDEIKSRILAMSGPDLQGHRPDVVITEIGGTVGDI
FT                   ESQPFLEAARQVRHDVGRDNVFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGIQPDA
FT                   LILRCDREVPPALKNKIALMCDVDVDGCISTPDAPSIYDIPKVLHSEGLDAYVVRQLGL
FT                   PFRDVDWTVWGNLLERVHQPRETVRIALVGKYVDLPDAYLSVTEALRAGGFANRSKVEI
FT                   SWVPSDACETEAGAQAALGDVDGVLIPGGFGIRGIEGKLGAIRYARHRKTPLLGLCLGL
FT                   QCVVIEAARSVGLDDANSAEFEPETTHPVISTMADQEDVIAGEADLGGTMRLGAYPAVL
FT                   AKGSVVARAYGSEEVSERHRHRYEVNNAYRDRIAKSGLRFSGTSPDGHLVEFVEYPADQ
FT                   HPFFVATQAHPELKSRPTRPHPLFAAFVDAALRHKLEERLPVDVHGEERAAADDEIAES
FT                   ADRDEVASVDSAG"
FT   CDS_pept        complement(688219..689169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06650"
FT                   /product="putative channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48912"
FT                   /db_xref="GOA:C1ASY0"
FT                   /db_xref="InterPro:IPR021522"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY0"
FT                   /protein_id="BAH48912.1"
FT                   /translation="MISLRQHAISIAAIFLALAIGVVMGSGLLSSGLVSGLRDDKADLQ
FT                   TDLENASERNNQLTEQLNSADGFDSAVGGRVVADSLAQRTVMVVTTPDADPADLDGVNR
FT                   MIAQAGGSVTGRVSLTDSFVDATGGDRLRTVVNNVIPAGVTLKTGAVDQGSLAGDLLGS
FT                   VLMLGKETGQPQSSAQEMALALETLRGAGFVSYDDGAVQPAQVAVVLTGDRDVEDGVSG
FT                   NRGAVVARFAGALDSRGAGAVLAGRPASAQGNGAVAVARADAALSAALTTIDNIDREAG
FT                   KITVPLALQEQLNGGAGRYGTGPGTTGVTVGATPA"
FT   CDS_pept        complement(689166..690350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06660"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48913"
FT                   /db_xref="GOA:C1ASY1"
FT                   /db_xref="InterPro:IPR022215"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY1"
FT                   /protein_id="BAH48913.1"
FT                   /translation="MKMPALLSRNTETLPGVSGIARVDRNTAKLLRRVGPGDIVVLDEL
FT                   DLDRGTADALVKAGVLAVINASPSISGRYPNLGPEVIVANGILLVDSAGAEIFKSIKDG
FT                   SKVRVNGGGVYSGERRIAKGDEQTEAEISDRMIEAKTGLVDHLEAFSGNTIEFIRTESP
FT                   LLIDGVGVPDVDVDMKERHVVIVSDGPDHASDLKNLKPFIKEYSPILIGVGAGADVLKS
FT                   AGYRPDLIVGDPEDITSATLKSGAEVVLPADQDGHAPGLSRIQDLGIGAMTFPASGSPS
FT                   DLALLLADHHGASLIVTVGSTVSLDEFFDRGRRDSNPSAFMTRLKVGPKLVDAKAVATL
FT                   YRSRVSGSAIALLVLAALVAVIVALVVSNVGGEALDWAVATWNSFALWVQGFFK"
FT   CDS_pept        complement(690459..692231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="ROP_06670"
FT                   /product="DNA repair protein RecN"
FT                   /note="protein synonym:recombination protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48914"
FT                   /db_xref="GOA:C1ASY2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY2"
FT                   /protein_id="BAH48914.1"
FT                   /translation="MLAEIRIDNLGVISEASAQFHEGLTVLTGETGAGKTMVVTSLHLL
FT                   SGARADAGRVRLGAPRAVVEGRFMTDEGSEHVERAVSRLLESTGAERDEDGTIIAVRTV
FT                   GSDGRSRAHLGGRSVPAGVLSEFTDPLLTVHGQNDQLRLLRPDQQCAALDRFADKTVGP
FT                   LVARYRKHRNEWMTARSELIERTGRTRELAQEADQLTFALNEIDGVAPTPGEDEAIVSE
FT                   VRRLSELDSLRSAAEEAHAALAGGDVMDGDGGAAPALDLLSEARARIESATDPELDGLG
FT                   PRLADAIAVVTDVSADLTTYLAGLPADPGALDSLLSRQAELKNLIRKYAADVDGVLEWA
FT                   DNARARLEKIDVSSDALAALTKQVEESAASTAEAASKLTAARVKAATKLAKAVSSELAG
FT                   LAMGRAALEVTVRPRIAGPQDTAPLTVDGTELHAGSSGVDEVEFRLSAHSGAQSLPISK
FT                   SASGGELSRVMLALEVVLAGSDSGATMVFDEVDAGVGGRAAVEIGRRLARLARTHQVIV
FT                   VTHLPQVAAFADTHLVVDKVDDQDGVVSSGVHTLTDDERVVELARMLAGLDDTETGRAH
FT                   AEELLATASAERSA"
FT   CDS_pept        complement(692234..693196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="ROP_06680"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:poly(P)/ATP NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48915"
FT                   /db_xref="GOA:C1ASY3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASY3"
FT                   /protein_id="BAH48915.1"
FT                   /translation="MSGGSSGGQQREREILLVAHPGRAEITETARRVGKIFERAGIGMR
FT                   VLVDEVDSTRIEPMDGMAADEFLVPGLEVTIVQAGPDAALGCEMVLVLGGDGTFLRAAE
FT                   LAQAASIPVLGINLGRIGFLAETEAEHLDEALGQVVRREYRIEHRMTLDVLVRVDDEII
FT                   ERGWALNEASIENRSRLGVLEVVLEVDGRPVSAFGCDGVLISTPTGSTAYAFSAGGPVV
FT                   WPELEALLVVPSNAHALFARPLVTSPESLIAVETVAGSHDGLVFCDGRRTLELPAGARV
FT                   EVVRGKEPVRWVRLDSAPFADRMVRKFELPVTGWRGRKP"
FT   CDS_pept        complement(693193..694023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="ROP_06690"
FT                   /product="putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48916"
FT                   /db_xref="GOA:C1ASY4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY4"
FT                   /protein_id="BAH48916.1"
FT                   /translation="MARRARVDAELVRRGLARSREHAQELIASGRVLISGAAATKPATA
FT                   IEAGTPLRVVEVDNEVSWASRGAHKLLGALEAFGPRGLAVDGKRCLDAGASTGGFTDVL
FT                   LHHGAREVVAVDVGYGQLVWRLQSDDRVHVVDRTNVRSIDAEQIGGPVELVVADLSFIS
FT                   LKLVLPAFVACVTDGADLIPMVKPQFEVGKDHVGSGGVVRDPELRVASVLDVAKTAASL
FT                   GLRTVGAVASPLPGPSGNVEYFLWLRADVTPGTDDVPVESVEELIRTAVQEGPQ"
FT   CDS_pept        complement(694025..694312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48917"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY5"
FT                   /protein_id="BAH48917.1"
FT                   /translation="MFVTRFAVCVSDRDGLALCPMSTPIPRPGAHLPGPPQSVDPEKIH
FT                   TEVDGLLSRLGAVEPDPDDEHGAGVIPRKAHLLEKAHDVLVEALATVDKI"
FT   CDS_pept        complement(694331..695326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06710"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48918"
FT                   /db_xref="GOA:C1ASY6"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY6"
FT                   /protein_id="BAH48918.1"
FT                   /translation="MTALRENYDALLLDLDGTLYQGPQEIPGAREALAAGMQSCYYVTN
FT                   NASRSPGDVAEHLTDLGFEAGESTVVTSSQSAARLLAENVAPGSPVLVVGTEALADEVR
FT                   NVGLRPVRSFEDAPVAVVQGHSPTTDWAILAEATLSIRAGAVWVAANLDSTLPTERGLV
FT                   LGNGSMVAALRTATSREPLVAGKPAAPLMEDAMRRSGCVRPLVVGDRLDTDIEGANNVG
FT                   LDSLLVLTGVSTAIDVLRAAPEQRPTYVASELDALNRPADESLVGEDSRWSVEFDGTDL
FT                   VIEPTADSAEPMDSAALLRAVAVGAWKFPDFARITSTTRAVSAVVSGWGA"
FT   CDS_pept        complement(695323..696330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48919"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY7"
FT                   /protein_id="BAH48919.1"
FT                   /translation="MVCVKGMTVSESDDGRRSFRGGGASQSGRGGASQSGRGGASHNDR
FT                   GASGGNRGGAGGSGRGGSSGGPRRDSRDNRGGAGGDRRGGGPRRGGEGGFAPRGREGDR
FT                   PQRQQARPDEPDLPENVEAGELDPAVRRDLLSLDKTNANTVARHLVMAGKLVDDDPRLA
FT                   LAHARAARQRAGRIAIVREAAGITAYHAGEWAEALSELRAARRMAGGPGLLAVMADCER
FT                   GLGRPERAIELGRSEEAAALSGDEAAELRMVVAGARMDLGQFDQAVVTLQTPDLDAART
FT                   GPGAARLFYAYADALVAAGRIEDGLKWFLNSAAADLEGDTDAEERVAELTGDDQ"
FT   rRNA            complement(696372..696491)
FT                   /locus_tag="ROP_r0010"
FT                   /product="5S rRNA"
FT   rRNA            complement(696641..699775)
FT                   /locus_tag="ROP_r0020"
FT                   /product="23S rRNA"
FT   rRNA            complement(700117..701637)
FT                   /locus_tag="ROP_r0030"
FT                   /product="16S rRNA"
FT   CDS_pept        complement(702246..703523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ROP_06730"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="protein synonym:TyrRS"
FT                   /note="protein synonym:tyrosine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48920"
FT                   /db_xref="GOA:C1ASY8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY8"
FT                   /protein_id="BAH48920.1"
FT                   /translation="MTENIIDELTWRGLIAQSTDLDALRRDLDAGPVTLYAGFDPTGPS
FT                   LHAGHLVPLLALKRFQRAGNRPIVLAGGATGLIGDPRDVGERTMNSADTVAEWADRIRG
FT                   QLERFVDFDDSPSGAVIENNMNWTGKLSAIDFLRDVGKHFSVNVMLARDTVKRRLETDG
FT                   MSYTEFSYMLLQANDYLHLRRSHGCSLQVGGSDQWGNIIAGVELNRRVDAASVHGLTVP
FT                   LVTSADGKKFGKSTGGGSLWLDPEMTSPYAWYQYFVNTGDADVIKYLRWFTFLSAEELA
FT                   ELETATAERPHAREAQRRLAAEMTTLVHGEANTRAVELASQALFGRAELQDLDEPTLGA
FT                   ALREASVAELAPGEPSSIVDLLVLSGLCESKGAARRAVKEGGASVNNQKISSEDWTPES
FT                   GDLLHGTWLVVRRGKRNFAGVKVLSN"
FT   CDS_pept        complement(703532..704149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06740"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48921"
FT                   /db_xref="GOA:C1ASY9"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY9"
FT                   /protein_id="BAH48921.1"
FT                   /translation="MTIDRLDRAEPVDAARIVLGSTLIVGDVRIRIVEVEAYGGEKDGP
FT                   WPDPASHSYRGRTPRNEVMFGPAGHLYVYRSYGMHFCMNVSYGPVGTAGGVLLRAGEVL
FT                   DGSATVQARRPRVTRPADWARGPGNLGSATGVTLAENGAGLFEGDSPVRLEVADSDDWL
FT                   SGPRVGVSTAADRPWRFWIPESPAVSAYRRSPRAMPADERMG"
FT   CDS_pept        704186..704974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06750"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48922"
FT                   /db_xref="GOA:C1ASZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ0"
FT                   /protein_id="BAH48922.1"
FT                   /translation="MGRIIHHTMNSPSDELRSAMTDAAAIDIRDLHVRRGRNEVLHGID
FT                   VQVASGSITGLLGPSGCGKTTLMRCVVGTQIVESGTVTVLGSPAGSVSLRSRVGYVTQS
FT                   PSVYADLTVRKNVAYFAALYGQPSSAVTEAVDAVGLTRFATQKAADLSGGQLGRVSLAC
FT                   ALVARPEILVLDEPTVGLDPLLRVELWERFEELAAAGTTLLVSSHVMDEAEHCASLLLM
FT                   RDGYVLAQVSPGGLREQTGETSLEDAFLNLIRASHVGSEN"
FT   CDS_pept        704974..705729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06760"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48923"
FT                   /db_xref="GOA:C1ASZ1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR004377"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ1"
FT                   /protein_id="BAH48923.1"
FT                   /translation="MNVTIFAATAGRILAQLRTDHRTVAMILVVPSLLMVLLYFLYQNV
FT                   PAPPGQQSLFERVAITMLGILPFVVMFLVTSIAMQRERTSGTLERLLTTPMGKLDLLGG
FT                   YAAAFSTAAAAQAGLACAVAFGFLGLTTEGSVTWVLLIAVLNAILGVALGLLCSAFART
FT                   EFQAVQFMPVVVVPQLFLCGLLVPRDQLPTWLEWISNVLPLSYAVEALQQVATHPGATG
FT                   LMWRDLAVVAAFALLALSLGAATLRRRTP"
FT   CDS_pept        705726..706352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06770"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48924"
FT                   /db_xref="GOA:C1ASZ2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ2"
FT                   /protein_id="BAH48924.1"
FT                   /translation="MTDPATRSDATTGLRTGRRRGNPDTRSRILTTARKLFAQNGFDKT
FT                   SVRSVAAGAGVDSALVHHYFGTKRQLFLASVDIPVDPTKVIAPVLDTPRDEIGSRLALA
FT                   VFSVWESPHKPAVVAAFRSAMAGNEPTLIRTFLLEVVLRDLGPRVDEPPGTGMLRMQLV
FT                   ASQMAGVLVTRYVLEFEPLASLPVDDLVAIVAPTLQRYLTGDLPV"
FT   CDS_pept        complement(706353..706565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48925"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ3"
FT                   /protein_id="BAH48925.1"
FT                   /translation="MVIDPTLLGILACPQDKGPLLLVGDELLYNPRLRRAYPIENGIPV
FT                   LLIDEARDVDADEHETLLARASGAA"
FT   CDS_pept        complement(706604..709645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06790"
FT                   /product="putative fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48926"
FT                   /db_xref="GOA:C1ASZ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ4"
FT                   /protein_id="BAH48926.1"
FT                   /translation="MRAGGSEACVTVRESGRVFVGLNTETVMGPIRRVVATAQNGLEVV
FT                   RLGGLETDLTTSPFEVVERAPMYRLRRYFPDTDPAEAGPPIVLVPPMMMSADVYDVTRD
FT                   QGAVGILRSMGIDPWVVDFGSPDSEEGGWDRNLADHIVAISEIIDQVRSHTGRDVYLSG
FT                   YSQGGMFAYQAAAYRRSRNIAGLVTFGSPVDTLAGLPFGIPAGFATDAAGFLADHVFNR
FT                   LAVSGWMARTGFQLLDPVKTLKSRLDFLRQLHDREALLPREQQRRFLATEGWVAWSGPA
FT                   VAELLKQFIVHNRMMTGGFVIKDQVVSLAELTCPVLAFVGEVDDIGQPLAVRGIRRAAP
FT                   RANVYESTLRAGHFGLVVGSAAATHTWPTTGKWVLWNEGLGPRPTNIELMRYDEHFGSE
FT                   SGVSISDRIIHTVASVAEVGVGVGKGISDFASGALRGTMELSGEATRALPRLARLGQIQ
FT                   PHTQISLSRLLAEQRRKAPGGECFLFDNRVHTYEAVNQRIDNVVRGLIQASVRPAAHVG
FT                   VVMQTRPSALAAIVALSRLGAVAVLLPPGREVHSAIRIDGVERIVTDPENLDAAIATGM
FT                   QVLVLGGGAQRDLDVDPSANVVDLEKIDPGAVTLPGWYRPDPGLARELAFIICSESNGH
FT                   WETKQITNYRWALSAFGTASAADLDRGDTVYCLAPLHHSSSLLAAIGGAVAGGSRIALS
FT                   RGLDAERFAEEVHRYGVTVVSYTWTMMREILDAENLALDGSHPVRLFIGSGMPQGLWRR
FT                   TTERFAPAKVLEFYASTEGDVVLANVAGAKVGAKGRPLPGSAEVRLAAYDPISGRLLED
FT                   EQGFIRECEDDEVGLLLGRAGVHAEMSGGAMRGIFAAGDAWIPTENLFCRDADGDYWLV
FT                   DHRKTVIATPRGAVFTQPIVDALGSVDRVDLAVAYGVEAGGRTLAVAAFTLRDGRPPRL
FT                   AEISDALDALAPALRPDIIQVVGDIPLGSSYRPNADALSAAGLPKPGTRVWYVDPESQQ
FT                   YRRLTKAVAAEFQDGSAGVPAGAR"
FT   CDS_pept        complement(709699..711117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="ROP_06800"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="protein synonym:arginosuccinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48927"
FT                   /db_xref="GOA:C1ASZ5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ5"
FT                   /protein_id="BAH48927.1"
FT                   /translation="MSAHGTNEGALWGGRFESGPAAAMAALSKSTHFDWVLAPYDVRAS
FT                   QAHARVLHKAGLLGDEDLATMLDGLGRLAADVASGDFIPSESDEDVHGALERGLIDRVG
FT                   PDVGGRLRAGRSRNDQVATLFRMWLRDAVRRVAEGVLDIVDALATQAAAHPSAVMPGKT
FT                   HLQAAQPVLLAHHLLAHTHPLLRDVQRLRDFDVRAAVSPYGSGALAGSSLGLDPEAIAA
FT                   ELAFDSSAENSIDATSSRDFAAEAAFVLAMIGVDLSRMAEEVILWSTPEFGYITLADAW
FT                   STGSSIMPQKKNPDVSELTRGKSGRLIGNLTGLLATLKAQPLAYNRDLQEDKEPVFDSV
FT                   AQLELLLPAITGLVATLEFHTDRMAELAPAGFTLATDIAEWLVRQGVPFRVAHEAAGAC
FT                   VRVAEARGAGLEDLTDEELAGVDPALTPDVREVLTVEGSIASRNARGGTAGIRVAEQLG
FT                   GVRQLSESLREWCR"
FT   CDS_pept        complement(711120..712319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="ROP_06810"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="protein synonym:citrulline--aspartate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48928"
FT                   /db_xref="GOA:C1ASZ6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ6"
FT                   /protein_id="BAH48928.1"
FT                   /translation="MADRVVLAYSGGLDTSVAISWIGKETGKEVVAVAIDLGQGGEDME
FT                   VVRQRALDCGAVESVVVDARDEFADEYCLPTIQANALYMDRYPLVSAISRPLIVKHLVE
FT                   AARAHGGTTVAHGCTGKGNDQVRFEVGFGSLAPDLDVIAPVRDYAWTREKAIAFAEENE
FT                   IPINVSKKSPFSIDQNVWGRAVETGFLEDLWNAPTKDVYDYTQDPTVNWQAPDELIISF
FT                   EAGRPVAIDGKPVSVLEAIQELNRRAGAQGVGRLDVVEDRLVGIKSREIYEAPGAMVLI
FT                   NAHQELEHVTQERELGRYKRQTEQRWSELVYDGLWFSPLKVALDTFIEKTQERVSGDIR
FT                   LVLHGGAIIVNGRRSNESLYDFNLATYDEGDTFDQSYAKGFVQIHGLSSKVAAKRDLGL
FT                   "
FT   CDS_pept        complement(712367..712903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="ROP_06820"
FT                   /product="arginine repressor ArgR"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48929"
FT                   /db_xref="GOA:C1ASZ7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ7"
FT                   /protein_id="BAH48929.1"
FT                   /translation="MNAAPPQRTGAAPPQRTANAATAPTRAGRQARIVAILSNNPVRSQ
FT                   TELAALLAAEGIDATQATLSRDLEELGAVKLRAADGGAGVYVVPEDGNPVRGVSGGTDR
FT                   LSRLLGELLVSTDASGNMAVLRTPPGAAHYLASALDRASLPDVVGTIAGDDTILVVARE
FT                   PLSGAELAAKIESLA"
FT   CDS_pept        complement(712900..713847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="ROP_06830"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48930"
FT                   /db_xref="GOA:C1ASZ8"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASZ8"
FT                   /protein_id="BAH48930.1"
FT                   /translation="MTTVVKHFLRDDDLTPEQQAEVLELAARLKKAPFAERPLEGPRGV
FT                   GVIFEKNSTRTRFSFEMGIAQLGGHAIVVDGRSTQLGREETLQDTGRVLSRYVDAVVWR
FT                   TFGQKRLEAMASGADVPIVNALSDEFHPCQVLADLQTLAERKGSLKGLKLTYLGDGANN
FT                   MAHSLMLGGVTAGVDVTIASPEGFAPLPWVVEAARARAADTGATITLTEDPQAAVVGAD
FT                   ALVTDTWTSMGQENDGLDRVGPFRPFQINEALLAKAAADAVVLHCLPAHRGEEITDEVL
FT                   DGPQSVVWDEAENRLHAQKALLVWLLAQRTGNRP"
FT   CDS_pept        complement(713844..715043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="ROP_06840"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48931"
FT                   /db_xref="GOA:C1ASZ9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASZ9"
FT                   /protein_id="BAH48931.1"
FT                   /translation="MTGTPELQQRWSGALMNTYGVPRVALTRGQGAVLTDADGKEYVDF
FT                   LAGIAVNILGHAHPALIEAVTAQLSTLGHVSNLYASEPAIELAEKLLSHLGAPGRVFFC
FT                   NSGTEANEAAFKLARATGRSKIIAAENSFHGRTMGALALTGQAAKRAPFEPMPPGVVHV
FT                   PYGDLDALDRAVDADTAAVFLEPMMGEGGVVVPPEGYLAGARQITADRGALLVLDEVQT
FT                   GIGRTGWFYAHQAVGIVPDVMTLAKGLGGGMPIGACVATGAAADLFGPGKHGTTFGGNP
FT                   VCASAALAVLRTIAEDDLISRADTLGKALSAGIEGLGHPLIDHVRGAGLLLGIVLTQDV
FT                   APAVENSAREAGYLINAAQPGVVRLAPPLVLTDEQAEGFVAALPAILDNAQSAAQPGKQ
FT                   "
FT   CDS_pept        complement(715040..715966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="ROP_06850"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="protein synonym:N-acetyl-L-glutamate
FT                   5-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48932"
FT                   /db_xref="GOA:C1AT00"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT00"
FT                   /protein_id="BAH48932.1"
FT                   /translation="MTAASEALTGITDHQKAHVLAEALPWLQQFRDKVVVVKYGGNAMV
FT                   DDALKTAFAADMAFLRTVGIQPVVVHGGGPQINAMLGKLGMTGEFKGGFRVTTPEVMDV
FT                   VRMVLFGQVGRELVGLINAHGPYAVGISGEDAHLFTATKRTVMVEGTPTDIGLVGDVTT
FT                   VNPEAVLDLIRAGRIPVVSTIAPDSDGVVHNINADTAAAALAEAIGAEKLVVLTDVEGL
FT                   YTNWPDRDSLATEIDVDALAQLLPSLDAGMVPKMEACLRAVRGGVPTAHVIDGRLAHSV
FT                   LLELFTGEGIGTMVTPAPTSPTEGVAP"
FT   CDS_pept        complement(715963..717207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="ROP_06860"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="bifunctional protein"
FT                   /note="protein synonym:arginine biosynthesis bifunctional
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48933"
FT                   /db_xref="GOA:C1AT01"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT01"
FT                   /protein_id="BAH48933.1"
FT                   /translation="MSSDSTIDPHPAREVAGGTLVRSQGVSGPAGFRASGIKAGIKASG
FT                   NADLALVVNEGPELAAAGVFTANKVKAAPVLWSQQVLTTGRLRAVVLNSGGANACTGAG
FT                   GFQDAHKTAEEVASALSNWGTETGAVEVAVCSTGLIGDRLPMDKVLTGVTEAVHELAGG
FT                   ISGGTDAAYAIMTTDTVPKQAALHHAGKWNVGGMAKGAGMLAPALATMLCVVTTDAVAT
FT                   ASQLDAALRAATRVTFDRLDVDGATSTNDTVLLLASGASNVTPTQEELNAAVTAVCDDL
FT                   ADQMMADAEGVTKRVRVTVSGAVSEHDALIGARTVARDSLVKTALFGSDPNWGRVLAAI
FT                   GIAPIELDPDKISVSFNGAPVCIDGVGAPGARDVDLSEVDIALDIDLGLGEHAVTIRTT
FT                   DLSHAYVEENSAYSS"
FT   CDS_pept        complement(717204..718259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="ROP_06870"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="protein synonym:N-acetyl-glutamate semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48934"
FT                   /db_xref="GOA:C1AT02"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT02"
FT                   /protein_id="BAH48934.1"
FT                   /translation="MTEHAGKPIRIAVAGASGYAGGEVLRLLLGHPSYADGSLVIGALT
FT                   AGGNAGSTLGSHHPHLLPLADRVLEDTTVDTLSGHDVVFLGLPHGNSAQYAKDLPESTV
FT                   IIDCGADFRLTNAEDWERYYKSPHAGSWPYGLPELPGAREKLAGATRIAVPGCFPTVSS
FT                   LAMAPAVAAGVVEPRVTIVAVTGASGAGRAPKADLLGSEVMGSVRAYGVGGVHRHTPEI
FT                   IQNLSELAGERVTVSFTPVLAPMPRGILATCTAVTTATEDEVRAIYEKAYADEPFVHVL
FT                   PRGVLPQTGAVVGSNAVQIAVAVDADAGQIVVVAVIDNLAKGTAGGAVQSMNLALGLPE
FT                   TAGLSTVGVAP"
FT   CDS_pept        complement(718328..718726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48935"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT03"
FT                   /protein_id="BAH48935.1"
FT                   /translation="MTEVRDVVAAASQLTDAEFLQVVRAVAAGRPGLGALLAAVDVGAA
FT                   IPTEDPVTAEVVPHVVPGAPAPDYTPGGVPTFDRVRERIEGRFGTATGSSELAHDSPSG
FT                   QSLEEAWEKREKAGKAKLDEIRRSLGKQ"
FT   CDS_pept        complement(718769..721255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="ROP_06890"
FT                   /product="phenylalanyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48936"
FT                   /db_xref="GOA:C1AT04"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT04"
FT                   /protein_id="BAH48936.1"
FT                   /translation="MRVAQSWLTEILQRATPDWDVTAEELDAGFVRVGLEVEEVDRLEP
FT                   VDGPLVVGKVLEITELTEFKKPIRFCKVDVGAAEPQGIVCGARNFAEGDLVVVALPGAV
FT                   LPGGFAIASRKTYGQVSDGMICSVAELGIGKDHSGILVLEPGTALPGADANELMGLHDT
FT                   VIELNITPDRGYCFSVRGLTRELACGFDLDFADPAAVAPSPADGEAWPIRVEPESKATR
FT                   FAARRVTGIDPNAVSPWWLQRRLLLSGVRPISPAVDVTNYVLLELGQPLHAFDAAKIRG
FT                   ELVVRRAVAGEKLTTLDETERVLDPEDVVIADDSGVLSLAGIMGGASTEVGPGTTDILL
FT                   EAATWDPLAVFKTARRHKLSSEAGKRFERVVDPEIPVAALDRAAALLVDIAGGRVESAL
FT                   TDIGEVTPHRPIHMDIDLPDRVAGVDYPTGTSARRLTQIGCSVEVGVSDSGHGQLVAAP
FT                   PSWRPDLVQPADLVEEVLRLEGLEKIPSVLPAAPAGRGLTPTQRRKRAVGRALAFSGYV
FT                   EILPPVFLPTAVFDTWGLDPEDPRRNTGRVLNPLESDRPELATTLLPGLLEVLARNVSR
FT                   GQRDLSLFGIAQVVLPGADTKPVAALPVDRRPTDEQITALLQSLPDQPVHVAVVLTGQR
FT                   EPSGPWGAGRAADATDAFAAARTVAAAAGVEFEFRAAQYLPWHPGRGAELLVDGVVVGH
FT                   AGELHPAVLERAGLPPRTSAVEIDLSALPLVENLPAPKVSPFPAVLQDVAVVVDTAVPA
FT                   AEVQAALRSGGGELLEDIRLFDVFEGEQVGEGRKSLAFALRFRGADRTLTEDEASAARD
FT                   AAVAAASAAVGAELRS"
FT   CDS_pept        complement(721323..722408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="ROP_06900"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.20"
FT                   /note="protein synonym:pheRS"
FT                   /note="protein synonym:phenylalanine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48937"
FT                   /db_xref="GOA:C1AT05"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT05"
FT                   /protein_id="BAH48937.1"
FT                   /translation="MAKKEGAASAGVEGGAVDASALTEDALTAAAESAEKAFASVADLD
FT                   DLAKAKVEHMGDKSPIALARRGLGALPGKEKADAGKRVNVARTRISAAFDERRAVLLAE
FT                   RDAAVLVAEAIDVTLPSQRQPVGARHPISIISEQVEDVFVAMGWEVAEGPEVETEHFNF
FT                   DALNFLPDHPARTMQDTFHIAPEGSRQVLRTHTSPVQVRTMLSREVPIYVVCPGRTFRT
FT                   DELDATHTPVFSQVEGLAVDKGLTMAHLRGTLDAFARALFGPETRTRMRPNYFPFTEPS
FT                   AEVDVWFPNKKGGAGWVEWGGCGMVNPNVLRASGIDPDVYTGFAFGMGLERTLQFRNGI
FT                   PDMRDIVEGDVRFTLPFGVQG"
FT   CDS_pept        complement(722503..723312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06910"
FT                   /product="putative RNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48938"
FT                   /db_xref="GOA:C1AT06"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT06"
FT                   /protein_id="BAH48938.1"
FT                   /translation="MDPLTERTPRVVSAVKLLRTAERRKVGRFLVEGENSVGEALATHP
FT                   VHDLFYTADAEQRYSALIERAHAAGVRTSLVTDRAVRALSDTVTPPGLVAVCELLDVPL
FT                   AEALGPGTRLLAVPVAVAEPGNAGTVIRVADAVGADAAILAGDSVDPHNGKCVRASAGS
FT                   LFHLPVVRERDTAAVLDTISAAGIQLLATAADGEVDLDDADELLARPTAWLFGNEAHGL
FT                   DAATAARADHRVRIPIHGRAESLNLATAASICLYSSARVQNRKRTDS"
FT   CDS_pept        complement(723351..723740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="ROP_06920"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48939"
FT                   /db_xref="GOA:C1AT07"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT07"
FT                   /protein_id="BAH48939.1"
FT                   /translation="MARVKRAVNAQKKRRSILEASSGYRGQRSRLYRKAKEQQLHSLTY
FT                   AYRDRRARKGDFRKLWITRINAAARANDITYNRLIQGLRLAEIEVDRKNLAELAVSDAA
FT                   AFAGLVALAKAALPADVNAPAGEAA"
FT   CDS_pept        complement(723805..723999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="ROP_06930"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48940"
FT                   /db_xref="GOA:C1AT08"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT08"
FT                   /protein_id="BAH48940.1"
FT                   /translation="MPKSKTHSGTAKRFKVSGSGKILRQKAGRRHLLEHKATKVTRRLD
FT                   GVAVVSKADTPRIKRLLDI"
FT   CDS_pept        complement(724057..724704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="ROP_06940"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48941"
FT                   /db_xref="GOA:C1AT09"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT09"
FT                   /protein_id="BAH48941.1"
FT                   /translation="MSTETRINDRIRVPEVRLVGPGGEQVGIVRVEDALRLALEADLDL
FT                   VEVAPDARPPVCKIMDYGKFKYEAAQKARESRKNQQLTVIKEQKLRPKIDDHDYETKKR
FT                   NVVRFLEAGSKVKVTIMFRGREQSRPELGFRLLQRLGADVADLGFVETSAKQDGRNMTM
FT                   VLAPHKGAKTRVKAQESAAAPPAQRATPAPAQAPATPAEQAGGSTPGEAPTS"
FT   CDS_pept        725106..725489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48942"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT10"
FT                   /protein_id="BAH48942.1"
FT                   /translation="MTDNIDDIPNDGTVSGGDQNTDVRELADVPSVEVISRAAVMLMSS
FT                   AAEKLGLSDADPDSSPHRDLDEARRVITALAGLVTASIEYLGPHAGPIREGLQALQRAF
FT                   REASSHPDEPGKGPGEKYTGPVY"
FT   CDS_pept        725540..725953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48943"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT11"
FT                   /protein_id="BAH48943.1"
FT                   /translation="MAGRNKTEQTQADVDEFLAAVTDPVKRADSARLVELLTAATGEPA
FT                   AMWGTSIVGFGTRHYRYASGHEGDTALIGFSPRAAALTLYLSLDFTEHETELAALGKHK
FT                   VGKGCLYVKKLADVDESVLVSLMDRSVAAARAL"
FT   CDS_pept        complement(725961..726662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06970"
FT                   /product="putative DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48944"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT12"
FT                   /protein_id="BAH48944.1"
FT                   /translation="MDRPARLHALTEELRRAGDRGRTAEQLAAQFEVTPRTIKRDIAVL
FT                   QASGAAIRATAGPGGGYGIIGNGTLPPVNFTPAQAVSVALALTAFRDAPFATDGRAALA
FT                   KLLDVMDAESRERVEQLGAKVWIRRDSHGARAEPRIRRVVEDGLQRELMVSLRYVDRDG
FT                   GRTERVVEPHLLAHTRGSWFLVAWCLSRAGVRWFRLDRVSDATLTGRSFVPRDPDLFGE
FT                   PPADARTVFDR"
FT   CDS_pept        726783..727529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_06980"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48945"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT13"
FT                   /protein_id="BAH48945.1"
FT                   /translation="MTRTSEAHGSTGTHIILVPGFWLGAWAWEAVESDLIGQGHHVTAV
FT                   TLPGLDATGSDRAGVRLDHHVTAITEAIANTPSSERVVLVAHSGAGPVAYAASDRLPGR
FT                   LARIVYVDSGPLQSGTALRDDLDPAVVEIPLPSWSELEAEGSSLAGLDDAALETFRNRA
FT                   VPMPAGPARDTTELTDSRRLDVPTTVICTSFPSEVIQQMAAAGHPMAAELAQIAKVDYV
FT                   DLPTGHWPMWSRPADLATAIDAAARD"
FT   CDS_pept        complement(727536..730529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ROP_06990"
FT                   /product="UvrABC system protein A"
FT                   /note="protein synonym:excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48946"
FT                   /db_xref="GOA:C1AT14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT14"
FT                   /protein_id="BAH48946.1"
FT                   /translation="MADRLIVRGAREHNLRGVDLDLPRDSLIVFTGLSGSGKSSLAFDT
FT                   IFAEGQRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVGTITE
FT                   VYDYLRLLYARAGTAHCPVCGEQIARQTPQQIVDQVLEMEEGTRFQVLAPVVRTRKGEF
FT                   VDLFDQLNMQGYSRVRVDGVVYPLSEPPKLKKQEKHDIEVVVDRLTVKAGSKQRLTDSV
FT                   ETALRLAEGIVVLDFVDREENAADRERRFSEKLACPNGHALSIDDLEPRSFSFNSPYGA
FT                   CPECTGLGIRKEVDPDLVVPDPELSLGDGAIAPWSMGQSSEYFGRLLSGLGDILGFDMK
FT                   TPWNKLPAKARRAILEGSEEQVHVRYKNRYGRTRSYYAEFEGVMPFLHRRLEQTESDQM
FT                   KERYDGYMRDTPCPACGGARLRPEILSVTIANEKFGMKSIAEVCELSISDCADFLNSLT
FT                   LGSREEAIAGQVLKEVQARLGFLLDVGLEYLSLARAAGTLSGGEAQRIRLATQIGSGLV
FT                   GVLYVLDEPSIGLHQRDNRRLIETLTRLRDLGNTLIVVEHDEDTIRTSDWVVDIGPLAG
FT                   EHGGKVVHSGPYQELLDCEESLTGAYLSGRSHIEIPAIRRPVDRKRQVTVVGAREHNLG
FT                   GIDVSFPLGVLTSVTGVSGSGKSTLVNDILATVMANKLNGARQVPGRHTRINGLDQLDK
FT                   LVQVDQSPIGRTPRSNAATYTGVFDKIRTLFAATTESKVRGYQPGRFSFNVKGGRCEAC
FT                   SGDGTLKIEMNFLPDVYVPCEVCHGARYNRETLEVHYKGKTIAEVLDMPIEEAAEFFEP
FT                   ITSIHRYLKTLVEVGLGYVRLGQPAPTLSGGEAQRVKLAAELQKRSTGRTVYILDEPTT
FT                   GLHFEDIRKLLGVVNGLVDKGNTVIVIEHNLDVIKTSDWVVDMGPEGGSGGGTVVAQGT
FT                   PEDVAQVPESYTGRFLENVLAVPAPVAAKPKAAKSSPTRKSASAKKTAAATAATPRKRA
FT                   PKKAAAVS"
FT   CDS_pept        730567..731370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48947"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT15"
FT                   /protein_id="BAH48947.1"
FT                   /translation="MDAQPSGRAMVSRGTDTFCATDGRPATHLPVFDGSLPIMTEQPMV
FT                   IEDSYTGHVSPGSAPQRRTVPGATITKMSVGPMDNNVYLVVCSATGKSVLIDAANEADR
FT                   VNQLIGEHAPSLDLIVTTHQHGDHWLALEDVAAATRVDTAAHPLDADALPVRPDRLLDD
FT                   GDTVTVGEVTLDVIHLAGHTPGSVALALTEAGGGRTHLFTGDSLFPGGVGKTADADKFA
FT                   SLLTDVETKLFDRYGDDTVVYPGHGDDTTLGAERPHLGEWRERGW"
FT   CDS_pept        731537..732466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48948"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT16"
FT                   /protein_id="BAH48948.1"
FT                   /translation="MLVRRIARPLLSAIFISGGIDALRNPAQKAQAAAPLIDKSTEALP
FT                   GSVTQKIPSDPETLIKINAAVQIGGGVLLATGKAPRLASLALAGSLVPTTVVGHDFWNE
FT                   TDPAKKAAQRTQFLKNVSLLGGLLIAAVDTEGKPSLGWRGRRAARHAQETVAAALPLGS
FT                   GHDHHGPEIAEALAAASERARILSGEAAERGTGLLEVAKDRGTELAKVAADRGAEWAEV
FT                   AKEHGAEWAEVAKEHGAEWADVARERGAELVEAAKEHGPELAEVAREKGGEWAGTAAER
FT                   GEVLGKRARKQAETALEKARAKRDELSH"
FT   CDS_pept        732613..734895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48949"
FT                   /db_xref="GOA:C1AT17"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT17"
FT                   /protein_id="BAH48949.1"
FT                   /translation="MPDEDTSRDERELEQQYVTMLYTRLDGLRQYAANRLSRVLLETGG
FT                   TPQARSERESFNQLYTEDLAKYDAAENGLCFGRIDLDGEHRYVGRLGILDEENDYETML
FT                   LDWRAPLARPFYLATPAAPDGVTRRRHIRTRSRRVTAVNDEYLDLAAAEAAGTVTGSDG
FT                   VAGESALLSALNAARTGQMNDIVETIQGEQDAIIRSEHKSVLVVQGGPGTGKTAVALHR
FT                   AAYLLYTYRQQLAKAGVLIIGPNATFLDYIGQVLPSLGETGVLLSTIGDLYPGVRATVE
FT                   DSLDAGEIKGSLDMLDVLKKAVRDRQEVPSRPVELTFDTYRITLDRKVVTRARGRARSS
FT                   RRPHNLARPIFVSSVIEALAQQLADTLGANVVDGGNLLSRDDIADMRDEMREDPAIMTA
FT                   ISALWPELSPQQVLADLYASPKRLADSAPNLTEAQRDSLRRPGMRGFSAADAPLLDELA
FT                   ELLGVDDAAERERARRQWRAQIADAQGALDILTGSAPQDLEDELDPEILMAYDLIDASQ
FT                   LAERHDVGQHQTTAERAAGDRTWTYGHVIVDEAQELSEMAWRMLMRRIPNRWMTLVGDT
FT                   AQTGDPAGTSSWQRILEPYVANRWKLTELTVNYRTPAEIMTSARQVLAEIDPEQTVPRS
FT                   VRESGFAPWALQVSEAELADTVRTCVSRETGPGTTVVIGGHDLVAALADLRSDTVSVLT
FT                   VRDVKGLEFDSVLIAEPQDVLDESPRGMNDLYVALTRATQRLGVVHTKTLPAVLSELGP
FT                   AEVGILS"
FT   CDS_pept        complement(735007..735459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07030"
FT                   /product="putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48950"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT18"
FT                   /protein_id="BAH48950.1"
FT                   /translation="MSAYRTVVVGTDGSESSFLAVEKAAAIAGDAGAKLIIACAYYPAD
FT                   PKDVGSAADALGDEAYQITGSAPTYEILRTAKERAHAAGAKEVVERAVVGAPVESLLNL
FT                   VDEVEAGLLVIGNRGLNTLTGRLLGSVPSDAARKSTSDVLIVHTVR"
FT   CDS_pept        complement(735647..736519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48951"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT19"
FT                   /protein_id="BAH48951.1"
FT                   /translation="MDAHNAGRTARSLELLHSLSYFVPEVEDRLVEAGLEPGRMSYFAG
FT                   RSAPMGAVGAGVVTATFFNFSPAAVASIIPRAWGLATPAAIVEARYRAVGEAYVRLLGE
FT                   SVTTSPEMAEAAELASIAARGIPGVEGRPLCAGYTEVEWPDSPHLAFWHALTVLREYRG
FT                   DGHIAALQTAGLSGLESLITHTATGYGFQKKFAITRRAWTQDQWDSACDSLRDREILDA
FT                   RGELTAEGKELRELVEDLTDDLALAPWAALGEDGAARLVELATPWRDAVVAAGVFPAGV
FT                   FGPKVPVSR"
FT   CDS_pept        complement(736550..738712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="ROP_07050"
FT                   /product="UvrABC system protein B"
FT                   /note="protein synonym:excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48952"
FT                   /db_xref="GOA:C1AT20"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT20"
FT                   /protein_id="BAH48952.1"
FT                   /translation="MAFASEHPVVAHSEFRPIGEIERSEARFEVVSDHKPAGDQPTAIA
FT                   DLERRINAGEKDVVLLGATGTGKSATTAWLIEKVQRPTLVMAPNKTLAAQLANELRDML
FT                   PNNSVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSATSSLLSRRDVVVVA
FT                   SVSCIYGLGTPQSYLDRSVQLEVGVEVPRDALLRLLVDVQYTRNDLAFTRGSFRVRGDT
FT                   VEIIPSYEELAVRIEFFGDEIEALYYLHPLTGDVVRKVDSVRIFPATHYVAGPERMERA
FT                   VKDIEAELEERLADLENKGKLLEAQRLRMRTQYDLEMIKQVGFCSGIENYSRHIDGRGP
FT                   GTAPATLIDYFPEDFLLVIDESHVTVPQIGAMYEGDMSRKRNLVEFGFRLPSATDNRPL
FT                   TWEEFTQRIGQTVYLSATPGKYELGQAGGEFVEQVIRPTGLVDPEVVVKPTKGQIDDLV
FT                   HEIRERADRDERVLVTTLTKKMAEDLTDYLLELGIRVRYLHSDIDTLRRVELLRQLRLG
FT                   EYDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSSTSLIQTIGRAARNVSGQVHMYA
FT                   DKITDSMQHAIEETERRREKQIAYNEKMGVDPQPLRKKIADILDQVYEEAEDTASGVDV
FT                   GGSGRNATRGRRAQGEAGRSVSAGVYEGRDTKSMPRAELADLVKELTDQMMNAARDLQF
FT                   ELAGRLRDEIADLKKELRGMDAAGLK"
FT   CDS_pept        738791..739309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48953"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR014465"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT21"
FT                   /protein_id="BAH48953.1"
FT                   /translation="MAGASTDIHPPKVEYFDLRDHTNTDPKGFVRHVDHYRVEPWGLYM
FT                   ARTADHRQFHYLESWLLPDLGLRASIFHYHPYHQRDQDHYVDVGTFTRGENVWKSEDHY
FT                   LDLVIRTGRDTELLDVDELMEAHRTGLLDAATAEQAILTATTAIDGIAAHGHDLGGWLA
FT                   SIGMPIDWR"
FT   CDS_pept        complement(739311..740525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="ROP_07070"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="protein synonym:dephosphocoenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48954"
FT                   /db_xref="GOA:C1AT22"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT22"
FT                   /protein_id="BAH48954.1"
FT                   /translation="MLRIGLTGGIGAGKSTVSKVLAELGAVIVDADLIAREVVEPGTQG
FT                   LAALVDRFGEEILTADGALDRPALAARAFADEESRLALNSIVHPLVGARTTETIESAPE
FT                   DAVLVQDIPLLVEGGMGAAFHLVVVVFVDAEDRVRRLVGSRGMSESDARARIAAQADDD
FT                   QRRAAADVRLDNSGAPGALEPEVRALWAERLVPFESNIRTRTVVRVLPELASPNPQWPA
FT                   QADRLIARLRLVCGDRAVRIDHIGSTAVEGLPAKDVIDVQVTVANLEVADELAESLAAA
FT                   GFPRIEHITADDPKPAYQGGETDPALWGKRIHGGADPGRPVNIHLRVDGWPGQQFALVF
FT                   RDWLRADTDARAEYLAVKEAAAEKAAGHADYQDAITAYVDAKTPWFDRAYHRAWQWAEQ
FT                   TGWSA"
FT   CDS_pept        740694..740912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48955"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT23"
FT                   /protein_id="BAH48955.1"
FT                   /translation="MRDHRNQFGRHRLGMAGGVHCIEIPEVASALAEHRRTWLTALISQ
FT                   GRHSFATMRKRTEVQSSSGYWIPATAN"
FT   CDS_pept        complement(741065..742549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="ROP_07090"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48956"
FT                   /db_xref="GOA:C1AT24"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT24"
FT                   /protein_id="BAH48956.1"
FT                   /translation="MPSTTVTSPQVAVNDIGSAEDFLAAIDATIKYFNDGDIVEGTIVK
FT                   VDRDEVLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRLILSK
FT                   KRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPASLVEMRRVRDLQP
FT                   YVGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRSEFLHQLQKGQVRKGVVSSIVNF
FT                   GAFVDLGGVDGLVHVSELSWKHIDHPSEVVEVGTEVTVEVLDVDLDRERVSLSLKATQE
FT                   DPWRQFARTHAIGQIVPGKVTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVGV
FT                   NDDALVKVIDIDLERRRISLSLKQANEDYNAEFDPSKYGMADSYDEQGNYIFPEGFDPE
FT                   TNEWLEGFDKQREEWENRYAEAERRHKMHTAQMEKTAADEAAEAATAAAGYSSESGAGD
FT                   ADAASSSSSSSSESAGGSLASDAQLAALREKLSGNA"
FT   CDS_pept        742800..743693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07100"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48957"
FT                   /db_xref="GOA:C1AT25"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT25"
FT                   /protein_id="BAH48957.1"
FT                   /translation="MSDPRPPDSPLSPEDDRHGTANSVLGTSGVSRVRVDSESSERASR
FT                   AWWDADADDYHRTHGEFLGVDSTRGEFVWCPEGLHEGDYHLLGDVAGKDVLEVGCGSAP
FT                   CARWLAGQGARVVGLDLSMSMLTRGVEAMRAGGPAVPLVHAGAEHLPFADASFDLACSA
FT                   FGAVPFVADSQQVMSEVARVLRPGGLWVFAVNHPIRWIFPDDPGPRGLTASLPYFDRTP
FT                   YVEVDGDGVPTYVEHHRTIGDRVREIVAAGLEVRDIIEPEWPEWLDREWGQWSPLRGQI
FT                   FPGTAIFSCRKPVSTC"
FT   CDS_pept        complement(743733..744494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07110"
FT                   /product="putative amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48958"
FT                   /db_xref="GOA:C1AT26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT26"
FT                   /protein_id="BAH48958.1"
FT                   /translation="MTPMVKADRVCKNFGALKVLKGVSLEIGAGQVLCLVGPSGSGKST
FT                   FLRCINHLEQVNAGRLYVDGEIVGYSERGGKLYELHPRAAAKQRRDIGMVFQHFNLFPH
FT                   RTALENIIEAPIQVKKLSKKKALERARDLLDQVGLSEKADAYPAQLSGGQQQRVAIARA
FT                   LAMDPKLMLFDEPTSALDPELVGEVLTVMKDLAAGGMTMVVVTHEMGFAREVADQLVFM
FT                   DAGVVVESGNPRELLANPQHDRTKAFLSKLL"
FT   CDS_pept        complement(744491..745474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07120"
FT                   /product="putative amino acid ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48959"
FT                   /db_xref="GOA:C1AT27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT27"
FT                   /protein_id="BAH48959.1"
FT                   /translation="MEKAPDRPGTETGQEPEPIKAIPLRRPGRWIAAIVVGLLLALFVN
FT                   GARTNEAYRWDVYAQYLFDARISAAAWNTIQLTILSMAIAIVLGVVLAVMRLSPNPVLK
FT                   AASWGYLWIFRGTPVYVQLVFWGLFPSIYKQLDLGIPFVHQFVHIDLQGINAAFLFAVI
FT                   GLGLNEAAYMAEIVRAGVNSVAEGQSEASVALGMTWSQTMRRTVLPQAMRVIIPPTGNE
FT                   LISMLKTTSLVTAVPYSLELYGRARDISGANFQPIPLLMVAATWYLAITSLLMIGQFYL
FT                   ERYYSKGASRKLTPRQLQALADAQGKPLVIEPGPETLPDTPGGERR"
FT   CDS_pept        complement(745495..746424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07130"
FT                   /product="putative amino acid ABC transporter amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT28"
FT                   /protein_id="BAH48960.1"
FT                   /translation="MPVSGRSVFARGRVARTICALAGGSALLLAGCASNTEGGGSPSGE
FT                   DTVAVEVDKVDAIAATLPEKIASSGKIIVGVNIPYSPNEFKDPSGKIVGFDVDLVDAVG
FT                   KVLGVTPEYTEADFDKIIPSIQAGSYDMGMSSFTDTKEREQSVDFTTYFSAGVQWAQPA
FT                   GKSVDPTNACGLRVGVQTTTIEDLEEVPAKSAACVAAGKPPIEIVKFDSQDDAANAVAL
FT                   GKVDAMSADSPVTAYAIKQSDGKIEAAGEVFDAAPYGWPVAKGSPLAQTLQQALQHLID
FT                   DGTYRTIAENWGVEAGVITTSQINGATS"
FT   CDS_pept        complement(746571..747668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07140"
FT                   /product="putative 3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48961"
FT                   /db_xref="GOA:C1AT29"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT29"
FT                   /protein_id="BAH48961.1"
FT                   /translation="MSGATANISGTRIGVLLGDGIGHEIVPATRRVVSAAVAAAGGGDV
FT                   DWVELPLGLGAIESHGTPIPDSTLAALDELDAWILGPHDSAAYPEPFRGRLTPGGVVRK
FT                   RFGLFANLRPARSLEGVAATVPDMDLVIVRENTEGLYADRNMFAGSGEFMPTPDVALAV
FT                   GVVTRQACERIAHTAFALARTRSRHVTIVHKANVLSMTTGLFRDVCREVGERDYPDVRI
FT                   DDEHVDAMTAHLVRRGRDFDVVVTENMFGDILSDLTGELSGSLGTAPSINTSETQVMAQ
FT                   AAHGAAPGLAGRNRANPTALMLSAAMMLEWLGDRRADRQLGGAAHRIRDAVRATIASGV
FT                   ATADLGGLASTSEFAETVLARTLRR"
FT   CDS_pept        747688..748209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48962"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT30"
FT                   /protein_id="BAH48962.1"
FT                   /translation="MVQSVELLFDEATDVAVRAEWQRLWDAGMPSRTRVRAESNRPHIT
FT                   LFVARHIPPEIDELLGRRIATPSFHVRLGGLVMFGGRHVTLSRLVVPSKALLSLHRSVF
FT                   DLAEHATEVTPHIRPGEWTPHVTLARRLPADQIPEAARLLDGGDIVGRASVVRRWDGDA
FT                   KREWVVTAPP"
FT   CDS_pept        complement(748210..749115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07160"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48963"
FT                   /db_xref="GOA:C1AT31"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT31"
FT                   /protein_id="BAH48963.1"
FT                   /translation="MRGNPAVQYAGTALAWGASFLFIKVGLEGLSFTQVVLWRLVFGAV
FT                   TLGAVLGITRTRLPRAAATWAHLSVLAVAQCLLPWLLFSWAEQSISSGLASIYNATTPL
FT                   MTMSVALAFLPGEKLTDAKLFGLLLGFGGVVVVLAPWQSGILGSVPAQLACLGATASYG
FT                   VALVYLRRFVLPRGVSTPTIAFMQVSIAAAAMVLATPWAASTPMHLTPAIVASMIGLGA
FT                   FGTGLAFVWNTNVVRGWGPTAASTVTYLTPVVGVALGAVALDERISWNQPVGALAVIAG
FT                   IVVTQRSSRKAAATTAAHTP"
FT   CDS_pept        749310..750308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07170"
FT                   /product="putative AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48964"
FT                   /db_xref="GOA:C1AT32"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT32"
FT                   /protein_id="BAH48964.1"
FT                   /translation="MLNKVVVPLMPLTEAFELGVACEVFGFDRSDDGLPTYDFSLVAGS
FT                   PEPIRTRFGYGIDVPYDLDRLDDADLIVVPAGGTYAEEDGSYLCAREPAPHLDPLLDKL
FT                   RAAVDRGAKVASLCSGAFVLGAAGLLDRRKCTTHWRHARRLAELHPAATVDPNVLYVDD
FT                   DPVLTSAGTAAGIDLCLHIVRKEQGSKVANVIARRMVVPPHRDGGQAQYVAMPLPSTTI
FT                   DTLGPLLDWMTEHLALDLTVTAVAAKANMSPRTFARRFQAETGTTPARWLSDQRVLAAQ
FT                   HLLENSDLSVDVIAERVGFGGGAVLRQHFLRLRHTTPQAYRRTFRNTERTG"
FT   CDS_pept        750381..750749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="ROP_07180"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48965"
FT                   /db_xref="GOA:C1AT33"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT33"
FT                   /protein_id="BAH48965.1"
FT                   /translation="MATKTLTQQNFDETVTGNDVVLVDFWASWCGPCRSFAPTFEASSE
FT                   QHPDVVHAKVDTEAEQGIAAAANIRSIPTIMAFREGVLVFSQPGALPPAALEDLVTQVK
FT                   ALDMDEVRKQIAEQAPAE"
FT   CDS_pept        complement(750769..753513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="ROP_07190"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48966"
FT                   /db_xref="GOA:C1AT34"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT34"
FT                   /protein_id="BAH48966.1"
FT                   /translation="MSPATTPRSTTSPASGAAAPSDDRPTLMLLDGHSLAFRAFYALPA
FT                   ENFKTHSGQVTNAVYGFTSMLINLLRDEQPTHVAAAFDVSRQTFRAEKFPEYKANRSKA
FT                   PDEFKGQVEITKDVLGALGIPVMAEEGFEADDIIATLTTQAEALGYRVLVVTGDRDSLQ
FT                   LVTDGVTVLYPKKGVSDLTRFTPAAVEEKYGLTPAQYPDFAALRGDPSDNLPGIPGVGE
FT                   KTATKWIKEYGDLVGLVDNVDKVRGKVGDALRENLPNVLLNRELTEMVRDVPLPYTPDQ
FT                   LMLAQWDREKIHALFDDLEFKVLRDRLFATLAPVEAEAEEGFEVRGSALEPGAVADWLS
FT                   LHASTGERSGVSVVGTRTPYGGDVTAIAVAAADGEGAYIATASATPEDEKALGDWLADA
FT                   EQPKALHEAKWAMHALRGRGWVLGGLTSDTALAAYLVRPGQRTFNLDDLSLRYLRRELR
FT                   VEETGQEQLSLLDDADQVDAEAAETEILSARAVLDLAAALDTELDNIESTALLSEMELP
FT                   LLEVLAVIEASGIAVDGTHLHDLQSRFAAEVSEAAEAAYGVIGKQINLGSPKQLQVVLF
FT                   DELEMPKTKKTKTGYTTDAEALQNLFEKTSHPFLEHLLAHRDATRLKVTVDGLLKTVAE
FT                   DGRIHTTFNQTVAATGRLSSTEPNLQNIPVRTDAGRQIRDGFVVGEGYDSLLTADYSQI
FT                   EMRIMAHVSGDAGLIEAFNTGEDLHSFVGARAFGVPIEEVTPELRRRVKAMSYGLAYGL
FT                   SAFGLAAQLKISTEEAKSQMEAYFARFGGVRDYLHEVVEQARKDGYTSTLYGRRRYLPD
FT                   LTSDNRQRREVAERAALNAPIQGTAADIIKVAMINVQRSLREAGLKSRMLLQVHDELVL
FT                   EVVDSEREQVEQLVRDKMSSAIELSVPLDVSVGTGRSWDAAAH"
FT   CDS_pept        753705..755105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07200"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48967"
FT                   /db_xref="GOA:C1AT35"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT35"
FT                   /protein_id="BAH48967.1"
FT                   /translation="MAPTVRKRLPAVRTRPTSARKHTRRGPVTRQLGRAFVLVLLGLVA
FT                   AIAFGGPAAAQEPTPPPPPSTSVQPAPPANAVRVSGNLNNAGERLADVEVRALDSSGTE
FT                   VAKATSESNGRWELQVAPGTYTFEIVADSLPDDVSVQGTVEREVVAGRANTVIFSFGEA
FT                   RTGSAVPFYEKLIRQTIDGLRFGLVIAIAGVGLSLIYGTTGLTNFAHGELVTLGAVAAW
FT                   VINVTFGVQLIPATVLAVFVGILIGLLNNAAIWKPLRKRKTGLIAQLVVSIGLAISLRY
FT                   LILIFFSDRAEPFVDYQAQVERHWGPIAITDANLVCIGISLVVLVGVALLLQKTRIGKA
FT                   MRAVSDNRDLAASSGIDVERVIRFVWGLGGGLAALGGVLFGISELGGRVQWEMGFKLLL
FT                   LMFAGITLGGLGTAYGALLGCVIVGLLVQLSTLVINPDLKYIGGLLILIVILVVRPQGI
FT                   LGSRQRIG"
FT   CDS_pept        755110..756099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07210"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48968"
FT                   /db_xref="GOA:C1AT36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT36"
FT                   /protein_id="BAH48968.1"
FT                   /translation="MDITGALQVSLAQLIGPSAIFYALLAIGLNLHFGYAGLLNFGQIG
FT                   FALLGGYGVGIMTVTYQQPLWVGILVGLAAAGLLAVVLGIPTLRLRADYLAIVTIAASE
FT                   ILRLIFRSTASDSITGSTNGLFGFADPFTTLSPFDSGKQYNFLGVKFYGDDLWSMVVGW
FT                   TLVLVLCGFVYLLTHSPWGRVLKAVREDEDAARALGKNVFVYKMQALVLGGMIGGLGGV
FT                   FNALQTKSINPDFYSTAQTFFAFGALILGGAATVFGPVVGAMLFWFLLAIPDALLRQAI
FT                   SGPEPLLPLTEQQVGAMRFVLLGIMIAVLMIFRPQGILGNKREVQLNA"
FT   CDS_pept        756092..757111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07220"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48969"
FT                   /db_xref="GOA:C1AT37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT37"
FT                   /protein_id="BAH48969.1"
FT                   /translation="MPDHRLPDHLQTDTVLTAEERASIFTDVPHSPGAAKPDPILLVDN
FT                   VSRTFGGLRAVDVAHLEIQRGCITGLIGPNGAGKTTLFNLLTGFDRPDSGTWSMDGQSL
FT                   GRMYPHQVARRGVVRTFQLTKALSKLTVLDNVRLGATGQRGERIFNTLLPWTWKAQERA
FT                   VTERANELLARFKLDTKSDDLAGSLSGGQRKLLEMARALMTEPTVVMLDEPMAGVNPAL
FT                   TQSLLGHIKSLRDEGMTVVFVEHDMDVIRDISDWVVVMAQGSVIAESTPEHLSSNSAVV
FT                   DAYLGSHHDQALEFDDEGNPVGATAVLAEALESAEAETLETGGDLSEPDITELRRENP"
FT   CDS_pept        757108..757902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07230"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48970"
FT                   /db_xref="GOA:C1AT38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT38"
FT                   /protein_id="BAH48970.1"
FT                   /translation="MTEPTPAEFAATPEEHARLAEGALVRADGVVAGYIPGVNILRECN
FT                   FFLREGEIVGIIGPNGAGKSTLLKSLFGLIPVREGSVTLRGEDITSKPAHVLVQMGVGY
FT                   VPQTQNVFPSLTIEENLEMGVYLRPKLFAERFAFVGDLFPLLVERKKVKAGALSGGERQ
FT                   MVAMGRALMMDPSVLLLDEPSAGLSPMFQDEVFIRCKRINAAGVSVIMVEQNARRCLQI
FT                   CDRGYVLDQGRNAYTDSGPNLMHDPKVIELYLGTLAGSQEKK"
FT   CDS_pept        complement(757972..759294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07240"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48971"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT39"
FT                   /protein_id="BAH48971.1"
FT                   /translation="MAKRTLVRAAAVLGAASLALAGCSSDSGDDSASGSDSSASATTVS
FT                   TDCTPEEAAAAGAPSTAPLKIGTLLPDTGSLSFLGPPMVAGTQLGVNDVNAAGGVLGQP
FT                   VQLIPGDSGDTTTDTANTTVDRELAAGTQVIIGAASSSVSLKVIDKVSSAGVVMFSPAN
FT                   TSDQFVCYPDKGQYFRTAPTDVLQAQAVSQLISDDGGQRVSILALNDPYGTGLADNIQK
FT                   NLVDAGIPEDQIQKIIYDPNAQSFNSEVDQVKDFAPDAVAVVGFEESAKIITRMHEVGI
FT                   GPSDGMKVYGVDGNMGNALGESVAAPLLDGMQGTTPLTDVGPAFQDRLKAINPGLIDFN
FT                   YAGESYDAVVISALAAEAGKSTAGRDIAANINNVTEGGTPCTSYQECLPLVQAGTDIDY
FT                   NGITGKLDFAAAGEPSIGSYGKLKFGADNKLTTDGYIVVGG"
FT   CDS_pept        complement(759582..760211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07250"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48972"
FT                   /db_xref="GOA:C1AT40"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT40"
FT                   /protein_id="BAH48972.1"
FT                   /translation="MVAMNAPQQQGVPSQARRVVVAEDEALIRLDLVEMLREEGYDVVG
FT                   EAGDGQAAVDLAVELKPDLVIMDVKMPRRDGIDAASEIAAKRIAPVVILTAFSQRELVE
FT                   RARDAGAMAYLVKPFSVADLVPAVELAASRFKEVTALEREISDLSERLETRKIVERAKG
FT                   VLMDKQSLTEPEAFKWIQRAAMDRRSTMKAVAQVVLETLGGEAPSS"
FT   tRNA            760312..760388
FT                   /locus_tag="ROP_t0030"
FT                   /product="tRNA-Leu"
FT   CDS_pept        complement(760469..760921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07260"
FT                   /product="carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48973"
FT                   /db_xref="GOA:C1AT41"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT41"
FT                   /protein_id="BAH48973.1"
FT                   /translation="MKARMTNPAMLVPDAMKSLLALGKATAKANVPPVTHALVHLRSSQ
FT                   INGCSVCVDMHARELEKEGETNQRIFAVAAWREAPFFSDAERAALALAEAMTRLSDRPD
FT                   PVPDEVWDEAARHYDEEQLASLVLSIAGVNLWNRLNAATRQVAGQW"
FT   CDS_pept        761036..761911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07270"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48974"
FT                   /db_xref="GOA:C1AT42"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT42"
FT                   /protein_id="BAH48974.1"
FT                   /translation="MDDNEFLAHRFEENRTHLSAVAYRMLGSISEAEDAVQEGWLRLSR
FT                   TGTSEVQNLRGWLTTVVGRVCLDILRSRKARREDPLEAHVPDPIVREVDGTDPEYEAVL
FT                   GDSVGLALQVVLDTLTPAERLAFVLHDMFALSFDEIAPIADRTPAATRQLASRARRRVQ
FT                   GSGPTPDTDPNRQREVVEAFMTASRGGRFDDLLALLDPDIVLRADRGADGSDVVRGARA
FT                   VGEQALTFSRFAPFGRLALVNGAPGVVTAPDGKTFSVMAFTVAGGRIVRIDILADPVRL
FT                   QRLRISPGDT"
FT   CDS_pept        762017..762520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48975"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT43"
FT                   /protein_id="BAH48975.1"
FT                   /translation="MELGTVTFTYDGRVALRFQQALSHSPEKVWRVLTDPQYLKAWFPA
FT                   DVDFDLTPGADLVFRVTPEQVRRFGLPADQTTTGTVISVHPAHILEYLWDAETLHWELV
FT                   PDGSGGCWLTLTHTVEEEESAYAHAAGWHAGLEVVEAQLDGREVDWSLWDRADELASSY
FT                   RKTS"
FT   CDS_pept        762539..763636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48976"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT44"
FT                   /protein_id="BAH48976.1"
FT                   /translation="MRIPDSTTTPAATFVKEVTGEATRRWGVHGTDLGCPVRLADGRVA
FT                   FFFGDTFTSRGRSGTGWRSPVMLRSTTTDLRGGIEFDSAAGGRTAREILPNAHDVRESP
FT                   DRESAGTEFTVVPADAVTIGDRTYLSVVSVHSWAAQAWPTNFTYLAWSDDGGEHWHRTR
FT                   ARWDNHGGSLDQLWTMERHDGYVYVVSSAFDRINPGGMILRRVPEARILEPGAYEDWGW
FT                   DRGTGWAWGQPATPILPGPVGEMCLRQIDGTWVLAYFDPTAYAIVTRTARRIDGPWSEP
FT                   TVQVAGGGWGAADGTWAQIYGGYIHPASTRDELHLLVSQWNTTTGDPYRVLQFTTPLDP
FT                   PVTPRAPTPTTALPLRVPHRGNGIG"
FT   CDS_pept        complement(763563..765350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07300"
FT                   /product="putative ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48977"
FT                   /db_xref="GOA:C1AT45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT45"
FT                   /protein_id="BAH48977.1"
FT                   /translation="MDWNNVVWDSSMWLLKAYVMTVVAFVVVVILLARFTKWGRQFWRF
FT                   AAPYFNPRRSLKPLTILAVLLLSTVFAVRMTVLFSYWYNDFYDSIQNLDESAFWHFLRV
FT                   FAILATVHVVRALVEYLIGQTLDIDWRTWLNHHLVDDWLDSRAYYRDRFLGDAIDNPDQ
FT                   RIQADITNFVTTSRSLSMGAVTAVLSIVSFTGILWDLSGPMTVFGVEISRAMIFLVYIY
FT                   VLVTTVVAFWIGKPLIKLNFLNEKLGANFRYALIRVREYGESIAFYRGENVERRTLARR
FT                   FADVIRNMWQIVFRTLKFSGWNLTVNQTAVIFPFLVQGPRLFTGQVSLGDVMQTSQAFG
FT                   QVHDSLSFFRESYADFASFRATLIRLNGLANDNQHAAELPVLKTGKSGDDLQVEKLDVR
FT                   IPTGETLIEGLALTVTPGQSLLVKGPSGSGKTTLLRTLADLWPYADGTVSRPSGEAIFL
FT                   SQRPYLPLGSLRTALAYPKEPTASDDVVRGALSRVSLGNLGDRLDETADWTRILSPGEQ
FT                   QRLAFARVLIARPAVIFLDEATSAIDEGLEHTLYTLLRTELPDSIVVSVGHRSTLNQFH
FT                   SRGVELEGEGRWSESELVG"
FT   CDS_pept        complement(765445..765747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48978"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT46"
FT                   /protein_id="BAH48978.1"
FT                   /translation="MAAAYGRSGISETERTCTMSADEPEQKKTGRPAESEVPVPDDEAL
FT                   AEARKKVEEIDARYEPGARETVVLPGSDGTVSGTAFDDYVDDDGNLKEPEPEKGS"
FT   CDS_pept        complement(765798..766676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ROP_07320"
FT                   /product="acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="protein synonym:thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48979"
FT                   /db_xref="GOA:C1AT47"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT47"
FT                   /protein_id="BAH48979.1"
FT                   /translation="MSEVAAKTDLQTLLELLDLEKTGEDTYRGRHPAQVGSRTFGGQLI
FT                   SQALVAAGRTVSGERAVHAVNAHFIRGGDVKEPIEYRVERHRDGRAFANRQVTALQNGQ
FT                   ELFVMLAAFQDWGKGLEHAVEVPDVPFPDTLPPLGDHFQGYEDRLKMFVDALKPIDMRY
FT                   ANDPSWIMKGTGEKLTHNRVWMKSDGDLPDDPLIHVAVMGYSSDTTVLDSIITTHGLSW
FT                   GLDRIVAATVNHSIWFHRPFRFDDWTLYATESPVAAGSRGLATGRFFSLEGELLATVVQ
FT                   EGLIRHFPPRQ"
FT   CDS_pept        complement(766677..768095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="ROP_07330"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48980"
FT                   /db_xref="GOA:C1AT48"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT48"
FT                   /protein_id="BAH48980.1"
FT                   /translation="MNRRTKIVCTLGPATATGDRIRELVESGMDVARLNFSHGEHADHE
FT                   ENYKRVRAASDATGKAVGVLADLQGPKIRLGRFAEGRTTWANGEEVRITVEECEGTHDR
FT                   VSTTYKQLAEDAKPGDRLLVDDGKVGLVVSGVEGNDVICRVTEGGPVSNNKGVSLPGMN
FT                   VSVPALSEKDIADLEFALGLGVDFIALSFVRSPADVELVHAVMDRVGRRIPVIAKLEKP
FT                   EAIDNLEAIVLAFDAVMVARGDLGVELPLEQVPLVQKRAIQIARENAKPVIVATQMLES
FT                   MIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKYVMETVRTMARIVEAVENESTQV
FT                   PPLTHVPRTKRGVISYAARDIGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTPLP
FT                   EVRSQLSLTWGTETFIVDPVDSTDAMVRQVDNALLGLGRYQKGELVVIVAGSPPGTVGS
FT                   TNLIHVHRIGEEDH"
FT   CDS_pept        complement(768132..769634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="ROP_07340"
FT                   /product="glutamate synthase small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48981"
FT                   /db_xref="GOA:C1AT49"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT49"
FT                   /protein_id="BAH48981.1"
FT                   /translation="MADPQGFLHIVKKEAPKRPIAERIHDWNEVYAPQSSAERAAEVSE
FT                   QAARCMDCGIPFCHSGSAGCPLGNLIPEWNDLVRRGRWSAASERLHATNNFPEFTGRVC
FT                   PAPCESACVLSLADTHTTGSVTIKRIEQAIADVAWDSGTVVPKPPMIATGRKVAVVGSG
FT                   PAGLAAAQQLTRAGHDVTVYERDDRLGGLLRYGIPEFKMEKAILDQRLMQMRAEGTHFV
FT                   TDCEVGVDLTVEQMRENFDAVVLAIGALRARDNTTVEGRELNGIHLAMEHLVTSNKECE
FT                   GDGPATITAKGKHVVIIGGGDTGADCLGTAHRQGALSVTQLDYNPELPTERDEAATPWP
FT                   AWPMVLRTSPAHAEGGVRRYQVAVQRFLGDANGNVRSMVLAEVEVAREDGKRIITPVGE
FT                   EIELPCELALFAIGFEGVDLGPLLDDYGLSPTRRGALSCGPDWQTTAPGVFVCGDAHRG
FT                   ASLVVWAIAEGRSAAHAVDVYLTGASDLPSPVHPTALPLAVV"
FT   CDS_pept        complement(769627..774210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="ROP_07350"
FT                   /product="glutamate synthase large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48982"
FT                   /db_xref="GOA:C1AT50"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT50"
FT                   /protein_id="BAH48982.1"
FT                   /translation="MLFSQLPGPQGLYDPDQEVDSCGVAMVADLHGRHSHAIVADGLLA
FT                   LENLEHRGAAGSEPNSGDGAGILLQLPTEFFGALAPFDLPAPLDDGSSTYAAGICFLPQ
FT                   DPQARAAAQRRVSDLADEEGLQILGWRPVPVDPDGADVGSTARACAPHMSQLFVAAPAV
FT                   GGIRPGGLALDRLVYPLRKRAEQVTPDIESEGSGVYFPSLSSRTIVYKGMLTTSQLARY
FT                   FPDLRDRRMASAIAIVHSRFSTNTFPSWPLAHPFRFVAHNGEINTVRGNRNRMRAREAL
FT                   LSSAVIPGDLSRLYPICTPDASDSASFDEVLELLHLAGRSVPHVVMMMVPEAWENDASM
FT                   CPDRRAFYQFHASLMEAWDGPACVTFTDGTVVGAVLDRNGLRPGRWWQTVDGRVVLASE
FT                   SGVLDVPQAEVVAKGRLEPGQMFLVDTSEGRIVPDEEIKMRLAAERPYAEWLYAGLLEL
FT                   KTLPDRPHAQHNHESVVRRQVAFGYTEEDLRILLAPMATSGGEPLGSMGTDTPIAVMSQ
FT                   RSRLLYDYFVELFAQVTNPPLDAIREEVVTSLSRVMGPEQNLLEPTAASCRQIVLPWPV
FT                   LDNEELNKIIHVNADGNHPGLAAAVLRALYDVERGGAGMAEAIEELRAQASAAIADGYR
FT                   TLVISDRDSDHTRAPIPSLLAVAAVHHHLVRTKERTKVALVVESGDAREVHHLALLIGY
FT                   GAAAVNPYLAMESIEDLVSEGELTGVEHTIAVRNYLTALGKGVLKVMSKMGISTVGSYT
FT                   AAQVFEAIGLDRDLVHEYFTGTVSKLGGAGLDEIAREVTVRHRQAYPDNPAEFAHRRLE
FT                   DGGEYQFRRDGELHLFTPETVFLLQHATRTGQHEVFAKYSEEVNRLAEAGGALRGLFTF
FT                   REGVRPPVPLDEVEPAERIVTRFNTGAMSYGSISAEAHETMAVAMNNLGGRSNSGEGGE
FT                   NVDRLYDPSRRSAVKQVASGRFGVTSDYLINASDIQIKMAQGAKPGEGGQLPAYKVYPW
FT                   VAETRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANDRARVHVKLVSSVGVGTVAA
FT                   GVSKAHADVVLISGNDGGTGATPLTSMKHAGAPWEIGLADAQQTLVLNGLRDRITIQCD
FT                   GGMRTGRDVVVAALLGAEEFGFSTAPLIVAGCIMMRVCHLDTCPVGVATQNPELRKRYT
FT                   GKPEFVEEFFRFVAEDVRRYLAELGFRSIDEAVGHADVLETAQGIAHWKNRGLDLTPIF
FT                   AVPAGPDGEPLPQRRRDRDQDHGLDRALDRTLIQLAEGALEDAHAVEIEMPVRNVNRTV
FT                   GTLLGAEVTRRYGAAGLPDDTIRLTFTGSAGQSLGAFLPPGITVDLTGDANDYVGKGLS
FT                   GGRIVVRPADDVLFVPETQVIAGNTLLYGATSGEVYLRGRVGERFSVRNSGASAVVEGV
FT                   GDHACEYMTGGRVVILGPTGRNLAAGMSGGIAYVLDLDPDDVNPAMVKLMQPDPDDLDW
FT                   LCGAVTRHHRWTGSAVAASVLADWPRRSALFTKVMPVDYQRVLDATRMAKAEGLDVDTA
FT                   IMEAARG"
FT   CDS_pept        complement(774485..775324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48983"
FT                   /db_xref="GOA:C1AT51"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT51"
FT                   /protein_id="BAH48983.1"
FT                   /translation="MTEPGKASDESGTGASDDAPKVDLGKSSDGTENSSDSSLPPEFGS
FT                   PFDYDATAEASLSQPPATSDATPSPGASGTGPGWDTYSGVGNGPGWGSTPTYPPPGGTE
FT                   PTAPFPNVGESTSPTAPYSGYDKPQQPDGPTYGAPDPAYGAQYGAAPQPPQDYQQPGYQ
FT                   QPAYGQQQGYPQQGFPPPGYAPGYNAYADPSAPFGRHPLTGEPYSDKSKLTAGLLQIFL
FT                   GAFGVGRFYLNQPGIAVAQIAVTWLTCGIGGIWPLVDGIMMLTGSVKDQYGRPLRDQ"
FT   CDS_pept        complement(775317..776348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="ROP_07370"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48984"
FT                   /db_xref="GOA:C1AT52"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT52"
FT                   /protein_id="BAH48984.1"
FT                   /translation="MTSTVDVLAYIPSPPQGVWYVGPVALRAYALFIIIGIVVAIVWGD
FT                   RRWVARGGEKGTVLDIAIWAVPFGLIGGRLYHVMTDWPTYFGEGGDPVDALKVWQGGLG
FT                   IWGAVALGGVGAWIGCRRRGIPLPALGDAVAPAILLAQAIGRLGNYFNQELYGRETDVP
FT                   WGLEIFERRNDLGQVSPQLIDGVSTGEVAFVVHPTFLYEALWNVLIVILLVWVDRRFRI
FT                   GHGRLFALYVAGYCAGRFWIELMRSDHASLIAGVRVNSFTSALVFVAAAVYFFAATKGR
FT                   EDPADLRPAGGEPVADASRAELVSDDPAPAEPVPDGKAASTASAGGDAGTKTIDSKKDD
FT                   AND"
FT   CDS_pept        complement(776345..777148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="ROP_07380"
FT                   /product="tryptophan synthase alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48985"
FT                   /db_xref="GOA:C1AT53"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT53"
FT                   /protein_id="BAH48985.1"
FT                   /translation="MSERLSRLAPTFAQCREEKRAALVGYLPAGFPTVPESIDVFKAMV
FT                   ESGCDIVEVGIAYSDPVMDGPTIQAAAETALQNGVRVRDVFTVVEAIASVGGKAVVMTY
FT                   WNPVLQYGVDKFARDLASAGGLGLITPNLIPEEAGEWIAASKEHDLDRIFLVAPSSTEE
FT                   RLAITLDASSGFVYAASTMGVTGARDAVSSMAPELTARIRAHSDIPVGVGLGVRSGAQA
FT                   AEIAAYADAVIVGSALVTAAESGLDAVRSLTEELAEGVRSATVAS"
FT   CDS_pept        complement(777145..778464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="ROP_07390"
FT                   /product="tryptophan synthase beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48986"
FT                   /db_xref="GOA:C1AT54"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT54"
FT                   /protein_id="BAH48986.1"
FT                   /translation="MTSRNQETVFKGGNLPTASAGIAERTTHDPDAGGHFGVYGGRHVP
FT                   EALMAVIEEVTAEYEKARGDESFLNELDRLQRDYTGRPSPIFEATRMSEFAGGARLILK
FT                   REDLNHTGSHKINNVLGQVLLAKRMGKTRIIAETGAGQHGVATATACALLGLECIIYMG
FT                   AVDTERQALNVARMRLLGSAVVSVESGSRTLKDAINEALRDWVTNAHNTYYCFGTAAGP
FT                   HPFPTIVRDFQRVVGLETRVQVQAATGRLPDAVTACVGGGSNAIGIFHAFLDDPSVRLV
FT                   GYEAAGDGVETGRHAATFAGGTPGAFQGAYSYLLQDEDGQTIESHSISAGLDYPGVGPE
FT                   HALLKDIGRATYEPVTDSEAMDALRLLSEREGIIPAIESAHAVAGALRLGRELGEGAII
FT                   VVSLSGRGDKDMDTAAKWFGLFDPDDSTETTTTDKEGSAK"
FT   CDS_pept        complement(778527..779336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="ROP_07400"
FT                   /product="indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48987"
FT                   /db_xref="GOA:C1AT55"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT55"
FT                   /protein_id="BAH48987.1"
FT                   /translation="MTVLDSILDGVRADVAAREAVLDFAAVKAAAAAAPPALDAAAALL
FT                   EPGIGVIAEVKRASPSKGALADIADPAELAAAYQAGGARVISVLTEERRFQGSLADLDA
FT                   VRRAVSIPILRKDFIVGPYQIHEARAHGADMVLLIVAALEQDALASLIDRTESLGMTAL
FT                   VEVHTEEEANRAIEAGAKVIGVNARNLKTLEVDKNTFGEIAPGLPTEIIKIAESGVRGT
FT                   ADLLAYAGAGADAVLVGEGLVTSGDPRKAVADLVNAGAHPSCPKPSR"
FT   CDS_pept        complement(779423..780127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07410"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48988"
FT                   /db_xref="GOA:C1AT56"
FT                   /db_xref="InterPro:IPR011746"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT56"
FT                   /protein_id="BAH48988.1"
FT                   /translation="MSDASEPAREPARAGRRRSMFAVLLLAVAAVCLWGASRMTWVEVT
FT                   SSDGLGEERTSVLVGGTWAAALTPLALTLVAAIAASFAVKGWALRVLGVLVAVVAVAAA
FT                   VPAVGLLVSGASDDEAARLAELPGRAEVQSVSVHAAPAVLVLVGALAALAAAVELVRRP
FT                   RVRAGLSSKYDSPGARRDAAKKTGADSAGEPVTQRMLWDALDAGEDPTVDDKKAEPVDQ
FT                   VDGSDEDPGTRT"
FT   CDS_pept        complement(780124..781722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="ROP_07420"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48989"
FT                   /db_xref="GOA:C1ATY1"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY1"
FT                   /protein_id="BAH48989.1"
FT                   /translation="MMVGMHGEPTTIPAPESAATPADGGSDSTTTREQFHALAAEHRVV
FT                   PVTRKVLADAETPLSAYTKLAANRPGTFLLESAENGRSWSRWSFIGAGSPAALTVVDGE
FT                   AAWYGNVPAGAPSGGDPIAALGQTLELLRSERLPDLPPLTGGMVGFLGYDAVRRIERIG
FT                   EHATDDLQIPEMVMLLATDLAAVDHHEGAITLIANAVNWDGTDERVDEAYDSAVERLDR
FT                   MTRALSAPASSTVSTFAKPAPDYRRQRTTEGFGADVQKLVGDIEAGEAFQVVLSQRFEI
FT                   DCTADPIDVYRMLRASNPSPYMYLLNVPDGDGETAFSIVGSSPEALVTVSEGVATTHPI
FT                   AGTRWRGHTEEEDILLEKDLLADEKENAEHLMLVDLGRNDLGRVCEPGTVKVHDYRHIE
FT                   RYSHVMHLVSTVTGHLADGKQALDAVTACFPAGTLSGAPKVRAMQLIEELEPTRRGIYG
FT                   GIIGYLDFAGDADTAIAIRTALIKDGIGYVQAGAGVVADSNPEYEDTEARNKAMAVLSA
FT                   IAAAHTLKTLGGGTQ"
FT   CDS_pept        781770..782234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07430"
FT                   /product="putative hydroperoxide peroxidase"
FT                   /EC_number="1.11.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48990"
FT                   /db_xref="GOA:C1ATY2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY2"
FT                   /protein_id="BAH48990.1"
FT                   /translation="MKPGQLAPEFTLPDQDGIARSLSSLLEDGPLVLFFYPAASTPVCT
FT                   AEACHFRDLGIEFSAVGASRAGISTDAVAKQASFAQAQSFDYPLLSDTDGAVAEKFGVR
FT                   RGLLGKLAPVKRSTFVIDTDRTVLEVISSEFRANTHGDQALAFLRTRQAT"
FT   CDS_pept        complement(782222..783001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48991"
FT                   /db_xref="GOA:C1ATY3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY3"
FT                   /protein_id="BAH48991.1"
FT                   /translation="MTNAMPALFLSHGAPPLVDSDLWVSQLAKWAGDLPRPTAILMVSA
FT                   HWESAPLTIGSTTTGTPLVYDFGGFPERFYRTTYESPGAPELAAQVVSLMPDDETVSHQ
FT                   PHRGLDHGAYVPLTVMYPDADIPVLQISLPTLDPQRLLHLGERLRPLREQGVLIVGSGF
FT                   TTHGLPFLRDPSPDATAPGWSSEFDAWADERLAAGDVDSLIDFRSLAPGMPYAHPTIEH
FT                   FAPLFVTLGASSDPEQIPRQVIDGFWMGLAKRSIQVA"
FT   CDS_pept        783201..783710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07450"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48992"
FT                   /db_xref="GOA:C1ATY4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY4"
FT                   /protein_id="BAH48992.1"
FT                   /translation="MSGNDEGKSDQSDTRWLDAEQQEAWLTLIALVTRLPAALDTQLQR
FT                   DSALTHFEYFVLASLSGEANRRLQLSLLAQRANASLSRLSHVVTKMEKAGWVRRESIRG
FT                   SRGSDAVLTDEGMAKVVEAAPPHVESVRSLIFDGLSADQVRQLSELSSAMLTQLDKSIA
FT                   SGTGRA"
FT   CDS_pept        complement(783768..783947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_07460"
FT                   /product="putative tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48993"
FT                   /db_xref="GOA:C1ATY5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:C1ATY5"
FT                   /protein_id="BAH48993.1"
FT                   /translation="MPLIQISQTPGLSAEQKRATIEAVTKAYADATGKDPAAVWVTITE
FT                   VPRDSWGVGGTPLG"
FT   CDS_pept        complement(783978..784322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="ROP_07470"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48994"
FT                   /db_xref="GOA:C1ATY6"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ATY6"
FT                   /protein_id="BAH48994.1"
FT                   /translation="MSLDPAIASRLKRNEAGLFSAVAQERSTGDVLMVAWMDDEALART
FT                   LDTRKGTYYSRSRQQYWVKGETSGHTQYVHEVRLDCDGDTVLLVVDQEGAACHTGTHTC
FT                   FDSDVLLAAD"
FT   CDS_pept        complement(784319..785092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="ROP_07480"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="protein synonym:IGP synthase cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48995"
FT                   /db_xref="GOA:C1ATY7"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ATY7"
FT                   /protein_id="BAH48995.1"
FT                   /translation="MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGA
FT                   DELTFLDVTASTADRGTMLDVVSRTAEQVFIPLTVGGGVRTVEDVDRLLRAGADKVSVN
FT                   TAAIARPELLRELSERFGSQCIVLSVDARTVPQGQPDTPSGWEVTTHGGKRGTGIDAVE
FT                   WAVRGAELGVGEILLNSMDADGTKAGFDLPMIRAVRAAVHVPVIASGGAGAVEHFAPAV
FT                   GAGADAVLAASVFHFGDMTIGDVKKSMRAEGITVR"
FT   CDS_pept        complement(785089..785922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="ROP_07490"
FT                   /product="putative inositol monophosph