(data stored in ACNUC1104 zone)

EMBL: AP011116

ID   AP011116; SV 1; linear; genomic DNA; STD; PRO; 558192 BP.
XX
AC   AP011116;
XX
PR   Project:PRJDA34839;
XX
DT   02-APR-2009 (Rel. 100, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
DE   Rhodococcus opacus B4 plasmid pROB01 DNA, complete sequence.
XX
KW   .
XX
OS   Rhodococcus opacus B4
OC   Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Rhodococcus.
OG   Plasmid pROB01
XX
RN   [1]
RP   1-558192
RA   Sekine M., Hosoyama A., Kosugi H., Yamada R., Matsuo Y., Tsukatani N.,
RA   Fujisawa T., Takarada H., Omata S., Kishi E., Shimizu A., Koga C.,
RA   Saito S., Nakazawa H., Sekigawa T., Nishiko R., Takeyama M., Tanikawa S.,
RA   Tago S., Fujita N., Kato J., Na K., Ohtake H., Nagayasu K., Harayama S.;
RT   ;
RL   Submitted (30-MAR-2009) to the INSDC.
RL   Contact:Director-General Department of Biotechnology National Institute of
RL   Technology and Evaluation, NITE Genome Analysis Center (NGAC), Department
RL   of Biotechnology; 2-49-10 Nishihara, Shibuya-ku, Tokyo 151-0066, Japan URL
RL     :http://www.bio.nite.go.jp/
XX
RN   [2]
RA   Takarada H., Sekine M., Hosoyama A., Yamada R., Fujisawa T., Omata S.,
RA   Shimizu A., Tsukatani N., Tanikawa S., Fujita N., Harayama S.;
RT   "Comparison of the complete genome sequences of Rhodococcus erythropolis
RT   PR4 and Rhodococcus opacus B4";
RL   Unpublished.
XX
DR   MD5; 63d2e6b91772fb5af2174ef2d34aa95d.
DR   BioSample; SAMD00060964.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01734; crcB.
XX
CC   Kato,J., Na,K., Ohtake,H. and Nagayasu,K. are at Department of
CC   Molecular Biotechnology, Hiroshima University.
CC   Rhodococcus opacus B-4 strain was isolated as a benzene-tolerant
CC   bacterium (Kyung-su Na et al 2005). The complete genome analysis
CC   of R. opacus B-4 was carried out by NITE. The genome analysis
CC   indicated that this strain has one linear chromosome, two linear
CC   plasmids pROB01, pROB02, and three circular plasmids pKNR, pKNR01,
CC   pKNR02.
CC   This work was supported by New Energy and Industrial Technology
CC   Development Organization (NEDO).
CC   Please visit our web site.
CC   URL:http://www.bio.nite.go.jp/
CC   DOGAN ; Database of Genomes Analyzed at NITE
CC   The database contains genome sequence data, physical maps and the
CC   genomic and proteomic data of the microorganisms analyzed.
CC   URL:http://www.bio.nite.go.jp/dogan/Top
CC   The microbial genomic DNA clones used for the sequencing project
CC   are available through the NBRC.
CC   URL:http://www.nbrc.nite.go.jp/e/index.html
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..558192
FT                   /organism="Rhodococcus opacus B4"
FT                   /plasmid="pROB01"
FT                   /strain="B4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:632772"
FT   CDS_pept        complement(232..1221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55500"
FT                   /db_xref="InterPro:IPR025447"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBR8"
FT                   /protein_id="BAH55500.1"
FT                   /translation="MSVFRMSSPSDVVAGAVALGGHLPVDEVAVLSLDRHPAAVMLVQL
FT                   GDDAERESGRILDALESAAPFQESPSMLAVVFGPAERGDVVGAILERLRPDAVTPVFVF
FT                   TDGLVRQWHGAGSLIGQPGMPVDLAAHPIIAEALVVGSTTLMTRAEMRASFAPAQHGPG
FT                   RAAIVAAGFGRERVILAAMAPQNAADRAYDFALAPYVGGTTGAGERGISVTDEHASIIA
FT                   AAMHDVPVRDLLFARIDAHNADAAAEVMRQVGAVLPHDLAGALIILAGVFHWVSRHAAL
FT                   AREAVNVGRALDPAHSFGKLFEQFLNHGMNPALWEQLRAAAVRAHQDQ"
FT   CDS_pept        complement(1579..1848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55501"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBR9"
FT                   /protein_id="BAH55501.1"
FT                   /translation="MAEELSRDGIARVSRGVRNSGVCVSDEHAARLLAAPWHTVRDALL
FT                   AGITVEHGRALGEMWRQVAAVTMRFPAAAPLILTGPDSGSFGTR"
FT   CDS_pept        complement(2147..3109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00030"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55502"
FT                   /db_xref="GOA:C1BBS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS0"
FT                   /protein_id="BAH55502.1"
FT                   /translation="MEFVAAHRDEHGVDPICAVLRGTAAQIAPSTVRAHLSPQRTESAR
FT                   AVRDREVLSRIRGVHADNLGVYGARKVHASLKREGMSVARCTVERLMKADGLRGILRLK
FT                   GRKTTHADGAETPRPADRVQRQFVADAPNTLWVADLTYIRTHSGWVYAAFILDVFSRMI
FT                   VGWQVSTSMRTDLALDALDMGLWARRRVGQDVAGLIHHSDRGVQYRAVRYTERLDECDA
FT                   VSSVGSKGDSYDNAMAEAFNSLFKAECIRNPVMRPHGGWRGLGDVEWAVAEYIDWFNHR
FT                   RLHGEIDHVPPAEYETAYWSNHTAADYRETPVLAEAGTR"
FT   CDS_pept        complement(3112..3438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00040"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55503"
FT                   /db_xref="GOA:C1BBS1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS1"
FT                   /protein_id="BAH55503.1"
FT                   /translation="MESMAAPRKYSVELKERATRMAVEARQDPATRPGALKRIADQLGV
FT                   HPEALRTWVKQAEVDGGVRPGTTTSDAERIAQLERENRELRRANTILKQASAFFAAEID
FT                   RPQR"
FT   CDS_pept        3602..5206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00050"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55504"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS2"
FT                   /protein_id="BAH55504.1"
FT                   /translation="MTATAALADPTADIAAPDPSRVVIRAFVYVLDPTPGQVEALRSNC
FT                   GAQRFAYNWALSQVKSNLDQRTAERSYGVPDAGLTPSMSWSAYSLRKHWNTVKDDVAVN
FT                   PETGQVWWSANSKEAYSSGIANCANALSNWSAARSGKRAGTMRFPRFKSKRAASSCRFT
FT                   TGCIGLVTTDGDRRHVQLPRIGVVRTAESTRKLARKTIAGTARIRSATVSFRRGRWQVS
FT                   FSVETLLPARALPPTTTGPRSVVGVDVGVKHLAVLSTGELIENPKHARKQAKKLRRLQR
FT                   RGARRTGPDRRTRQQPSNRWLRTQDQIQRIHARVANSRRDHLHKLTTQLVRVYDTVVVE
FT                   DLNVSGMSRSGGAYKRGLNRAIGDAALAEIRRQLTYKTDWTGTGLHVADRWYPSSKTCS
FT                   NCQAVKTKLPLNVRVFVCDHCGYRGDRDHNAALNLAALAVSVEDGTSPASCGRDVKAAR
FT                   QKPTIRPATSGQTVSLREHHTPVVNVAGATRPLMPSTQKNTQRERQMVSPPPSPRPVVP
FT                   VSRTTPNLPTCVGKNTT"
FT   CDS_pept        complement(5294..5890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55505"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS3"
FT                   /protein_id="BAH55505.1"
FT                   /translation="MVIVGPLTAVIDSVGPHPWLRVKDPQPLPEASKPALLARQLRELD
FT                   ENSLGRLIRDHLVPLSSDRSYRTRWNGFWSSLGFDPVLRDRATRIINGFLDLAEGALEA
FT                   NDQDDNQTKRTEKFFDRCEGALDRILKREDEPLAWAGAAAMTFNPPARAVIDQLVSAIE
FT                   KHRSDLDNEALWATLDSVRKQSLGGSGPRKRRSQR"
FT   CDS_pept        complement(6018..6650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55506"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS4"
FT                   /protein_id="BAH55506.1"
FT                   /translation="MVVHRGPRWTRKRLEAMLRTCYGETARGSVDVQAVADAMHVSSRT
FT                   VRRWLAGSNRRLAAVPHRRLEQLRLPAAESELRGRQQTDYAREAIAQIALPKDKGILPV
FT                   WRERGWLEPHVVAILDITGKPWKQIVISNGSARSMSEFRRRGSIVDVTTVPTRFHGVVL
FT                   AQEVLDEIEPWRLHPLPELLPHGRTHVWSNDAPAVDLSVLAVSKELR"
FT   CDS_pept        complement(6654..7385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00080"
FT                   /product="putative terminal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55507"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS5"
FT                   /protein_id="BAH55507.1"
FT                   /translation="MARKPLSRTAYSRIADSLADYGSVVDNQINVVRAAKELRVTQTAV
FT                   REVLRAERGKMQSEFFGKLTGRRGSDTSGRPGSANLKAQLLAAYGPGKRSEINTAAAAR
FT                   DLGVSRRTVERWLAPEGRQRIAKPRAETLKALAHKAKRAASTQSARRAAMSTMRSSKQG
FT                   KALAKYGGKIRIDAVQGPGPREYARDRLITLALTPDQVEAMWSAYERGGDKGMTDWMNT
FT                   RAQDYVGGWEFFQINSFDVER"
FT   CDS_pept        complement(7385..12760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00090"
FT                   /product="putative telomere-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55508"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS6"
FT                   /protein_id="BAH55508.1"
FT                   /translation="MTAITAGTIQIGRMSSFDRVRAAAERNGGVNERGSTQLMARCPIH
FT                   GDRHASMSVTWVDGHRGGMVLLHCHGCEAPVSEIAEGLGLSMTDLFDEPLPDRDALTRV
FT                   GRSPRRRGAGRRRPKGGRLPARIALPDVTPDAQHRWDRVKVYSYVSADGTLVQEVIREE
FT                   CTSCEAGRHKQFRQIFVDAAGTRLRRKPEGFEPVLYRLPELLSAISSHSPVWLLEGEKD
FT                   VETAESLGLVATTNAQGGLNFPLSCADLFEGAEVRIVLDRDSVGWKRGIELASLLGGSG
FT                   AQVQLLLSATAEPKSDFTDHVDDGHWSTDSMWGGLIPVRAGEVAAHGFAADVIEKQALI
FT                   ELALAEATARVDRASERDGDEEFRRAQRWALESERRFEDLTELLDKVRQQAAAEGTDWA
FT                   GEAVENAMTAWRAALVAARATHDVARVPVPPILQDPELEPVPGAVQDSLSPVDSQRVWS
FT                   DSESLATPLNSIRGRNVIAPVYRIIDGNLVEIVTTKSGDQQAKLVLDLDARIVEMEYLE
FT                   VADAGIDVDEPELMGRAAMAGQSEVNPAAPQELTAVVIGYTHPESREFLRIRIPAKEYR
FT                   DCGWVDTLPGPPAYDSRPSGVAKLRDALKGAGGREIRRVVRYRSTGWRRDDQGKWFFVH
FT                   AGGAIDENGGRVAPVLLTGPLKMYDLPAPTPDPVRIREAFLRHSGSMLERTPTRVSAAL
FT                   LGQVFRSALGPNPWVLTLVGSPNSYKTSLASLAMHHWGEKWDRRRPATSMSGNGDTLNA
FT                   LRIKLNAAKDALYWADDVAPTRDFGTAQKALEEFARMVHNGEQRSRSTRDGLGVLDGTP
FT                   PRASALVTSEIMPRPGSAAQRMLVVPLQAREIELNVLKELDTAHSRHGRALLMATYLQW
FT                   LCPRLDIVRAEAFAEGERYSERLRTSGESVRQADALGSLWAGWHAMSRFLVDVGALTEN
FT                   EVAQVGDLVTMGLSDAAAAATDPDLPMRTGARVRELLVHALRNGHAYVEDVDTGQAPSD
FT                   WSMAACLGWRRSVVGETSDGTPRWRAEGRGVRLGYVVANPRPCDGQPQVLLDPMALEQV
FT                   LKATGQTMTDTLQIDRGTALRALYDEGVLIAEERKGRMPRYTVQRMVKCENRRQRMVAL
FT                   RLHKLLGSDGPEDQVTSDAGSSDPTLGGDSSDSSTPVPGGPALFDGWIADLNSPGSGVA
FT                   SGDSSNEVMSLTSSHSEQEPEMAIETDAEGHTADGVQISPVSICALCGGEDAGWQIDGL
FT                   VMHLPCWWQSTAATRSAAAATGDTVGQVSPMVKDEPVAAPVETTSRETAAATPAIVATA
FT                   ETTHQPTTTTPAPKLAAGDARTTFTAPAAVLDVDGAWLPDGTRHDLASQITHVGDVAEL
FT                   VATLNLGTWTSDKWSVPGQIWITDAMAQHMGIDTSSLGKRNRNDRLKELTAQSPFVTEA
FT                   LSEGWQLGGKEGDRLGTWTRVWKGETRGVWVTLTSGMSQDPKEMPILGDSPAPATLARR
FT                   LSLLANALRFPWAVSPASTGIDLMIAARPKEWKRVFAPSDAEFAKKFQIFEADIDWSRT
FT                   LSDDEAKCRYVHAFDRGGSYAAGIAGLELPIGEPAHHSNGLPFDRKLPGYWLVEIPESA
FT                   DWRFPNPLNPMGLSISEPKWVTTPTLERASSLGYEPEILEAYVWPDHGRVLVPWYERIR
FT                   DARIALDIKDDLDAQLAREQNKVIYTHTIGILNSDLHLAGRPGYSPERHHHIVAKSRAN
FT                   IMYRIAQIGEDTGQWPVAVTKDTVLYVSDESDPKLAWPGGPKQFGRGFGQYKPEGSALL
FT                   AEHQQYLDGKGYRGKSDLIAPAEWMSAGISAESDS"
FT   CDS_pept        complement(12952..13209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55509"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS7"
FT                   /protein_id="BAH55509.1"
FT                   /translation="MGRPHKGTRKCISVRAPLQQHSFYEARAEELGLELGDYALLVMAR
FT                   AYNLDVPDYILKKLDPEKLRAHDERYAVSDSSDNELSISA"
FT   CDS_pept        complement(13681..14409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55510"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS8"
FT                   /protein_id="BAH55510.1"
FT                   /translation="MTETSTPRRKSLASAFAPKGNRAEGLAGLLPTAGNPTQPRRSTPI
FT                   TEVEPAAEESRHVEKAPAAQEPPQAQAQPPAPTTTAPIRSEPARKPEPTPPPAPVEKQD
FT                   PIYEPVPDPTPVLDDDVEPSTETGKVTVTAYLDRTTRDALQSRAAESRCDHADVAIEAF
FT                   DSVGIAGLRSLFQPVARRSAAGIPMHQEPFAVKGPVETWFRFTTAQRDWLDAQVKVVGS
FT                   KSRSRLLAGVLSLHLRTASR"
FT   CDS_pept        complement(14406..15374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00120"
FT                   /product="putative Soj/ParA-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55511"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS9"
FT                   /protein_id="BAH55511.1"
FT                   /translation="MSMHVVETSTAEQQELPVSFGFFNGKGGVGKTSCAANCGGLLAAA
FT                   GYRVLIGDFDPQGNLCRDLGYDKRDGSELFTALLQGSAPPIVHNVGGRENLDVVPGGPA
FT                   MFDLAAVMVSRQQRQGGKRLGQLVRAMLLQVAHNYDVIIFDTPPGDLTIMEALMEVVQA
FT                   VVIPVRADDASLDGLETIAGQFSATRDGDPDRNLPAVNPRLQLAGICLFGVGSRSTKLT
FT                   AKIRQSVNEMIGDAAPIFESRIRTMESTAYDARREGLLVHELEQQTEVAKVARFAALKK
FT                   GAKPTDQILSRNASGLAEDYAELTREILVRLSTISEEVASA"
FT   CDS_pept        complement(16289..16957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55512"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT0"
FT                   /protein_id="BAH55512.1"
FT                   /translation="MTVPNGEGLELGLPWVEDLRWHRDQCRQSRFQWSGSEALLAATEF
FT                   TRGRHDFTSLMDLRELNEGRRAATEYAAVCQRAFGEAVRQARRAICPTSWVTVAAELDS
FT                   TVDDCSASSHFATWSSPADRTNAQVDRVHRIVDGLYFSNPLIRAWELKQLWDLYKAAEN
FT                   ILEDTVIDLVVELDRQRRAQDIADAIGVITIAGLHHRISLQRSRRGTVGDPRRRPNQYR
FT                   "
FT   CDS_pept        17445..18044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55513"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT1"
FT                   /protein_id="BAH55513.1"
FT                   /translation="MPLAPCSASEYIVVTQEHGRPQATGEHRPLASTFRSPAARSVEHI
FT                   ASQYIEGSDDVEVEPNREAPPERGSVADADGGGKSSSVRVPAKCHAKLEQLREQTGMTN
FT                   GQIFIVAIEATHERLPELLYPGGRIGGGLFAPRGIRPKSSRDDSETQVTYRLFKSDFDV
FT                   IDQLVVDLAAKSRSHLITAALTGYFFGDDERTQAAE"
FT   CDS_pept        complement(18922..19188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55514"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT2"
FT                   /protein_id="BAH55514.1"
FT                   /translation="MNKGVELRAEQGGSEPLKRTRDTVTHRPISEYSIVGSDQPTTSIE
FT                   FDGQRYDGIAPTSRFARFAETQYEAFVQAVRADFPTNRATTTA"
FT   CDS_pept        complement(19738..21795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55515"
FT                   /db_xref="GOA:C1BBT3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT3"
FT                   /protein_id="BAH55515.1"
FT                   /translation="MTNLHAPSSEDGRANDSGRVALLVASLLAALLASLIAVVSPSQAG
FT                   AAPASSGCPAVEVVMMPGTFETDSTANPDVAKGLLKQVTDPLSQLFGSSIKITYPAYEA
FT                   SAFNKGKTYGISKASGIAAGARVMQTRATQCPNTLFALGGYSQGADVAGDLAWLIGHDK
FT                   GPIPAEKLIAVGLVADPRQSSNGDNTLVGPPVDGVGIAGARPGGFGKTAAVTRSYCAPD
FT                   DLYCSTNAGKDGLLAGLGRVLAQPPTASGPQQSDGFQPTTAGLQNALVSDYSKVDLPGL
FT                   AGNIETLQQQLQSGAPDLKSMESAATDVANTLVPVVDTTSWVTQNPAVEQTLKTADAST
FT                   PEYAAGQLVDKVKGIDLTSAFQAADTIARTVQNASTPDQVQQLQTSVDTLSTQVSPLAA
FT                   TPADGLSLAADALSIIKPSVLINQVTHIGTNAFDLANNIPAVLDIVFNRIPHIVLDPGL
FT                   DPMAKVKAVHAEFDRINVLFEPLITLAAGLDYKTAAALIAMIPDPSGAAQIISMIVGVV
FT                   GNLDIIGLANTAGELQKQLWHAIETGDIIGAGLGALPHILDFAKIAVGTLSGGQKTDAS
FT                   KLGSVSASTTTGQQIMQQSQAGDLGKLASSLTALAGSDGANALSQIGAEGVKFASFIGS
FT                   GTHQNYGELVVDSSGTTALQDMTNHFRDPIAKAVAKIGRTSNGGWFDAGR"
FT   CDS_pept        complement(21812..22075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55516"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT4"
FT                   /protein_id="BAH55516.1"
FT                   /translation="MIRSLAPLFTVMVFIAAAFLLTETSLLLEATRGFDAALTRPAIAR
FT                   PGLLAESSHVMSRVALTVADFLPRDITTHIDSGRVIVPALYR"
FT   CDS_pept        complement(22075..22911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55517"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT5"
FT                   /protein_id="BAH55517.1"
FT                   /translation="METSTHAPTAITASSATPVRSTAQSNLYSRLNTEWMYLCARPAAE
FT                   VLTWSVSRAALRDVADLNDLAAAHRRDRDGVLLALLRLHQEGSALAGRALLQLMLGKLI
FT                   SLTRHARVSGHDRYYACDERAASTVATFMSLIATYRPSGENVYAALFLHTLKKITCEET
FT                   FTQEIPASDVMDESDSAENEPEADISAPALLSWAVEKKVINDLDRTLIQRAYLEQTDCD
FT                   LAVIAAEIGMTPAALRQRLYRAVTRIRKSVVASNPPTPRPRFARGRRRTATTTAVI"
FT   CDS_pept        23247..23510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55518"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT6"
FT                   /protein_id="BAH55518.1"
FT                   /translation="MHELDNSLQAQLHDLGYVHAVTEEIRRVAAALAVNPLDEEANTSL
FT                   WLLVFVEAPAARAALSRASAFDIADSVPDCRTSDPTTEAGIR"
FT   CDS_pept        23507..24688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00200"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55519"
FT                   /db_xref="GOA:C1BBT7"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT7"
FT                   /protein_id="BAH55519.1"
FT                   /translation="MKIDLAKINNFGRSPKSKTDPATENSVDSVVAEAEELARAVRAQW
FT                   GLRQVWTTRLLKAGILAALGAGIVALILVVFGSSPTPNLTDNATKDTADVDTIGQAKAE
FT                   DLARQFVVAWLQASRGNEQELDHFVSGSPSLPTAPLFAATDPAVASIDYEQKSRTYAVT
FT                   ISVSVRAASDANAATVRRYFQVPVVVTEAGVRAAALPAEVAEPSTSIDVKLGYKYRVAN
FT                   HPIATSAHEFLSAMLTGNGEVARYLTPGVSIAPIVPAPYRRVAITDVYSSEDLSAASAS
FT                   APLPDGDVVRLLVTAAQKVAEVDSVSGQYALTMTSRGGRWEVSAIDATPLYPPAAPRTP
FT                   SSSTTAPSSTTPSAGAPESASPDSGQTPALSVPTAGDVPLFSPSGTDPHSSGR"
FT   CDS_pept        24695..25021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00210"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55520"
FT                   /db_xref="GOA:C1BBT8"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT8"
FT                   /protein_id="BAH55520.1"
FT                   /translation="MSIALATTDPNNAVLAAGLFDKAQEFTSNGKLLLQSAAGCLVLFF
FT                   LLKNLMASFTVARLITSALIGGAALWVVFNMDVLKDSTGEELESAPAVVHIVAEPISGL
FT                   DLPV"
FT   CDS_pept        25182..25802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00220"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55521"
FT                   /db_xref="GOA:C1BBT9"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBT9"
FT                   /protein_id="BAH55521.1"
FT                   /translation="MSDDRTTGEVIKNFTRARKVPQLIGRTPDGKKLPFGPYTVPQAVS
FT                   GAIVGALLWLLHPLWLRDSISWNVGFFAFWSLGTVFVVGKVRFAGRSPASVAQGICAAA
FT                   FAPAGAKIQINGRRVTIRPPHLVRPSGYITADPTAAELSATVVPQAVHIATAEVTETAS
FT                   AEPVAPRPQTSAPVPTPASGPTHRAGRSSVKELLALAAAGTSE"
FT   CDS_pept        25817..28327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55522"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU0"
FT                   /protein_id="BAH55522.1"
FT                   /translation="MEQPTLSMAANIRWTKSGVVWADYVLTGIDYGYRPDVDKRTARTL
FT                   HTMLVRALPGESLLMGIAASLSAEAIVSRMTEGVDLDAHPDWATECEATLDSIELYRPG
FT                   QRIYWLSIPLTTPKVVDQVKAAAHSAWTTLSDYIGLPRTALDDDEIRARVRQANRIMAD
FT                   IPGVFDPQPATPAQMVWLWQHAMTRGLHVDPDLPDAAVTPGAKSGAALTACRIDEGAQS
FT                   DREKASGWRGKVPTFSRVLKVDQPYEIVDHPASYQVLLALADTPAGGVYFPGSEFFTLA
FT                   DDFGDIDVDFAVRLKVTAGADVMRANKRALENLKEQYEQREGELAGGQGVLDLAAAALT
FT                   EYTSLLETNRDEVEVAWTALFAVGADSEERALADAKALVKAFEQQEYKVVAPVGYQEDL
FT                   WWAMLPGVPTSKIVREFAQITTSTHFAAYMPFIRNELGDGSGPLLALNITTSRIGVVHH
FT                   DVAGKSLRDQSGSFAVTGELGSGKSVTMKVIAGQVVDCGGQVIGIDQSDLGEYANWARA
FT                   VTEAVVVDLVEPEYSMDPLRIFEAGLAAEMAQSVLLTLLRIQPSSDLGIALAKVIEPEY
FT                   RAEHPYQGLGELTEHLLSGACPIAHAQDLGEAMNVYARRTYAAALFGKDLPPLPITAPG
FT                   IIFRTHKVDLPTQLQTEKQHLYENLPLEKRFGHAVYTLIAKVARGQCFADPDQMALFLV
FT                   DEAHHLLGADDGVDIVEDFVLQGRKSSAAVGLGDQDCAFGTPKLRGLIKTRIAHRHTDE
FT                   TLAKRAIEWLGLDPDDYGLVKQYMEQTAPVTGKDKYVEPHRRGEGYMRDGSGNVGRIKT
FT                   LLPATESRRIAVSTTPKDNKLVKA"
FT   CDS_pept        28324..30603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00240"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55523"
FT                   /db_xref="GOA:C1BBU1"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU1"
FT                   /protein_id="BAH55523.1"
FT                   /translation="MTAAAASSREREVVGGPEPREYFSVRAAAKRSLLWLVTAWIPQSW
FT                   LTALIHLTRPVTRWLWARWWSRLLIRLIAGWHAAGALLMIVATPALADPAGGGGASPFF
FT                   AWMNLKDSHGIDAWSYFLSIDKGNASVGGGWRMIWAYIITLEYEVFRFLMATAIWFITW
FT                   VLSFEWLDLILTPVRTIADSVTTITDQFALTPLMLTVAGLSVAIWIIRGRFSTGIYELL
FT                   MSCVIAAAAAGVLSNPVDRVLGDNGLVLSARDAGLEVASGLANGGDTSGNPQTEIETIE
FT                   SKLIDTFIRQPTQLINFGVVLDAPENNGKCVKEFDAAYLAKPKEPGLADKAQDVVSEIA
FT                   PGAGVALDLINPDAKPEDRVKDAIAKCEGEDGPMKAYADNPGPGQAMGLFFLIFAGALL
FT                   MAFAIYLAGRLIIAAGVSIGNAIKSIPGVVLAIAPSMRGQFWRTIANVAMALLQMIFAI
FT                   VFLVGYVMVVEDLFAADESNLIRTVFFVDIFLVTALLLFRRAVKGMKRMSDNLATILTK
FT                   RPNVAPTAISRSTPTTARDIAAMAANGRHMYQGGKAVVKGAGALAKKSGTAAATTGKVA
FT                   AGATSTAATGGAAAVLVAGRVLSSTAKRAKNKVDSIADPDSYPKSTSGTVGAQTSRGTA
FT                   ATNAAADAVRSRLSKTAVSDKAGIKHPIGVAPSLPVANPGQVRASATTTSSPDGRRFRE
FT                   FTTTSGAPVMLPTTPSRTPRPARPASPETGVPNGAGSKTAQLLAAAAQSGSAPVVTPSA
FT                   LAHRAR"
FT   CDS_pept        30603..32255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00250"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55524"
FT                   /db_xref="GOA:C1BBU2"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU2"
FT                   /protein_id="BAH55524.1"
FT                   /translation="MALLDTPPSTPDAQEGSSKKWWWLLAGIPAFAMVIMMAPILVILA
FT                   TTGSDTNCGQPVPDAGGGSLMGLKPGSLAVPMAEGTYTISSPFGMRETGMHDGQDYAAP
FT                   LDTPFYAAGDGEVIAAEPAAGYGHWIRIRHTIEGQIVESLYGHMQASGVLVHTGDKVTA
FT                   GQLIGKVGSEGQSSGPHLHFGVYPGGWSLGGGVDPIPWLKQQGTISPTRGPAELVAHTD
FT                   STGGDLPPLPADKGSEAQMQVDSIRVMRTIAAAFPEITTIGGWRPTDDVAQDHPAGRAV
FT                   DIMIPDSASAQGKALGDKIALYLQQNKAALSVEYVIWQQRYWDGTGDWSLMEDRHGYTA
FT                   NHFDHVHVTLEGGGMPTADSHYGSAPGGTTTTEPCPPEVGDQTRFAPGSIPPQYTNAVS
FT                   AAGSLCPEVSPVLVAGIVQQESGFNEKAVSKGDGVNQGGAEGMSQFMPETWKAFGTDSG
FT                   LDRSGKAEPPNAADPFNPYDAIASEGRYLCHIADYLRPHHDSGAVKGDFTDLIIAAYNG
FT                   GEGAVVTYGGIPPFGQTQAYVPAVREHMKKLTA"
FT   CDS_pept        complement(32440..32802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55525"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU3"
FT                   /protein_id="BAH55525.1"
FT                   /translation="MSKKDGPVPRPIKRVEWHLVFATRDAAKGWTDLLATARNATVDAW
FT                   DTLTREPIVETSRLYQLKGDYAYGTYQGRTYARYQYKVTDGGRIWFFVDPAPKGAKNAG
FT                   RVLLERCEPGHPKETE"
FT   CDS_pept        complement(32799..33236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55526"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU4"
FT                   /protein_id="BAH55526.1"
FT                   /translation="MRSPKDVLGVLEDSGEVVLTRRNAPALRLTQESASRAELSALGVV
FT                   GQLFAASLDEAALDRVATRLAVTLPWIGLLPAALHAEFVAEFQATARACIAVARFDRLA
FT                   ILLEAWKATAEAYADPRLTADGSDLEYLDEPEVVEAPDLGA"
FT   CDS_pept        33343..33531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55527"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU5"
FT                   /protein_id="BAH55527.1"
FT                   /translation="MPPRPKRVTVGKFFGRSVSASKPHVASVFLPDFLPYFDTEATAHV
FT                   GIERSGRSESFRRRRTG"
FT   CDS_pept        35589..37943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00290"
FT                   /product="putative FtsK/SpoIIIE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55528"
FT                   /db_xref="GOA:C1BBU6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU6"
FT                   /protein_id="BAH55528.1"
FT                   /translation="MTTTPPQQSGARFARSPRISSLPPRPHTWLRDSFCLGTTAVGASA
FT                   AAPLFGYSALAMPAAASLSIAALYAGLAGKRNQLRDVDVDEVIERLCPIVGLPEATRAV
FT                   LSTSKWSSGWPGLPRKLTVHYDSTQALNDETWLADICGVFEDQGWGFFELDKHDPARRR
FT                   LIFTPAAEPEREVSDSDQVVRAKRIIAQLLGPTATVTVIDVAAETGEVTSMEVRHELGP
FT                   KLESDGYRTRVERGMSATLPGRWRARWNLETDWVRFEQRTAFPDSVWLPAPDLDPGADL
FT                   MASYDSVEIPYGIDEDGNEVVWRPAIDPNLMLIGPPGSGKTVTAHNLLVNFSRRGWPIW
FT                   VLDGKYVEFLGFQDWPNVQVVATTIEQQVALVHRARDLMEFRYQKIVTGEATEADFEPV
FT                   LVFLDEWAEFRGNVEDWYSRVKPKGGARQPPVLNMLASMARKARTSRVHLVFGTQRPDA
FT                   QYFLGDMRDNFAMRISMGRLSPQGALMMWQSPTIGTSVPRKCRGRGTTVTDNYQPIEIQ
FT                   CYRVPDPRKTRAGTFESDLLDTLRPPITRHPRLLIVPPDELPDIDATDDTSEPAPLTYF
FT                   DYIEAEWVLATDRPDLDPVLRRAKMTHETDRRLASPTALLGLLGGRAEPTNEAAVELDD
FT                   YRTPTAAGATDAASFLDQLSAPQLGESSAARAESSRARLALVKESAATEPEIPADGGAE
FT                   VFDIPEDSPDTYEDQYGPVRDVRAADVALGDLLLMEDIDEWVVVDTDPEPDIIEDSLLS
FT                   LTWRSDTDEFGDLALPDSSYVSIRKPIQVSG"
FT   CDS_pept        38043..39617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55529"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU7"
FT                   /protein_id="BAH55529.1"
FT                   /translation="MPPILLTQLQPTEPPAPPEIPAEPLPPAEIPSSPTIPVTLEDLKS
FT                   FLEAASPTPGLLTQPWATLLASLAVLGSGYLVYRNGNKTRKQAEIHFGTSHDLEVTRSL
FT                   RDRFTTIAGQLADPASAVRTAGVYAMEALANDWLARGDKSEAQACINVLCSYVRAPYAQ
FT                   AQGRGQNQTNRIIRISLTDRVVEEHYEYRQDDREVRQSIIRTIAAHLKANGKGNWSDLD
FT                   FDFTGAHLDNADFSYAIFNKPARFERAQFLGASARFEHATFTASATFGEARFCSGLTIF
FT                   DDAKFHGPNNKFSGAKFGSRYNRFDRVEFTGGITNFTDCEFEGEDTAFDSARFESKNTL
FT                   FTGAKLLSKRTWFVEATFESEMTSFDRSTFDGEAVSFDQAKFRGKNTTFKNAEFSGGLT
FT                   DFNAAEFRAEATRFGYAKFNGDQTSFDKSTFGDTRAKFGGTEFNSVSGTTFHEARFIGG
FT                   RITFGWAIFNGPASFERPEVWANVEFDWSAQIPYEMRKRKPQNVLPDVWPPALMDSHGA
FT                   EEEEEQD"
FT   CDS_pept        40098..40610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55530"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU8"
FT                   /protein_id="BAH55530.1"
FT                   /translation="MRIESLSLTLCDDSALAPAFGSARRVGIAEFGAMQPPDEDARVRY
FT                   VRSEAVVILHHSAETLLRMYFAHVAYPHCPWVGIASSRTPGEFKDKCLKVAHHGVKRDN
FT                   VATVFMGGTDPRGAAVRLTDDQFEASVEALTSLLLFCAERFLSESFIYNAAKHGSSTVN
FT                   PEHPLRG"
FT   CDS_pept        complement(41357..41674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00320"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55531"
FT                   /db_xref="GOA:C1BBU9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBU9"
FT                   /protein_id="BAH55531.1"
FT                   /translation="MRRPVESAQYTAAAFVDVCRRHGIQLSRGRVGSSYDNALAESFFQ
FT                   GLKREWLHGRSWTSKSQARLDLFEWLSYFNRRRRHSALGYLTPVEFEQRLIASSTLSVA
FT                   A"
FT   CDS_pept        complement(41658..43058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00330"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55532"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55532.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        complement(43287..45623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00340"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55533"
FT                   /db_xref="GOA:C1B685"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B685"
FT                   /protein_id="BAH55533.1"
FT                   /translation="MTAAVRAVGEADATWPASTFPVSLERYDRREELTDAERRALRDLS
FT                   PKALRRNRARGIPRRTATHWTALVRLVEPLDTARAGLHHGDDARFRRAGAHAAAIILQN
FT                   CADTGRSYWAWTSEDWAQLCGSSAEAFVAARELPTETTVRPFLVALAYLLGSFDAFQLL
FT                   GTFNRLHLARLVFGAEAIEESMRQASAVLDQWGYRGVFIGKHRLRGGLSQALLINRSSR
FT                   LEDLDTAAFDRLRVHPATNDHQGEMLYALQRAVAALGHCDPPVRTGDNPYAVIEGTTDS
FT                   WANWVARWHDTSTLTPRVRRTIRTILAKAGRWLAAEHPEITEPGQWTRQTSAAWVAAVD
FT                   RMTVGDYVQRRDHLRARTGDPISPRTKAHILMATRTFFRDCQEWEWIDRRFDPARALAL
FT                   PRSVSALIGTNPRVIADDVWAKLLWAGLNLDSSDLPGNSAHTYYPMELIRAITLTWLFG
FT                   GLRSDELSRLRVGCVRWQHDGQPIAADSPDVLAEDAVCLLEVPVHKTGTAFTKPVDPLL
FT                   GQALEAWQALRPPQPKTLDRKTSEQVDMLFAFRAHPVAKNYINRTIIPALCAKAGVPSS
FT                   DVRGNITSHRARSTIATQLYNAKEPMTLFELQAWLGHRTPNTTQHYAKITPNTLSKAYN
FT                   EAGYFARNVRTIEVLVDRDAVTSGGAATGQPWQHYDLGHGWCSYTFFEQCQHRMACARC
FT                   DFYTPKDSSKAQLLEASGNLQRMLTSIPLTDDERAAVDDGHTAVAALLERLTDLPTPAG
FT                   PTPREIGTSPTVTLLPIVQVRHGEP"
FT   CDS_pept        complement(45620..46675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00350"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55534"
FT                   /db_xref="GOA:C1B684"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B684"
FT                   /protein_id="BAH55534.1"
FT                   /translation="MSMILEEKWPVLCRHERAAEWLQIWTDLGRAPRTIDAYARGLAEY
FT                   LLVCEREGVDPVVATRAQIALFVRDLRTRPSRRGTNVVALDSGSGLANATLQQRLVPVR
FT                   LFYDFLVEEGVRESNPVGRGRYTPGRHFGGQPRPLVPRMVKLPWIPGEAEWLQLLDVFR
FT                   LEPIRNRLMLALAYDSALRREELCSLRTDDLDPAHRMLRVRPETTKTRRGRVVPYSAAT
FT                   GVLLSGYLAHRAGISRARGPLFLSESRRNFGEPLSLWSWSKVVRRVALAADVPQFSTHT
FT                   TRHLCLTDLARMGWELHAIATFAGHRSTESTLTYIHLSGRDLAEKLNRAMTHLHAQRIS
FT                   MLTAPDGTGPA"
FT   CDS_pept        complement(46521..47204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00360"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55535"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV3"
FT                   /protein_id="BAH55535.1"
FT                   /translation="MKTRRWDFISDHRAEFGVQRLCRVLGTSRSGYYKHLITEPARVER
FT                   QAEEAATVAEIRAIHAEHRSAYGAPRVHAELRSRGRKINRKRVTRLMRIHHVVGRHLRR
FT                   SKRTTVADKSAPSVPDLVMRDFTATAVDTKWCGDITYIPVGSSWLFLLVTWNHAGGRLF
FT                   VPRCHHELRGPVDCVDDLGREVAGPVPARAGGRVVADLDRSGAGASHDRCVRSRPGRVP
FT                   ARLRA"
FT   CDS_pept        complement(47201..47524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00370"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55536"
FT                   /db_xref="GOA:C1BBV4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV4"
FT                   /protein_id="BAH55536.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYAAVAADVGVSGETLRTW
FT                   VRKDTARNARSQDRSTGADGTEADELARLRAENARLRGAEKEWQLEREILRRAAAYFAK
FT                   EVK"
FT   CDS_pept        complement(48639..48863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00380"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55537"
FT                   /db_xref="GOA:C1BBV5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV5"
FT                   /protein_id="BAH55537.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYAAVAADVGVSGETLRTW
FT                   VRKDPAAKPVESTVVCRVASSHEAEVLAF"
FT   CDS_pept        complement(49539..50003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00390"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55538"
FT                   /db_xref="GOA:C1BBV6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV6"
FT                   /protein_id="BAH55538.1"
FT                   /translation="MKPRYWRSRVHPVSDPPRSIRSDKYDPDMDREVWQIREMQEIYKD
FT                   SVNGLSKELRSRFHASRAKLRLGLGMAIATLVIDLTIIALKWTTLQQSPLSLSTMALTL
FT                   IGAIALVIYVVYQFPRVRYRYEDAVKQLSREAALTFDQLDSPAPRNRPSS"
FT   CDS_pept        50313..50672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55539"
FT                   /db_xref="GOA:C1BBV7"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV7"
FT                   /protein_id="BAH55539.1"
FT                   /translation="MHPSQPQQPIKPARNAAGLSDEDQLSLLMAAPLILGLLVAALPAM
FT                   STKATAWLLAHDLIVGASASPLVTIPGTEGAGLDLRRLIIVVAVLVLAATLALSGVRRS
FT                   IDRRRQQRLRRGDSA"
FT   CDS_pept        complement(50696..51136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00410"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55540"
FT                   /db_xref="GOA:C1BBV8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV8"
FT                   /protein_id="BAH55540.1"
FT                   /translation="MRAPLNGFKPQALEDARTTAGITRGDLSRAIGVDPTTIHNWETSR
FT                   THPQPDHLARAAEKLGIPLDRLVVVPEDSRTIADLRNLAGLTQKHVADRTGLSTTTIGR
FT                   IERGEGSLSDRHTTALAEALRLEERTIRDAFIRARNRPLPSR"
FT   CDS_pept        51297..52985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55541"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV9"
FT                   /protein_id="BAH55541.1"
FT                   /translation="MRPDQPLNGKEHPMTTTVSAAPPLSQTSAHRRDARSSVCAAQLAR
FT                   LNAAGFPARSALPSRDDGWFQTSRQSGLGGRDGQAWTPARRVDTSVDTVDVRYHINALM
FT                   CAGMTTALIADLASVPVATIRSLRSTSTRTTTSVIADAILSITFRPSRGRDLTPAVGAR
FT                   RRLRALNAMGYGDSSLAHRLNVEVDVVTSMPEKGLIPSELWEAVDEIYDELSMRPGPDA
FT                   DLREQARAEGLVPPLGWDDDEIDNPKARSHERERATGAVAVDEVVIVRRLSGEQVPMRN
FT                   CERREIIRMAYEQCWSPSLLADKLAIKYDSAVTELSRYRRALIQTDVSGSDDPSTAETP
FT                   TTTDAPTGERGKGETAAVAATADHATDFDSPREAAATSDAAESQSPAGSRVNAPARASS
FT                   NRVSAIRRRWTGAFTASAQFHDATIDCARSAPEGGVPGSWPIARRSKLWRPACRLGSTR
FT                   AVGAEQNWPDSDERWRLSSGWPSSRQRWHRLAEQASAPRPGRPGRPCASSLIPVDAGDR
FT                   VRHCCALQIATLLKETRPDGPHRNPRGLPRGVHCGRPRRERSQRP"
FT   CDS_pept        52903..53235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55542"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW0"
FT                   /protein_id="BAH55542.1"
FT                   /translation="MALIEIPEDFHAAFIAAAHDANDHNDLDLAIDEDRTYIALSNLCP
FT                   GFVPALRLITRGEHEATVEIWSIVDHQRDDGSWERTEGVDATTAVDLADPTDAAMRAVE
FT                   CWLTTL"
FT   CDS_pept        53357..53983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55543"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW1"
FT                   /protein_id="BAH55543.1"
FT                   /translation="MHESFSSALNEMSVADAVMQLASGTVELALEDAHEFARWCWFADV
FT                   LDSGWGLTGRLPAAGDDVFHALERVAGMCRTSETKALSPDAWRAAYEATERLAHSSAVT
FT                   SSEATYLALSAANDIALECIDETHPEFTVAIALAFESLAACAADSAVARCWIARALTEW
FT                   TNRTHPVAGGPRTGEAPPITDTRQNASILSAGCGERVLLRVSGNL"
FT   CDS_pept        complement(54735..55106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00450"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55544"
FT                   /db_xref="GOA:C1BBW2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW2"
FT                   /protein_id="BAH55544.1"
FT                   /translation="MLLPPVEPGQYRAVRYTERLDECDAVSSVGSKGDSYDNAMAEAFN
FT                   SLFKAECIRNPVMRPHGGWRGLGDVEWAVAEYIDWFNHRRLHGEIDHVPPAEYETAYWS
FT                   NHTAADYRETPVLAEAGTR"
FT   CDS_pept        55122..56522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00460"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55545"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55545.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        complement(56419..57150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00470"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55546"
FT                   /db_xref="GOA:C1BBW4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW4"
FT                   /protein_id="BAH55546.1"
FT                   /translation="MEFVAAHRDEHGVDPICAVLRGTAAQIAPSTVRAHLSPQRTESAR
FT                   AVRDREVLSRIRGVHADNLGVYGARKVHASLKREGMSVARCTVERLMKADGLRGILRLK
FT                   GRKTTHADGAETPRPADRVQRQFVADAPNTLWVADLTYIRTHSGWVYAAFILDVFSRMI
FT                   VGWQVSTSMRTDLALDALDMGLWARRRVGQDVAGLIHHSDRGVQGGFNRSSQHRAVRTS
FT                   VPVRQTLPLEFSNRALFGGGC"
FT   CDS_pept        complement(57153..57479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00480"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55547"
FT                   /db_xref="GOA:C1BBS1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS1"
FT                   /protein_id="BAH55547.1"
FT                   /translation="MESMAAPRKYSVELKERATRMAVEARQDPATRPGALKRIADQLGV
FT                   HPEALRTWVKQAEVDGGVRPGTTTSDAERIAQLERENRELRRANTILKQASAFFAAEID
FT                   RPQR"
FT   CDS_pept        58038..58826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00490"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55548"
FT                   /db_xref="GOA:C1BBW6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW6"
FT                   /protein_id="BAH55548.1"
FT                   /translation="MPTVTTPDADIFYTDSGGEGPVLLLGHGFFMDSSMFTPQVRDLSP
FT                   DLRVVSWDARRHGKTTDAGMPFTYWDLARDALAVLDDLGVEKAIIGGMSQGGYTALRTA
FT                   LLAPGRTRALILLDTEASACTPEQKSGYRVLFDQWCSTEPFEPLTSALAPQLIGGEPAD
FT                   WTSWISKWNSGDRMAVRPAAECLIERDDIVDRLSDIDVPALIIRGENDLSAPAEKADEL
FT                   KAGLPGAAPVVTIPVAGHAANWTHPEPVNAAITAFVKALR"
FT   CDS_pept        complement(58828..59610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55549"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW7"
FT                   /protein_id="BAH55549.1"
FT                   /translation="MDSISPPSLGDFIRARRTRATPKHPDGMTRAQLGEENYLSVSYIA
FT                   RLEGNVKDASPSPPVLDATANALCLDDAERRHLFNLARRTQTEREDITTPWTIADYRTL
FT                   ITPDMETAIAALNPHLVAYLDERWNVIDCNSAYDKAFPGLVDEGNVLRWFFSTPASMTV
FT                   MVEWEAEAALTVSWFRALMGRYYNPDWAVETLEELSEFPLFRELWLREEVRFGRHQPFM
FT                   HLRDAETGEHYSVHVQVHAEMRGKYPLQMYLGVRLPAS"
FT   CDS_pept        60416..61123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00510"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55550"
FT                   /db_xref="GOA:C1BBW8"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW8"
FT                   /protein_id="BAH55550.1"
FT                   /translation="MASLLTKKIDKLRSSGDDLPPAHNEADQDDPPDLNTRARVRRRPI
FT                   YLAIGVALVVVAVIGMLTAVNAMRATTDVLVLTNEVQQGETIESKDLAAKSVNVDADLG
FT                   ALPASERGRVVGMSASTRLPAGTVLLPSAITDQVVPGEGLTMVGITVSYSHLPSEPIVP
FT                   GDMVRVVDTPRDQDDPPVQGPINTKAQVYSTKEIPEAGETTLNLLVPEAEANWVAARGA
FT                   TKRVAIVLDNRVR"
FT   CDS_pept        61130..61948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55551"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBW9"
FT                   /protein_id="BAH55551.1"
FT                   /translation="MFLALTSASRSPGVSTTALALALNSPTDRTLLVEADAIGSSPVLA
FT                   GYMLGNHYHDRSLINLVDANRHGRLKAALAEQLIQIPESSVSLLPGLVHSAQADAMRPV
FT                   WGPLGVHLAGLSVDDTNVIVDAGRIGQRGAPVELIVNATTIAIVTRTERTAIAALRASQ
FT                   NALRQQLSAVQSRASLGLILIGESPYNAEEVTKVTGLDVIAVLPDSDDAKVFSDGLSIS
FT                   KWRRRRSIYLHTLHRSTWPKITKFAVSHQADWKSGPTLNAALPTLTGERR"
FT   CDS_pept        61945..63591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55552"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX0"
FT                   /protein_id="BAH55552.1"
FT                   /translation="MNSDDATQPPQNKITELPFFSAPIPDADLAGGGRSSISEITLPDT
FT                   DPLRSLRLHELPPASTKGHSGTARRSVPPAAKVKVDRALVRALQKEAAELLRDYRSARD
FT                   RERHDPKNAGKYFAPFTEEEEREFGRETITGLVKNHVQKTINSGGEAFTIVEEEALIKA
FT                   IFDAQFNLGPLQELVEEPHVTDIFLNGAAVYVKFPDGHYEHRDPVVDTPEELLEWMGLL
FT                   ASRADNGGRPFSRLNPSLRLTMRGGHRLSVMGYSVKRPSVAIRIHRLKNIALDQLAIEH
FT                   RMMPIELATILSCAVRGGASVVTGGGMGFGKTTFTRALANALPLQTRIGIAETERELFI
FT                   DELPGREDFVVDAETILGGGERGADGELAGSYTLSDILYEFVRQQLDYMIVGEVAGHEI
FT                   LALLKALQTARGGLSTTHAYTARGVVDRLVNLATEPPMNATVDYVERQLAEHIDLIVQL
FT                   GTKVRVDGEGSRTSVRYVDEVVYVEPGDDKKPSFSTIYRGYSDGTGEFGSIPQPLLRKL
FT                   LAGGFKRIHLPSDSLRHFDEERDLYDDEEVA"
FT   CDS_pept        63591..64466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00540"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55553"
FT                   /db_xref="GOA:C1BBX1"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX1"
FT                   /protein_id="BAH55553.1"
FT                   /translation="MYQQIGIFLVLLLCAGVACIVMGWKDRRDPTAPTRQRRRRSSSKI
FT                   PRSTQILLVVGFAAGIVVSSLSGWLFTLFLVPALLVGLPYLLGRPEAEQQISRLAAMDE
FT                   WARNLSSSMKAGSGIEHTIISTPIPEALREEITAFISRLRNNVPPVDAITRFASDLNDS
FT                   VGDKICGALLLSMQLRGVGLAAVLEGLAEDVGDMVARRRRTEADRKSSRTQAKWVTIIA
FT                   ITTLAAAFLFTNFMEPYKSGGMQIVLLILLTLFAADLYWMKQATKPPTYPRFIGTNDRV
FT                   NRTDLVGAQR"
FT   CDS_pept        64463..65362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00550"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55554"
FT                   /db_xref="GOA:C1BBX2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX2"
FT                   /protein_id="BAH55554.1"
FT                   /translation="MSIQMTVILYTSVGTIGIYLVALYFMRAQPALSDAMSRLSGPAPE
FT                   RTSTAGTSLIDGMANKLGIRVHPYLQDSKFFTLPNADLALLHRDPAHVLGEKLVAALLG
FT                   LLIFPFLNLVLTAFGVGLGWSIPAILSIATAFLLFLIPDIEIRRRATAARAEFAQALSS
FT                   YIDLVALCRRGGIGTTQSLERAAQVGDSWVFLRLDEELYEAGRSGEAPWNALTRVSHEL
FT                   GLTELGDLADIMNMTGDKGASVYASLRAKAAGLRSAQASAEQGAAAEATEKLAMPLAGL
FT                   AGLFIMLLLIPALTIITG"
FT   CDS_pept        65489..65746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00560"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55555"
FT                   /db_xref="GOA:C1BBX3"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX3"
FT                   /protein_id="BAH55555.1"
FT                   /translation="MSITTVATATRRTAREAVTSYITLTMMFVAALAGTLLHRAGGKDS
FT                   DRGPSTLEYVFLAVLVVGAAAAAGAIVVRKIMSRANAIPD"
FT   CDS_pept        65937..66353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55556"
FT                   /db_xref="GOA:C1BBX4"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX4"
FT                   /protein_id="BAH55556.1"
FT                   /translation="MVTLEQLIDRWRRDDRGPATLVTVIAMVAFLLIFSVLLQTALFFH
FT                   GRDVANSCAEKALKNTRSQYGNQALGTAAAYACIAQAGTGDLQIPVVLVSKNIRETTVN
FT                   ITGKAPSLVPGLEFPIVVNHTKPTERVTNPGGIG"
FT   CDS_pept        66350..66802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55557"
FT                   /db_xref="GOA:C1BBX5"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX5"
FT                   /protein_id="BAH55557.1"
FT                   /translation="MRGTRWISRARRDDRGDVTIELCLATVILILLLGWMYAYGVNRQA
FT                   HQKVEHAATEGARAASLARTIATATPLAYQAAAGSMDGQGLKCATMNVNADTSGFRTRP
FT                   GVPATVEVTVTCQVSFDALGWPGVNGARTVTATAISPIDTYRERTR"
FT   CDS_pept        66799..67260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00590"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55558"
FT                   /db_xref="GOA:C1BBX6"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX6"
FT                   /protein_id="BAH55558.1"
FT                   /translation="MTNALRKRLASRLPAEHRDKGAVTLMTVVFAPVLIFFVWGLIVDG
FT                   GGMLTADQRADNVAEDAARAAGQQIIGSVSARGIGTVVDPVRATAAAKRYLFEAGVDGD
FT                   VIPTGPRTLLITTRIVYNSKLLPYPRTKLLIGTAAVNLNRTNAGEVYIL"
FT   CDS_pept        67257..70448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00600"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55559"
FT                   /db_xref="GOA:C1BBX7"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX7"
FT                   /protein_id="BAH55559.1"
FT                   /translation="MSANAARSRLAGLGYLLILVMLVAGIPAALWALRGNPLDIPWSDF
FT                   EGLLASPDDGSLLIALLPLVGWAAWATFTVPILLELAATLRGVKTPKLRLLRSQQRTAT
FT                   FLVSGALLLLTAGTATAAPVLTQPADVGSTSPYAPHSQQEDPSALPQTQVDPRATRVAV
FT                   QPAGPTVTTVRGDTLWGLAQQHLGEGRRYAEILDLNRTAVPEPGFLAEGLTLQLPASQL
FT                   EVVRGAYTVKQGDTLWDIAERELGDPLRFKEITTPDGTPAGELITVGQQLIMPTAASAA
FT                   ADATPAPALVPPADAVPAPAPAPAPAPEAVPAPAPAPEAVPAPAPAPAPAPAPAPAPVD
FT                   VAPNWQLDPVEPQMPADLVTNDAPAETDTEDGSSDVVFIGLGISAVAAAGLTGHLALRR
FT                   RKQQHRRRRGERIALPAETAIQAEQALTAAADPLTTTHVDIALRHLAHHCRSTGIALPG
FT                   LLAVFVGDNDIDLGLVEQVSLPAPWTQIDDTTWSVDPRAFPRGVPEAEISPYPALTAVG
FT                   TSDDGRDLLLNLEQIGHLAISGTPTATAGVLRALAVELAVSPIADSLHLNLVGYCADLP
FT                   EAIDNGRITHSEDADTVLTTLANHVKLDSEILADNDFESIAQARTSYTTSELTAPEIVL
FT                   IADPVTEAQAGLLAGIARHAPRIAFAAVTTESAHTNAKWTLEVDDNGSAVLARPGIASA
FT                   GITVTTLDEESYASVLDLLTTTSREPRVAHKGDNLDIRWEAARLDNDISTDEFITSSDP
FT                   ATFSVVGNEDLDHAVDRPEPSDSDEVTAEGELPEADHIWIRLLGVPAVTPPSPGPAEGR
FT                   EKSLTEIAALLITTDGGVLAADIDSKIWPHDVEAARTGTAEQEKEAKARLRRRRNEALS
FT                   RLRKWLGDTETGEPALIKSGDRTGRTPQRLHDAVTTDWDYWEELVNSHPADVDIARLSA
FT                   ALALVTGQPFSSDDPTAYGWADHTKQDMISAVTDVAEELATRYIRGQQVPQDLAAAHAA
FT                   AETGLEVDIVHEGCWRAAIIATHFSGDTEITQRLIDRMITELDALEEEPEHETKMLLSQ
FT                   LDSTYGSHYRIGAAS"
FT   CDS_pept        70445..71005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55560"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX8"
FT                   /protein_id="BAH55560.1"
FT                   /translation="MTRRIAALATLTAAMCLTASCSILTPEPVILETNAGPTFTGPPGS
FT                   GKSPEQQAGEAALVKVNEYYTVLARLSADPAANPADLDNVAAGNFLQSTKRDITAHRIE
FT                   ADAGEVKVLKNTITRHNIPIDENGIPTPGTATIEMDVCLARATDVLELGKPILTNAAWP
FT                   DPAGWRVTADYTLPGTPCNAGLF"
FT   CDS_pept        71017..71655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55561"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBX9"
FT                   /protein_id="BAH55561.1"
FT                   /translation="MAHTTIRRTAVAALAATALLVGVTACSDTDAADPAVELTVTGDPA
FT                   FEGPDGADTSNKTPDELAREQALAKVNDFYAVVGKLDGDAAAPIEQLDTVAGGPVLDSW
FT                   RGDITLRRSQNVVGAGDVKVVDAKITDAGIPVGDDGKAISGPAWVHVRACTDISGMTWT
FT                   KSDGSPAYDVNRPQFVLAQLTVRNADWPDANGWRVTSDAAARYAPCDAP"
FT   CDS_pept        71669..72616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55562"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY0"
FT                   /protein_id="BAH55562.1"
FT                   /translation="MPNRRRFHAAVIGALVLGSLVASPHSALGQPGFGSGGIDVAPGSG
FT                   NLGANIVVQGSYVQVPSASPGSGGSSGASAAGTGGGGSGYSGGGDVVAAPTGPPVREQL
FT                   KACGRFTDCVPLSPDVGMPATPVSMAQVMNVVGTAVTGMQLEEPPMCWTPEPANFPGGR
FT                   TGLVGKNAWAWVCPDQIRESTVGPVTRVVPGPGGVVVTATAVNSSVTINWGDGSLPTIC
FT                   PGALLPFTPYNDLIDASPLTPPSGLPSPTCGHHIEKTSITQPGGVNNVSATAAWIVNWT
FT                   AVWPGGGAGGVVPVPLTSNYQQRIGELQVLVTPN"
FT   CDS_pept        72955..73299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55563"
FT                   /db_xref="GOA:C1BBY1"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY1"
FT                   /protein_id="BAH55563.1"
FT                   /translation="MSTLAQKVTAVAAVAIALLIVLGGFLIGTMVFTAAEGVDRTISNL
FT                   ADVDDPRVVRQAICLPYSDFVLRQHQAGLSTSQIQGVLDYAGHDGEGSAVDNSDVCGSP
FT                   QSILDAAGIK"
FT   CDS_pept        73517..74383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55564"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY2"
FT                   /protein_id="BAH55564.1"
FT                   /translation="MPGHIHCSEDGSRVTETRPGRIPVGDPIALRFDPEPKRKLEDMAE
FT                   GIGPRRFGALIRVACRRLVTQPKAVGTGLAEQRRLSEALRAIPLVMLKIKLEPDTAQEF
FT                   AALAAAYDTTVSALMRIALHRFLQAPGRYKHPMLREAERTGLSDWVDVMVNPSSKQQIW
FT                   RLAGRYGDKLNTSLLRVALRRLLEEPGDLAGDLETIAPLRDLRPEIYARANVHFDEPLR
FT                   DKLDGLAARVGSDRAELMRLAARRVLEEPGKIEQAVNNEVFRSEKNRKHLMARHARRQA
FT                   RRHTQPD"
FT   CDS_pept        complement(75211..77304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00660"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55565"
FT                   /db_xref="InterPro:IPR011518"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY3"
FT                   /protein_id="BAH55565.1"
FT                   /translation="MSEVDGRLRERFEVLLPHLNERQRRLALAAEARSLGHGGVRAVAR
FT                   AVGVSETTVRRGVFELEAGEQPAPTGRVRRPGGGRKGADALNPQLVPALLALVEPDERG
FT                   DPESPLRWTTKSLRHLAEELTRQGHPVSAPTVGRLLRDNGFSLQANAKTLEGEQHPDRD
FT                   VQFRYINEQVKAHQDAGEPVISVDSKKKEQLGQLPTPGREWRPQGDPVRVVDHSFFTGP
FT                   NADRAIPYGVYDLTTDAGWVNVGVDHDTAAFAVASIRRWWQARGAADYPHARRLLITAD
FT                   AGGSNSYRYRLWKAELAALATETGLAITVCHFPPGTSKWNKIEHRLFSQITMNWRGRPL
FT                   TSHEVVVKTIASTRTRTGLRVDAELDTGDYPIGISVGRDELRALPIRPHAQCGTWNYTI
FT                   EPTHADAAPVPGRDREGERVAAVAMLADSRLTGMTGDELDELTARLAPAQAARAEQRRW
FT                   HQRGGRRRNAPGAGGRRLLSDAAALLITVVYLRQVCPQRVLSDLLGVNPNSIGEIIAET
FT                   RMLLDEHGHHVTPTIGLRFSTAADLAGFLRDGTAPDPTPNRPLPEALSHPALTGMSRRQ
FT                   LGDLVERLAVRQAAMVERRRYAQRGGERMPGGRGGIFLQKITDAERVLATVLHIRQLCN
FT                   RAVLAELFQVSPRTIGNALLDVRPLLEQDGYTPAPATIRYRTAAALLAAIPPREGDTPE
FT                   SAH"
FT   CDS_pept        complement(77659..78237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55566"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY4"
FT                   /protein_id="BAH55566.1"
FT                   /translation="MKKTTRNSRRPHCGRSTSPVRSYTEYTKRLAAGAKTVVIDADPEN
FT                   WLDLGHIPSQVEVKIIGQTCAGIAGGSIAAAGRCFVQASNHARVTAYEHAHIEAFDDST
FT                   VDARGKSHIVGTDNARIRAEDSAIVFAHSHCHVQANGQALVAATDTTTVRIDGEAHVRV
FT                   SGGVRIIGPGRPANVETHPISRLARHLNF"
FT   CDS_pept        complement(78349..78864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55567"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY5"
FT                   /protein_id="BAH55567.1"
FT                   /translation="MNRRTTTEFAALSLITAAILTGCSSTEAETVSPSAEPAAAATSVE
FT                   WSTNPTVDQGQPGVADAQTRLSETQPATTTQATALPPTSAQCGIVTNNLNGATAPVIII
FT                   AGTPSCPAALSISDRYLNDRTVAAQGQGRFAVIDAWNCSWPYLPDRSHADSYLHCVDPT
FT                   GNAVKIGD"
FT   CDS_pept        79113..79976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55568"
FT                   /db_xref="GOA:C1BBY6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY6"
FT                   /protein_id="BAH55568.1"
FT                   /translation="MTEPTSELAGSGLSEEPQSPAVGAEDAAGQRSDHLPATVYAPAGN
FT                   VVVASVVVWFAVRWFDAEYGITALWWAASACAAVGAALSAAIAPMMARLCKAVDIPSEA
FT                   TGRRIVPAATTAGMWFGAVLLARGDAILTAWLALSLLCVWAGWIDHFTLRFPLTLIRLT
FT                   TAVGLMFGAFAVAVDQDPAAGGRALLAGMLVFAFNLAFAIVTRGYPGLADVRLSFILGA
FT                   ALGWVGWMNVLSGMLLPNVLALVVMLWVKLIGRRKDLGEFGFAPFLVSGTALAIAVPPM
FT                   WWIVWI"
FT   CDS_pept        81015..81350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55569"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY7"
FT                   /protein_id="BAH55569.1"
FT                   /translation="MDDADQSAPMPSIVQTELPCEFCAEHPQYFPGDPVGFVRAARWAV
FT                   VVKDCCHFDARVDYLLCDEHWAMIRHQQLPGQCPRCGAIAYSVKDIVCTEIPLGRTVDG
FT                   AWPVIRR"
FT   CDS_pept        81774..82763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00710"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55570"
FT                   /db_xref="GOA:C1BBY8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY8"
FT                   /protein_id="BAH55570.1"
FT                   /translation="MRMVGSRSGWPAMRAPGDRTRLVLTADGTSLAVREIGSQMAPVTV
FT                   IFAHGFCLHMDAWAPQRAYLAMVWRGRARLVFFDHRGHGGSGAADTDSYTISQLGRDLD
FT                   AVIRTVAPQGPIVLVGHSMGGMAVMSYVAHHQEAAAAQVVGVGLISTAVDNVAGAGIGR
FT                   ALNTPAVTLLRSASAHAPGLVGRSWNLSRRILSPVVGATCPLAPSASVRAAATSYGMVH
FT                   ATPIATVAAFLRDLRIYDASPALDVLAKVPASIICGTRDRVTPIGHSQRLAAALPLAEL
FT                   IPVSGARHMVGLERPDVVSESLDRLLGRAVGRREQDTTRRSKSDLVGA"
FT   CDS_pept        82760..83206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55571"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBY9"
FT                   /protein_id="BAH55571.1"
FT                   /translation="MRSARASDLTRQPLMGEVVSIHQDVDLSSGPAHHRTDKLVHRGAR
FT                   SYTRHVLNRVAACGVQVGARHRCIDLHHEPKTYNPWQDVTYCRCGHIRWAGDHAQFDTA
FT                   VEAFDGFPHHPSGRPDPRTYPGKNDTESRQVSEQRPIGRSELRR"
FT   CDS_pept        83203..84240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00730"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55572"
FT                   /db_xref="GOA:C1BBZ0"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ0"
FT                   /protein_id="BAH55572.1"
FT                   /translation="MIPAEAGDPAARAVLDMIDRVEIDPESDQFLTALDRIHLQLLSPR
FT                   AATIVARRAELGFTAHDVNTYPRRNIWRTQVPFGRTNGGVVVEIPLVVIAPVLIGMIPV
FT                   LLNMNPLFQSPITDLTVFISAAAGVEVLAMWWWIRRDPLRLTAADKQMIRGSIAKLDAY
FT                   VSAGGDYFELRLAMTASAIVDDIREVPAWSHEDLDIHRIRLDIEDQLRMILCHCGELAT
FT                   FRASVGEPTRGVSAEADAARAAHHEQRRWFEQAKESLIGRVAALWTYHQDLLMLQDSID
FT                   GTAALGRIDAHAPALGELLVNSANDDLAASAIGDLATDLADQHQAREKALAQLRGDVTG
FT                   FDRRN"
FT   CDS_pept        84240..85127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55573"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ1"
FT                   /protein_id="BAH55573.1"
FT                   /translation="MGRSHDRISPDRGNGVFDPDRGDSDVATRKEGALISQHAYDTRAD
FT                   LRSGARELDTATENLPGLTRAQRDLNRAYPRPTPAAIGNSRLRPQLPPAIELRRTLSAR
FT                   QRNTRSAAKRRVLDAMPKTQYTALASLTSDPKTWRETNNALSAVAGDAVELDDARRKQV
FT                   QRVDRAIQRYERASGRGHLVYTSVSIPNAVVNPSDLPSTLSPGTVLSFDRFTAATHSLH
FT                   ELDSTARPTDVVFEIQTDRGMYYGQSSRVDNSHHLLPRGMQLQVVGAHFVPYERPGQPP
FT                   GERLVVQLVDHETP"
FT   CDS_pept        85650..86597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00750"
FT                   /product="NlpC/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55574"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ2"
FT                   /protein_id="BAH55574.1"
FT                   /translation="MDFASIIIGVAVAGASAAQGGGVDPAITDSVTSVAQKLPPALAQY
FT                   VPDPQPYLDDAARAVQQAQEQLPDEWQAEIENAIPPEVRDAAEGAREQLPPEAQGLIPE
FT                   VVLPAPSPEPGPAGGVADPAGPAAQAPSSTPQQETNPLFLSPVVSGAPTTAAGIPSLTG
FT                   MLAPTAVSDLTFDPRFPRNLEFARAVIEAAMRAIGLPYQWGGGLLTGPSMGDGTGGATA
FT                   GYDCSGLTRFAYYIGTGGTKVLPRTSQEQFRAGQQISMDRAQPGDLLFGNWQADGANHV
FT                   AIYLGGGRMLEAPQTGELIQISAVRSDMVPARFL"
FT   CDS_pept        86726..87142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55575"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ3"
FT                   /protein_id="BAH55575.1"
FT                   /translation="MTITPAAHKKAIETARKNAEALAQKAIETRVALVGAIGEAVEELA
FT                   ALDSAREAAVDAIRTAHENAIEGGWTAKELAAMGYTAPKKRKNASSKAARGGASKDATE
FT                   TTDVADAAAPQGGDQPPSTDGQISSEREPEHSYS"
FT   CDS_pept        87352..87882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55576"
FT                   /db_xref="GOA:C1BBZ4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ4"
FT                   /protein_id="BAH55576.1"
FT                   /translation="MLVPGRAAVLDVESTNLDGSIIEICVLDAATGNPLLDTLVDPGDV
FT                   PMHPDAYAVHGIALADLIGAPGWSTVHQALIAVTTGRVTLSYHSEFDRGRVLHDCARHG
FT                   LDPAHLADPEMWGCIMRMRSQAEGTEKSIRLDGGHRARSDAAAARTVLLGIAEGTSAPS
FT                   TTVDPATTSHLPL"
FT   CDS_pept        87979..88371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55577"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ5"
FT                   /protein_id="BAH55577.1"
FT                   /translation="MTAAHPRPDLEAYNQAARMSQPELVTALRELLGAKLVAYLGRVKE
FT                   TRAVRQWAEGTRTIGSDSDVERLRIAYRAARLITARDTPAVAQAWFQGLNPILDDRAPA
FT                   LLLREGELADVGPQVLAAARQFAAVG"
FT   CDS_pept        88368..89120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55578"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ6"
FT                   /protein_id="BAH55578.1"
FT                   /translation="MTQLDHALVATAQGSMWCAHRYGCEVYRVGFAPSPWEWTPWVYAT
FT                   DGRFTGRWDDPDGVWRTLYVGASRLACYLEVLAYARPSAQVIADLDEIVVDDEDAAAFP
FT                   TVEPGRVPRSWCEPRMTAHGALTGWFAVPGHPETLATLRVGFRSAAIRHGLDDLDGAAI
FT                   RDGRPRALTQAISKWINTLGGPDGCPITGVEFDSRHGDGLRLWAVYERPGDPVVSPHVT
FT                   ALDQVPVAPDDGDLVQAMRLLGLEWDDT"
FT   CDS_pept        complement(89281..90135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55579"
FT                   /db_xref="GOA:C1BBZ7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ7"
FT                   /protein_id="BAH55579.1"
FT                   /translation="MAGKPEPDGLDLNTLRALRRPRRDLAKLTGRIAGHLDDHDGYLAF
FT                   SGGKDSLVALHLTLQVEPNIPVVFFDSGLEYPETYTYITALADTWNLNLAPHRADPPLL
FT                   TVLAQSGEWDHHQPTRATSQKLRDILIGAPSRAAHAAHGPGEIWGVRADESPKGTGRWS
FT                   LYYNALSSHVTRMCDGCCTNTTEQRRHHGGLIDRADGTRVFGPVWDWNTDEIWTYIAHH
FT                   QLPVNPVYGTLRRLGTPEKHLRVSHMLDGAFLEHGRITRLRRGWPTLFEELAHVLPRIR
FT                   EFV"
FT   CDS_pept        90263..90940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55580"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ8"
FT                   /protein_id="BAH55580.1"
FT                   /translation="MGKLCEVAGRKDVVAAAFASTKTREVVEVARVGRCARCAASPVRV
FT                   EAVTKVVSRTFTGYDCWKAPVEGGLCTSCAWAYRHPDLRRSMHVVTTRPAMRAVTAADL
FT                   ERILSRPLDPDTAVVVPLRPGRKHILPHARWGGIAVEDTCLPWTSRDVAAVTAMRRLRA
FT                   LGFGARMLAEPAAPYPVLATIAPGRWPAVFADWDRLAPYRQVGQWWELALRATVSASAK
FT                   GTK"
FT   CDS_pept        90937..91353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55581"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBZ9"
FT                   /protein_id="BAH55581.1"
FT                   /translation="MTSPTDRWLAAAPAGLPPLEGPAATAERLLLLLHYGIDWDSGWIG
FT                   RRRETYWTQHLPNRVRVATYIGGGDLDRWWSVVSRSLESEPTNTDQRLELATLLREESE
FT                   PVLTLLRERPTSYVLRTRIVAEAVAAARTSGTKK"
FT   CDS_pept        91350..92219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55582"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC00"
FT                   /protein_id="BAH55582.1"
FT                   /translation="MMRSTVRWDVELTALSSISQKGEDSGTTTTLFRREPVIQPDGRPV
FT                   LVPIVSGNSLRGGLRRIAEELFRDVIGYEGQIPLSAAHALRNGGSLTKVTGDGLTGRRR
FT                   HRLRELVPPIGVFGGNGGGQPPIDGCLRVGKVVPRVRETETIMTRAYDGRLMSQFELVS
FT                   LESYSRFDDTDTRTFPESSAGGGAGKDVGSSMLMRFEVETLPAGTRFETFLRLDRATPL
FT                   EISFFTDVWGRFARDGFLGGRSAIGHGRVRAESDRVVLAGPDPQTVDWRVELAPLRDEV
FT                   IEALCWLT"
FT   CDS_pept        92234..92941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55583"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC01"
FT                   /protein_id="BAH55583.1"
FT                   /translation="MAPFVVRAHLSSGLAHATPWGISLDGILAAELWADHKAAALDRVE
FT                   YVPALTPECAPPDLALPLARCELAGEDWHWCATCSFPEDPAGDPVVRHWASRADHRGLE
FT                   QLSHTLPAVISDRQGRYRARYMPLMITSTRTVTWRGVGDLDAVARILGGLDVIGKKRAH
FT                   GEGRVLRWEFEHCPAADRWAAAHLHSDGTLGRTTPPACLPDRPEPESAGFGLAGLRPPY
FT                   MHPTRMRQLHLPR"
FT   CDS_pept        complement(92967..93464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55584"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC02"
FT                   /protein_id="BAH55584.1"
FT                   /translation="MTTTGSTTTTAATNRTTISSDNSDTIGGTAQTITAADVTARIEVK
FT                   EPQLIEKTSMGEPRILLFPIVLDVDSGTLNATSTNWKVRTLSGQTITGDNSWGNIPTAM
FT                   GNNALDGHAEGLVLFPGIGDKLTDDVSIAEVALYPPNGSNTPLARWTLPEPVAVPDLPR
FT                   SE"
FT   CDS_pept        94058..94327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00860"
FT                   /product="WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55585"
FT                   /db_xref="GOA:C1BC03"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC03"
FT                   /protein_id="BAH55585.1"
FT                   /translation="MSEMTDTDIRPRIELDAPEWRDFALCRVTDPEAFFPETGENGRPA
FT                   KRVCAGCEVREACLAEALAHDERFGIWGGLTAAERRKRYPKRRR"
FT   CDS_pept        94324..94698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55586"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC04"
FT                   /protein_id="BAH55586.1"
FT                   /translation="MTAMAMDFEHTSQAEGRRGTKAIQLARYLWDRVVPRPTCCHYGRN
FT                   SFADLRGGWAFIRHVWQETCYGTASLPKQKTRWARAEPEHPAAARARMTSGTCGCRRRS
FT                   RSRRLMGPVVMENRRMGGKR"
FT   CDS_pept        94695..94847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55587"
FT                   /db_xref="GOA:C1BC05"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC05"
FT                   /protein_id="BAH55587.1"
FT                   /translation="MSDAFILGVALACGVGVLGLVVALFWGAEPSRTCRCVVGGHTEAC
FT                   DARWS"
FT   CDS_pept        95141..95401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55588"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC06"
FT                   /protein_id="BAH55588.1"
FT                   /translation="MRDLLEQSVRYLEALSDAIVDAAPSTDASFVAEFAEALRECAEAV
FT                   KIAREDMIDAGRPISPVYSHPGDEDTREELASRLTAHLFTG"
FT   CDS_pept        complement(95438..95962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55589"
FT                   /db_xref="InterPro:IPR018840"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC07"
FT                   /protein_id="BAH55589.1"
FT                   /translation="MPRFYTVDRRGTLHEGLSLGLTRFDDVEPTALQQHLDVLFPDGVA
FT                   AHGEINFVNAAAQFQVTDHLIELIWENVRRAHFPTAPSRFQSAFAVDTLDEARAFRTAF
FT                   DPTEAAKIWQVETDHDGFRANMELLRAPGTALMTSYHSYCYWSQQSPDHEVPVTWEVLL
FT                   SPPIRVLGPAE"
FT   CDS_pept        complement(96081..96578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55590"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC08"
FT                   /protein_id="BAH55590.1"
FT                   /translation="MPADRGSVHTDSDQALPHLATDDVWADSHIITAARTGTNIELQIH
FT                   TSIAPFGAAAEAWFPAATGFTVTVIVHTVDAQTGEPRYLPPAEPAEWARTIFSTVDAPH
FT                   GYFLGAVDPATGVHRGSQLAYRLYLDSTRRTIPVPRQVVTCPHYLLAALDGRAEVTIDT
FT                   TA"
FT   CDS_pept        complement(96568..96762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55591"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC09"
FT                   /protein_id="BAH55591.1"
FT                   /translation="MVLEDLAEGRHQFLYRDRRQGNKQVIALIAAQERATKVGIPDELA
FT                   VYRLADQIIRERDKQAHAR"
FT   CDS_pept        97202..98077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55592"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC10"
FT                   /protein_id="BAH55592.1"
FT                   /translation="MGQGVMPPVTAVASHSLFGYLRNPVMIAVGHDRHNHLVLMAYIDE
FT                   TGDTGLIAKGGTNCYALGCVLIDDSQWPEAFDKMLDFRRRLSKTYGINQRWELKANYLI
FT                   RGGGPLKALALPPGIRHLVYRGHLKMLHEIGARAFTVVVDKEATKLSGQECFHMAWETL
FT                   LNRLERTSTKEKSTLMILHDEGEDHAVRREFRKARRHLTAGSAYGSGQIRSKGTLFLDD
FT                   PVSRASHNSQLIQTADMVAYAGWRTYMPPSKKVAEVCPSDMWRHVGLATHRVVNSVTRN
FT                   GAPGVVIRKR"
FT   CDS_pept        98220..98369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55593"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC11"
FT                   /protein_id="BAH55593.1"
FT                   /translation="MTDEEINQWVKTVGPAPDDVFAKIVLRFAKAAREGNLKFDEIDPQ
FT                   SGDK"
FT   CDS_pept        98502..98681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55594"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC12"
FT                   /protein_id="BAH55594.1"
FT                   /translation="MAEADLVVAGELRRSERAEEVDIARQSAFWTKVRGIAALVAVATL
FT                   CGLPPLLSAPASCV"
FT   CDS_pept        complement(98916..99212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55595"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC13"
FT                   /protein_id="BAH55595.1"
FT                   /translation="MLPRIQESPTRILSATLTVSDLLDFQSTDEAPLLVEVDTTDDDGR
FT                   TYRQSHIVAKLSEKHDTVKGHHEFTICFADPTLAAHTYGPEDTVTIHRMFFAP"
FT   CDS_pept        complement(99245..99493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55596"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC14"
FT                   /protein_id="BAH55596.1"
FT                   /translation="MSEVRSTLPLMNLIQRTSPEPQAFSSHGFKIPRPSGEHSARIWQA
FT                   AETFGKDSNAVSEATFHAVVALEAEVVALRRATGTSE"
FT   CDS_pept        99774..100874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55597"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC15"
FT                   /protein_id="BAH55597.1"
FT                   /translation="MADLATAVTVLDANGRAGVPSLLISGPGMGKSSLVRGLAASDGVL
FT                   CETVLGSLREPADFAGLPVVREHGVTLEAPDWAKRIHAEGGGYLFLDELTTSPPAVQAA
FT                   MLAVALDLKVGDLQLPKGTRVIAGANPPDCAAGGYELEAPLANRFCHVEFTPSVDEWLD
FT                   GMATGWATPPASRAVATDEQRVALVRSSITGYVQRNPEALDAFPSSAAQTGGAWPSRRT
FT                   WAMLAAVLPHLRDDDNAAINAVVFGLIGEGTGVEFLEWRRNADLPDPVAVIENPETAFD
FT                   WQSRPDLVWAVLSGVTAWAAGRGTVEAWRSAWGPLIAAAEAGAPDVAGAAARTLAKARP
FT                   AKAVVPAAAKRFSPMLVAAGLVGEAA"
FT   CDS_pept        100871..102130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55598"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC16"
FT                   /protein_id="BAH55598.1"
FT                   /translation="MSAVRVLDPDELRPFRLARLVSAEQMPYFMRALFAAQPVAAPGLG
FT                   TFAVDAQWRLYLDPALLVGANAWPVPVAGAVLLHEVGHLLRAHAARAASLPKPVQHLAW
FT                   NYAADAEINDDLLAAGVGLPEGVITPESFGCASGGIAEDYYTNLVDPSASPSPNAPADG
FT                   DGDPGCGSGAGCPAVPGELGAAGNEVTEGLDGAEADLVRRYVAQAVRESSGKGRGSAPA
FT                   GLVRWAGEVLAPPTVAWDRLLRAAIRRVLADQAGRTNYTYSRPSRRGIPGIVAPAMRGP
FT                   SITVSIVVDTSGSMSADDLDAAMSEVAGVLRAGGVSRDRVRILACDASSTTAQPVRSIA
FT                   DVKLIGGGGTDMRVGIDAANAARPQPHVVIVLTDGDTPWPDRPSRSHLVCAVIGSDTAA
FT                   ARTPSWASTVYVPVGAGARA"
FT   CDS_pept        102127..102321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55599"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC17"
FT                   /protein_id="BAH55599.1"
FT                   /translation="MSAAGNGDLVRYADRVLAGTGITANQVAAVVAGAATDAAATALRA
FT                   GWRCAANPVQGSDEERGAA"
FT   CDS_pept        102318..103508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55600"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC18"
FT                   /protein_id="BAH55600.1"
FT                   /translation="MSVEWFDLAQRLYAAETRSPVARLTHTTFAASTAALAVRAVARGG
FT                   SVTVSVAGFEGREERARDVDALGLLAAHGGTIVGRCDPAPLLTDDTGTLPALVTLARAH
FT                   AHHPDPQVAGAAAMVAWWADRADHPGTSAVVNLVAASSARYVLGTTPEAERSATTWRQW
FT                   LRICDDGVSGLHEWAAKISGGPLLPLLEPIHEDDRYSWDRALSAATAGHDWSRPDNTAS
FT                   AAMGLRTRCDAAELKSAALLDDPLWRQRAVHTGHVAVGVASVTPPPKGSRRRNASLSVT
FT                   CDRLDSRLRVGSEVTGWMGTPADKPFERFFVEVTSAQVVEGKLVLGLGSVGAHAPAPGA
FT                   RVCLMPGPPSPQTMRAGRGRYWRLYRARRSWLSTGQTPVAARREVPLDVLIAGAED"
FT   CDS_pept        103578..104876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55601"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC19"
FT                   /protein_id="BAH55601.1"
FT                   /translation="MRILAPRPDIPKPAPSSAPAPRPSAPSLTQWPGSQIMSDPITARV
FT                   LFSVWSGDPAVVVPSPPGAGKTRLVALLAAALAHRGDLRVGIAAQTREQAVEIARRLGT
FT                   LTDRAALMWKTKPPKPDSGETPAVSGQKVRWPGDVGAILIGTTARWLFSDPDRVGADVL
FT                   IVDESWQCTYADLGALGAMARQVVCVGDPGQIDPVVTGDVSRWDGSDTAPNLPGPIALQ
FT                   AAHGDAVGVVRLRHTWRFGADTTALIGPLFYPDLPFTSRRPPEHLTDAGGVVPELAHRP
FT                   VTVCGGPSDPALVTACAQRARELLDAVLVTAEDQRPMSAADIAVVVPHVTQAAAIRALL
FT                   SDHPDVLVGTANSLQGLERAAVVVLHPLAGYRTAEPFSLDPGRACVMLSRHRAHMSVVI
FT                   DDASAEVLANTEPSTAHATNTALLAALHRTPAV"
FT   CDS_pept        104904..105248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55602"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC20"
FT                   /protein_id="BAH55602.1"
FT                   /translation="MSDEIMTAYHAERLADVDSPAQLAAAFAGRIRPNFTYEYDDDSQV
FT                   HDNGVRALRAGDGLITYARICNTDQEEAMTVFGDFLGDLHHLADAMGVDWDEAQRRGAV
FT                   HYTAELYGAD"
FT   CDS_pept        105741..105908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55603"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC21"
FT                   /protein_id="BAH55603.1"
FT                   /translation="MQLNTRVLASTEARLNWLVKNRNFSVTSVVDVALQELFDRHHVPP
FT                   ADIEGRIVEQ"
FT   CDS_pept        105911..107749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55604"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC22"
FT                   /protein_id="BAH55604.1"
FT                   /translation="MTRPWEQIALFDLHEPAPPAPAPEPGDDATEIAPEETAPAEPASA
FT                   EPTTTAAAANLLNASATEPAATPPAPVWEALPAGEEADGHALIVTADGTYTPSGRELTG
FT                   SVDSVEKLDKLIRWAALTPLGAPAQIWVVGQAACELLGWIIDPGSEDDVDDMEALRNRA
FT                   AQELTAVLHATLTPLLNAGWELRGEPGHVVHLSRSIGNFTSMVDVVIEPYVWTYWNKDF
FT                   GWHNRVGDMGILGSPTAGTYLPDDDLSAARELGRRLAWCAKHLGVLPGPTPARTGAALV
FT                   DKIKRERTRSGKGIVVTAPGSVPPLDGPPRGDLEPAVGWTRVPESDDLDNAHRLVSIDQ
FT                   RAAYLASAGMLEFGYGQPTHLTGDAAATAAVGEKGAPFGLWRITLPPGQTLSLPEKLPL
FT                   PHPHMLADQPVQTWVTTVSLDGLCSPVADGGIGADRGDLDITEAWVYPQQGRALDKWAK
FT                   ILREARKAAVDTEDDATKRFLGTCYKGYIGRMVNPDMWTAKQMQHHHQPLWRASIIAHC
FT                   RWRGRRVAMRIAREHGRWPVRTVTDSWVYLLAGGEDIADASEALGKMSVEKDVVLTDTL
FT                   LSAFTSAQDVHEVNLAIKAAFADNEDAADDEEEGED"
FT   CDS_pept        107749..108546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55605"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC23"
FT                   /protein_id="BAH55605.1"
FT                   /translation="MALHLPKPRTKKPAQEAVGLDGLKVTVANAATSGVEKSKQVKSGG
FT                   LAGLTSKVSVKQLRKELGNEGLRQAAIDAGRTPPSARTLRRWAQQGRIPHPDVLERAQR
FT                   RAAIERLGGVDAVAAKIGRSRSAVSRYRSGETNELRADASKKLRNVKAQDIMKRAGVLR
FT                   PDGTPKKAVIRVKGGVMVRNGADEGYDYRVRTLDFANSDTPFTSEESRELAAALANDDH
FT                   ARVVALLERHATLDYPENKGFDKYSDQFGFHFDHIDSVHIDWI"
FT   CDS_pept        complement(108594..109163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01070"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55606"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC24"
FT                   /protein_id="BAH55606.1"
FT                   /translation="MRTPPATQGDLPNYTNLGDEPADHGIGRSRGGLTSKAHLACDGHG
FT                   RPLSVLVGPGQAGDSPMFAHVLEGICVPRLAGGAHRTRPDEVRADKAYSSRANRELLRS
FT                   RGIKAVIPEKTDQAANRVNKGRAGGRPPNFDPESYKGRNVVERAFNKAKQWRAVATRYD
FT                   KLALTYRAGFLLAGIVEWLKLLGDMP"
FT   CDS_pept        complement(109108..109503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01080"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55607"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC25"
FT                   /protein_id="BAH55607.1"
FT                   /translation="MADVVDRFEVLTDKQWELLALLLPSSDGLRGRKFRNNRVVVEGML
FT                   YRLRTGLPWRDLPSHFGPWKTVWKRHRRYAGDGTWDRVLTALVAMADAGGNLDWAVSVD
FT                   STVVRVHQHGANAARHTGGSTELHEPR"
FT   CDS_pept        complement(109696..110217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55608"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC26"
FT                   /protein_id="BAH55608.1"
FT                   /translation="MTAFTKDVISMRANRSSASPLQLYAAFRRHHPRIVVPVDYVTECG
FT                   FRLGLWQDRQRVARMLGTLPPQRIAQLDAIGFVWSDDDLPLPAVSPADGKRRRMLSEIA
FT                   AYREEHGDALVPANYVTADGEQVGQWLYQAVKKWRANALPDDERRPLAALGVSPGPRPR
FT                   GPRMSAQPVG"
FT   CDS_pept        complement(110545..111498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55609"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC27"
FT                   /protein_id="BAH55609.1"
FT                   /translation="MGITFHGPSPWPHITRAIRTRGPRHGAIAYLGEDAPTLLPLRAGD
FT                   VLVVNASRAAVRAHATSPAALAHYVDAGVRVLSSPNLHANVIVTDRRAVIGSANASHSS
FT                   TIADEAVVITEDPDIVAAVRKFIDGIEEITEVDQVFLDNATAIWQIGRAVPLPGIGGRN
FT                   RAEPDFLPTPVTRMFLWHITDYQPGAAEEHERAAHTSRHRTSAGPAATYQLEWFRIDTP
FT                   GGRGQLQRGDVLLQVTADNEWLYPPAVVDSDPIAIPHTRRAVAYQLRTRIDLEPIAVTD
FT                   AEVWLADVGHPNPRLRTDHRIVSASLRAAVLRLWNL"
FT   CDS_pept        complement(111719..112306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55610"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC28"
FT                   /protein_id="BAH55610.1"
FT                   /translation="MSGVIGCDRHTPARGGRHLPRRRHHAMPAVPGHGGQVGTRACPHR
FT                   PRDDPDRAPTRVRCRDCGATHILLPTALQVRRADTAEVIGNALAHKAKGLGFRRIAERM
FT                   GRPESTVRRWLRRTTGEHVQWLHRRGTERLGLVAREAFCTIRYVGNPLGDALCVLSAAA
FT                   VEDRRRFGFPDPPWDLIGIYTQGRLLSPPRSG"
FT   CDS_pept        complement(112787..113959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC29"
FT                   /protein_id="BAH55611.1"
FT                   /translation="MDPALNPFKPGSGLRPPALEGRDQERQEFDLLVARSKRGNYDRGM
FT                   VLSGLRGVGKTTLLNNLAEHAERQGWLAITIEARPNEAGIAAVRARLGYELAVGLRRFS
FT                   RKHQLHKVIDDLVSLARGFTLGVGLGPAKIEIALGGRAASGDIDLDLEELVEAISDVMR
FT                   KKGAAFGLFIDEMQDLDPDLLGALLAVQHRASQREWPFFVIGAGLPSLPAVLADSRSYA
FT                   ERQFSYRTIGPLSPADAADALRVPVEAHGGAFTPDALEILVEASGGYPYFLQEFGKAIW
FT                   HTAPTSPFDAEDAHTAVEEGRRALDDGFFPSRWIRATDRERRYLRAIAEAGEPTPRSGK
FT                   VAAAMGVATTAVSDVRDSAIKKGLVWSPEHGRIAFTVPGMADFIRRQPTA"
FT   CDS_pept        114211..114951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55612"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC30"
FT                   /protein_id="BAH55612.1"
FT                   /translation="MVVDLDPRPTSVVANVRRSADGVECEADWDALVPESLVGAAAPWR
FT                   TFRWYHGQKHYSGAYWSSTEQALVIYESRLELARLLLADFDRSVRRILAQPFLLEADVA
FT                   GARRRHVPDYLLLSDDGPVVVDVKPAWRLAKPEVMQTFAWTRQVVESRGWRYQIASEPA
FT                   ETELSNVRFLAGYRRDWLFDDDLLADLRSVDLDGATLGEAVRCLSDRPEPVMRSTVLHL
FT                   LWRHHFTVDLSKTLSSDSVLGERS"
FT   CDS_pept        114948..117089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01140"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55613"
FT                   /db_xref="GOA:C1BC31"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC31"
FT                   /protein_id="BAH55613.1"
FT                   /translation="MSGAGVRVGVGTRFLYDGETVEVVEMVSTASGNEVVVKDATGRQY
FT                   RRFALKELLACERARVIPDSPGPASDDDQEVASVVLAQLTTTEQEQLTARAAHVREVLT
FT                   GYRSGNPLIAGPGEPRPQYSENVALSDRYAAKAAELGVGVRTIERWAGKFQKAGEAGLA
FT                   VRRDPSSVSSTRTDDRWVETALEVMVEHTDQSRPSRTMVIERANARAVARFGADVVRLP
FT                   SRATAFRVLEELERRHPTFRLSTKRNRDIAARPDEPYGKLRPTRPGEYLLMDTTRLDVF
FT                   ALDPVTLRWVQAELTVGMDWYTRCIVGIRLTPVSTKAVDAAATLYQAFRPRPAGKDWPA
FT                   HAVWPEHGIPRSLLVDASAIDGPIAGAASPALAPETIVIDHGKIYVSEHLTSVCQRMGI
FT                   SIQPARLRTGRDKGPVERFFRTIREDLLQALPGYKGPDVHSRGVAPESEAFFYLDELEA
FT                   IIREWVAVVYHHRPHESLLDPHLPSVKMSPAVMFEHGIARAGYIEVPRDPDLGYEFLKV
FT                   EWRTLQHYGFEVHGRRYHGDLPPGCRDGASPYPDRGKGKGRWWPLHVDPDDVTRVYLRD
FT                   PTSRRWYPLEWEHARSMQMPLSEDALAFARRLAKAKYTYPDDRIAVADLLERWNLGLGS
FT                   SMTERRMALRMAREDTALDLDPDEPTDATGPPSVTRHDATAPVYAAQDGKDIGDDDAED
FT                   ELNRPDDGDDFYADALEYL"
FT   CDS_pept        117086..118189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55614"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC32"
FT                   /protein_id="BAH55614.1"
FT                   /translation="MTIALIRQRLQDCAPLGNVALSRKEGWREFADAPALVAPAVLTRT
FT                   QLQALSADDAEVYNHFRQLWHANLGPIRTPQLTALHEQLSTVVDSNLQFGDKAKGAVAI
FT                   DAYPGLGKTTSVLAFAKAFHRREIRIKGTHTRDGHQRWPVCRVGLTGNTGLKEFNRAML
FT                   EFYAHPGTTRGTSADLSRRALDCVTSCETRLLVVDDLHFLRMHATSGVEISNHFKYIAN
FT                   EFPVTVVFVGVKLAERGLFAEAQTARRTTLVGMQPFLIDTDTGRREWRTMLLAIEQGLV
FT                   LADKYPGMLADDLSDYLFTRSTGHIGSLMVLINRGCHRAVVTGRERLDAGVLDGVSNDE
FT                   DAETARRELAAALEARRITTRPTRRRR"
FT   CDS_pept        118186..120531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55615"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC33"
FT                   /protein_id="BAH55615.1"
FT                   /translation="MTGVRSLPIRVAPLPGEAIDSWLEAIAHRTGTAFGDLDTALHRED
FT                   RTAAERVRRPSVWPVHLPPREVDTIAAAAELPAATVEAMTLARYDGIALSLNGRKGRAA
FT                   AGLPWGRGRRSRYCPACLAVSGGRWQLRWRLGCVFACSEHHCLLADTCPHCGGFQRCRR
FT                   PLREVIPSPGRCAHWSADTAAPSGLARCGADLTSAPVTRLRADHPALWAQQLVLDVLAA
FT                   GQGTFGVYAERPLGAREVLADLHAVASRVLVYGTDAEIAERVPAGLADALARVRSSSAS
FT                   EALTSRGSELSGAGGAIATAVAVTAAAAVLDRPDIADAGEALRWLVHGGRRLGRQVNAG
FT                   VKGDWGSATSTRLAAVQLAALRPLFVRAVDQLRYRSAADLPSYPTVSATAVNDAARRIP
FT                   TLLWPEWSLRFTVPPCSPAQVRPALSAALMLVGTTLTVGEAADRLGSAVRADGVTRTLA
FT                   CLRSSPRWDDTLTALIRLADHLAAEPPPIDYERRRHLDYRGLLPDDMWKQICRRTGTPP
FT                   GAGQKADFARCLLFERLSGLPADRSPFLAAGYDVRAKLSEFPRALTPALAAQVDAAAHR
FT                   FLDDQGLGEEPVYWHPPRDLLDGLDLPGPDPNSVDLAALHDLTRRDHTALSEIARQLDT
FT                   TLDVIRHLLVNHPAPASPPAAERFGRRATQAAAEEAVSRTEFVDLYCVQRRTLAEIAAM
FT                   IGVSRKAAGRLARHHGITPQSGRPPVDPAWLHDQYVTQRRTLRELGHETGRSVPQMSRI
FT                   AKDYGIPIRPPSEACRTGDAARRHRTSQ"
FT   CDS_pept        complement(120553..121005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55616"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC34"
FT                   /protein_id="BAH55616.1"
FT                   /translation="MTETSSPRTVADAREFLELTELTDIVFFETGARRKPDVEETPLSI
FT                   QIALRREELLLEVRCRATVSGSGGEYLADASAVFTLREPIEASDAIITEFVERVGVMSV
FT                   YPYLRESITQSGAKLGLDRPVLKLLRPGDIHITVEDSDGDESTDAT"
FT   CDS_pept        complement(121002..121598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55617"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC35"
FT                   /protein_id="BAH55617.1"
FT                   /translation="MSPTEFELIFVTPEVSGPGDTRIAAVEELLDIVVESHSGLTLATV
FT                   TAEGDDAVTAALDAAAVLSSRGLPVVRSYPDLVTRQDIADRAEVSRQAVGNWVRGDRMQ
FT                   SDPFPAPVNLVGGGAWLWGDVVAWLRRQDYKIDDIEFPSMDDHVRIDAALVGAPRRTPK
FT                   ISGHLEAKVGFAPAVVGISRDWAGDSFQSSYALAV"
FT   CDS_pept        complement(121650..121967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55618"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC36"
FT                   /protein_id="BAH55618.1"
FT                   /translation="MWAQARLGTRPRTRGRRMGEAWDEVSLKDARRSLDSEVYAVVEDL
FT                   VKNKGWRLREQGHKYAIYCPCTDGRANFITLPGTSRNPGNAAKRVKRSASRCPDRHELM
FT                   K"
FT   CDS_pept        122161..122478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55619"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC37"
FT                   /protein_id="BAH55619.1"
FT                   /translation="MNCDIKCLIHDGTEITASVAPQGLTPERGDSPTRVGDRVGTTQGG
FT                   IGMIGRSETYWQQRIHADRCSGGADLPPGGIPDDPVDLLENYRPTARCSAAARRPQHPD
FT                   L"
FT   CDS_pept        complement(122648..123799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55620"
FT                   /db_xref="GOA:C1BC38"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC38"
FT                   /protein_id="BAH55620.1"
FT                   /translation="MGTPARPHEQGGRRVVDVLVDTVADLDVHHIFGVDGANIEDLYDA
FT                   LFATDRPVQGVVAKHEFAAATMADGYARSTGGLGVVAATSGGGAMNLVAGLAESYTSKV
FT                   PVLALIGQPPTPLEGTGAFQDSSGRSGSIHAVRLFTEVSRYCARIERPDDLAAHLERAV
FT                   AAARDGGPAVLLLPKDIQQATVVGAFTFHPPPRRSGHDPDGLTRIRDQLVAARRTGKIV
FT                   LIAGDQVARDDAREPLLALAAAVDAAVGVAPDAKDVYPTDQPGFCGVAGTMGHTELIEA
FT                   VRHSALCLLIGTRMPATARTGLEAALAAVPVASLGAEPPYLPTTHATSRDLRHGLAALA
FT                   DMWSPRHTSDAVVHGGPSWTTRRIEVERRGWTMTPDPLCPNHT"
FT   CDS_pept        complement(123837..124547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55621"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC39"
FT                   /protein_id="BAH55621.1"
FT                   /translation="MSTDRAAPADTRMMGILHDALRRDLGRARTVLTAPTPPAQSQRIA
FT                   VADHLLWMMDYLRYHHRTEDENLWPLIRRLNPGAGTLLDRMDADHTHISPEIDRLCSAA
FT                   GAYRDDGSTDARQAVVVALDGLEAALLPHLRREEDEMMPVVSRTITVGHWEDWGRDIVK
FT                   DKPKLELAREVPWVLDGLDAEQYRLVAHVLPAPARVILLHALAGQYRRACAARWGPRVE
FT                   VTPLTSHHRERPRV"
FT   CDS_pept        complement(124544..124993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55622"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC40"
FT                   /protein_id="BAH55622.1"
FT                   /translation="MIVAEESVVIDRPIEEVFTFIQDPGNVTLFMTNVISYELVSGQAG
FT                   EVGSVVHGVVEVAGRQLEITEELTDIEQGKYLRRRGTDSPVPYETETLFESTDRGTRVT
FT                   YHQESGSLGGIFGALADGIVAKLYARDVRSNLEHARTLLEAGDPQ"
FT   CDS_pept        complement(125066..125866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55623"
FT                   /db_xref="InterPro:IPR033786"
FT                   /db_xref="InterPro:IPR040832"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC41"
FT                   /protein_id="BAH55623.1"
FT                   /translation="MRHHRMHRLLGLLLAACVTVAGCGAAAAGPEEIRTYFGSSQSVGH
FT                   GTVRIYTTVDTRGEPTAVGLRMSAAALEGLPDTSAMFMLGLPEQASATVFDHVMLNWNP
FT                   HGHEPEILFGKPHFDMHFYMTDMSSTMGIDPAAPEYAARAAHLPDGKYIPRDYITPPGP
FT                   LASELAVPLMGVHWMDATAGMIPGIYDFTQTFINGSWDGNYTFMEPMMTHAWLLTRPTI
FT                   QEPVKQPQAYQHTAYYPTTYSVRFDNTTGEYDIALGEMMLRQRS"
FT   CDS_pept        complement(125904..126359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55624"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC42"
FT                   /protein_id="BAH55624.1"
FT                   /translation="MSRTVHAEMVFPFDPEETWDFFADQGQHLVNLSKRVAAVRDYHIR
FT                   ADGTPRYSMVLRIGPLTVQGTSDYTVFDRPRRTVNAVLSEPFGGVYEMRFEPVVLGTRV
FT                   RIEWAVEATTRPGGLMLPMVAPLLARALRADLVTIARRACKESLCGP"
FT   CDS_pept        complement(126473..126835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01260"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55625"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC43"
FT                   /protein_id="BAH55625.1"
FT                   /translation="MSAANTHDSTLLQPMVSAIPAVKSRRGPRRRKPGKLRADKGYDYD
FT                   KHRRWLREERIVPRIARRGIERNDRLGRYRWKIERIIAWLTGYRRLTIRYERHAEHFAG
FT                   FLHLAAALTCFKKLPT"
FT   CDS_pept        complement(126922..127281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01270"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55626"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC44"
FT                   /protein_id="BAH55626.1"
FT                   /translation="MLDGLSLRLVPDALWEIVEPLIPRFAARPQGGGSAPLEDRAVFTA
FT                   IVYVLTSGCAWRHLPPSFGVTVPTAHRRFTAWAAAGVFERLHREVLDRLGSAGELDWTA
FT                   AILDAASVRAKKGDR"
FT   CDS_pept        127610..128140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55627"
FT                   /db_xref="GOA:C1BC45"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC45"
FT                   /protein_id="BAH55627.1"
FT                   /translation="MPDRSPTSTPIAPPNDATKAQLVQWALDRLNAQDVDSLRGSFWTA
FT                   DSTVHFPTGTCRGSAEIAAYFEQVFAAVTDFTFETVSIAESGDDVLVHWHLTGRHVGTF
FT                   VGIAATGRRIDFEGFDHFVVQDGKVVTNTVRYDQMEFARQIKLLPPDGSIADRALKAAF
FT                   NATTRVVGIVRRR"
FT   CDS_pept        complement(128262..129716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01290"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55628"
FT                   /db_xref="GOA:C1BC46"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC46"
FT                   /protein_id="BAH55628.1"
FT                   /translation="MVSESSTGGVPWSSGRAGPSVRLDVVARTSEEAQEYPIAPDAPMP
FT                   LFARVKALNKFHTGLEDIRDAGGPVTIVALGPKRLVPPFAVVTSPQGAHDVLGGSDGAF
FT                   DKELTVHAESRKWSGDNLFNITHEPWLSRRRTLQPLFTKKHVAIYASCMAGVAQTMAAE
FT                   WARSDQVDLDRETRRLTLRVLGQSLFGSDLGAQAEVLGPALDRAARFVSHRALQPVRAP
FT                   AWLPTPPRHRFRTAKDVVDTVIDEAITSAHDEPGRNAELIRLFFDTTDPQTGKPFTDRA
FT                   IRQELWAFLFAGHDTTATTLAYSLWALGRDRAIQDRVAAEVAALGDRPLHVDDVARIPY
FT                   TVQVVHEALRACPPAAAVGRRAMRDVAVDGYRIPAGTNVIVGIYALHHDPTLWGAPGRF
FT                   DPERFSPDRSAGRTRWQYLPFGGGPRTCIGDHFAMLEATLALAGILRTVQTESLGADFP
FT                   LVTPFTMVAGGPVPARIRARTPAPPI"
FT   CDS_pept        130535..131116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01300"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55629"
FT                   /db_xref="GOA:C1BC47"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC47"
FT                   /protein_id="BAH55629.1"
FT                   /translation="MTARAQSAAQTTERIMGATLELYREYWLDEITLERVAGRAGVSIK
FT                   TVQRKFGNRDGLLTATLRWIGREVTAQRFPVAAGDVDAAVENLMTHYEQWGPLGLRHVL
FT                   QAQRSPLIASIVARAQGLHHRWVEQVFAPYLDPLPAADRDLLFAQLAAGTDVLVWHVFR
FT                   NDLGMSAERTGQALLGMLRALLPDAPPEPT"
FT   CDS_pept        131388..132287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01310"
FT                   /product="putative glycosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55630"
FT                   /db_xref="GOA:C1BC48"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC48"
FT                   /protein_id="BAH55630.1"
FT                   /translation="MFTDPGPGIDLLDTVAAEPADVVVTDCLLYGALAAAERARLPRVT
FT                   LVHTFYEFMEAGARRGPAPVLARLKGQRPLRLWTSSDLVLVTTERELDPAGRRRRDLPP
FT                   AVHYTGVVPHRMPSALTWVGEREPLILVSLSSTNFRGQQQTLQRVLDALRGVPARTVVT
FT                   TGTSVDPTTLTAGPDAEIHGHLDHETILPDATLVIGHGGHDTTMRALAHDVPLIILPMH
FT                   PLLDQTMIGRTLDHRGAARCLPKKAPPDRIRAAVDTLLADGPHRAAAAGLGTRIRSHDG
FT                   SMAAADLIDHLPHRQVRR"
FT   CDS_pept        132971..134479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01320"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55631"
FT                   /db_xref="GOA:C1BC49"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC49"
FT                   /protein_id="BAH55631.1"
FT                   /translation="MTEDTRTTAPTVAPSGTFASLDPRSGTVLAEYPIADSVAVAAAVD
FT                   RARAAARWWHDQGFRGRRTMLLAFKRAVASDADALATLISAETGKPRGDAALEIMLAIE
FT                   HLDWAARHARKILRRKRVRSGLAAINQSASLGYQPLGVIGVIGPWNFPLYTPMGAISYA
FT                   LAAGNAVVFKPSELTPGVGTWLEQKWNSLDGTRPVLQVVTGLGETGTALARAGVDKIAF
FT                   TGSGTTARKVMTTCAETLTPLVAECGGKDAMVVAEDADLDKAAEAAAVGAFGNAGQVCA
FT                   GVERVYVVEPVYHRFLDKLAAAAIRVRPGGDDTATYGPMTLPRQVDIVRDHIADALTRG
FT                   GTAVVGGVGAVHERYIDPVILTDVPETSTAVREETFGPTVVVNKVGDLDEAVERANATA
FT                   YGLGASVFTRKRARGTALAHRLRSGAVSVNSVFSYGAIPALPFGGIGESGFGRVHGADG
FT                   LFEFSRAHALTVERYPAPLKLFALERAERDMRIATWMFRLRHAR"
FT   CDS_pept        134536..135105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55632"
FT                   /db_xref="GOA:C1BCN8"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN8"
FT                   /protein_id="BAH55632.1"
FT                   /translation="MNTEQPTPATTPTSPSDITSVAVRCMEMMADGDRATFEELVHPDA
FT                   INRESRTEPPDTRVIGPEGFYATALWLRGAFAELHHDVLHAVAADDLVVLDTVMTGRQV
FT                   GPFVTYDEHGRVDQAFAPTGKSFSVRQTHWLRFVDGRLIEHWAVRDDLGMAQQAGWIPP
FT                   TPAILIRNAFAKRRARKTTAAGTAFH"
FT   CDS_pept        135153..135548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01340"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55633"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC25"
FT                   /protein_id="BAH55633.1"
FT                   /translation="MADVVDRFEVLTDKQWELLALLLPSSDGLRGRKFRNNRVVVEGML
FT                   YRLRTGLPWRDLPSHFGPWKTVWKRHRRYAGDGTWDRVLTALVAMADAGGNLDWAVSVD
FT                   STVVRVHQHGANAARHTGGSTELHEPR"
FT   CDS_pept        135493..136062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01350"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55634"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC24"
FT                   /protein_id="BAH55634.1"
FT                   /translation="MRTPPATQGDLPNYTNLGDEPADHGIGRSRGGLTSKAHLACDGHG
FT                   RPLSVLVGPGQAGDSPMFAHVLEGICVPRLAGGAHRTRPDEVRADKAYSSRANRELLRS
FT                   RGIKAVIPEKTDQAANRVNKGRAGGRPPNFDPESYKGRNVVERAFNKAKQWRAVATRYD
FT                   KLALTYRAGFLLAGIVEWLKLLGDMP"
FT   CDS_pept        136106..137239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01360"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55635"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCP1"
FT                   /protein_id="BAH55635.1"
FT                   /translation="MVLDLVAAELEALHERISGRFARSEPRSRVREYVTGLVAGLERKN
FT                   GWTLAERAGEISPDGMQRLLRRADWDVDGVRDDVRDYVVERLGDPAGVLIVDDTGFLKK
FT                   GTRSAGVQRQYSGTAGRVENCQIGVFLAYASGAGHALIDRELYLPESWTSDRDRCRAAG
FT                   ITDDIEFATKPRLAQHMIERALDAQVPFSWVTADEAYGQVKYLRVWLEERDISYVLATR
FT                   CNDDVFTPHGRSGRADEMIAAVPAKQWRRISVGDGAHGRREYSWVRIPIRIAWAPGRGH
FT                   WLLARRSLSDPTEIAYYICAGPRRTTLTELATIAGSRWRVEECFQQAKNEAGLDQYQVR
FT                   TYRAWYAHITLSMLALTWLAGSKTEAIKGESGSKIRA"
FT   CDS_pept        138197..138658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55636"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCP2"
FT                   /protein_id="BAH55636.1"
FT                   /translation="MFIKQIAGFIGGGALVAASVAALIAAPANAVPGVNPPAPRFVSLS
FT                   YSLESTFAGSSNVVDTYAESVSQAYYHCDNLSGANDCQVVITSDWGCVTLVRGWTKESY
FT                   LGSPQGKPIFGVGNGPTREEAEQVATIDVEARLDATPYAVGHGVTKCVY"
FT   CDS_pept        complement(138913..139395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01380"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55637"
FT                   /db_xref="GOA:C1BCP3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCP3"
FT                   /protein_id="BAH55637.1"
FT                   /translation="MRCRSAMMTLRERTTQYGIIVNLPVDHTAESVKNAVIKAFSGLPK
FT                   RMRRTLTWDQGTEICLHREISAALDLKIYFAERSSPWQRGANENFNGLARQYFPKGTDL
FT                   SVHSHAHVRSVTRELNTRPRKNLEYATPATVFNAERRATAHRRRTALELAMPTAVT"
FT   CDS_pept        complement(139520..140254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01390"
FT                   /product="putative RNA-directed DNA polymerase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55638"
FT                   /db_xref="GOA:C1BCP4"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCP4"
FT                   /protein_id="BAH55638.1"
FT                   /translation="MLANIALSVLDAHFCAKWDSHGSAYRREVHRKRGGATYRIVRYAD
FT                   DFVIMVVGTKAHADALWDEVADVIAPLGLRLSAEKSRVCHLDEGFDFLGFRIQRRRRKG
FT                   TNKMSVYTYPSKKALLSIMAKVRALTKRARHHGLADLLGRLNPVLRGWCAYFRHGVSKA
FT                   TFGYLDAFAWHRVTQWLLKRHKRITWADLYRRFLTGRPGNRPQENGIIMFDTTTVPITR
FT                   YRWRASNIPTPWTSRAETLVPA"
FT   CDS_pept        141131..141454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01400"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55639"
FT                   /db_xref="GOA:C1BBV4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV4"
FT                   /protein_id="BAH55639.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYAAVAADVGVSGETLRTW
FT                   VRKDTARNARSQDRSTGADGTEADELARLRAENARLRGAEKEWQLEREILRRAAAYFAK
FT                   EVK"
FT   CDS_pept        141451..142134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01410"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55640"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV3"
FT                   /protein_id="BAH55640.1"
FT                   /translation="MKTRRWDFISDHRAEFGVQRLCRVLGTSRSGYYKHLITEPARVER
FT                   QAEEAATVAEIRAIHAEHRSAYGAPRVHAELRSRGRKINRKRVTRLMRIHHVVGRHLRR
FT                   SKRTTVADKSAPSVPDLVMRDFTATAVDTKWCGDITYIPVGSSWLFLLVTWNHAGGRLF
FT                   VPRCHHELRGPVDCVDDLGREVAGPVPARAGGRVVADLDRSGAGASHDRCVRSRPGRVP
FT                   ARLRA"
FT   CDS_pept        141980..143035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01420"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55641"
FT                   /db_xref="GOA:C1B684"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B684"
FT                   /protein_id="BAH55641.1"
FT                   /translation="MSMILEEKWPVLCRHERAAEWLQIWTDLGRAPRTIDAYARGLAEY
FT                   LLVCEREGVDPVVATRAQIALFVRDLRTRPSRRGTNVVALDSGSGLANATLQQRLVPVR
FT                   LFYDFLVEEGVRESNPVGRGRYTPGRHFGGQPRPLVPRMVKLPWIPGEAEWLQLLDVFR
FT                   LEPIRNRLMLALAYDSALRREELCSLRTDDLDPAHRMLRVRPETTKTRRGRVVPYSAAT
FT                   GVLLSGYLAHRAGISRARGPLFLSESRRNFGEPLSLWSWSKVVRRVALAADVPQFSTHT
FT                   TRHLCLTDLARMGWELHAIATFAGHRSTESTLTYIHLSGRDLAEKLNRAMTHLHAQRIS
FT                   MLTAPDGTGPA"
FT   CDS_pept        143032..145368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01430"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55642"
FT                   /db_xref="GOA:C1B685"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B685"
FT                   /protein_id="BAH55642.1"
FT                   /translation="MTAAVRAVGEADATWPASTFPVSLERYDRREELTDAERRALRDLS
FT                   PKALRRNRARGIPRRTATHWTALVRLVEPLDTARAGLHHGDDARFRRAGAHAAAIILQN
FT                   CADTGRSYWAWTSEDWAQLCGSSAEAFVAARELPTETTVRPFLVALAYLLGSFDAFQLL
FT                   GTFNRLHLARLVFGAEAIEESMRQASAVLDQWGYRGVFIGKHRLRGGLSQALLINRSSR
FT                   LEDLDTAAFDRLRVHPATNDHQGEMLYALQRAVAALGHCDPPVRTGDNPYAVIEGTTDS
FT                   WANWVARWHDTSTLTPRVRRTIRTILAKAGRWLAAEHPEITEPGQWTRQTSAAWVAAVD
FT                   RMTVGDYVQRRDHLRARTGDPISPRTKAHILMATRTFFRDCQEWEWIDRRFDPARALAL
FT                   PRSVSALIGTNPRVIADDVWAKLLWAGLNLDSSDLPGNSAHTYYPMELIRAITLTWLFG
FT                   GLRSDELSRLRVGCVRWQHDGQPIAADSPDVLAEDAVCLLEVPVHKTGTAFTKPVDPLL
FT                   GQALEAWQALRPPQPKTLDRKTSEQVDMLFAFRAHPVAKNYINRTIIPALCAKAGVPSS
FT                   DVRGNITSHRARSTIATQLYNAKEPMTLFELQAWLGHRTPNTTQHYAKITPNTLSKAYN
FT                   EAGYFARNVRTIEVLVDRDAVTSGGAATGQPWQHYDLGHGWCSYTFFEQCQHRMACARC
FT                   DFYTPKDSSKAQLLEASGNLQRMLTSIPLTDDERAAVDDGHTAVAALLERLTDLPTPAG
FT                   PTPREIGTSPTVTLLPIVQVRHGEP"
FT   CDS_pept        145396..145665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01440"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55643"
FT                   /db_xref="GOA:C1BCP9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCP9"
FT                   /protein_id="BAH55643.1"
FT                   /translation="MATVIDIFSRRVVGWSIADHMRTDLVTDAIEMAVRTRGGDVGGVI
FT                   FHSDRGSQGGFNRSSQHRAVRTSVPVRQTLPLEFSNRALFGGGC"
FT   CDS_pept        complement(145562..146962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01450"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55644"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55644.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        146978..147298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01460"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55645"
FT                   /db_xref="GOA:C1BCE0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE0"
FT                   /protein_id="BAH55645.1"
FT                   /translation="MLLPPVEPGQYTAAAFVDVCRRHGIQLSRGRVGSSYDNALAESFF
FT                   QGLKREWLHGRSWTSKSQARLDLFEWLSYFNRRRRHSALGYLTPVEFEQRLIASSTLSV
FT                   AA"
FT   CDS_pept        complement(147328..147870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55646"
FT                   /db_xref="GOA:C1BCQ2"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ2"
FT                   /protein_id="BAH55646.1"
FT                   /translation="MPQHGAALTRRAATPHPTPVNRRTPPTTPHRYMPSPRIREGYDLG
FT                   VTSAEGKHVFISYVKEDQQQVDQLCKILDAAQIPYWRDRTSLAPGDNWKAKIRDAIRSG
FT                   ALIFLACFSDNSRARPKTVMNEELTLAVEEFRQMAPGVTWLIPVRFDDGKIPGWDLGAG
FT                   RVLGDLNYVDLFGANYT"
FT   CDS_pept        complement(148080..148718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55647"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ3"
FT                   /protein_id="BAH55647.1"
FT                   /translation="MEDILSVYARPHDPSRPVVCMDENPYQLLAHAHDPIPAGPGRDLK
FT                   EDSEYVRHGTCSIFCWVEPLAGWRRVDSQPRRTKVDWAGQVKDLLCVDYPDAETVLLVM
FT                   DNLRHPRHRIALRGLRAGRGVRARAAAQDPPHPQTRLVAQHRRDRALRADPPVPGPAHR
FT                   GPRNPQRRTRRLATTDQRRSTPGPVALHHRRRPHQTPPPISQHLAATVY"
FT   CDS_pept        complement(148769..148975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55648"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ4"
FT                   /protein_id="BAH55648.1"
FT                   /translation="MTSHRCRREITGEIEARLIALACSKPPEGRSRWSLRLLEKHVALV
FT                   DDIPDLDHSTIGRVLKKRNFVLT"
FT   CDS_pept        complement(148938..149147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55649"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ5"
FT                   /protein_id="BAH55649.1"
FT                   /translation="MIRRARVLLALDTSVGVVDEKEVIAARLEVSGETLRLVANRFAET
FT                   GRDVEATIGRKQRDLPPVPSGDHW"
FT   CDS_pept        complement(149333..149821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55650"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ6"
FT                   /protein_id="BAH55650.1"
FT                   /translation="MFKFFRRRSATARDQPGVEQSVESASPADLARLRLFASEFAVSGP
FT                   FVDPDSDEHDLWQAGKLVPWYISHLLDNGRHSGPTVDIACHAEEPTVDLWEAGQAYPTW
FT                   DQTIALAQLLDVRVRDLTHPDARPRHHPNRPQRRRRDLAILSFEPSAVHAATECRTIL"
FT   CDS_pept        150109..150456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01520"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55651"
FT                   /db_xref="GOA:C1BCQ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ7"
FT                   /protein_id="BAH55651.1"
FT                   /translation="MTMAGITGAVRGRHRIVTTRSDDTAPRHPALIGRAWSTPTHPAQW
FT                   WVADFTYTWTLSGFCYTAFCVDVFSRRILGWRVMTSKSTPLVTSVLEQVLFTRRRHDFH
FT                   FTATGLVHHSD"
FT   CDS_pept        150961..151227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01530"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55652"
FT                   /db_xref="GOA:C1BCQ8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ8"
FT                   /protein_id="BAH55652.1"
FT                   /translation="MLQEAGIVGSIGSVGDALDNGLMESAIGLYKTELLGRHPILKGRA
FT                   ELERETAAWVHWYNNSRLSALDYLTPVEYEDRYHQQTTSSEVA"
FT   CDS_pept        151296..151541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55653"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCQ9"
FT                   /protein_id="BAH55653.1"
FT                   /translation="MRHAFPHNTNDPNGYIVADRGGRLHGLRNRVSHMEPLLGVNITAR
FT                   HNDALRILAAISPEVRDCCAGMSTVIEIRRKCPIRL"
FT   CDS_pept        complement(152219..152689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01550"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55654"
FT                   /db_xref="GOA:C1BCR0"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR0"
FT                   /protein_id="BAH55654.1"
FT                   /translation="MSTVNGLPVHVLLVHFMVVLAPMTAVLVMLCSVWPTARHRLVWPT
FT                   LVLAAVTTALTPLTTDAGQWLEKNVTDTAAVDAHTERGDTMIYFSAALLLIALAITAVH
FT                   LRERKAGPSRPLTWIVAILAIVVAASTIVQVYRIGESGSRAAWGDVVPGEAP"
FT   CDS_pept        complement(152757..153488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01560"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55655"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR1"
FT                   /protein_id="BAH55655.1"
FT                   /translation="MTPEVSRMPKSTIGQRNWPGLTGALSLPSDRPRPEKWSYGAARLP
FT                   FAIAPAVHGALLEAARTHHTGLFTALHAAVTLLLARLSGATDIAIGAPVAGHGHPSLDD
FT                   VVGMFVNTVVLRTQVESTTTFDDLVARCSGHRVAGVRARGCAVRAPGGDPRSRTVTVVA
FT                   PVLPGRDLARKLRPRRTRCRRTHFDITPSPLDIAKCDPHFYFTERHDGTGAPDGIDAKL
FT                   VYSTDLFNKGLRAVLSTRSEL"
FT   CDS_pept        complement(153485..154759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01570"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55656"
FT                   /db_xref="GOA:C1BCR2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR2"
FT                   /protein_id="BAH55656.1"
FT                   /translation="MHLSGAGLARGYHLRPGLTAATFVANPFGEPGSRMFRSGDHIRWS
FT                   TNSEFEFLGRADDQVKIRGLRIELGEIDAALSDHPDITFAAPWCIAGPPGIRCSSRMYC
FT                   RASPRRSTSSSSMHESGGSSPITWSPRQSCSWTRYPCPPPASSTVRRCPIPPSRTAHGL
FT                   DEIPRHRPNTPSPTCSQVLGASAVGADSSFFDLGGDSLSATRVVSRINDRWGTDLGGRD
FT                   VFDAPTVAALATRIGESTRDTDRHRLGAIPLPDRLPLSPAQTFIDRTVTAPAHYNIPFT
FT                   LRVRGAFDHTALRRAVADVLERHRPLRTIYPDTPAGPYQHLLADAVPDPRRRRNIRAVL
FT                   TAGFDVRTHPPLRIRVFEFGPDDHMIACTFHHIGVDGWSLAPLARDLVLAYSARADDSA
FT                   PQWQDLPVQYADYTLWRRAVLGQRG"
FT   CDS_pept        complement(154870..155442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01580"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55657"
FT                   /db_xref="GOA:C1BCR3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR3"
FT                   /protein_id="BAH55657.1"
FT                   /translation="MIDYPTHSNGLRSTPRNCAVISDPDPYTTSNAHTPSAATTPPTSS
FT                   TPPVPPAPRRWCVVTHAGLANLAQEIREKYGISTASRLLHLASPTFDTALVEILAAANA
FT                   GATLVVAPATAFGGRELAKFLWEHHITHLLATPSSLATVDPAGLDELQLVLVGGEPCPP
FT                   PLVRRWAQGRDMRNAYGLPPKPRAVSP"
FT   CDS_pept        complement(154922..155716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01590"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55658"
FT                   /db_xref="GOA:C1BCR4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR4"
FT                   /protein_id="BAH55658.1"
FT                   /translation="MALRADERALTYVELDRRSSRVARALISRGTGPETLVAVADSRSI
FT                   ESVVGLWAVVKSGAAFVPIDPCHPADRITYTVADSGAAIGLAVSQARDRLPDSLKWLAL
FT                   DSEELCGDQRSGPVHDLERTHSLRRDHPAYVIYTSGSTGTPKVVRRHPRRTGEPRSRDS
FT                   REIRYLHSVPSPAPRFTDVRHRPGRDTGRRQCRRHPGRGPRNRLRRSGTGQVPVGTPHH
FT                   PSAGYPFLPGDRRPGRSRRVAIGAGRRRTVPAPAGPTLGPRP"
FT   CDS_pept        complement(155686..156363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01600"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55659"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR5"
FT                   /protein_id="BAH55659.1"
FT                   /translation="MIVSAFAAFLALMTGAENILLSLPVSARTSALLRNSAGSVSNMLP
FT                   LRRRRVRSSTVGEAMKPTQAALTAALRHQRYRREDIGRDRHSGAAASAPSDPAPFGPVI
FT                   NLMMFTQQISFGGVTGQVQVLTTGPTSELAINVYPGSIGSLPRIDFEGNSTAYSHDKLG
FT                   AHHRWFIAFLDTFAAADSSTAIADLGLFLPGERTGFVPASGAADCPPSSIPKRWRCEQT
FT                   NGR"
FT   CDS_pept        complement(156360..156800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01610"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55660"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR6"
FT                   /protein_id="BAH55660.1"
FT                   /translation="MKWMRRDRKISLDMYDEHLVVSHILRLTDSRCFWYSRAHHIALDG
FT                   YGAMTLIGRTAELYVAALEQREAPAHPVVHPGQLLDEDLRYQQSDQRRRDRDFWVGETA
FT                   DLPDAVTLGRSSTPGAAAHRVSGAVSARGNALVDRGGSVRRR"
FT   CDS_pept        complement(157517..157777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55661"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR7"
FT                   /protein_id="BAH55661.1"
FT                   /translation="MLLRLPGVYPPQADTWLLAQVLASQKLGPRSRVLDLCTGTGALSL
FT                   GALAAGAGRVTAVDLSRRARLNTRLNAAMHRRSIRVVRAAT"
FT   CDS_pept        complement(158146..158445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55662"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR8"
FT                   /protein_id="BAH55662.1"
FT                   /translation="MRTRFADSIDGLTGGLAATCALTVTAVSDATNALLDADLTLAERV
FT                   IDASGALENDATTWEQRAFSLLPLQAPVAHDLRVMVGGLVLSATYDAWVDSPCT"
FT   CDS_pept        complement(158697..158957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01640"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55663"
FT                   /db_xref="GOA:C1BCR9"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCR9"
FT                   /protein_id="BAH55663.1"
FT                   /translation="MASLVFFWPLAFSAFNHAFDVYPRWASGDVEGAVDASRRVRRLGQ
FT                   LSLWIAGGLLLLAVILYTILAIVLIAQGGDGDHEWGREMRG"
FT   CDS_pept        complement(159371..160132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01650"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55664"
FT                   /db_xref="GOA:C1BCS0"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCS0"
FT                   /protein_id="BAH55664.1"
FT                   /translation="MKKLPQITAIFWVMKIAATTLGETGGDLLAQTLNIGYAAASVLFI
FT                   GLFLVSLVTQLKAKTFHPALYWTVIVATSTAGTTMSDFLNRSAGLGYAKGALILITCLA
FT                   CVFAIWSRFGDTFDVERICTFRGELLYWTAILFSNTLGTSLGDFLADSSGLGFAGGALL
FT                   IGTVMALILGAHYFTTSSGTVLFWAAFVLTRPLGATVGDLFSKPHDKGGLALGTVGSSA
FT                   VLAVILLALIVYTHIRHQETVADREPVHERS"
FT   CDS_pept        complement(160053..160925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01660"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55665"
FT                   /db_xref="GOA:C1BCS1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCS1"
FT                   /protein_id="BAH55665.1"
FT                   /translation="MPTLLGALGLLGVLGAVFVESGLLVGFFLPGDSLLFTAGVFAAQL
FT                   QPFAPLWVPVIAIPVAAILGDQVGYLIGRRVGPAVFDSPSATRLGPKQLEQSRRFFDRY
FT                   GPRTVLLARFVPVARTIAPVMAGASGMRYRTFVTYNVIGGVLWGTGVPVLGYLLGGIPI
FT                   VRNHIEVILIAVVVVSLVPLLINAVRTRRRRDSVGAAAHNHPGRVGEPRRHPSVDQFDL
FT                   HHPTSTEPWGHRRCMNDQHSCCRTTHRASVPVTVAAHSDWSNHEETPPDHRHLLGDEDR
FT                   RHHARRNRW"
FT   CDS_pept        161463..162221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55666"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCS2"
FT                   /protein_id="BAH55666.1"
FT                   /translation="MTSTKDRPVHPPTSPPPRRRAGRRTARRIVGVAVTTMVLAAAMSY
FT                   AQALLAPGYATWQDKSSSWLRDHGAAPLLNLYENWLYTRHPPSNAQPDLSQLAPSLHVP
FT                   GVPGRDAAAATGPAAAAAPGKHATGHVVTGSCRPGRHALVLYRGVPTRCRAPRRGRRCA
FT                   ADLCARGDAHLMEGTEQPSSSPNPADARVPVGDAVVGCRVQLGFQAERHSWWLPLERDP
FT                   GAATGRRTSIGGHRRLRLPLGSGHRISCGD"
FT   CDS_pept        complement(162207..162527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01680"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55667"
FT                   /db_xref="GOA:C1BCE0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE0"
FT                   /protein_id="BAH55667.1"
FT                   /translation="MLLPPVEPGQYTAAAFVDVCRRHGIQLSRGRVGSSYDNALAESFF
FT                   QGLKREWLHGRSWTSKSQARLDLFEWLSYFNRRRRHSALGYLTPVEFEQRLIASSTLSV
FT                   AA"
FT   CDS_pept        162543..163943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01690"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55668"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55668.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        complement(163840..164100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01700"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55669"
FT                   /db_xref="GOA:C1BCE2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE2"
FT                   /protein_id="BAH55669.1"
FT                   /translation="MIDIFSRRVVGWSIADHMRTDLVTDAIEMSVRTRGGDVGGVIFHS
FT                   DRGSQGGFNRSSQHRAVRTSVPVRQTLPLEFSNRALFGGGC"
FT   CDS_pept        164181..165236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01710"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55670"
FT                   /db_xref="GOA:C1B684"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B684"
FT                   /protein_id="BAH55670.1"
FT                   /translation="MSMILEEKWPVLCRHERAAEWLQIWTDLGRAPRTIDAYARGLAEY
FT                   LLVCEREGVDPVVATRAQIALFVRDLRTRPSRRGTNVVALDSGSGLANATLQQRLVPVR
FT                   LFYDFLVEEGVRESNPVGRGRYTPGRHFGGQPRPLVPRMVKLPWIPGEAEWLQLLDVFR
FT                   LEPIRNRLMLALAYDSALRREELCSLRTDDLDPAHRMLRVRPETTKTRRGRVVPYSAAT
FT                   GVLLSGYLAHRAGISRARGPLFLSESRRNFGEPLSLWSWSKVVRRVALAADVPQFSTHT
FT                   TRHLCLTDLARMGWELHAIATFAGHRSTESTLTYIHLSGRDLAEKLNRAMTHLHAQRIS
FT                   MLTAPDGTGPA"
FT   CDS_pept        165233..167569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01720"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55671"
FT                   /db_xref="GOA:C1B685"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B685"
FT                   /protein_id="BAH55671.1"
FT                   /translation="MTAAVRAVGEADATWPASTFPVSLERYDRREELTDAERRALRDLS
FT                   PKALRRNRARGIPRRTATHWTALVRLVEPLDTARAGLHHGDDARFRRAGAHAAAIILQN
FT                   CADTGRSYWAWTSEDWAQLCGSSAEAFVAARELPTETTVRPFLVALAYLLGSFDAFQLL
FT                   GTFNRLHLARLVFGAEAIEESMRQASAVLDQWGYRGVFIGKHRLRGGLSQALLINRSSR
FT                   LEDLDTAAFDRLRVHPATNDHQGEMLYALQRAVAALGHCDPPVRTGDNPYAVIEGTTDS
FT                   WANWVARWHDTSTLTPRVRRTIRTILAKAGRWLAAEHPEITEPGQWTRQTSAAWVAAVD
FT                   RMTVGDYVQRRDHLRARTGDPISPRTKAHILMATRTFFRDCQEWEWIDRRFDPARALAL
FT                   PRSVSALIGTNPRVIADDVWAKLLWAGLNLDSSDLPGNSAHTYYPMELIRAITLTWLFG
FT                   GLRSDELSRLRVGCVRWQHDGQPIAADSPDVLAEDAVCLLEVPVHKTGTAFTKPVDPLL
FT                   GQALEAWQALRPPQPKTLDRKTSEQVDMLFAFRAHPVAKNYINRTIIPALCAKAGVPSS
FT                   DVRGNITSHRARSTIATQLYNAKEPMTLFELQAWLGHRTPNTTQHYAKITPNTLSKAYN
FT                   EAGYFARNVRTIEVLVDRDAVTSGGAATGQPWQHYDLGHGWCSYTFFEQCQHRMACARC
FT                   DFYTPKDSSKAQLLEASGNLQRMLTSIPLTDDERAAVDDGHTAVAALLERLTDLPTPAG
FT                   PTPREIGTSPTVTLLPIVQVRHGEP"
FT   CDS_pept        complement(167320..168054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01730"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55672"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE5"
FT                   /protein_id="BAH55672.1"
FT                   /translation="MKTRRWDFISDHRAEFGVQRLCRVLGTSRSGYYKHLITEPARVER
FT                   QAEEAATVAEIRAIHAEHRSAYGAPRVHAELRSRGRKINRKRVTRLMRIHHVVGRHLRR
FT                   SKRTTVADKSAPSVPDLVMRDFTATAVDTKWCGDITYIPVGSSWLFLAIMWNQDCQVHQ
FT                   GSPCRTCTIGSRVTVGDVPISRGVGPAGVGRSVRRSSSAATAVCPSSTAARSSSVSGML
FT                   VSMRCRLPLASSSWALLESFGV"
FT   CDS_pept        complement(168051..168374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01740"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55673"
FT                   /db_xref="GOA:C1BBV4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV4"
FT                   /protein_id="BAH55673.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYAAVAADVGVSGETLRTW
FT                   VRKDTARNARSQDRSTGADGTEADELARLRAENARLRGAEKEWQLEREILRRAAAYFAK
FT                   EVK"
FT   CDS_pept        complement(168438..168677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55674"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT0"
FT                   /protein_id="BAH55674.1"
FT                   /translation="MACALVIAERVGKSVRSPAKDTLLSHATAATGRGRGRGFAVHEAL
FT                   DQIDYEGEVLPDRDHVVVYAGIPAHWPIVMCPPS"
FT   CDS_pept        complement(168712..169068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55675"
FT                   /db_xref="GOA:C1BCT1"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT1"
FT                   /protein_id="BAH55675.1"
FT                   /translation="MTPSEPADRSSNARRGSHAPVPKPVRTVGIAGRVRRPMGALRVVF
FT                   AFGTISLLTDVGYEGALSITGPLLASLGATAFVVGIVTGVGEAARQCCGWSPGRWSTAP
FT                   KSLRRGPSPDTRSP"
FT   CDS_pept        complement(169069..169605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55676"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT2"
FT                   /protein_id="BAH55676.1"
FT                   /translation="MTQNNHNHPAPRETLRDWRTPLRVDGPPAPTPAVCHLVVGFDRHP
FT                   ASHAALTYAMDLAGRLTAFVHVAHIVDIDDIPIEPDRDDWEQRFADAVEQERTEASAML
FT                   AALPGNWAYYSREGNPAQLLTTIAEANDALMIIIGTSRGGAMSLMERFLGESVSSKLVH
FT                   HAHRPVLLVPVPPGA"
FT   CDS_pept        complement(169630..169995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01780"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55677"
FT                   /db_xref="GOA:C1BCT3"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT3"
FT                   /protein_id="BAH55677.1"
FT                   /translation="MMVWWIACAGSVGAIARFVVDGAIKHRRSVEFPWATAAINVTGSL
FT                   LLGFVVGLVLFHGVPREVQLIVGVGFCGGYTTFSTASFETVRLIHRGRYAAGVTNAVGT
FT                   LLVTVAAGAAGLALAGI"
FT   CDS_pept        complement(169992..170516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01790"
FT                   /product="CrcB protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55678"
FT                   /db_xref="GOA:C1BCT4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT4"
FT                   /protein_id="BAH55678.1"
FT                   /translation="MAPFPFRGRSVPVDGRRDPNPTLPVDPDTAPRTPGPLHVRPAAIA
FT                   AVGGGGLLGAPLRYQLGVWFPQAAGGWPVTTFVINVAGAFLLGLVLEALTRLGPDTAWR
FT                   QRVRLGVGTGVLGSFTTYSTLAVDADLLLRGHQWWAAGSYAAGTVLAGMVATIAGIAVG
FT                   EQVRSRREEQR"
FT   CDS_pept        170749..171654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="ROP_pROB01-01800"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55679"
FT                   /db_xref="GOA:C1BCT5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT5"
FT                   /protein_id="BAH55679.1"
FT                   /translation="MTSTVDVLAYIPSPPQGVWYVGPVALRAYALFIIVGIVVAIVWGD
FT                   RRWVARGGEKGTVLDIAIWAVPFGLIGGRLYHVMTDWPTYFGEGGDPVDALKVWQGGLG
FT                   IWGAVALGGVGAWIGCRRRGIPLPALGDAVAPAILLAQAIGRLGNYFNQELYGRETDVP
FT                   WGLEIFERRNDLGQVSPQLIDGVSTGEVAFVVHPTFLYEALWNVLIVLLLVWVDRRFRI
FT                   GHGRLFALYVAGYCAGRFAVELMRSDYASLIAGIRVNSFTSGLVFVAALVYFFAATKGR
FT                   EDPAELQSTHGDAANTRQPE"
FT   CDS_pept        complement(172192..173628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01810"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55680"
FT                   /db_xref="GOA:C1BCT6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT6"
FT                   /protein_id="BAH55680.1"
FT                   /translation="MEPMDGIWPLLHPRRWGLRIRSAIIAGVVVAVAVGFAAIALTLVL
FT                   YRSMISASDDAAAARIQEVSAQLRLDTPDELDAATVSVNPRVTLVQVIDPQGRVVRSSA
FT                   AGPTEPVTAVRPPEGALVHGARPAPRTDGLRVSAYTTTGVGGRYTVVVATSVENIENTI
FT                   KTVAVLVALGAPFIVAVAALATYALIGRSLRSVEKIRTRVAAISSSDLAERVPVPTQHD
FT                   EIAALAETMNAMLSRIESGQHAQRRFVADASHELRSPLSTVTTALEIGRDRPELLDTAL
FT                   VEHTLLPEAARMHHLIDDLLLLARADEHGLPLRIVDVDIDDVVASEVHRKRAEGGATFS
FT                   CVLEPVQVRGDATQISRVVRNLVDNAARYATTTVRVRVSSDSVTARIEVSDDGPGIPET
FT                   ERDRVFERFFRLQRDRARGSGGSGLGLAIVAEIVTAHHGTVHIDTNPDGGATAIVHLPV
FT                   RGTTPHSTKKPELPEPGYTD"
FT   CDS_pept        complement(173690..174016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55681"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT7"
FT                   /protein_id="BAH55681.1"
FT                   /translation="MNLKGKLIATAAAVSAAAAIGGGIAAANTAQPPPNPPSVVDTPEP
FT                   GDVPDACGTVDNDNIQEGDQTGPEVPDTPECDTPGAVDNDNIQQGDQTGPEVPDAPGMH
FT                   TPGR"
FT   CDS_pept        complement(174138..175856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01830"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55682"
FT                   /db_xref="GOA:C1BCT8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT8"
FT                   /protein_id="BAH55682.1"
FT                   /translation="MLRARGASRRQLLRLAAVEAVTVGVGGSAVGLAAAAAVGVMLFGS
FT                   ARFGATATSALAWSGAAVATGLAVAAAAILMPARRDLRALTVTAGRATLTAGRSPRWAR
FT                   AGLDIGLLAAAGVLFWSTSRNNYQLVLAPEGVPTISVSYWAFTAPALLWVGAALLIWRL
FT                   ADLILGGGRRIVGTALRPLAGPLAPTVANSISRQRHSLARGIVLLALALAFAISTATFN
FT                   ATYRAQAEVDAHLTNGADVTVTESPGNPVPPDAATALSAVPGVRAVEPIQHRFAYIGAD
FT                   LQDLYGVNPSTITTVTALQNSYFQGGTAAELMNQLAVHPDSVLVSAETVKDFQLAPGDT
FT                   LNLRLPDSRTHQLVPVPFLYVGVVTEFPTAPKDSFFVANGDYIAQQTGNNSVGAFLVDT
FT                   AGRETTAVADRIRAVVGTSATVTDITTTRATVGSSLTSVNLAGLTRIELGYGVVVAAAA
FT                   GALVLALGLAERRRGFAIASALGAQPRHLRAFVVAEAAVLVVGGLAAGGLLGAVLSQML
FT                   VKILTGVFDPPPESLTVPWGYLGAVTATVVVVTAVVATTTSRIARRSPLTVLREL"
FT   CDS_pept        complement(175766..176797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55683"
FT                   /db_xref="GOA:C1BCT9"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCT9"
FT                   /protein_id="BAH55683.1"
FT                   /translation="MIGIWVRGLLRRRRARLAATVGGIGAAVALLAGIGIFLTTAQGSM
FT                   TVRAAGTVAVDWQVEVRSATTPSAVLDLVRATSGVTAAVPVGFAQTNGFTATGGGSTQT
FT                   TGPGMVLGLPEGYRTDFPGAVRTLAGAGGGVLVAQQTAANLHVKPGDTVEVGRAGLPTV
FT                   PVVVDGVVDLPQADSLFQKVGAPPGAQPVAPPDNVLLLDQARWHVLFDPLAALRPDLVG
FT                   TQIHAVLDHALPADPASAYREVTAAAHNLEARSVGGALVGDNLGASLGAARSDAAYAQV
FT                   LFLFLGLPAAILAGLFTAGSSTPGGGDAARSRRCCAPAGPRAGNFCAWPPSRRSPSGSG
FT                   AAR"
FT   CDS_pept        complement(176794..177504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01850"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55684"
FT                   /db_xref="GOA:C1BCU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU0"
FT                   /protein_id="BAH55684.1"
FT                   /translation="MVVEGTALGRTYGAGPNAVIALREASFELPGSARIALMGPSGSGK
FT                   TTLLHLIAGLDTPTTGSLRWPALPDLRRGRAASVGVVFQGPSLLPALNVIENVALPLLF
FT                   AGQSADRARARARRALEVLSIGDLADKVPDELSGGQAQRVAIARVLAARPALILADEPT
FT                   GQLDHDTARTTLSVLLDTAEAIDAAVLVSTHDPVVAGLLTGRWTMRDGRLDTGARSGTE
FT                   PPGLGPPETGGGAR"
FT   CDS_pept        complement(177549..178232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01860"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55685"
FT                   /db_xref="GOA:C1BCU1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU1"
FT                   /protein_id="BAH55685.1"
FT                   /translation="MSTGSPSGPPALRARTLYRFYRAGEEETLALQGVSLTVGRGEFVA
FT                   VVGPSGSGKSTLLACLAGMDDPDGGSVHIDGRRISHQPEPVRARIRARHVGMLFQNANL
FT                   LEHLTVAENLTLVRGLARRRTRTSGAALLDSLAVGHRAPAYPSQLSGGELARAGLAIAL
FT                   ANEPTVLIADEPTGELDSVTESGVLDLLAAAAEGGTAIVVASHSPAVAVAAARVITLED
FT                   GRVRR"
FT   CDS_pept        complement(178237..178854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55686"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU2"
FT                   /protein_id="BAH55686.1"
FT                   /translation="MKHIGNRAGTALRTGLLAVVLVMVTVSCSQNPPPISPGQSTAPNA
FT                   TAPESNPAGDIPDNQVYVPFTPAGDRFTISVPEGWSRSTAGTETVFTDKYNTVRVQAGD
FT                   RAAAPTVESVISQELPGIAAGTPGYRAGTVTAVQRRAGQAVLITYQAASAPNPVTGKSV
FT                   TEAVERYQFWHNGTEVVVTLSGPQGTDNVDPWRTITDSLQWP"
FT   CDS_pept        complement(179122..180063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01880"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55687"
FT                   /db_xref="GOA:C1BCU3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU3"
FT                   /protein_id="BAH55687.1"
FT                   /translation="MPGMRDAIDLVINEVRTEAATAEIAIWMLTVGVLAYTVALGAERW
FT                   NRRRGDSTVTTVCGWGAVRVAALLLMFTLLAVQVRLSGWVTGADTATLDWFVAHRSPGV
FT                   TAAAVVITDAASPVGVALVAVVTAALVSWRRRSWEPGVLVVGIVAVAAAASTIVKMIVA
FT                   RSRPPTASQLVTETDWSFPSGHVTGIVALAGALLIVTGAGLPGRARGALAGTLAVLVVV
FT                   VVAATRLYLGVHWLTDVLGGALLGGAVVAAGSCAVTALAARRPPGRAAEVTGAPAVPIS
FT                   AVQISGIEDGRPSDTPPMPHPVADEHRPISTG"
FT   CDS_pept        180165..180839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01890"
FT                   /product="putative OmpR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55688"
FT                   /db_xref="GOA:C1BCU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU4"
FT                   /protein_id="BAH55688.1"
FT                   /translation="MRILLVEDEARLAETVRRGLTAEGFVVDVAREGCDGLEQAVTGDF
FT                   DVVVLDIMLPGMHGYQILRELRARQVWTPVLMLSAKDGEYDQADAFDLGADDYLTKPFS
FT                   FVILVARLRALLRRGAPERPAILTAGNLALDPARRRVSRGEDVLALTPREYGVLEFLLR
FT                   NKGDVVSKAEILRSVWDSNYDGDDNVVEVYIGYLRRKIDAPFGMATIETVRGVGYRLLD
FT                   AQ"
FT   CDS_pept        complement(180847..181332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01900"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55689"
FT                   /db_xref="GOA:C1BCU5"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU5"
FT                   /protein_id="BAH55689.1"
FT                   /translation="MNHIARFVEEVVEVFHSRIVDEGKLGAFVVLASFLVSFVGVRVIT
FT                   HAVRRGSRFVRNVRVGGTHVHHLVPGIVLLLVTGYLAFAFGYGDHPVVAALFGVGAALT
FT                   LDEFALWLNLRDVYWERAGRRSVHVVLSAAATGALVVIGLDFWEAVLRAFARLIQRV"
FT   CDS_pept        complement(181617..181862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55690"
FT                   /db_xref="GOA:C1BCU6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU6"
FT                   /protein_id="BAH55690.1"
FT                   /translation="MRRPPAASDRRRAQSPFRRCIGAVILLSVVGTLIPDNPDRSLEAT
FT                   TMIFGIALIAAFVLGYASERTLSIHSIDTTGREGFY"
FT   CDS_pept        complement(181899..183188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01920"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55691"
FT                   /db_xref="GOA:C1BCU7"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU7"
FT                   /protein_id="BAH55691.1"
FT                   /translation="MFSHVALRSDVVDEATRSETIKAQRAMLSKVPEITVWFWVIKILC
FT                   TTVGESFADWINMTLGFGLNTTALTFTVILAAVLGWQLRLSRYEPFVYWLTVVVLSVTG
FT                   TLYTDILTDVLGIPLALSTSVFAAALTIVFAVWFVRERTLSIHSIVTVPRELFYWLAVL
FT                   ITFALGTAAGDWTLDLTGWGPGVSVLLPAGLIVLIVIGWRLGANAVLSFWLAYILTRPL
FT                   GANLGDWLASPSTDHGLGLGTALTSAIFLTAILATVVYLTLTRSDVIEEHEQTHTTTIT
FT                   THPTRERIMLGYYVAVAVATGALLIWAAGQPHATAASDEETGTTPVITTLTPGQVSAHF
FT                   PPTEIAQFRTIAEDTLGKVQAGDQADATARIKDLETAWDDDETTLRPLDETTWTVLDGQ
FT                   IDSVLHALRASKPDTATETQTLTALLTALR"
FT   CDS_pept        complement(183919..184308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55692"
FT                   /db_xref="GOA:C1BCU8"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU8"
FT                   /protein_id="BAH55692.1"
FT                   /translation="MEVAMVNPSSEPAPDERPTRTEPARDPTDGQSVRARPSSNAGWAV
FT                   VSVLFFWPLAFSAFHHAFEVYPRWAEGDLDGAEYASRRVRKLGQLSLWIFGGLLLLAIV
FT                   LYAIAAIVLIANGGDGGEWHDHMRE"
FT   CDS_pept        184830..185675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01940"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55693"
FT                   /db_xref="GOA:C1BCU9"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCU9"
FT                   /protein_id="BAH55693.1"
FT                   /translation="MMRKLPHITLTFWMLKIVATTFGETGGDLLAQTLEVGYLVSTLVF
FT                   FAMFLVAVVVQLRARKFHPAIYWTVIALTSTAGTTLSDLMNRTGGIGYTKGAILLTSCL
FT                   AVVFVVWWRSGQTLDVENVASFKGEVLYWIAILFSNSLGTSSGDFLADDLGIGFRDSAV
FT                   VLSAVMLLLLAAHYFTRINAMLLFWIAFVLTRPLGATAGDSLSKPIEKGGLNWGTMWTS
FT                   AALLAAMVGLIIYQAIHLRHHPLDPLPAPIDRRTGDRQKPNGALVPEDRAERVTAEGSA
FT                   "
FT   CDS_pept        complement(186244..187560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01950"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55694"
FT                   /db_xref="GOA:C1BCV0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV0"
FT                   /protein_id="BAH55694.1"
FT                   /translation="MLSELTGWSLLSGPIRAALTVAVVIGLGVLLLRRGRRWLLVGVPL
FT                   AGCGAVALAVGSVWIVERVWKPFPDILDRRVYFWGGVAVLAVLLATLRAFFRCRDRRYP
FT                   VTATAIALSSVVVVIAAAGQINVLFAAYPTLGSILGIPDYRTLALDQIRGTDRTAVDRD
FT                   PLSPVWEAPAAMPATGAVTTGTIPPTVSRFEARPAIVYLPPAYFAEPRPLLPVLVLLAG
FT                   VPGGPEDWLAGGRLVETMDSFSAQHAGLAPVVVVADATGTQFGNPACVDSHLGNVDTYL
FT                   GTDVPNWVKSTFQIDPDPQGWAIGGLSYGGTCSLQLATAHPDIYPTFLDLSGQIEPGLG
FT                   DHRRTVTDVFAGDEQAFRRINPLDLLHTHRYPDSAGAFVAGSADPEAQQALQLLAIAAR
FT                   DAGMDVHYSELPGGHTFEVWSAGLEKELPWLGRRLAITP"
FT   CDS_pept        188381..188581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55695"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV1"
FT                   /protein_id="BAH55695.1"
FT                   /translation="MKALIAVKHAMLVVWNILATATSAPIPGPSTSSGVAPPRPGARAV
FT                   GELEALGYRVTPHPSSPAVVT"
FT   CDS_pept        complement(188715..189017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55696"
FT                   /db_xref="GOA:C1BCV2"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV2"
FT                   /protein_id="BAH55696.1"
FT                   /translation="MSDNDIVETASVWEAISDAPGEAYNRQLRADLMTAIRGQIDRFGW
FT                   SQVTAAQNLGVTQPRLSDLYRGKLSKFSLDALVNLGSKVGVHVGVHVDTDELTSR"
FT   CDS_pept        complement(189017..189361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55697"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV3"
FT                   /protein_id="BAH55697.1"
FT                   /translation="MRGNEKPIRWVGSALDDLRDLPGDAQTDLGYQLDRVQQGLDPDDW
FT                   KAMKEVGAGCREIRVRTPDGAFRTFYVARFGEVVYVLHCFQKKTQKTSKSDIDLGRRRY
FT                   KAADAHAKEK"
FT   CDS_pept        189494..189850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55698"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV4"
FT                   /protein_id="BAH55698.1"
FT                   /translation="MTTTISTNDVPVPEVYMSQAERARGRGSHYIEESVWVYLMRDWDG
FT                   ADRWVLDPVTVDGYGLDSGLENGVRNSECVCEDQAECDVSGIGWTGPPLCGGAGGAGRS
FT                   RFRCSRSFLRISRP"
FT   CDS_pept        complement(189998..190162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55699"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV5"
FT                   /protein_id="BAH55699.1"
FT                   /translation="MTGVGTKLAPKIVSEVARLEASSRIHLMSSKKVNERQAATSRWPP
FT                   QFAIWLKRR"
FT   CDS_pept        complement(190732..191157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02010"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55700"
FT                   /db_xref="GOA:C1BCV6"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV6"
FT                   /protein_id="BAH55700.1"
FT                   /translation="MPLILRDRRVLATLAVLASLAVAAALAPRPSISQVQEWAESMGPA
FT                   FVLVFFLAQAVLTIAPVPRTVFTLSAGLRFGPGPGVAVAIAATTVSAVLALLLVRALGR
FT                   TAVRARLTHPAVKAIDARLARRGWLAVGSLRLISPNR"
FT   CDS_pept        complement(191307..192545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55701"
FT                   /db_xref="GOA:C1BCV7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV7"
FT                   /protein_id="BAH55701.1"
FT                   /translation="MHTHPPRRTPILIALAILLALLAACAPSGTGSSPGGGANPSTPAD
FT                   PDPTITVTPADGADTVNPADPVSVETTGGTLESVTMTNNEGKVIEGIFTPDRIAWKPGA
FT                   ALGYGRTYTIAATAIHDDGTRTERTSTFSTVKPGNLTKPTFVTSGGNLLTDGGTFGIGI
FT                   VVVTHFDEPITDRAAAERALTVETTPPVPGSWYWADEQNVHWRPQNYYTPGTKVTARAN
FT                   VYGVDLGGGLFGQEDATTSFIIGDAHIAIADDTTKQITVSNNGEVVRTMPTSMGMGGSE
FT                   TINGQTLTFWTQRGIYTVLDKANPVIMDSSTYGLPVNSRLGYKETINYATRISNDGIYL
FT                   HELADTIWAQGNTNVSHGCLNLSPDNARWFYDFSVPGDIVEVRNTGGEPLAQWQNGDWS
FT                   VPWDQWLAGSALA"
FT   CDS_pept        complement(192672..193355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55702"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV8"
FT                   /protein_id="BAH55702.1"
FT                   /translation="MWSLRSPRATFVLSAAAVSGVLVLAGCSDNSGGGHDMSQMSNNTS
FT                   GTTSSSPTTAAVETTAFNNADVTFLQTMYPHHAQAVEMANMVEGRTTNPQILDLAKNIA
FT                   AAQGPEMEQMTALLAQRGMSVPSTDAGGGMSGMKHGGTSGMADGGGMSGMMTPEQMSDL
FT                   AGKSGADFDTAWLNMMIEHHTGAIEMAQTELSDGENADAKQLATAIVGAQQAEITTMQG
FT                   QLQQG"
FT   CDS_pept        complement(193450..193905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02040"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55703"
FT                   /db_xref="GOA:C1BCV9"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCV9"
FT                   /protein_id="BAH55703.1"
FT                   /translation="MTVKALGTTPPMQHLLRVAAVVAVLFGVLLMHSSPLLDHTGGHPT
FT                   SSGHDSGVHAHSHDAAAAPMPMPLEDFPVALAGTGCEGGDCTDHSGLHLCMAVMTIAAA
FT                   LVLARWYATATTGETAVHSLRALLRHRAGRAPPWTTPTLAQLSVLRV"
FT   CDS_pept        complement(194054..194311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55704"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW0"
FT                   /protein_id="BAH55704.1"
FT                   /translation="MPEPQRLDLSADFFLAQEPYADGTAPIAVRLPHADGAVRLVLGYP
FT                   AAGMNVLLTLDDAGRISEETLTDSKHLVTRRFLYPEPGER"
FT   CDS_pept        complement(194350..195354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02060"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55705"
FT                   /db_xref="GOA:C1BCW1"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW1"
FT                   /protein_id="BAH55705.1"
FT                   /translation="MNMWWQSRPGLVLLTEAAGLAGAIVVAAADRRKWTLAPLVLVVAA
FT                   EGLRSHANVAAPGWGGLLTAVHLAAAAIWVGALVHTVRAVRAWWGERAAVRWVLAGYTR
FT                   LAVGTFLVVVATGTVSALLLIPFSALLSTTYGQVLVVKLVLVAAAAAGLALAARQSLHA
FT                   PERTALMRRTIRAESIVLIAVLAVSATLVSTTPAGTSPQPGPPAPTGPVLPLGALAGQI
FT                   GLSVAASDGQLVVRLSTPRRGDYYAPEPGQDFSLTGRIDAAGTDGAPLDLRGCGPGCFV
FT                   APASWQGGDNVLTLGAAAQGWQGGTVSLLAPWPTGPGGDDLARAVAATHAHGT"
FT   CDS_pept        complement(195351..195989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02070"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55706"
FT                   /db_xref="GOA:C1BCW2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW2"
FT                   /protein_id="BAH55706.1"
FT                   /translation="MPALARHLFRGLLLLLALTAAAGAGAGVAGARPTLLFTDPGSDTA
FT                   VSDPPQSITLMFNEPVTPGAPAIVLHEGAGREIPMGAAETARDGRVLTARPADTLAAGT
FT                   YTVRWQVTGADGDLVEQDFRFAVGLALTGDGSAADGPSTSWTDTALRWLLLLGLAVALG
FT                   GLIAERVTTTARRENPSLPVLRSPLVAGALIGLVGVLGLGAALAASPAR"
FT   CDS_pept        complement(195995..196816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55707"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW3"
FT                   /protein_id="BAH55707.1"
FT                   /translation="MPANRIARTVFPTGIAALLVLAGCSSQADDTTTPDAAVPTVELSS
FT                   ELTHLHGLHVGADGAVLAGTHTGLFAIDTSGTTSRVGASDDDFMGLTGVPNTDTVFASG
FT                   HPGASSSAANPLGLRSSTDGGTSWVDRSLAGQVDFHVLSTDGRLLVGFDGKDGLLVSTD
FT                   GGTTWTPGASLVAGALAVNGSGVWAVTPAGLEHSTTGARTFSPVPNAPRLVMVSGAGDA
FT                   LWGIDEDGYAWRSRDGRDWQKRSRVGTVEAMTAANYDTAYAATSQALYTLN"
FT   CDS_pept        complement(196911..198461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02090"
FT                   /product="putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55708"
FT                   /db_xref="GOA:C1BCW4"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW4"
FT                   /protein_id="BAH55708.1"
FT                   /translation="MIEQFPGAARLSRRNFLALAGLGAVAAAGACSRGGGPGPAPTAVG
FT                   PDSAAVRTAEQVRRATIGTGNTVTASLKAGPTRIDLGGVQVDTWAYNDRIPGREVRLRR
FT                   GDLLRAELTNDLPAESTIHWHGIALRNDMDGVPGLTQSAIAPTSPFTYEFLAPDAGTHW
FT                   LHPHVGMQFDRGLYAPVIVEDPAEGGDYDLEAVLVLDDWLDGVGGRTPDQQLDELRQGG
FT                   MPMMSGMGMDHGGMSGMDIGTTIDPANPLGADTGDVDYPYYLINGTLGTDPFSVRARPG
FT                   QRVRLRIINAGADTAFRLAVGGHQLTVTHSDGYPMQPVTGSSVLIGMGERFDAIVTLGD
FT                   GVFPIVAAAEGKQGQGFAVIRTGAGGRLDPAIRPAELDAPPITGLALRSREDVRLGLRN
FT                   PDRVHDLMLGMDMSGYRWTINGATYDEHTPLAIAQGQRVRLRFVNQTMMFHPMHLHGHT
FT                   FQVVDGHGTGPRKDTTLVLPNQTVEVDLDADNPGQWLVHCHNLYHGEAGMMTTLSYTE"
FT   CDS_pept        complement(198587..199876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02100"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55709"
FT                   /db_xref="GOA:C1BCW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW5"
FT                   /protein_id="BAH55709.1"
FT                   /translation="MKNLLTQFRSFDRPSQVLMVNQFSINVGFYMLMPYLAGYLAGPLG
FT                   LAAWAVGLVLGMRNFSQQGMFLLGGTLADRLGYKPLIVAGCLLRVAGFVLLAAVESLPA
FT                   ILLASVATGFAGALFNPAVRAYLAADAGPRRVEAFATFNVFYQAGILLGPLIGLALTTL
FT                   DFRVTSLAAAAVFAVLTIVQIWALPAHRAETAAAKTSVLEDWRVVVANRPFVLFAVAMI
FT                   GSYVLSFQIYLALPLQAAVVAGDERSDTALVTSLFVVSGVVAIAGQLRITSWFSRRWGS
FT                   GRSLVVGMAIMALAFLPLILLPSPAALGGWAAAGALVLTAALLAVGTAAVFPFEMDTVV
FT                   ALSGGKLVATHYGFYNTVVGIGILLGNLGTGAVFGILRDADLGALIWVALTVVGAVCVG
FT                   ALYLLDRSAQLAPPPAQTPAPEGDEVPAAR"
FT   CDS_pept        complement(199873..200985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02110"
FT                   /product="putative cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="protein synonym:O-acetylserine (thiol)-lyase"
FT                   /note="protein synonym:O-acetylserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55710"
FT                   /db_xref="GOA:C1BCW6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW6"
FT                   /protein_id="BAH55710.1"
FT                   /translation="MNSAVPSTLVPPSASHLPSTAGRCPQPSTMVGNTPVLWIGEPFAD
FT                   TGRGFWAKLEGSNPGGMKDRPALHMVEKAKARGDLAPGAMIIESTSGTLGLGLALAGIT
FT                   HHHPVTLVTDPGLEPIVHNMLAAYGAHVELVTTPHPTGGWQQARREKVRELLSAHPGSW
FT                   CPDQYTNPDNVDAYESLALELIAQLGRVDTLVCSVGTGGHSAGVARVLRRFCPDLKLVG
FT                   VDTVGSTIFGQPAGTRLMRGLGSSIYPDNIDYPAFDEVHWVAPHEAVWSCRTLAATHHA
FT                   SGGWSVGAVALTAGWIARTSPPETRVAAIFPDGPQRYFDTIYNDDYCAEHGLLDANPPT
FT                   EPATIDHPTDHVVQSWTRCATVVDPTESVS"
FT   CDS_pept        complement(201093..201515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02120"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55711"
FT                   /db_xref="GOA:C1BCW7"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW7"
FT                   /protein_id="BAH55711.1"
FT                   /translation="MTAFAIRPPRMRTVVAVAAALYLLAHTIAQCGIFLAHDHQGEDVH
FT                   VSSSTTSMPAEESAPGHAHIDDGSTHLSHETHTVVAMPRSDNPLRPLTVAAVVAIALAV
FT                   VLVLMSVPLTPRAPPDLPIPIRHGRTVLNELCINRC"
FT   CDS_pept        complement(201602..202561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02130"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55712"
FT                   /db_xref="GOA:C1BCW8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW8"
FT                   /protein_id="BAH55712.1"
FT                   /translation="MSAAACFPLFSGLVAVLGPPVLRRITHGGLAPRLGVIAWSAAIAS
FT                   VVLSWAMAALLLVLDLLRYRARPGESLLGACLARLQESLGGADTAFEVAGVAAATAVVS
FT                   ITVWITGRLAVGLMRLRIRTHGHARRARLIGHQVRGVDAVVIDNAERAAYCAAGRPHAV
FT                   VITTAALAALDDRQVQAVLAHERAHLAGHHAQILAVLRVLAASLPGMTLFTAGAVEVGR
FT                   LLEMCADDSAARAHGSRALLSGLLALCAPAQVPDGALGAGNIALLDRAGRLASPPRRTA
FT                   KVRVCLLSAAVVAMVTAAPLALAVLEVTGTMWCLPMAS"
FT   CDS_pept        complement(202561..202941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02140"
FT                   /product="putative BlaI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55713"
FT                   /db_xref="GOA:C1BCW9"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCW9"
FT                   /protein_id="BAH55713.1"
FT                   /translation="MRVRGFGELEAVVMERLWDREGSTTVREVFDDMARGREIAYTTVM
FT                   STMDNLHRKGWLERERSGKAFRYWPTLTREEHSARLMREAFESGGRSDVVLTHFFEQMS
FT                   EEEAAGLRMALQRMATDEDAAP"
FT   CDS_pept        203320..203910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02150"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55714"
FT                   /db_xref="GOA:C1BCX0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX0"
FT                   /protein_id="BAH55714.1"
FT                   /translation="MCWSSRSGHDKSDDDPSTGPPTAIATGRGSDQAERGRLAAAAALQ
FT                   PCPTAKAETVDAGALGGITARCLGSTTEVDLGAALSGEPTLINVWASWCGPCREEIPVL
FT                   EEYAHTPDAIRVVGVDVDDSSTAALALLTELGAHYPSFGDTDAGALRGALGAPPVLPLS
FT                   FLLRSDGSIARITEPAVFAEPAQIHRAVSELTS"
FT   CDS_pept        203907..204533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02160"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55715"
FT                   /db_xref="GOA:C1BCX1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX1"
FT                   /protein_id="BAH55715.1"
FT                   /translation="MTTPTPQRLLRRRVVLAAVCAALLTAPACATGADAVAQGGTFDFV
FT                   APGGQTDIFYDPPQARGSIGALTGPDLMTDRPVSLADYAGHVVVINLWGQWCAPCRSEA
FT                   DDLERAYTATADRGVRFLGINVRDPGRDKAQDFVVDNAVTYPSIYDPPMRTLLALGGSY
FT                   PTSVIPSTLVLDRQHRVAAVFLRALLTEDLQPVIERVAAEPGDPR"
FT   CDS_pept        204530..205336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02170"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55716"
FT                   /db_xref="GOA:C1BCX2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX2"
FT                   /protein_id="BAH55716.1"
FT                   /translation="MTVLAQELGSSFQTAAATGPMLLALGAAALAGLISFASPCCIPLV
FT                   PGYLSYLAGITGAETESAPGGAIGVRTATRWRVTGAAVLFVAGFTVVFVLATASVFGAI
FT                   SVLQLNRELLGRIGGVVTIVMGLAFLGAIPALQKDTRPHPRRISHLAGAPLLGAVFGLG
FT                   WTPCLGPTLAGVLSVAAGTEGATAARGVTLIVAYCLGLGLPFILLGFGSTAAVRGVGWL
FT                   RRHSRTLQILGGLTLVVVGLALLAGAWDVFVAWIRDEFVTAVVLPI"
FT   CDS_pept        205466..206743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02180"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55717"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX3"
FT                   /protein_id="BAH55717.1"
FT                   /translation="MTAQKGPAMRGITSSALTACTRRLPTLCLGASTAAAMVVLTAPPA
FT                   SAAHPGHADSSSALAAALADAVTMVADAAQPDVVVVDPSRWQTVANIAAASLRNAEANG
FT                   SLADAFEAQHLLAGCLSGFAAGSAAAEVLGACADELGAVDGGIAPRLLAALELGDVSES
FT                   SGPGIFDHTDPAEAAAAPDSALAEATVPNPDEEQTAGTGAETGEAEADADPQSEHPGPE
FT                   GAEDIEAPSPEADTGGDADGSHTHDGADAEGAADDATGDETGAVTGADETGADETEDGA
FT                   AAPQQPRTWNRPGTKEFVAPSAGTVTSTMGDGRGHEGIDIANTLGAPIVAVADGEVIDA
FT                   GPAQGFGLWVRIRHDDGTITTYGHNNDNLVEVGERVKAGQQIATVGNRGNSTGPHLHFE
FT                   IEDPDGEIVDPVKWLAKRGASIVGLD"
FT   CDS_pept        206802..207035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55718"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX4"
FT                   /protein_id="BAH55718.1"
FT                   /translation="MQRHSGGGRGRWLPMIDVEDSIVIDCPIGEVFDFVADQTNAPRWQ
FT                   NGLEQVRRITDGPPGWEPNMLSSASFWVGDWT"
FT   CDS_pept        207032..207283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55719"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX5"
FT                   /protein_id="BAH55719.1"
FT                   /translation="MINEYAHFEPNAEITFTGASGPSRFEVTYRTEETAEGTRLSCHMR
FT                   MEQKGLFALGDRVVAEGLRRDFAANLRNLKALLETRAE"
FT   CDS_pept        complement(207307..207843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02210"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55720"
FT                   /db_xref="GOA:C1BCX6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX6"
FT                   /protein_id="BAH55720.1"
FT                   /translation="MTMSPPVRTLALTVHIGASAGWLGAIVTYLVVAAATLIGADPAQV
FT                   RGGYQVMAMLADAVLLPLALASLVTGLICSLGTAWGLFRHYWVLLKLLLNLVATVVLVL
FT                   YTRSIEYAATVAAQPSWSQADRAVLQDPTHLVHATAALIVVLAALVLAVYKPRGVTAYG
FT                   HRKALRNRAAPSLSR"
FT   CDS_pept        complement(207840..208025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02220"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55721"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX7"
FT                   /protein_id="BAH55721.1"
FT                   /translation="MKVVAVVVGLLLVLVIAVMLFGGGNHGPGRHMSAPATVVHPVTGF
FT                   DADRALPQALTGPITL"
FT   CDS_pept        208203..208778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02230"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55722"
FT                   /db_xref="GOA:C1BCX8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX8"
FT                   /protein_id="BAH55722.1"
FT                   /translation="MPKLWNETIESHRQAVREATMDAAAAVVAESGLAAVTMSKIAERS
FT                   GIGRATLYKYFPDVDAILTAWHERQIAGHLHHLAEVRDHTDGPGARLAAVLEAYAQILA
FT                   HHHTGAIAAGLHRGDHVARAQQHLHEFVRDLLTDAAETGEGEVRADATTDELTWYVLHA
FT                   VAAAEGLDSPAAVHRLVTIILAGLRPQR"
FT   CDS_pept        complement(208818..209579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55723"
FT                   /db_xref="GOA:C1BCX9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCX9"
FT                   /protein_id="BAH55723.1"
FT                   /translation="MSTTNISPDTEALVALLDVIDNYPGAAALRARSIELLAAPPGAVI
FT                   VDVGCGAGRAVAEMTEQGWDGLGIDLDEHMLTIARRRWPHCRFEKADAAELPLADHSVQ
FT                   GYRAEKVFHDLADPTAALTEARRVLAPGGRIVLIGQDWDGFFIDSDHPELTRIIVHARA
FT                   DTVAAPRAARRYRNLLLDTGFTDAQIEVHTGVFTDHTLLPMLTGIAHAAAAVGAITSEE
FT                   SEDWIGDQTRRGQADRGFVAIPVFLAHAARP"
FT   CDS_pept        209608..210036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02250"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55724"
FT                   /db_xref="GOA:C1BCY0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY0"
FT                   /protein_id="BAH55724.1"
FT                   /translation="MKSSDDSRSWSIGEVAERFGIATHVLRHWETVGLLHPSREGGSRR
FT                   RYEKSDVYAVAMILRAKEAGFGLDDIREMFDTDDPVRRTAILGRHRDALARRIARAQAS
FT                   LALIDCALDCDHDDIASCPHFHAAIDARIGALAPLSLP"
FT   CDS_pept        complement(210082..210747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02260"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55725"
FT                   /db_xref="GOA:C1BCY1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY1"
FT                   /protein_id="BAH55725.1"
FT                   /translation="MGLGRKLLGGPDGHADDGSGGLIRRARLYECFSAVGFGGFRRRVF
FT                   DGLVALAGAHPGDEVLDIGCGTGYFSRRAARAVLPGGRVVGIDPSPPVIDYARRVSPPH
FT                   CTFRLAGAEALPLYDASMDLVISSLAVHHIPPELRATALREAFRVLRPGGRLFIADFRP
FT                   PRNRIANHLVGTLSGHAMQHNPIHELDGLISGAGFEITGSGDRRPLLHYVRAARPASP"
FT   CDS_pept        211385..211849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55726"
FT                   /db_xref="GOA:C1BCY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY2"
FT                   /protein_id="BAH55726.1"
FT                   /translation="MDLVLQPGEVVGLTGENGSGKSTLMKILVGEYRPDAGTVTRSGRL
FT                   GYCPQQPVVYERLTCDEHFELFGCAYRMTPNEERRSRRGLYAALGFERYAGTRADRLSG
FT                   GTLAKLNLGLAMLADPEVLLLDEPYSGFDWDTYLRFWELVAHRRHTGTRC"
FT   CDS_pept        211926..212330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02280"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55727"
FT                   /db_xref="GOA:C1BCY3"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY3"
FT                   /protein_id="BAH55727.1"
FT                   /translation="MRSDNHLAGPGEVVLLIHRFLVDYARNPVNMLVLVLVPVVFVIVA
FT                   AGSMADAAKLLGGAGGPAVETATAGWAAGFLAGIARFFQIGGARAADRRMVSAGRAPMR
FT                   LVAARLGTGGVLGVLVAAALLAFGRAYRHR"
FT   CDS_pept        212439..213467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02290"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55728"
FT                   /db_xref="GOA:C1BCY4"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY4"
FT                   /protein_id="BAH55728.1"
FT                   /translation="MFVWILDVFFGPAVGSPDRIETRWFPTHFVTLWMVDILSRHGGRM
FT                   RDLGWALVWMFAALIVSTAVIAATVGVSRRSRRRPPVGSGWGQFSTGLRMGLRDYRRNP
FT                   VLWVLLVVVPIVFIVLAKAMTASESGVFSLVERGSTVMQVFWLPDVHAGTMTPIAVSSL
FT                   AALAGLFVGLDARGGDRRLTLAGFPFPLLLAVRLTMIGFAAGLVTVSSLMIIATVFDAR
FT                   QWGVYGGGNLLMAVTYGLLGFSLGPSFGCVGGVFIAFLVPFLDLGIGQSPMLRPEPATW
FT                   AHGLPGYGAMRVLLDGGLTARFDEVGPLLGALVWLLALSALAGRLFHRAHPRASPLGLV
FT                   IR"
FT   CDS_pept        213830..214078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02300"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55729"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY5"
FT                   /protein_id="BAH55729.1"
FT                   /translation="MTNEDGRAPYVGNDGDRGVGEEPQGVGGRSRHRWMMACCIPMLIV
FT                   AVALIASGTVGIGSLVFALACLGMMAVMMFSMGGQRH"
FT   CDS_pept        214197..216629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02310"
FT                   /product="putative copper-transporting ATPase"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55730"
FT                   /db_xref="GOA:C1BCY6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY6"
FT                   /protein_id="BAH55730.1"
FT                   /translation="MNTTVLEVSGVHWASSTATVEATLRRRPGVTSVEANAVNQTATVT
FT                   YDPGLTSVVELSKWVRDCGYHCAGRSVPDHVCDPMSEPAAVRGEAGHAHPAPEAAAPAE
FT                   PAAHEMPAGHAPAGRLPQEMMGHGGGHAGMSMDAMIRDMRNRFLVALVLSVPIMLWSPM
FT                   GRDMFGFMVPAPFGLRDDVFTLLLSLPVVFYSAWIFFDGAYRALRARTLDMMVLVAVAV
FT                   GAGWLYSVGVTLTGGGDVFYEAATMLTTFVLLGHWFEMRARGGANDAIRTLLELAPPRA
FT                   VVLRGGEPVEIPTAEVTAGDLLLIRPGAKIPVDGTVEDGHSEVDESMVTGESLPVTKPP
FT                   GSEVIGASINTTGTLRVRATKVGSDTVLAQIVALVQEAQNSKAPGQRLADRAAFWLVLV
FT                   ALIGGIGTFLVWVLVGESVQTALLFAITVVVITCPDALGLATPTAIMVGTGLGAQRGVL
FT                   FKNATALETSARIDTVVMDKTGTLTKGEPEVTDVITDGIIEDEFLALVASVERESEHPL
FT                   AGAIVRYATDRGIPQLPLTGFENVPGHGATAQVHGRRVAVGNRKLMAAEQVDFGALMDR
FT                   RDELARGGRTAVLVAVDGHGVGVIALADAARDTSAAAVSALHDLGAEVVMLSGDNEATA
FT                   ARIAGQLGIDTVIAEVLPGDKAAKIAELQRAGKTVAMVGDGVNDAPALAQADLGIAIGA
FT                   GTDVAIETADLVLMRSDPLDVPIALRIGRGTLRKMRQNLGWAVGYNVIALPIAAGVFEP
FT                   SLGLVLRPEIAALSMSGSSVIVAVNALMLKRLALPSPPEPQLTQPRPAPAPTPTGPR"
FT   CDS_pept        216991..217692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55731"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY7"
FT                   /protein_id="BAH55731.1"
FT                   /translation="MKTTKIAVGAAAVAALVALTACSNSGSDQSAQSSASASVTATTAA
FT                   ADTHNQADVTFAQQMIPHHAQAIEMCDVVLAKNGIDPRVTDLANQIKAAQGPEIEQLQG
FT                   WLTEWGQSSMPMATSGMMTPGQSMPMATSGMMTPGQSMPMSGMEMPGDSGMGMSGMMSA
FT                   EDMTALQNAQGVDASRLFLTQMIAHHQGAIAMAQTEIDSGQYPDAVAMARTIADTQQQE
FT                   ITTMQNILASL"
FT   CDS_pept        217725..217976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="ROP_pROB01-02330"
FT                   /product="putative copper chaperone CopZ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55732"
FT                   /db_xref="GOA:C1BCY8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY8"
FT                   /protein_id="BAH55732.1"
FT                   /translation="MTSSEENTVSTTASYHVSGMTCAHCVKAVTEELDRLDAVTSVDID
FT                   LVPGGDSRVRVTSSRPLSLEQVRHAVDEAGYSLADPPT"
FT   CDS_pept        complement(218320..219447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02340"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55733"
FT                   /db_xref="GOA:C1BCY9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCY9"
FT                   /protein_id="BAH55733.1"
FT                   /translation="MRSRGPGLGIRLLLAQSLVLVAGVVTCWVVAVFVGPPLFREHLHR
FT                   AGVPAFSDEQFHAEQAYRSATAISLAVALGVATLAALVVTWYFSRRLQRSVTEVSYAAT
FT                   AVADGRYDIRVTPPHLGDDFDALAEAFNRMAAGLESVETTRRQLLGDLAHEIRTPVSVL
FT                   EAYMEALEDGVETLDADTIGMLRDQTRRLVRFSDDVNALSHAEESRTSIEPTWVDPAAL
FT                   LSTTLTAAADRYAAREVALTSRVPAHLPRLWADPERLGQVLGNLLDNALRHTPGGGRVE
FT                   VTAGHRHELLVIEVTDTGDGIAAEHLPHLFERFYRVDAARDRAHGGAGIGLAIAKALVE
FT                   AQRGHITARSDGPGTGSTFTIALPLRRDQRRGNTR"
FT   CDS_pept        complement(219489..220250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02350"
FT                   /product="putative OmpR family two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55734"
FT                   /db_xref="GOA:C1BCZ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ0"
FT                   /protein_id="BAH55734.1"
FT                   /translation="METMDNTPPLSPESAAGYRALVVDDERPLAAVVASYLEREHFEVA
FT                   VAYNGVDALTLAREIDPDVVVLDLGLPGMDGIEVCRELRTFSDAYVVMLTARSAEMDTI
FT                   IGLSVGADDYVTKPFSPRELVARIRAMLRRPRKAPVYEIPAPEPGAEAPPRVFGALRID
FT                   VAGREVCLGEQPVMLTRTEFDVLAVLSSRPGMAFSRRQLIEAVWGESWVGNEHLVDVHV
FT                   GHLRRKLGDDPAAPRYVTTVRGIGYRMGTGQ"
FT   CDS_pept        220383..220658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55735"
FT                   /db_xref="GOA:C1BCZ1"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ1"
FT                   /protein_id="BAH55735.1"
FT                   /translation="MMWWNNGMGYGMGWGGWVLMAALMVAFWGLVIVGVMALFRTIGAD
FT                   RHPPYDTDATSRPSADKILDERFARGEIDAEEYRIRRDQLRTGHDR"
FT   CDS_pept        complement(220971..221315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55736"
FT                   /db_xref="GOA:C1BCZ2"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ2"
FT                   /protein_id="BAH55736.1"
FT                   /translation="MATPTPAATQAPAETDGHDHAAHGYITEKDAYLKRLKRIEGQARG
FT                   LQRMVEEDKYCIDILTQVSAMTKALQAVAMGLLEDHISHCVVDAAVAGGPEAEAKIKEA
FT                   TDAIARLVRS"
FT   CDS_pept        complement(221612..223873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="ROP_pROB01-02380"
FT                   /product="putative copper-transporting ATPase CopA"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55737"
FT                   /db_xref="GOA:C1BCZ3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ3"
FT                   /protein_id="BAH55737.1"
FT                   /translation="MNPVTQHPTADGQVELEIGGMTCASCANRIEKKLNKLDGVTATVN
FT                   YATEKARVNYVGDVSTEDLVATVEQAGYTAKVPTPPSASTGTDAPAAEQDPTASWRQRL
FT                   LISLVLSVPVIAMAMVPALQFPNWQWLSLTLAAPVVVWGAWPFHKAAFTNLRHGTSTMD
FT                   TLISMGTIAALGWSLYALFWGTAGMTGMTHPFELTISRSDGAGNIYLEAAAGVTTFILA
FT                   GRYFEARSKRRAGAALRALLELGAKEVSVLRNGVEERIGIDQLAVGDEFVVRPGEKIAT
FT                   DGVVTEGSSAVDASMLTGESVPVEVGPDDQVVGATVNVGGRIVVRANRIGSDTQLAQMA
FT                   KLVEDAQTGKAQAQRLADKISGVFVPIVIALAVATLGFWIGTGGGVAAAFTAAVAVLII
FT                   ACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTVTTGKMTLL
FT                   DVITADGEDTAQVLRLAGALEDSSEHPIAQAIAKGAREQVGALPAVDQFANIEGLGVQG
FT                   MIDEHAVIVGRARLLADWAQHLPEALENAMAAAEADGKTAVAVGWDGRARAVLVVADAV
FT                   KATSAEAIEQLRGLGLTPIMLTGDNAAAARAIADQVGIEEVIAEVLPADKVDVVKRLQD
FT                   AGKVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAADAIRLARK
FT                   TLGTIKGNLFWAFAYNVAALPLAAMGLLNPMLAGAAMAFSSVFVVSNSLRLRRFKSTAG
FT                   "
FT   CDS_pept        complement(223903..224847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55738"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ4"
FT                   /protein_id="BAH55738.1"
FT                   /translation="MNASSKFAGFTVGLAAVFALALGAGAAFGPEGTTPADTHDTSTHD
FT                   AGSVSTSDAPAADQRPGGLMVTDSGYTLALDTAQVPAGADVPLRFRILGADGQPVTRYV
FT                   DSHEKQLHLIAVRRDMAGFQHVHPVLDAAGTWSVPLDLTRAGAYRVFADFTPDGGDGLT
FT                   LGADLQVAGAYDPQPLPPAAASAVVDGYTVTLGGTLTPGQASKVTLSVSRDGQPVTDLQ
FT                   PYLGAYGHLVALRAADLGYLHVHPDGHPGDGVTTPGPGIDFFVTTPSAGDYRLFLDFQH
FT                   DGVVRTAEFTLTGGQTPAAVPAAPEPMPAGHGH"
FT   CDS_pept        complement(224887..225093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copZ"
FT                   /locus_tag="ROP_pROB01-02400"
FT                   /product="putative copper chaperone CopZ"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55739"
FT                   /db_xref="GOA:C1BCZ5"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ5"
FT                   /protein_id="BAH55739.1"
FT                   /translation="MSTTTATVTGMTCGHCVSSVREEIGSIPGVTGVDVDLASDRVDID
FT                   SDTPIEQEALAQAVDEAGYQLAG"
FT   CDS_pept        225567..226991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02410"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55740"
FT                   /db_xref="GOA:C1BCZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ6"
FT                   /protein_id="BAH55740.1"
FT                   /translation="MPTQASSTRKWWALALIAAAQFMVIMDTSIIGIALPKMQTDLGFS
FT                   QENLTWVFNAYVIAFGGLLLLGGRLSDLWGARRTFATGWVVLLVGSITAAAGNVGTELA
FT                   GRAVQGAGAALIAPSALTLLMMLFGSTQQELTKALAVYGAAAPAGGTAGVFLGGVITEY
FT                   LSWPWVFYINIPIAVIALAATPLLMPNAPTRSGSIDILGALTVTAGLALAVYSIVRAPE
FT                   VGWDSGQTWGYLAVSAVLLGAFVLIQSRRREPLMRLGIFTAPNLAAANVAQLLLGAAWI
FT                   PMWFFLNLYLQQVLGYSAFPAGAALLPMTTLIMLGMIVIAPRAMQRFGAKPMIVTGLIV
FT                   LALGLGWMALVRPTGNFWVDVLPASLVAAAGMSLAFIPSLGTAISAARPDEGGLASGIV
FT                   NVSYQVGSALGLAAMTAVAASFGANQIGDLPELTNGFSAAFIGAAVIALAGAGVTAVSM
FT                   RTAQSDKVPEPVLEQH"
FT   CDS_pept        227509..228180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02420"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55741"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ7"
FT                   /protein_id="BAH55741.1"
FT                   /translation="MAKHRRTADRSNSITGRLKIATVAAATGAILIGGAQFGAGSAAAR
FT                   PLEIPPGLLPAGVQLPAIELPDIPAAPPAPGMPGPVNPGIPAPLKARAVQPVSGTLSSG
FT                   YGPRWGAHHGGIDIAAPIGTPIQSAADGEVISAGPASGFGLWVRVRHDDGAVTVYGHIN
FT                   EFIVNVGQRVAAGQQIATVGNRGQSTGPHLHFEVSDAGGNRLNPSQWLRDRGVSVTWGA
FT                   D"
FT   CDS_pept        complement(228720..229748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02430"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55742"
FT                   /db_xref="GOA:C1BCZ8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ8"
FT                   /protein_id="BAH55742.1"
FT                   /translation="MSEYDGKQFVGIDLHRQRSVIVRQTDTGEQLSAVRIVNDPVALGL
FT                   QIDQAGPNPEVVLEATYGWYWAVDALRASSADVHLAHPLGVKGFRYRRVKNDRDAGDLA
FT                   DLLRMNRLPEAWIAPPQTRELRELVRYRAKLVALRSGLKAQVHSVLAKAGVLIPVSDLF
FT                   GVTGRQKLARVPLADAYAQRVISLLELIDDLDAHEARFTARIATELRGDRGYTAIQALP
FT                   GIGPTLAAVFVAEIGDVHRFTDPAHLCSWAGLTPKHRESDAVVRRGHITKQGSKLVRWA
FT                   AVEAIQRHPAGTKISTDRKRIEARRGRNIAKIAAARKLLTLVYYGLRDGEIRAVAHQKA
FT                   VA"
FT   CDS_pept        230052..231629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02440"
FT                   /product="putative phosphodiesterase/alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /EC_number="3.1.4.-"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55743"
FT                   /db_xref="GOA:C1BCZ9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCZ9"
FT                   /protein_id="BAH55743.1"
FT                   /translation="MPLSRRQLLRVGVAGSAAVLVGTSAVSSARLPAPRWRGDDPFGLG
FT                   VASGDPTPDGVVLWTRLAPDPLAPGGRGGMGWDPVTVEYEVAHDESFRQVVTRGTAVAT
FT                   RELAHSVHPEIHGLEPARWYFYRFRAGSAISAVGRTRTAPAPGQPTARMRLAFASCQSW
FT                   SSGFYTAYEHMRDEDLDLVIHLGDYIYERGWRRGREGMPMGADRDEAVDLPSYRLHYAQ
FT                   YKAEKPLRDAHAAFPWIVTMDDHEVDNNWAADSPGLGFDIYRIPALFRRRRAAAFQAMY
FT                   EHQPLRLTQLPSGESMRLHRRYWFGDLAQITMLDTRQYRDRQACGGNVTADCADRLDTD
FT                   RTILGAQQRDWLLDGFTGSPARWQIIGNQVAMGQTDNDPGPDTVVSADSWDGYVADRNT
FT                   VLGGAADRGVRNLVVITGDRHQNIVADLRRDYADPESPVIASEFSGTSITSAGDGADMN
FT                   DTGRRLLAANPDMKFFNAQRGYVRVDLDHQLWRNDFRVVPYIQRPGAPIHTRASFVVQD
FT                   QRPSVTEA"
FT   CDS_pept        complement(231602..232399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55744"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD00"
FT                   /protein_id="BAH55744.1"
FT                   /translation="MCRDPALHTWSRYAADVIALLDHLGASEAVVGGTGLGGTIALRAA
FT                   PAFPSRVRAVVVISAEDIEDDEAKVAETALVDRFAERVRGDGIEAAWELFLPHLQPLIG
FT                   NLVRSAIPRADPGSVAAAAAIGRDRSFRTLDELGAIEVPVLIVPGADERHPAELAERMS
FT                   ATIPHATLARNVSFDALATADDLAGAVVPQIRRFLGNCGHYPSPCVPEPPSSDRRTLAM
FT                   AMWLGTGTAAQRCLVRGPGADRACRAASCVAGSGRHASVTLGL"
FT   CDS_pept        complement(232596..233465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02460"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55745"
FT                   /db_xref="GOA:C1BD01"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD01"
FT                   /protein_id="BAH55745.1"
FT                   /translation="MTSLDMPAVRTPGTAQVDALAPEDAVTYAGWFACLADPTRVRLLH
FT                   QVASRPAGITVGELAEALGIGQPTISHHVRKLADVGFVSVHKDRTSTVVTVNPSCCTGL
FT                   PHAADAVMGVLTPRPCCPDDLPDDVTVRPMTEQDWDDVRRIYGEGIATRTATFTTEVPT
FT                   RETLDAQWLPGHRWVAEIDGVVVGWAALSPTSGRDCYRGVAENSVYVADGMRGRGVGKT
FT                   LLRTQVIAADEAGIWTLQTSIFPENRASIALHHSAGFRTIGVRERIARLDGIWRDTVFL
FT                   ERRSPVAG"
FT   CDS_pept        233542..234912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02470"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55746"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD02"
FT                   /protein_id="BAH55746.1"
FT                   /translation="MNVDERIIQMNTLPVVVVGAGPIGLAAAAQLRERGLTPLVFERGP
FT                   VAGAAISEWNHVRLFSRWGELIDPAARRLLDATGWVAPDDEAYPTGQDWTRDYLSPLAA
FT                   ALGDIVQLGTEVVGVARRGRDRVVDAGRDTEPLSVHLRRADGTADRILAQAVIDASGTW
FT                   TTPNPLGGEGLPALGEKSAADRIEYRVPNIDDPEVRARYAGKHIVIAGSGHSALTAIVA
FT                   LADLEKQAPGTRISWVLRRGDAGSTFGGGEDDQLPARGALGLRAKAAVDDGLLQVVPGF
FT                   RTAAIESHGERVVLVSDTGARIEDVDRVVVLTGFRPDLSWLSEIRLGLDPVLQAPVELA
FT                   PLIDPNVHSCGTVYPHGVAELSHPEPNVFLVGMKSYGRAPTFLAMTGYEQVRSIAAALA
FT                   GDHDAAARVELTLPETGVCGGAGVFDDPDTPAAAEESVGCCVAPDPQLITLSARAGG"
FT   CDS_pept        234916..236151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02480"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55747"
FT                   /db_xref="GOA:C1BD03"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD03"
FT                   /protein_id="BAH55747.1"
FT                   /translation="MAPTTTLPQNTPTLAEGGLRRVLAVLCLTEITSWGILYYAFPVLS
FT                   VSISADTGWSLPVIVAAFSLSQLAAALTGIPVGRIIDRFGPRAVMTAGSVLAVPALLVV
FT                   AAAPNLPTFYAGWLAAGIAMGAVLYPPAFAALTRWYGDGYVKALMILTLAAGLASTVFA
FT                   PLTAALVDRYDWRTTYLVLAAILAVITVPGHLLGLRGRWPHPPTPVGDHPVDHRDASRS
FT                   RAFLALVIALSLRAFAAFAGVFNLVPLLIEQGFSPSLAALTLGLGGAGQVLGRLGYLPI
FT                   AARTTARTRIVVILAATAASTALLGIASTTAALIGVAIGAGLIRGIFTLIQATAITDRW
FT                   GATHYGRLNGLMSAPVVIVMALAPWAGTALSARTGSYAHAYLILAALAVVASLIGAASI
FT                   PRHRRHDAATTT"
FT   CDS_pept        236459..237382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02490"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55748"
FT                   /db_xref="GOA:C1BD04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD04"
FT                   /protein_id="BAH55748.1"
FT                   /translation="MTAPAVLVEDLHVAFGKNWALDGVDLEAAAGTTLGVLGHNGAGKT
FT                   TLIRTLTTLVRPTIGRVHIEDLDVVADATEVRRRIGVTCQYAGLDEFLTARENLELIGR
FT                   LTGLRRTARARADALIDRLGLDEYAARRVGELSGGSRRRIDLAASLVGSPSLLFLDEPT
FT                   TGLDPLARAGLWDVVDELTDAGTTVVLTTQYLEEADRLADHIVVLSRGRVAARGTPAEL
FT                   KRIVGGKVVSATVPAHQLAALPFIPDADRVDDNRVRASVTVDDAPAAIALVADLHDRGI
FT                   EVTDLDVASPSLDDVFTHLAHTGAHK"
FT   CDS_pept        237379..238185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02500"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55749"
FT                   /db_xref="GOA:C1BD05"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD05"
FT                   /protein_id="BAH55749.1"
FT                   /translation="MTTTNAIGRPSALDQLAALTVRNLRTSARVPQLLMFSLTMPMAML
FT                   VLFSQVFRSVAAGPSFPAGVSYIVFLTPAMLAVSTVMAGTNAGVSAAIDHTNGLHDRFA
FT                   ALPMRAALTGVARTINEAVFTLARAALLGIAAVALGFEFHGTAGDAVAAVIVLVVLAGA
FT                   MSALFGLIGDRLRRPDVVQFAGMMVMMPLMFVSSAFAPIETMPGWMQAMATVNPVAHAT
FT                   DALRGHVLGTATAGDTAAALVAAIGLWAVVTAVPAFTRVVRSARTR"
FT   CDS_pept        complement(238469..238660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55750"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD06"
FT                   /protein_id="BAH55750.1"
FT                   /translation="MICGSSPSYRIPAPRRGGDPLGQGRSRGTDDIDRHRTHLRPNPKF
FT                   LVCMGVDVDSGFSGSTYQ"
FT   CDS_pept        238659..239288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02520"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55751"
FT                   /db_xref="GOA:C1BD07"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD07"
FT                   /protein_id="BAH55751.1"
FT                   /translation="MNEDTATTATTPQSAPADLDQLWRRFSSDLRAFIARRVSRPEDAD
FT                   DILSIVFLRMAKSLDNLREQDRLLGWMYAITRNAITDYYRSAPHRRELAVDTVPDNPRE
FT                   GEPDDDETAEKELASCLVPMLSGLPAEQAAAVKMVDLDARTHAAAAGEAGISVSGMKSR
FT                   VQRGRATLQARLHACCEISQDRTGHVHDYQPRSGSCACGAPSPADQ"
FT   CDS_pept        239829..240599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02530"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55752"
FT                   /db_xref="GOA:C1BD08"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD08"
FT                   /protein_id="BAH55752.1"
FT                   /translation="MLDGLSLRLVPDALWEIIEPLIPRFAARPQGGGSAPVDDRAVFTA
FT                   IVYVLTSGCAWRHLPPSFGVTVPTAHRRFTVWAAAGVFERLHREVLDRLGSAGELDWTA
FT                   AILDAASVRAKKGGSLTGPSPVDRGKKGSKIHVLSETNGIPLVVDVSAANTHDSTMLQP
FT                   MVAAIPATKSRRGPRRRKPGKLRADKGYDYDIHRRWLREQGIVPRIARRGIERNDRLGR
FT                   YRWKIERTMCAARRSVVSPVQSGRTWREVLGSGG"
FT   CDS_pept        complement(241237..241761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55753"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD09"
FT                   /protein_id="BAH55753.1"
FT                   /translation="MKLKARRRGGLSVVRDLREVRAAVGPEDTERFETDVFAGFVLARC
FT                   AAGLSDNMIRSDVSHLEQVRTWFGKPLWDMLPADADSYFGTVLRPVLIPTRLARAQALK
FT                   TYFEFLELRHKIEIHNLTGRIAPPGRPVRTRRDHSDPILHSRATDPPNPSRGTRSTELS
FT                   TNPRINSPQIH"
FT   CDS_pept        242309..242788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55754"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD10"
FT                   /protein_id="BAH55754.1"
FT                   /translation="MQRSSVHSKGDALDPVIAEVTRGQPYRHVMGFEAGERRRAEKDAG
FT                   YNTDLRTGEYPLIEWGWFRDDAIAYTKSVIGTRVGKSACTCCPFAFANKSTRAEIFARY
FT                   AADPAKGRSRGPLFVTHRRPGSQSRRRPRHVTAGTPGRLMRGGEGACAGRLAWGS"
FT   CDS_pept        complement(242795..245047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02560"
FT                   /product="putative cadmium-transporting ATPase"
FT                   /EC_number="3.6.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55755"
FT                   /db_xref="GOA:C1BD11"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD11"
FT                   /protein_id="BAH55755.1"
FT                   /translation="MSDACCGPAATPNTDAAAEPDHGQDRWWQVRELQVAAAAAVLLGA
FT                   GWLLGRVGADTAGTAVELLAAVVAASTFVPGALRNLLRHRRIGVGTLMTIAAIGAIALG
FT                   QIPEAAMLGILFSIAEGLEHYAVTRTRRGLRALLSLVPPTATILCGGTESSVSPDELAL
FT                   GDRMLVRPGERAATDGIIRTGRTSLDLSAITGESVPVEAGPGDPLHAGAINGGGAIEVE
FT                   VTARAADSSLARIVHIVEEAQDRKGAGQRLADTIARPLVPAIMILAVLVAGIGAMLGDP
FT                   LLWIERALVVLVAASPCALAIAVPLTVVAAIGASSRHGALIKGGAALEELGRIRAVALD
FT                   KTGTLTRNTPQVIATVTAEGIGESDALVAAAALEARSEHPLAQAILTAAGPGITPADDV
FT                   TAVAGHGLHGTLGGTALRLGKPGWIHPGPLTDQVARLQGEGATVVLLERNGTVIGAIAV
FT                   RDELRTEAPEAVQRLRALGIDVAMLTGDNERTAHSLAAEAGITTVHAELLPEDKAALLP
FT                   TLANGRRIAMVGDGINDAPALATADVGIAMGAMGTDVAIETADVALMGEDLRHLPQVLA
FT                   HARRARTIMLQNIGLSLAIIGLLIPLAATGVLGLATVVFIHELAEVLVIGNAIRAARTT
FT                   TLPGLTAAPTTTRPVHVSVAPSAHVLGDACCPPAPPRGAEIPLIGSVGSARPAPTLLPL
FT                   TSPTAADGTSQGTDEDCDCCQSSTAGTDRPSNPPGQLTDHITDSNVPDERHSDTPR"
FT   CDS_pept        complement(245040..245465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02570"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55756"
FT                   /db_xref="GOA:C1BD12"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD12"
FT                   /protein_id="BAH55756.1"
FT                   /translation="MTKERVDTCDLLCLDLPHAEQIRAQLPEASRIEPAAAAARALGDP
FT                   TRLTIAAALASGGELCVCDMAWVVGQAQNLVSHHLRQLKIADLVSSRRHGRLVMYSLTP
FT                   RGRALVGAVLDDHATAAPAPAPAHAEGSSEHVETEHV"
FT   CDS_pept        complement(245549..245893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55757"
FT                   /db_xref="InterPro:IPR022172"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD13"
FT                   /protein_id="BAH55757.1"
FT                   /translation="MTELTDAIRALYEREMSAASSTGEAQARWAHLERAHIVSQPYPWL
FT                   HTRNHVAMFRLALRQHDRREALGQVVRIIVAAPGSALGRYPEGNTGRVSAGLMTPMPVP
FT                   GDLAAEIAAA"
FT   CDS_pept        complement(245928..246257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02590"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55758"
FT                   /db_xref="GOA:C1BD14"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD14"
FT                   /protein_id="BAH55758.1"
FT                   /translation="MDTVTHADALSRFGYALSDATRTRILLSLKGQPGYPSELADQIGV
FT                   SRQILSNHLACLRGCGLVVAVPEGRRTRYELADPRIGHALGDLLDLVLAVDPALCPDAD
FT                   DSGCC"
FT   CDS_pept        246619..247770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02600"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55759"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD15"
FT                   /protein_id="BAH55759.1"
FT                   /translation="MRGITTAMLTTCMRRLPALALGASTAVVAVVIAAPSASADTPGDA
FT                   DSPSVLAATLADAVTMATDAAQPDVVVVDPSRWQTVANIAATSLNNADASGSSGDTRNL
FT                   LAGCLSEFAATGSAASDVLGSCADELGAVDGGIAPRLVAALELGDVSESAGPGSFDHTP
FT                   AADEASSDSEPAEDTAPKPVEDEATGTGEAGTTTEEQSEPTDPTGVEAPSPEGPSPEAN
FT                   AGTAAATGEREADAAATPAPQRPRTWNRPGTKEFVAPSAGTVTSTMGDGRGHEGIDIAN
FT                   TLGAPIVAVADGEVIDAGPAQGFGLWVRIRHDDGTITTYGHNNDNLVEVGERVKAGQQI
FT                   ATVGNRGQSTGPHLHFEIEDSDGEIVDPVKWLAKRGASIVGLD"
FT   CDS_pept        247859..248302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55760"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD16"
FT                   /protein_id="BAH55760.1"
FT                   /translation="MMIDVEGSIVIDRPVGEVFDFVADQTNAPRWQNGLEQVRRVTDGP
FT                   PGVGTKHVVVRKFLGRRLELINEYAHFEPNVEITFTGASGPGRFEVTYRTEETAEGTRL
FT                   SCHMRMEQKGLFALADPVVAASLRRDFAANLRNLEALLETRAE"
FT   CDS_pept        complement(248321..249541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55761"
FT                   /db_xref="GOA:C1BD17"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD17"
FT                   /protein_id="BAH55761.1"
FT                   /translation="MHARRRPGHLAAVLAVLLLALAAACAPSTDQPAGPATPPPGPEIT
FT                   VSPADGAAAVNPTDPVAVSTNGGTLETVTMTNDEGRVVEGIFTPDRLSWKPGVPLGYGR
FT                   TYTLAVTAVGDQRVPSEKTSTFSTVTPGNQTKPTFVTSGGNLLADGGTFGVGIVIVTHF
FT                   DEPITDRAAAERALHVETTSPVTGSWYWADVQNVHWRPQNYWAPGTQVTVRANVYGIAL
FT                   GEGLFGQEDATTSFTIGDAHISVADDTTKQVTVTDNGEVVRTMPTSMGRGGTEVVGGQT
FT                   LSFWTQPGIYTVIDKANPVIMDSSTYGLPVNSRLGYKESINYATRISNDGIYLHELADT
FT                   IWAQGNTNVSHGCLNLSPDNARWFYDFSVPGDIVEVRNTGGAPLELWQNGDWSVPWEQW
FT                   QAGSALT"
FT   CDS_pept        complement(249600..250529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02630"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55762"
FT                   /db_xref="GOA:C1BD18"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD18"
FT                   /protein_id="BAH55762.1"
FT                   /translation="MGQGHGHGHGISPADATSASGKHLRKLWIAVALGLVTFVTQVAVG
FT                   LSTSSLALLSDSAHVFTDVLGILMAVIAITLANKAHNRPERTFGMYRAEVFAALFNAVL
FT                   LFGVAGWILYEAAGRLDDPPEVPGLPVVIVALVGLAMNVIAFLLLRSGAKESINVRGAY
FT                   LEVMADMLGSIGVLVSGLLTLLFGWRYADPIIGVAIGLFVLPRAFNLGRHAIRILLQHA
FT                   PAGVDVDAIGHALETLPGVKESHDLHVWTLTSGMEVASAHLITERGADPTAVLASAQTL
FT                   LAEKFDLEHATLQVEPAEGEGRCRELPW"
FT   CDS_pept        250712..252646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02640"
FT                   /product="putative copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55763"
FT                   /db_xref="GOA:C1BD19"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD19"
FT                   /protein_id="BAH55763.1"
FT                   /translation="MSAVDDPSAPGERARRRTLPQILGWAAIAALVAAALAQLSTTEAL
FT                   RLLGLPDPGTLTTYGLPAVMAFGEACAVVMVGSALLSTALVPPQPSGVLDVDGYLAMRT
FT                   AGVAAALWALSAVALVPLTLSDSSGQTLAVVFADPGPFVQAVTDLEVPKAWAWTCLLAV
FT                   VAAIAARLVLRHKWTPVVLALAVISVLPRALSGHSASGGSHDVATNSLLFHIVAAALWV
FT                   GGLVALVLHARRRGARLDIAVRRFSALALGAFTVMAVSGVINAAVRLPITDLVTSTYGV
FT                   LVLAKVAALVLVGFAGWRQRTVAVTALENDPEDRAEFVRLAVIESVVLAVTVGIAVALG
FT                   RTPPPAGERREPTPLGETLGYDLGGAPSAGRMLLDWRFDLIFGTAALVLAAAYLLGVRR
FT                   LHARGDRWPVGRTVCWVLGCVVLLLATSSGLGRFAPAVFSVHMGAVAGLAIIAPLLLAL
FT                   GAPLTLWSAAARRGADGVPGMWEFSRQLYLSAPLRLLTRPAVALTLLFGGFYVFYLGGI
FT                   YGSLDGSHTWHVVSNGYFLVAGFVFFWVSVGPDPTPAAASTRTRLITAVAGLAAYAGFL
FT                   LLVARADSVIAAEYYTMLRRGWWDDLAADQRLGAAIGAGTGAVALAFAVVLAAAAVTAP
FT                   RRGRTAARR"
FT   CDS_pept        252786..253244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02650"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55764"
FT                   /db_xref="GOA:C1BD20"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD20"
FT                   /protein_id="BAH55764.1"
FT                   /translation="MAELLISELSRRSGVPATTLRYYEQVGVLPAARSHSGYRLYDEHA
FT                   EQRLRLISAAKRLQMPLLEIVELLTVWEEDACRSVRSHLRPALDARIAEAATGIAALTR
FT                   LHTELIAARERLDSLPDRDDRCNPRCTVLLEPVTVQGPDSAKTDRPIA"
FT   CDS_pept        253320..253517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55765"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD21"
FT                   /protein_id="BAH55765.1"
FT                   /translation="MDTGVRVTVPSESAAELAGLVVAEQHCCAFLDFILAFDRGTVALT
FT                   ITAPSDGRALIDDLITPTAP"
FT   CDS_pept        complement(253613..255046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55766"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD22"
FT                   /protein_id="BAH55766.1"
FT                   /translation="MTLGVGVTIGTAYAVAATASADHPTESLLTRRSTLTLGPDSTVRL
FT                   GDAPDGAGVLSEFAHRLGDVLVAGDGRRYAAQDLVAAAAHCVIAETHVAEDTPVVLAHP
FT                   AVHSAHAVGELRAALDRAGLARVGLVPEPVAALAWFEAEHGPLSDGVALVCDLGADSLD
FT                   LTIVSGGTNDGSDPIVGRPLRSTEFGSHRSQPTVDELTSALELVADCLDAAGLYTSDLD
FT                   LVLLTGAETPPGLRERLEGLGAPVTCPPFPGSVSARGAALLAAASRYPIVPPGHTVRRG
FT                   RGGNLRVVAAVVLAAVALIVPWYASNVGSNARHDDTVVASPPPSQHGFRLVERAAPAPV
FT                   PSASAATVPAAPATVALTANPVTPIPRMVAVTAPPIPPTLPTSIHPVIDFVDTTIEPST
FT                   RKTMSLSSVPSPAPAPAPAPIPESNPVPTTDPDESTPTTEPRPTTEPPATTLPDETETP
FT                   PAPIDPLRPSDPETPVTPP"
FT   CDS_pept        complement(255060..256403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55767"
FT                   /db_xref="InterPro:IPR017549"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD23"
FT                   /protein_id="BAH55767.1"
FT                   /translation="MPHHPPRRFSITCAGPLAALLLGATGCSPAAPAADTESLPGNRYA
FT                   AATLVASNDSYGAAATFPEMVNAWGIAIRPQGEGGHFWVGGGGTSFEFVGDVSASPNPA
FT                   LRPLHQDALHEVTVPGTDSDTSDTGGGKITGVAFNPAPLASDSFAVTGQPVDVDGHPEL
FT                   LAGSSRFLFATDTGRIAGWTEQGADGRIVRRDGPALQMFDGGPAGMNFFGLALASGRDD
FT                   TLWAADFGADPQIRQFDKSWRLVPTQGFVNPFATGDPIDPADPGSGKRARPGDPAPFNL
FT                   VTAGDRVFVTYAVTKAAEDSADGREFDAGEEDSLDAEQEVAAGDRPDRGKIAEFDRAGN
FT                   LVRVLDDGGRLNSPWGVAVAPADFGALSGSILVGNFGGAGHIAAFDDTTGAFIDYVRDE
FT                   SGAVLGVEGLWGLLFGNGESLGDSNSLYFTAGPADEKDGVFGRLRAAQ"
FT   CDS_pept        complement(256484..256966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55768"
FT                   /db_xref="GOA:C1BD24"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD24"
FT                   /protein_id="BAH55768.1"
FT                   /translation="MLASATLTVVLWISAHVTVDPVLHTAALFVHLASLVLGFGGVLIA
FT                   DYLVLVWVSGRSTLAEAIAGAHRLHLPIWLGLAGLVASGALLEPNLASTLTRIKVPCVL
FT                   ILTLNGLQALILSRRMARAATVSLAPTLTIWGAATASVSQICWWTAVWIGFWNAEH"
FT   CDS_pept        257227..257403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55769"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD25"
FT                   /protein_id="BAH55769.1"
FT                   /translation="MSPVLVKSARTEIRADLVRLVARAAPDAVTRWGVVCELPHCHVRP
FT                   LEVVASQACSVRR"
FT   CDS_pept        complement(258084..259124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02710"
FT                   /product="putative iron(III) ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.30"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55770"
FT                   /db_xref="GOA:C1BD26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD26"
FT                   /protein_id="BAH55770.1"
FT                   /translation="MTYALEVDGLDKSFGAAAILRHVAFAVEAGSTTAIVGPSGCGKTT
FT                   LLRLIAGFEKPDAGTIALAGRVVAGGGWTPAHRRSVGYVAQDGALFPHATVGANVGFGL
FT                   PRRARTPARIAELLEMVSLDSSYASRRPDQLSGGQQQRVALARALAREPELMLLDEPFS
FT                   ALDAGLRANTRRIVADVLAKAAITTILVTHDQPEALSFADRVAVMSAGRLAQIGTPREI
FT                   YSTPIDVPTAEFIGDAVVLSAHVDGGRARCALGDVAVASNGVHGSARVMLRPEQIEVTT
FT                   DGAGVSGTVVDVDYLGSEMLLGIRLDTGDGEVPERVTVRRFGATALTPGDRVGIRVLGK
FT                   AVAYDL"
FT   CDS_pept        complement(259121..260686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02720"
FT                   /product="putative iron(III) ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55771"
FT                   /db_xref="GOA:C1BD27"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD27"
FT                   /protein_id="BAH55771.1"
FT                   /translation="MRSGDAATARRPTARPHLPFPLAVAAVIVVAASFIPLGYVMVQSI
FT                   ATGWDTASALLFRPRVRELLSNTVLLVVVTVPICVVLGVLAAWLVERTRVPGAKVWAVL
FT                   LAVPLAVPAFVNSYSWVTAIPSLGGLRGGVLIATLSYFPLVYIPAAATLRRLDPAVEES
FT                   ARALGVGPWAVFFRVVVPQLRLAIAGGALLVSLHLLAEYGAFVFIRFDTFTTAIFEQYQ
FT                   STFNGTAATMLAGVLVLLCLTLLVIESVVRGSARYARIGSGAARRAVPAELGWRYSPIV
FT                   LLFLGVLIAASVGVPVVSVVRWLVIGGSAVWEWDAVASALVQTLGFGIAGAVVTCVVAF
FT                   PIAWISIRHPGRFSRFLEGGTYISSSLPGIVVALALVTVSIRYLHPLYQSVAVVIAGYA
FT                   LLFLPRALVNLRAGLAQAPVGLEEAAQSLGLSPLSAFVRVTLRLAAPATAAGGALVFLG
FT                   IVNELTATLLLAPTGTRTLSMQFWSLSSEIDYAGAAPYALIMIVLSLPMTYVLFSQSKK
FT                   VAGL"
FT   CDS_pept        complement(260707..261744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02730"
FT                   /product="putative iron(III) ABC transporter
FT                   iron(III)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55772"
FT                   /db_xref="GOA:C1BD28"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD28"
FT                   /protein_id="BAH55772.1"
FT                   /translation="MRMRIGLMSGVALATAAVLTVAGCSDSGSDNGTDSGAANQITVYN
FT                   AQHESLTQEWADAFTAETGIEVELRNGSDTELGNQLVAEGDQSPADVFLTENSPAMTLV
FT                   ENAGLFADVHRDVLDQVPGQYRPSSGKWTGIAARSTVFAYNKDMLPDQLPKSLLDLQDP
FT                   AWKDRWAASPSGADFQAIVSALLELKGEDATRQWLAGMKENVRTYKGNGTVMKAVNAGE
FT                   IPGGVIYHYYWFGDQAKTGENSNNVALHYFKNEDPGAFVSVSGGGVLQSSTKQDAAQQF
FT                   LKFVTGQKGQEVLQTGTSFEYTVGSGVPANPKLVPLAELQAPQVDPAKLNSPQVTELMT
FT                   EAGLL"
FT   CDS_pept        261914..262078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55773"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD29"
FT                   /protein_id="BAH55773.1"
FT                   /translation="MEEGSHRVDVDVPVYEELGRVIPTPGQPINARNRHPHIVDVRGEN
FT                   HPTSLLTCL"
FT   CDS_pept        complement(262048..264699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02750"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55774"
FT                   /db_xref="GOA:C1BD30"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD30"
FT                   /protein_id="BAH55774.1"
FT                   /translation="MSSSSFHLERFGVRFVRVLGRFGDSLALITPGETVTYRELAERVE
FT                   RKASRLGGTRRLVLVAGSNEVDLVVTYLSALFAGHPVLLAPGDNPDSLEALIAAYRPDV
FT                   VVRSADGRTVVEELRECSVHLLHPDLALLLSTSGSTGSPKLVRLSHRNVQANAESIAEY
FT                   LDIRDTDRAVTTLPMHYCYGLSVIHSHLLRGAALILTTHSVTDPGFWDLFKAHRGTSFA
FT                   GVPYTFDLLDRIGFDELDLPDLRYITQAGGRLAPDRVRAYADLGRRRGWELFVMYGQTE
FT                   ATARMAYLPPELAATHPQSIGRPIPGGSFRLEPVADAPDGAGELIYAGPNVMLGYAHTP
FT                   DDLRLGDTLGGELRTGDLARQTGDALYEVVGRRSRFAKVFGLRIDLQHVESALAQHGLT
FT                   ACCAGGTDELIVAVQHCGDVDTVRHATARASGLPVAAIRVFPVDELPRTSTGKPDLRAV
FT                   AELAHASEPPMATQSTTGPDTGAVRALYAEILHCTHVTDDSTFVSLGGDSLSYVRMSLR
FT                   LEEMLGHLPENWHTTPVGDFAPAPRRRRWRRMETNVLLRAVAIVLIAGSHIHLFTLLGG
FT                   AHVLLGVAGYNFARFHLGTAERTERVRHTLGSVARIAVPSMVWIGSVIALTGDYRITSA
FT                   FLLNGIFGPDGWSAEWRYWFVEAIVYIVLVLAAVLYIPLVDRIERRHPFWFAMGFVAIG
FT                   LLTRYGLVDVDDSRNRILTASVVFWLFALGWAAAKSTTIWQRLWVTAVVVATVPGFFFG
FT                   ETRREIIVVGGLCLLVWLKSVPCPMVLSRVAGVLASASLYIYLTHFQVYLPLRDDHPWL
FT                   ALALSIVVGILYWRAVTFVLGLCRRPGVVRSESDRNRIASLLVRTCASRQRDKRPPIDG
FT                   RIDHRHVRSDVG"
FT   CDS_pept        265004..266008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02760"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55775"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD31"
FT                   /protein_id="BAH55775.1"
FT                   /translation="MRVRHRFVISTPARNAILARHRKPEPDLDVCWDHENITTAAVGAV
FT                   TSAPAVDPHPAAGEGQAETGEWAAVPAAAPHAPRHRRGGAHRQPTPARPGGRAMVLSMA
FT                   TGALLAAGTSTAHAAPADPTPQASEVAPQPAPDPIAAALAAVPQVLQIPETAELSKFTD
FT                   QLAKAREREAERLAREAADRAARTPQATPGSGGGFLRPPGTSIAPVSGTLTSNYGARWG
FT                   TTHYGLDIANDIGTPIVSVTDGTVLEAGPASGFGMWVRILQDDGTVGVFGHINEALVTA
FT                   GQKVRAGQQIATVGNRGQSTGPHLHYEVWQADGMKTDPMAWLRARGINMTSSD"
FT   CDS_pept        266044..266403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02770"
FT                   /product="putative BlaI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55776"
FT                   /db_xref="GOA:C1BD32"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD32"
FT                   /protein_id="BAH55776.1"
FT                   /translation="MKGLGGLEAEVMDILWSSAEPLSVHDLLDTLSERKQLAYTTILTV
FT                   VTHLHEKGWVEREKRSRAYFYFPVRSREEATSQALRELLDSSNDSAAVLLHFAGTVSET
FT                   EQEALRRGLRKGRKK"
FT   CDS_pept        266400..267347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55777"
FT                   /db_xref="GOA:C1BD33"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD33"
FT                   /protein_id="BAH55777.1"
FT                   /translation="MTLAAVLLVGAVLVAVLAPPVLETMPFSGIRPNVVLAFWLASMAS
FT                   VLFFAGSAVVVLAWPDHAPAEGVIETIVRCFSAVSHTAAPWIGASLVAAGLMVGAGVVA
FT                   RAVFFARQQSVSRSHMQDFHRDVVAIVARTEQGHDDVMWLDHPLPMAYSVSGRPGFVVA
FT                   TEGLSSSLSGVERDAVLAHERAHLSGHHHLIVGVADLLARVLPMVPLFARSPRAIKTVI
FT                   ELAADEQAARVTSAAVVSSALSVVADAALPTPAFTLGLGNDMNLRLWRLRRAPHTRFSR
FT                   LACCAAAAVTVTVPAVVALTVVSVTTMTACILLT"
FT   CDS_pept        267465..269243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02790"
FT                   /product="putative cytochrome c oxidase subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55778"
FT                   /db_xref="GOA:C1BD34"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD34"
FT                   /protein_id="BAH55778.1"
FT                   /translation="MTAIAPPPVATRAYPARTAPKGSFVYKMITTTDPKVLGIMYLVTS
FT                   FAFFLIGGLMALIMRSELAVPGMQFLSNEQYNQLFTMHGTIMLLLYATPVVFGFANYIL
FT                   PLQIGAPDVAFPRLNAFSYWLYLFGAIIATAGFITPGGAADFGWTAYAPLSSAVSSPGI
FT                   GADLWIVGLLVSGLGTILGGVNMITTVVCLRAPGMTMFRMPIFTWNIFITSILILLAFP
FT                   LLTAALLALLADRQLGAHIFDPASGGVMLWQHLFWFFGHPEVYIIALPFFGIVSEIFPV
FT                   FSRKPIFGYTGLIYATLAIAALSIAVWAHHMYATGAVLLPYFSFMTFLIAVPTGVKIFN
FT                   WIGTIWKGHLTFESPMLFSIGFLVTFLFGGLSGVLLASPPIDFQVTDSYFVVAHFHYVV
FT                   FGTVVFATYAGIYFWFPKMTGRMMDERLGKWHFWTTFIGFHGTFLVQHWLGNEGMPRRY
FT                   ADYLPSDGFTFLNSFSTIFAFVLGASTLPFVWNVFKSYRYGEVVTVDDPWGFGNSLEWA
FT                   TSCPPPRHNFTELPRIRSERPAFELHYPHMIARMHAEAHVGPGHGGKHASAVLEQERHA
FT                   PLTDDATGGVRGDQAR"
FT   CDS_pept        269288..269830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55779"
FT                   /db_xref="GOA:C1BD35"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD35"
FT                   /protein_id="BAH55779.1"
FT                   /translation="MTTHAIPLLTVPATHAATATLADWLIRSLAPTVLDGAGMVEDADD
FT                   LCALAPITVRHLARPRRLRSHERQLHQITATMEERLQRQPPHPPAAVFADPAVRPIPDE
FT                   ILDIAAHIGGTIADVGSPAAALANRALHLGAVVVDAGLGATAPEHLRTQVTESYRSLLT
FT                   YLWHTDPDLQIHLTTPR"
FT   CDS_pept        270132..270635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02810"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55780"
FT                   /db_xref="GOA:C1BD36"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD36"
FT                   /protein_id="BAH55780.1"
FT                   /translation="MRAMAVAVGVLVLLFSFTLAHTGTANGWEVLVSADDAGAEAVALP
FT                   SRVFLTLAVVFGAVMSMLALITRLWVLAWLALAGCALASVFGMLAVWSRQTVSPNLAVA
FT                   GVGPGLLLGWATVIVLTFHWLKVVWGRTVAQMDAEHERRRRAADAEQYGDGNTGPGGFT
FT                   PKLK"
FT   CDS_pept        complement(270680..272965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02820"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55781"
FT                   /db_xref="GOA:C1BD37"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD37"
FT                   /protein_id="BAH55781.1"
FT                   /translation="MEGFAPAPGQGERRPVIYAWGVAVARRRRLVLGAWVALLVLCAAA
FT                   YPMLESRLGTPDFSVEESESAEVDRLLTEHFPQIGVEQDVIVFQSRTRTADDPEFRAAV
FT                   TRTVAVAQQMSGVRSVLGPYAGDGAQISVDRRVAIAVVGLDGDMARRAVVARELQEAIA
FT                   ATGTADIDAALTGYSPVQNDVTEIQNADVQRAETIGIPVALALLVLALGALVAAIVPIC
FT                   VAVAGLLVAVGSMFAMTTVTAFDPLVVSMATMIGIGIGIDYAMFIVSRFREELTRAGVT
FT                   GRDGRALIADAVGRSLMTAGRTIIASGLIVMISLCSLIVMAAPVFRGIALAVATAVVST
FT                   LIVSLTLLPALLATLGPAVGRGALPKWMRPAEAAPVDPGKPGRWARWAYAMMARPVLFG
FT                   SLAVGVLVFAAIPLFGIRYGLDMGTSALDTAPSGRAAAALTANFPAGSLSPLEMIATGP
FT                   GDTPLTAQDITRVDQLVDRIARDGRVDAVLPAQESQGRLLISAIPGVPFDSMAAGELVR
FT                   DLRAEAAEVARGGGPVVLIGGSTAEFIDISDEMTAKLPLVITLVLGSSLVFLLAAFRSL
FT                   VLPVKAIVMNLLATGAALGITVAVFQWGIGESLLDFTSTGFLQVYLPTVVFVILFGLSM
FT                   DYEVFLIGRMREYWDSSHDNQYAVAAGITHTARPITAAAAIMVVVFGSFVTAEVLELKQ
FT                   LGLALAVAVAIDAVIVRLVLVPALMRLFGARNWWFPRTRHRRGGRVRPDLRLEESAASE
FT                   PRPSSSPR"
FT   CDS_pept        273702..275447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02830"
FT                   /product="putative carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55782"
FT                   /db_xref="GOA:C1BD38"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD38"
FT                   /protein_id="BAH55782.1"
FT                   /translation="MPPTTTTQSDDPPTAADDSAKPAPWLPRVLRHDLPASLVVFLVAL
FT                   PALPDGQWLGVATGVLTVALIASVESLLSAVSVDKMHTGPRADLNRELLGQGAANITSG
FT                   VLGGLPVTGVIVRSATNVNAGARTRASATLHGVWVLVFSALLAGLVQQIPNSVLAGLLI
FT                   VIGIQLIKLAHLRIAHRTGDLWVYGVTAAAVVFLNLLEGVLIGLALAVALVVWRVVRAS
FT                   IHAEPVGTPQSRQWRVVVEGSCSFLALPRLTSVLASVPPDSHVTIELTVDFLDHAAYEV
FT                   IEEWSRQHESNGGTVLIDERGTAEMAAAAAGPPTRTTDGTAQLSRRGGFAPWRVWQKFH
FT                   LHHTPDGQTKQPGPRALRSVLAGISDYHRTHAPHLRPHMDDLHDGQNPDALFLTCSDSR
FT                   IVPNIITSSGPGDLFTVRNIGNLVPAGERDDSVEAALAFALDELGVSSVLVCGHSGCGA
FT                   MKALLADQDQPHPRSGDGLAVGRWLEHAQPSKRAYLAGHPVARAAAESGFGALDQLAMV
FT                   NVALQLQTLQRHPLIGAAMSEGRVHIAGLFFDIPTARVLAVSTSTIDELDPDSAAAASL
FT                   SAPLG"
FT   CDS_pept        complement(275606..276787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02840"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55783"
FT                   /db_xref="GOA:C1BD39"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD39"
FT                   /protein_id="BAH55783.1"
FT                   /translation="MGTSVERKRTWISAVGAALLIGAALLLLAMVGGRTLPERAGPPIE
FT                   QLAVEHTELVPGSIEVTVRNTGPDPVQVAQVFVNDSYVDLTGGEQPIGHLDSEVLRLDY
FT                   PWQDGQPYLLSFLTSTGLVIEHEIPAAVTTPQADAGFFALMALIGTYVGIIPVVLGMLF
FT                   LPVLRRIGPGGIRVLLGLTVGLLAFLAVDATLEGVELSERGGGAFGGPALLVLGAVLAF
FT                   LGLTALDRYLGSRRAVSDTRGSSGIRLAFMIALGIGLHNLGEGLAIGAAYAVGELALGA
FT                   TLVVGFTIQNTTEGLAVVTPLTQRRPPVLHLLGLGLLAGTPAIVGALIGASVNNAELSA
FT                   LLLGIGVGAIAQVILQIAPALRDRAGRVLSPGTIGGITAGLLTMYVTGLLVVA"
FT   CDS_pept        complement(276787..277839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02850"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55784"
FT                   /db_xref="GOA:C1BD40"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD40"
FT                   /protein_id="BAH55784.1"
FT                   /translation="MMAESRRQFLLGSALLGTAGAAALGVRGVSAASPSPGTEEAHSGG
FT                   AHAGGHGGGVSGPTFRKGAIVDHDANGFDPTEVLRDFDYGRVSLLPDGRVLREWDIAAA
FT                   DVDVEIAPGVRYPAWTFNGRIPGPTLRCQEGDLLRVTFINASMHPHTMHFHSIHRAEMD
FT                   GVPDIGPGVIPSGGSFTYEFDAQPFGLHLYHCHVGPLAEHIARGLYGTFIVDPPTPRPP
FT                   ADEMVMVMHGYNTTFDGEGNQLYAVNGIPFHYMHEPIRVRRNELVRIYLVNALEYDPIN
FT                   TFHLHGNFFDYYPTGTRLQPSEYTDTVMQAQGQRGICELRFPYTGRFMFHAHKTEFAEL
FT                   GWMGFFEVTD"
FT   CDS_pept        complement(277836..278519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02860"
FT                   /product="putative DtxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55785"
FT                   /db_xref="GOA:C1BD41"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD41"
FT                   /protein_id="BAH55785.1"
FT                   /translation="MRAPSQCCGSLLTPVVEDYLRTLFCLSARGDTTSTSALARCLHLA
FT                   TPTVSGMHRRLAGAGLIARPGLHRVTLTAHGGRHAVDVVRRNRLAKVFLAEFLGMSWSE
FT                   IGAEADVLEHAISPRLASRLTAALGNPTRDPYGNPIPPATGDYVEAWPESLRAAVPCRD
FT                   FTVERVVDRDIDGLRLLAGLGVYPGRVIARAEASPQGGEVCVDIEGHPHELAAAVGGLI
FT                   YGRAA"
FT   CDS_pept        complement(278651..279304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02870"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55786"
FT                   /db_xref="GOA:C1BD42"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD42"
FT                   /protein_id="BAH55786.1"
FT                   /translation="MRAPASAASSGYIDPPAPRSAVPFTGSRVVGWVLVVAGALGLTAS
FT                   LVLTIEKFSLLADPTYRPSCSINPVISCGSVMSSPQAEAFGFPNPLLGIIGFTVALTTG
FT                   VVTLGGVRLPRWYWLGLAAGLIGAAVFVHWLIFQSLYRIGALCPYCMLVWVAVVVSLWY
FT                   VLLHTGAQTRSPGRRLRRWMAFAARNHTAVLTVWVLIIAALIAEAFWVYWRTLV"
FT   CDS_pept        complement(279301..279984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55787"
FT                   /db_xref="GOA:C1BD43"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD43"
FT                   /protein_id="BAH55787.1"
FT                   /translation="MDGYMKLSTNLKFSAALVAVFAVVIGMLLYVNRSGSGSAASGAAG
FT                   RTVDPAAVLRENTHLLTSSPDRKVVLVEFLDFECESCLAMYPTMERIRAEYSGRITVGV
FT                   RYFPIPSHTNSNLAARVVEAASRQGKFEAMYQRMYETQTQWGESGRSQEPLFRSFAQDL
FT                   GLDMGRFDSDLGNPALAERVDQDFNEGIELGVQGTPTLFLGGTALPPMPSYEDLRARID
FT                   AALAE"
FT   CDS_pept        280122..280670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copC"
FT                   /locus_tag="ROP_pROB01-02890"
FT                   /product="putative copper resistance protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55788"
FT                   /db_xref="GOA:C1BD44"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD44"
FT                   /protein_id="BAH55788.1"
FT                   /translation="MRRVITLLAVTATALLLGMGSAQAHSELISSSPAADSVLDFGPPG
FT                   VELVFNQNIQNQFVNVSVTAPDGTQVGQGEPSVQGAQVLLPIRDGVGSGQYTVGYRVIS
FT                   EDGHPITGTYSFTLALPAPPVEQTGAASAAPAPAPVAADTEQSGGGSSLVLPILGGVVA
FT                   LLFVAGIVIVLRGERRKRD"
FT   CDS_pept        280713..281660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02900"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55789"
FT                   /db_xref="GOA:C1BD45"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD45"
FT                   /protein_id="BAH55789.1"
FT                   /translation="MMTAMDWVQLPGAPPSLGAMLSWNPQPLPLLPALGVALAAWYCWA
FT                   VRRVHRTGRVWPWPRTASFLGGALLLILVTGLGIEGYGFELFSVWMFQHLTLSMAVPPL
FT                   LVLGCPGTLLLRSTPHTGWGNPVLRAALGALRSRAARLLLHPSVTIPLFLFSYYGIYLS
FT                   PVFDTLATSWAGHTGLEVFFLATGVLFIVPVLSSGPLPVKQSNLGKCFDLFVEMPLHVF
FT                   IGVILMMATSPLLSTFTDPPASWGIDVMSDQQLAGALAWSYGEPVALIVVVIFAMRWNR
FT                   DEDRSNAAVDERNSRGGDSELAAYNEFLKTLPRR"
FT   CDS_pept        complement(281729..282436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55790"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD46"
FT                   /protein_id="BAH55790.1"
FT                   /translation="MVDDAARRRSASRSAVALGAIIAVLVGVLLGAWAQRWLDGDQPGA
FT                   PAGDSVDVGFAQDMSVHHGQAVEMSAMALANAADPAVRSLAYDVLTTQQSQLGTMQGWL
FT                   SLWDRPPLGSGEPMQWMPTDSAAGSAHHSMPGMESGTATADSSSPPMPGMATTGELADL
FT                   RRTTGSAFDARYLQLLLRHHKGGIPMAQYAADNAAVPPVSALAGQMVATQQAESTAIEQ
FT                   LLAAKGATALTMN"
FT   CDS_pept        complement(282471..283268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02920"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55791"
FT                   /db_xref="GOA:C1BD47"
FT                   /db_xref="InterPro:IPR021454"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD47"
FT                   /protein_id="BAH55791.1"
FT                   /translation="MTNNRNKARPGGIPGTRRIPWLMIGAVVIIVGLIGIIAYNMVPRA
FT                   VERAEAQRYAPSADNPDPATDIAGVTEIEYTAGSHIQAPQRVAYDQSPPVGGAHDQYWA
FT                   TCTGIVYPEPIRTENAVHSLEHGAVWVAYNPDRLGADDVTALAAKIDGRPYTLMSPYPG
FT                   LDAAIALQSWGHQLKLDGADDRRITQFVTALSQNPNTYPEAGASCSTVPGGFDPANPPN
FT                   PPPFDPSAPGPDAVPATDDQAATAPSDGSPTSTPTAPTGGGNG"
FT   CDS_pept        complement(283323..284141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02930"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55792"
FT                   /db_xref="GOA:C1BD48"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD48"
FT                   /protein_id="BAH55792.1"
FT                   /translation="MTAHGIVLAQGVGVSFQNAAATGPLLLALGACVLAGLVSFASPCV
FT                   VPLVPGYLSYLAGVSGAETPAVTPSGDCAAGSDRWRVAGAAALFVTGFTVVFVLATASV
FT                   FGVIGALRLNQELLQRVGGAITIVMGLVFLGFIPALQKDTRFTPRRISSLAGAPLLGGV
FT                   FGLGWTPCLGPTLAGVLSVAAGTEGATAARGVALIVAYCLGLGLPFIALGFGSAKTLHG
FT                   IGWLRRHSRTIQIVGGVMLIVVGTALLSGAWELFVGWLRNEFVTSVVLPI"
FT   CDS_pept        complement(284138..284794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02940"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55793"
FT                   /db_xref="GOA:C1BD49"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD49"
FT                   /protein_id="BAH55793.1"
FT                   /translation="MTTRYCLTIGRRPMWWSHRGWRARLLAVLAVGMAAVLGAAGCASG
FT                   SDAVAQGGTFDFVAPGGQTDILYDPPESRGKVGPLSGPDLMADGRAVSLSDYAGQVVVI
FT                   NLWGQWCAPCRSEADDLEQAYEATKDLGVQFLGINVRDPQRDKAQDFVIDNRMSYPSIY
FT                   DPPMRTLIALGGSYPTSVIPSTLVLDRQHRVAAVFLRALLAEDLLPVIERLAAQP"
FT   CDS_pept        complement(284791..285441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02950"
FT                   /product="putative thiol-disulfide oxidoreductase"
FT                   /EC_number="1.8.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55794"
FT                   /db_xref="GOA:C1BD50"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD50"
FT                   /protein_id="BAH55794.1"
FT                   /translation="MRTGSRWLVFFLAAVVALIAAIWPRSEESDVPEARVTAGAGAVSV
FT                   AGAGAPQGAAELSRVAAEAELRPCPTPLPSQPVGMVLSGVSARCLGAAQAVDLGAALSG
FT                   APTVVNMWASWCGPCREQIPVLESYANQPDSLPVAGINVQDDPVAALKLLTELDAHYPS
FT                   FGGAEAAMQALAAPPVLPLSFVVQRDGSVDRIVTPSVFADPAEVRSAVGELIR"
FT   CDS_pept        285609..285965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55795"
FT                   /db_xref="GOA:C1BD51"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD51"
FT                   /protein_id="BAH55795.1"
FT                   /translation="MTPSPPAGHRPANAALATPAPGGPESGSHPPTDTSVTRLIRLVLL
FT                   YTAARLTVIAALVALLIGVDRAFDLGLPLMLSSMGVLLAGVAISAVAFRSLRRRINQDV
FT                   NTIDDRRRRARDQR"
FT   CDS_pept        286281..286706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02970"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55796"
FT                   /db_xref="GOA:C1BD52"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD52"
FT                   /protein_id="BAH55796.1"
FT                   /translation="MPTAHPGDLRPVGGVAATIGALLTTWVTFVPCFVFIFLGATTSSG
FT                   SATHPTSALSGITSTFGMSTWSAAVVGVIANLAFCFAVHALFDASLRHGGRSTLLVPDP
FT                   DTIRPVVAVIAAAAGVMIYRAGAGRRLPAARREDTDR"
FT   CDS_pept        complement(286779..287156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02980"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55797"
FT                   /db_xref="GOA:C1BD53"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD53"
FT                   /protein_id="BAH55797.1"
FT                   /translation="MDPMTEAAAPAVAPAASLSHPVEPDQERLDTATETFRMLADPTRL
FT                   HILWILTRGEADVTALIEQTGGSRTAVSQHLAKLRFTGLVDTRKEGRRVIYRIHDGHLS
FT                   RLILEGINHADHVVTGEPPHA"
FT   CDS_pept        complement(287161..288405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-02990"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-02990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55798"
FT                   /db_xref="GOA:C1BD54"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD54"
FT                   /protein_id="BAH55798.1"
FT                   /translation="MLEVLRHRTFGRLFAAQIVALVGTGLLTVALGLLAYDLAGADAGA
FT                   VLGTALAIKMVAYVAVAPVISALADRVPRKVLLVGADVIRAAIAAALPLVDQTWQIYVL
FT                   IFVLQAASATFTPAFQSLIPAVLVQEADYTRALSLSRLAYDLESLLSPILAAALLTLIS
FT                   YNFLFLGTVAGFVGSALLVMRTVLPRPVPADRSVPLLHRITLGARVMVGRPVLRGLLAM
FT                   NMVVAAATALVVVNTVVYVRDLLGGSNTGVAVALGCFGGGSMLVALALPRLLMALEDRR
FT                   LMLTGCAILPVGLAAAALMLFAAPTPSVGWGLLAGIWIVLGAGTSMINTPSARLLRYES
FT                   DEQNRSAVFTAQFSLSHACFILTYPLAGWVGAQVGQVAAALTLTVLATLAGLAAARAWP
FT                   ARTEPLVEAVVAGRR"
FT   CDS_pept        288550..288810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03000"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55799"
FT                   /db_xref="GOA:C1BD55"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD55"
FT                   /protein_id="BAH55799.1"
FT                   /translation="MSAASSLEVEDLRWGWGAAGFVLGCAAVLAFTPLYLVLAAAALGL
FT                   AGMAVFHLAGHRTAGARLASFGLGVLIPAAAGAVLVGINSF"
FT   CDS_pept        288845..289507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03010"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55800"
FT                   /db_xref="GOA:C1BD56"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD56"
FT                   /protein_id="BAH55800.1"
FT                   /translation="MGLGARLLGDHRGHADDASGGLIRRARLYELVSAAAFLGRRRRVF
FT                   DRLVSLSGAGPGDRVLDVGCGTGYFATRLAAAIEPGGRAQGIDPSSPMIDYATGRRGTA
FT                   HTTFSVAAAERLPFPDNSFDVVTSTLVIHHIAPNARAAAAREMARVLRPGGRVLIADFR
FT                   PPTNPVANHLIGALAGHAMQHTPIDDFAALLDRAGLHTTATGEQKPWLRYLQADKTR"
FT   CDS_pept        289569..289991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55801"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD57"
FT                   /protein_id="BAH55801.1"
FT                   /translation="MGLGLLILDLPRAWSRHTALDTAADALRERGIYNWSRLELRGTAA
FT                   TGTDLVRQFTFTYWDPSTHGRQVYNLSYTDLWERLDAADRTTLLSVLSGGTIGSHVTTT
FT                   LARVAGDDFLVRDREGNQNLPRSLRHFLRAMDDHRR"
FT   CDS_pept        complement(290124..291614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03030"
FT                   /product="putative aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="protein synonym:aspartase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55802"
FT                   /db_xref="GOA:C1BD58"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD58"
FT                   /protein_id="BAH55802.1"
FT                   /translation="MPPPPVTRDEHDLLGTRPVSDSAYYGIHTLRAVENFAITGTPISV
FT                   YPELIVALASVKEAAAQTNHQLGLLDTRRMTAIVEACREIRGGRFHDQFVVDVIQGGAG
FT                   TSTNMNANEVIANRALEILGLPRGTYREVHPLEDVNLSQSTNDVYPTAIKVTLHFAIDH
FT                   LRAAMKDLATEFTIKATEFHDVVMGRTQLQDAVPMTLGQEFGTYAVMVTEDADRLLEAE
FT                   RLVAEINLGGTAIGTGINTHPLYAETACEALRAITGLPLTTATDLIESTQDVGSFVQLS
FT                   GVLKRTAVKLSKICNDLRLLSSGPRTGLGEINLPAVQAGSSIMPGKVNPVVPEVVNQVA
FT                   YEVIGNDVTISLAAEGGQLQLNALEPIIASSLFQSLTHLSAACRALTERCVPDITANAD
FT                   KLRADVEHSIGIITALNPHIGYTAATSVAEESLSTGRSIPDIVVTRGLLTADQLERLLR
FT                   PEVLVRPQQLEHFRQARAFVEIPTPDFWHPPLQGEAPV"
FT   CDS_pept        complement(291717..292154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03040"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55803"
FT                   /db_xref="GOA:C1BD59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD59"
FT                   /protein_id="BAH55803.1"
FT                   /translation="MLHHNEATARSLPRPQWNNANVAFLVEVFRLFSDPTRVRVVWSLT
FT                   GGERSVNDIAAIVGTPASTVSRHLAQLRAAHLVASRRIGTRRLYRLENDYARMLITDAL
FT                   SCSGVTGGRGAGATGPPETANAPPPSAGVTGAGSKFACAAS"
FT   CDS_pept        complement(292238..293716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03050"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55804"
FT                   /db_xref="GOA:C1BD60"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD60"
FT                   /protein_id="BAH55804.1"
FT                   /translation="MTSTVTPADTAPAPQNPLWRPLAGGFWEGLWRDGARHLHVYDPED
FT                   RTLVGTVMNATDHEVDKAIAFVARGHRQRAWPLWQRREAIEKAAARVAHDRERFARLIT
FT                   AESSKTLREADREVTRAMETLRLSAQASSALTGRSIAFDDTPRGEGWTGWYTREPVGVV
FT                   AAITPFNDPLNLVAHKLGPALIAGNAVVLKPSGATPVTALALVDVLLASGVPPEYLAVV
FT                   TGDTAGQALVANPAIDVVSFTGGPATADLIAHAGPARKLLMELGGNNARIACADADPEE
FT                   VAASIVDGAFGVAGQNCLSVQRVFVHNRLYRTVVDRVVEGASALVVGSKRDPATDIGPL
FT                   IDEDQARRITGWIDEAVDGGAVLRTGGVRTGTFVTPAVLTDVPRDAQIRTNEVFGPVVM
FT                   IDPFTDLDSVIDSANAVDTGLQAGVFTQDIDVALDLAAKLRVGAVLINSSPDFRIDAMP
FT                   FGGVKRSGIGREGVWSAVEALTEPKIVAARTQRP"
FT   CDS_pept        complement(293713..294759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03060"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55805"
FT                   /db_xref="GOA:C1BD61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD61"
FT                   /protein_id="BAH55805.1"
FT                   /translation="MTSMMMSPPHRRAEHAPDMVVMEGAVKRFPLPRRGLRRTREHVHS
FT                   IDGVSLTIKAGQVLGLVGESGSGKSTIARAILRLIELDAGTVAIDGLDTRTMKESQRKQ
FT                   LRRIAQLVFQDPHAAMDPRMTIADSLYAVLAQHRIGTRAERGLAISASLQEVGLDDTYL
FT                   GRYPGQCSGGQLQRVVIARALLLKPRLLICDEPTSALDASVQARVLNLLTRLRREHHLT
FT                   MVLISHDLRVVRFASDRVAVLYLGQIVEIADRDDLFEGSVHPYTLALLAAATHAHPCTG
FT                   HAEAAGEPPSPINPPPGCRFHTRCPLAVDRCRAEQPVLTEIAAGHSVRCHRWNDVRAAL
FT                   VHDKEKSV"
FT   CDS_pept        complement(294756..295757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03070"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55806"
FT                   /db_xref="GOA:C1BD62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD62"
FT                   /protein_id="BAH55806.1"
FT                   /translation="MPELLNVTKLSARFDGAPTSPVLDEVSFHIDRGEILALVGESGSG
FT                   KSMTALSLMRLLPRGAQMNASAITLDGVDLLGLSDRAMNKVRGGRIGALFQQPKRMLDP
FT                   TSTVGAQVAEPLRRYLGMNRHSARRAAVELLADVGIAEPDRRARSYAHQLSGGIAQRVM
FT                   IAIALAGQPQLLIADEPTTALDVTIEAQILALIAAKRTQLGMSVLFISHDLGVVSAIAD
FT                   RIAVMYAGRIVEEGTTADILAAPEHPYTQALINASMLKTTATGELYAIPGNASSARDLS
FT                   AGCRFRSRCSVAATAHVEHQCATTEPDLTAGRHEPHEHSTRCWAPIHLGESA"
FT   CDS_pept        complement(295759..296481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03080"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55807"
FT                   /db_xref="GOA:C1BD63"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD63"
FT                   /protein_id="BAH55807.1"
FT                   /translation="MRKAPPDNDVPKRTLAAVVTSQIRQRIFDGTFAPGMPLNEVELAA
FT                   QFRTSRGPVREGLQRLVQEELLVRTPHRGITVRVLTAEDLEDLYFARATVERAALIRLV
FT                   TRGAPASLIAELEQTLGRMSLAIHREDWVQASAFDLRFHEIAVYAAGSERLTTMYAQLA
FT                   GQTRLGLNMLVGTYKGRGDLLDEHQHLLRLITTGNLPALIEALDAHFGDAMNTLTTHRD
FT                   DTSAIAVAVAHTHQHHGG"
FT   CDS_pept        complement(296529..297431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03090"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55808"
FT                   /db_xref="GOA:C1BD64"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD64"
FT                   /protein_id="BAH55808.1"
FT                   /translation="MSLLDNPTAPAPSRPERPAPRRASTPSRAVHALRNTPVSLIIGIA
FT                   VIVAITVILVLTPWIMPYNPSAQNLSDRLAPSSSSHWLGTDQLGRDVLSRLMDGGRFSV
FT                   SIAAITLAICAVSGTLIGIVCARRRGALDQFVMRVTDVLLAFPEMIVAMFLVSILGAGY
FT                   TTLILALVIGGWTPFARLARGLTLEIDSRDFIEAARALGCSSTFIVFRHILPNALSPLT
FT                   AHAALRFGHKLITVGALSFLGLGVQPPDADWGSMLADAQPFMSAAPGLVIYPGLAIFIT
FT                   ALSVTLIGQGINARRSRQS"
FT   CDS_pept        complement(297418..298368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03100"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55809"
FT                   /db_xref="GOA:C1BD65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD65"
FT                   /protein_id="BAH55809.1"
FT                   /translation="MCSDRHRPTHVRARRHLADRLVRRLPHPVHHPGDPARKILRARVN
FT                   DVTMDPEVVERLRAAYGLDRPLVVQYFDWLAKAVTGDLGLSYTSRSPVMEMIGHALSVT
FT                   AILAVTSLLVALLFALPLGSIAAIKRGTPTDTVITTITQAFVAIPEYWLAPVLILMFAL
FT                   KLGALPSAGWTGPSSMILPCLTLALRPMSYFTQVTRASMVDVLESPHITASRARGLTFR
FT                   ETMVRHGVRNSLLPVVTLFSVWLAGLLGGSVVVEVIFAVPGMGRLLYDSVMNGDVPVIQ
FT                   ASIISIVALAVIITTATDVLYTYINPTVRSANVPA"
FT   CDS_pept        complement(298405..299682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03110"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55810"
FT                   /db_xref="GOA:C1BD66"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD66"
FT                   /protein_id="BAH55810.1"
FT                   /translation="MKLGSYWLDTAEPGADYRRNDVPAHADVAVIGAGLTGLSTALHVA
FT                   RAGASVVLLEEHTIGWGASGRNGGMATTGLAISFPTAVRRYGPERAREMFLAYNAAIDT
FT                   IEDLVTTEGIDCAFERTGKLTLACKPSHYTGFERSAELISKYTGQDVALIPPQDIRDEI
FT                   GSSFYHGAMVDPLGAGVHVGKLVHGLARAAAANGVSIHEGCKVTAMTKRDGYQHDIQTA
FT                   RGVVRADQVVVATSGYTGGLTPWLRRRIVPIGSFIIVTEPLPQHVVDELLPRKRVAADS
FT                   KHLLYYFRITPDNRLLFGGRARFAMSNSGSDIKSGQILKRAMTKVYPQLADVGIDYCWG
FT                   GLVDMSVDQMVHAGEQDGLYYSVGYSGHGVQMATHMGKVLSHIVTGDTTANPWRDLTFL
FT                   PVPGHFGPPWFLPPAGAFFRVLDLVR"
FT   CDS_pept        complement(299679..300380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03120"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55811"
FT                   /db_xref="GOA:C1BD67"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD67"
FT                   /protein_id="BAH55811.1"
FT                   /translation="MELSDFEPKFITFDCYGTLTNFQMAEAVAPLIKDTIAPADVAAFN
FT                   ADFRAYRMDEVLGPFKLYPQLLRDSWLRACNRWRIQFKPSDVDAIIEAVGSWGPHPDVP
FT                   EPLAALAAEYPLVILSNAVDSMLARNIEQLGVDFHRVFTAEQAGAYKPRYRAFEYMLDQ
FT                   LDAKPSEILHVSSHIWYDVIPAHELRITHKVYVNRGYDPSTPFYGYAETTDLGGVPALL
FT                   GLRAMSTADAS"
FT   CDS_pept        complement(300403..301908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03130"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55812"
FT                   /db_xref="GOA:C1BD68"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD68"
FT                   /protein_id="BAH55812.1"
FT                   /translation="MAGALAATACGSFEGSTTSGSGSADNLTVSLQFTPRANYSLETDD
FT                   AFVLSQVGCLETLVKYDAEAGALVPLLATEWVQTEPTAWDFTLREGVKFQDGTDLTTAA
FT                   VVASLQYLLRADAPPRAFTPKLITSVEALNDSTVRIRTPEPSALVPFRLASINTGILAP
FT                   AAYTGTGIDPLSHCTGPYTPVAQTPAQSMTLEGNTAYWGGNVPLKSVTARFIPEGATRA
FT                   TQVRTGESQIALGLPASTVPELEGDARIKVSSAFTPRTTGLYFNQSRAPFDNPEVRKAV
FT                   QAAVDVESITASVFGGQAHPAIGPFAPTEAWAPDSQPVNRNLDQARRLLTAAGYAPGQL
FT                   KLTLLAYTERPEFADLAAVIQANLAEIGIDVGVQVSDYSAIEPSLLDGSYDLALLSRNH
FT                   LTDIADPLGFLTADYSCGGGFNISQYCDPAIDAQLSAANTENDPQRRNAIYADVASQLQ
FT                   ADAVTTFIAHEQTTAARLETIESFVDDPLARYAVTPDLTVSNS"
FT   CDS_pept        302639..303898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03140"
FT                   /product="putative CDF family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55813"
FT                   /db_xref="GOA:C1BD69"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD69"
FT                   /protein_id="BAH55813.1"
FT                   /translation="MGSHAPKHEHGAHAHSRTASGHADHAHDDQRHENHGHGDHSPGHG
FT                   HPHGDHDDQRHDDHSPGHGHGHGHGDHDDHDHGHGALAKLKHIFVPHSHDANEAIQSAQ
FT                   ESSGQGIRAAWIGLAGMMTTAILQIFIVAISGSIALLADTLHNLGHAMTTIPLVIAFRI
FT                   GQRAASKRYSYGYRRAEDLVGVLISLVIAASAALIIYESIDALINPRPLTNLGWVFAAG
FT                   LVGALGNEVVAVYRIRTGRKIGSAALIAEGQHARADGLTSIAVVVGVIGVWFGFERLDA
FT                   IIGLFIAAAILWILFNSMRTICRRLMDGVDPGVIESMTTTVAAVDGVVDVDRVRARWSG
FT                   HRMEADANVVVSKGLSVVDGHHIAEQVQHQLLHTTPHLEEVVVHLHPDLSAGELDELHE
FT                   LSGHHASAEARSRYLAKTRR"
FT   CDS_pept        304006..304611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55814"
FT                   /db_xref="GOA:C1BD70"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD70"
FT                   /protein_id="BAH55814.1"
FT                   /translation="MSGDTTSGEHDFVVRELTIDDLPEARALMLRSVVEDFGDEYDPRV
FT                   HADIDDMIGWYLEPEGPFMLVVADRATGELLATGGIRGGALKEGLSPQNLVERYRDGHT
FT                   GQLVRVYVLREHRRRGIARIVVDAVLERVAQEGIYATIALHTFRHSPGAIPFWLSMGAR
FT                   IIEDDTTGISRAIFLEIPVDDATAAHCCKSTAYSQSSI"
FT   CDS_pept        304667..305101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55815"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD71"
FT                   /protein_id="BAH55815.1"
FT                   /translation="MTKRRDLFIFVPETGKAEQAQAYLGEWLRSLDGHPGYLGGSVLKE
FT                   VANELLPDTLVLVLEFESTEAARALWPKIENTVNPLYPDDKSDKSPDQGTAFFDGTKQA
FT                   VAAGGPLPLKFTRGNGLLARMLHIHAAEVDEFATAATAAV"
FT   CDS_pept        305148..306404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03170"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55816"
FT                   /db_xref="GOA:C1BD72"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD72"
FT                   /protein_id="BAH55816.1"
FT                   /translation="METTGILWHPQTHMPTAPQERLVITAGDGAWVTTEDGQRLLDLPA
FT                   GLWYANVGHGRARIADAAAAQIRTLETYHLFGAHANKPALELAERVSALLPIDDASIFF
FT                   TSGGSDSVDTACKLARRYWNVLGKDTKKTILSRRGGYHGLHGFGTSIAGLDFNREGYGT
FT                   ASLIPDTARVPQTDLAGTAEVIDRLGPENIAAIIVEPVIGTGGVVPPPEGYLPGLAALA
FT                   KNHDILLIADEVITGFGRTGHWFGCTRWGIEPDIITMAKGITSGYLPLGVVGIAPRVAE
FT                   PFFIGADAPIFRHGLTYSGHATACAVASANLDIIEEEDLVRRAADLEPVLAQALTPLTR
FT                   SPFVAEVRAIGLMAGIQLHPDIDGNEVVRDCRREGVLTRLLADNTLHVCPPFVITKEEI
FT                   EFAMSVIGDQLSALEDKAA"
FT   CDS_pept        306506..307879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03180"
FT                   /product="putative succinate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55817"
FT                   /db_xref="GOA:C1BD73"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD73"
FT                   /protein_id="BAH55817.1"
FT                   /translation="MIDPATERIVATAPDCSVADARLALTAAHEAGDTWARFPLRARAG
FT                   ILHRLFALVHEHRERLAVTISLEVGKTLAEARGEVDYAADYIRWYAEEAVRPAGRSTPS
FT                   PDGRSHIVTVAEPLGPCLLITPWNVPLAMATRKLAPALAAGCTAILKPSELTPLSSLIL
FT                   AELALEAGLPPGVLSVLPTTEAAPVCAALMADDRLRKVSFTGSTAVGRILLEQGGRRVL
FT                   RMSMELGGNAPFLVFDDADLDTAVEEAMIAKMRMGGQSCVAANRFLVQDGVADQFADAL
FT                   AARVNAMRVGPPGTEGVDLGPLVSAPAVAKARRLVEDALARGASLRAQAKVPDGPGFYY
FT                   PPTVLDNADRGALICREEVFGPVAAISRFRTEDEALALANDTEYGLAAYLVTRDLGRAS
FT                   SVAGRLQAGMIGINRGLVSNVAAPFGGIKQSGLGREGGAEGLLEYQQTKYLAVPPLYS"
FT   CDS_pept        complement(307968..309143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03190"
FT                   /product="putative sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55818"
FT                   /db_xref="GOA:C1BD74"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD74"
FT                   /protein_id="BAH55818.1"
FT                   /translation="MTQPSKDDAEVAIVGLGAIGSMALWRLAERGVRVHGYERFGVGHD
FT                   RGASAGQTRRFSAQSQRVHQCTPLALDALGLWRELEHTTGRGLLEITGGLILGPNDSDA
FT                   LILAHQSAMAAGLEHELLDSTELARRYPQHLVRPTDAAITDPFGGFLRPELSVVTAVDR
FT                   ARALGATVSDYTRVLGVEPDGAGVTVRTAEGVRRYSRVVVAPGPWARDLLPAAAATVLP
FT                   RRLVQAWYLPRDVDAYRSSRFPVFERVGDIRAYGFPTIDGATVKVGIYTSGHPIVYDTE
FT                   NPALTVGHSIVRYFRDVVEEYFPGLHPDPITTTVNMEGYTTDGQPMVGAVPGTEQIVVA
FT                   CGFSGAGFKFAPVMGDVVADQIIEGSTDRDVEFLAPGRNLQEWAPETRTPA"
FT   CDS_pept        309306..310604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03200"
FT                   /product="putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55819"
FT                   /db_xref="GOA:C1BD75"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033845"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD75"
FT                   /protein_id="BAH55819.1"
FT                   /translation="MDGETTVTTSRDTELVSLRRALHAHPELGFCEIETAARIIDELAT
FT                   AVDTLEFGSTVCAVAELAGLPPAEELDHARRRALEAGIEPELVERLGHGNTGVVASVRG
FT                   RRPGPVIALRCDMDGLPITESEDAAHPPFRGGFASEVSGIMHACGHDGHVAIGVTLAKR
FT                   LAEDRNFAGELRVIFQPAEEGVRGARAMVAAGAARGVDVMLGLHLGIGLDVGTVASSTS
FT                   GVMATEKWKIELTGAPAHAALAPSEGRNALLGAATIALGLHALPPFAQATTRVNVGKMT
FT                   AGTSANIIADSAEIHCELRADDTDVFAELTSRARDVVLGAAGMYGLGARIDVIGSAEVA
FT                   VCDSEIARALDRCAHTVDDITNALPTAPMSASDDVTLFMADVQRRGGKATFVLVGASSP
FT                   APHHHPRFDIDERSLPIAADWLEQFIRTQDYHR"
FT   CDS_pept        310670..311416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03210"
FT                   /product="putative GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55820"
FT                   /db_xref="GOA:C1BD76"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD76"
FT                   /protein_id="BAH55820.1"
FT                   /translation="MEISGGARVGSATGASATENAYRHIKRLILTSELAPGTELREATL
FT                   SESTGFGRSPVRESLRRLVQEGFVDVRARQGYRVSVVTMASVRDLFEMRLLLEPAVVEL
FT                   AAERAPMAELEALHSLAHQTYVSGDIHSYEKFLEDNREFHVRIAQASGNEIFTRTLRTL
FT                   LEEMQRLFFISLDGSDSVSEQMHEHHDLHDALLARDGTRAREIMIAQIEASRERVMEGL
FT                   VGAAQRPRRAATGVVLSSSSSSKRGY"
FT   CDS_pept        complement(311571..311768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03220"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55821"
FT                   /db_xref="GOA:C1BD77"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD77"
FT                   /protein_id="BAH55821.1"
FT                   /translation="MRPAEPAPVPTPIRWWRLGLWSRNRLMRRSDRYEAVIVLLTVMLV
FT                   LLLIPFAGTFGTATHTRLDT"
FT   CDS_pept        complement(311878..312201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55822"
FT                   /db_xref="GOA:C1BD78"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD78"
FT                   /protein_id="BAH55822.1"
FT                   /translation="MNSNDKNTDYDELAEWAEHDMTLPKDSATAKRGADAAAAGKALLE
FT                   RVGAGRPSLAQDAGISGASPKRQVRLPLPLSNKLDELAQRQHRKPSELMREAVEEYIQK
FT                   HSA"
FT   CDS_pept        complement(312314..312589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55823"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD79"
FT                   /protein_id="BAH55823.1"
FT                   /translation="MAVEWANSADKHGIDHEDALHAIENALYVEQEFDEPRVPGHAKPW
FT                   LFIGPPRTLGGPLLEVMVEIVPPRGMVVFHVMEAREKHLARMRDRP"
FT   CDS_pept        313241..313891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55824"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD80"
FT                   /protein_id="BAH55824.1"
FT                   /translation="MLKDAGLVGDRAVGTRRIYHLDPAGISVLRSQLDRFWAQALTAYK
FT                   DAVEQPAGEVMTQTHAESVHKQVVVNAGVERAFSLFIERFDAIKPREHNIMAVPIAETV
FT                   FEPRVGGNIYDRGVDGTECRWARVLAYEPPSRVVFSWDINGHWQIETDPAKTSEVEVRF
FT                   IAESADRTRVEVEHRNLERHGPGWEAVRDGVEHDAGWPLYLQRYRGAVDSEQH"
FT   CDS_pept        314006..314350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55825"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD81"
FT                   /protein_id="BAH55825.1"
FT                   /translation="MDGDGTSQVGEKCLTTRRIGFAERPVTSELTHIDPPRTWGVHGVD
FT                   GPIRAVVNVSVDPLDSGHRSRVTIAVDFEGHGIGKVLVPLAVRPQARKEMPSNLAALQQ
FT                   RLEASPAQPN"
FT   CDS_pept        complement(314386..315684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03270"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55826"
FT                   /db_xref="GOA:C1BD82"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD82"
FT                   /protein_id="BAH55826.1"
FT                   /translation="MSTTSPRPIRLGLGPNLAQFSLLVAVNALVGGMVGQQQTVLPLLA
FT                   SGEFALTGYTFIFTYVAAFGITKAAANYLAGTFSDRYGRKPVLLVGWLFAIPVPLMLIA
FT                   APNWWWVVAANVLLGINQGLTWSTTVVMKIDLVGPARRGLAMGLNEAAGYGAVAVSSLL
FT                   AGYLAEQFGLRPAPFLLGLAYTALALLLSGVFIHETRDHARLEAAQHIPRADGAHDHLH
FT                   ADLTDRQIAMATSFTEPALSSASQAGLVNNLNFGLSWGLFPLLFATADLGAGQIGLLFA
FT                   LYPGVWGAGQLVTGALSDRIGRKHLITAGMTLQAAALALIAASDAFLGWAAGTVLLGAG
FT                   TAMVYPTLLAVIGDVAHPAWRGRAVGIYRVWRDSGYAVGAIAGGIVADLMGMHAAVWAA
FT                   AAVSGACALVVAARMYETHPKPIRTSTQRAPKG"
FT   CDS_pept        complement(315681..317060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55827"
FT                   /db_xref="GOA:C1BD83"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD83"
FT                   /protein_id="BAH55827.1"
FT                   /translation="MAGIDLVPLIDEGLGNSAYLVDLGDGRALAVDVSRDLRAVHAAAA
FT                   RRGLTVAFAADTHLHADFLSGAHQLGATGGTRVLASAAGDREFPHTGLRDGDEVDLGGL
FT                   RLRALMTPGHTHEHLSFLLLDGEKEVGVFTGGSLIVGSAARTDLLGPDRTEVLARAQYA
FT                   SLQRLAALPGDVAVWPTHGAGSFCSAPPGADRTSTIARERATNPLLATRDEDTFVDQLL
FT                   GSLGSYPPYFLRLGEINRLGPPLLDQDPVLPALTVDTVRARLAGGAALIDVRPLARFAA
FT                   AHIPGALSIPLRPVFASWLGWLAPADRPLIIVRDPDQDVNEIVWQALKIGYDNLIGELG
FT                   GGLAAWTAAELEVAATALTGPDGVEGVRVLDIRQRPEYLAGHLPGAVHIELGALPGRVD
FT                   DLPDEPTVVMCGHGERAMGAASLLERAGHRNLTVFEGGPDDWAAATGRTLETGTSAKTG
FT                   A"
FT   CDS_pept        317152..317805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03290"
FT                   /product="putative ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55828"
FT                   /db_xref="GOA:C1BD84"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD84"
FT                   /protein_id="BAH55828.1"
FT                   /translation="MGDRIAKTELFDQFARVGKALGSGKRLELLDLLAQGERTVDGLAR
FT                   AAELGLTTASAHLQTLKQANLVATRREGTKVFYRLAGADVAQLFALVRTVANEHLPDVE
FT                   AARAAYLGPDTDQVSKDELLERARSGKVTVLDVRPREEYEAGHIPGAVSIPWDELADRL
FT                   ADLPEDQEIVAYCRGAYCVFAHDAVRLLTDHDRQASRLADGMLEWRLADLPVAT"
FT   CDS_pept        complement(317828..318388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55829"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD85"
FT                   /protein_id="BAH55829.1"
FT                   /translation="MLRRSQARAVMSRSKRVDRREIAGEFERVRAEFHRLVGGASSEGF
FT                   DRPSEGTRWTNEQLLFHMVFGYMVVRRLLILVRLLGRLPDGVSRRFAAAQNASTRLFDE
FT                   VNYRGTCQAARVFNRHRMVRQCDKVIDSLLRSLAAEAENDLQRGMHFPGRWDPFFADYM
FT                   TLEDLYRYPAQHFDFHRRQLTLD"
FT   CDS_pept        complement(318755..320107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55830"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD86"
FT                   /protein_id="BAH55830.1"
FT                   /translation="MDVSIIETSSLGDRSYLVSDGAVGVVVDPQRDIDRVLALAHDRDV
FT                   RITHVLETHIHNDYVTGGLELARTTGAEYVVPTGDDVDYQRCAVSDGDLIDAGPIQLQV
FT                   MHTPGHTHHHVSYVLRETTGGIRGVFTGGSMLFGTTGRTDLLGNDHTRELTHAQYHSVR
FT                   RLAGALPADTKIYPTHGFGSFCAATPASGDSSTVGEQRTTNPALTQDEQSYVEELIAGL
FT                   GDYPAYYAHMGVINTQGPTPVDLSLPKLVDPDELRRRIDDGEWVVDLRERTAFAAGHLG
FT                   GTLGFELSDSFVTYLGWLYKWGAPLTLIGENEDQVTDARRELVRIGIDDLAGAAVGEIH
FT                   TLVTGTELRSYRVADFPALAERLPEHDITVLDVRQRNEYDSSHIDGAINIPLHELADRQ
FT                   GTLPDGEIWVHCASGYRSSIAASMIDRPDRTTVLINDEYDNAKDTDITSTP"
FT   CDS_pept        complement(320194..320967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03320"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55831"
FT                   /db_xref="GOA:C1BD87"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD87"
FT                   /protein_id="BAH55831.1"
FT                   /translation="MEITIALALGAIIGVLLGLLGGGGSILAVPALVFGLGLDLEQAIP
FT                   ISLLVIGVASLVGAIPKIREHQVNWRMAGVFAACGIPATFAGSAVGRLLPQSVVMVGFA
FT                   AVMVLAGIRMLMDRGDTGTACEVGDSGIDWRRCAPRSIPAGVAVGFLTGLFGVGGGFLI
FT                   IPALVLMLGLDMSVAVGTSLVIIVANSAAGLVSHLSGASIDWAITAAFAGTAIAGSLIA
FT                   GHFGTKVDTDKLQRWFAYLVFVVAAYVLVDTILLR"
FT   CDS_pept        complement(321012..321425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55832"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD88"
FT                   /protein_id="BAH55832.1"
FT                   /translation="MTLALSTTLHTSFADAVDRTRKALADQGFGVLTEIDMKATLKAKL
FT                   GEDMEDYLILGACNPPLAHRAVTVDRQIGLLLPCNVVVRADPADPGAVLVDAMNPQVMV
FT                   QVADQPGLGAVADDATAALQAAIDTLSQDTGDR"
FT   CDS_pept        complement(321486..321734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55833"
FT                   /db_xref="GOA:C1BD89"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD89"
FT                   /protein_id="BAH55833.1"
FT                   /translation="MTDALPARGWTIERVVPLLAGTMVLASLALTVAFSLWWLLLTRFV
FT                   GANLLLFGAAGWCPASLPLHRLGVPRLVAASPAPSGR"
FT   CDS_pept        complement(321780..322052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55834"
FT                   /db_xref="GOA:C1BD90"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD90"
FT                   /protein_id="BAH55834.1"
FT                   /translation="MVGDEDSIALVLNRLRRAHGQLAGVISMIEQGRDCKDVVTQLAAV
FT                   SRALDKAGFKIVATGLRECLTGEAAEKGKEPMTEAELEKLFLALA"
FT   CDS_pept        complement(322147..324687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03360"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55835"
FT                   /db_xref="GOA:C1BD91"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD91"
FT                   /protein_id="BAH55835.1"
FT                   /translation="MREVDLGEFAVRWADGVPVVDVRERWEYVDGHVPGALLMPLGQLA
FT                   AHTVEIPAGEVVYVICASGNRSREGARIVEATGRGAVSVAGGPRAGPPWAGRSTPETDR
FT                   ERTLTPDLADTRCQRFAITSRRTCMTRSTALGGDAPRTEPITEGGVLGRMGAAMAGHAK
FT                   WVFGIWLILLVALGAAAPSVFSSLAGAGWQANGSESVQVRELAEQHFGGNSSAAVQVVV
FT                   HSDTQTIDSPQMQHTLADVGTVFAGDPRFGAVIAPQPGTSISPDGHTGILIAGANASTD
FT                   DMVKAVDERKAELTALSGDGIEVYPTGASALWSDFNKANHDAMIQAELFSWPVTLAIMV
FT                   LAFGSLVAAGLPLLLTLAGLVASAGGLVLLNQVFPISVWAMNFAMMFALALGIDYALFV
FT                   VARFRDAIRHASSPRAAVADTMETAGKAVVLSGITVLVSLSAVLLVPAPAVRTMAVGIM
FT                   LAVFFVLLASMTLLPAALGALGGKVNAGSLPYAKRQIHRSPRFAAWGELLHRHPWPFAI
FT                   GALLVLIALSVPALGLKVAMPSIEVVPTDAPVRQGYELVQAQMGEGAPGMLQIITPTTG
FT                   GAETAAAAAATDGIAMVTPPQPAPDGSDYVMLQAMPTVDPSDTRMGTILDTLRADLPQG
FT                   ALVGGAPAENLDLQQALNDYLPLIVGIILVLGFVLLLVALQAPLIALLGTVVSLLSTAA
FT                   AFGVAKLIFQDGHGASLLGFTPQGFLDGWGPAFFFAMIFAIAMDYTVFLLATAKEHYEH
FT                   SGDPTVAHVDGLAHSGRVIFAAAAVMVAVFFTFALADPLPPKEMGIILGVAVLLDAVLI
FT                   RLILLPVLLRLTGHAAWWSPAWLRMVLPKINFSH"
FT   CDS_pept        325046..326425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55836"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD92"
FT                   /protein_id="BAH55836.1"
FT                   /translation="MILEQYYIECLSHASYLIGDESTGRAVVVDPRRDIGEYLDDADKH
FT                   GLRIEGVINTHFHADFVSGHLELVEATGSWIGFGEAAETDYPIRRLRDGERIRLGEVEL
FT                   EILSTPGHTWESISVLVRERAGVTPTAVLTGDSLFIGDVGRPDLVNLGHGSNTDLARAM
FT                   YRTVHEKLLTLPDQVTVMPAHGAGSSCGKNLSTELSSTIGEQRATNPSVQPMSEDAFVA
FT                   LVTNGQPAAPSYFSVDAAMNKQVHPLLSRDRAIPELSPERVRAELVAGTRVVDARSVDD
FT                   FAAGHLCGSVNVGFDGRFAETGGMVAEVGEKLVLITYPGEEQDAAVRLARIGSDDTVGY
FT                   LSVGHDGHFPAELADLVQSALRTTVDELDALLAADAVTLIDIRNPGEREFGTIPGAAPI
FT                   PLAQLHTRLEQIPTGKPIVVHCAGGWRSSVAASLLRAQGFENVSDLLGGYNAWAEAHVP
FT                   A"
FT   CDS_pept        326580..326840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03380"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55837"
FT                   /db_xref="GOA:C1BD93"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD93"
FT                   /protein_id="BAH55837.1"
FT                   /translation="MFEKSSATHPDIVHAKVDTEAEQQLAAMANIRSIPTIMAFRESVL
FT                   VYSRPGYCPHAPSTTLIGRVKALDMALVHATVAERRAVAGA"
FT   CDS_pept        326888..327061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55838"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD94"
FT                   /protein_id="BAH55838.1"
FT                   /translation="MCYPVTCANCGNTGWGGCGRHLDTVMSSVPTADRCTCRQDTTPVQ
FT                   DQRRTLRSFFRR"
FT   CDS_pept        complement(327245..327571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03400"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55839"
FT                   /db_xref="GOA:C1BD95"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD95"
FT                   /protein_id="BAH55839.1"
FT                   /translation="MRFLQQSPAHTMSDACRAWVPLLTANPAHLAVDYLFSDYDEGVTA
FT                   DDWRTRAEKRFIVIILGLILLVIGFVAGISILWTIGIILLVIGVILALLGATGRAVGGR
FT                   RHWF"
FT   CDS_pept        327995..328390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03410"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55840"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD96"
FT                   /protein_id="BAH55840.1"
FT                   /translation="MADVVDRFEVLTDKQWELLALLLPSSDGLRGRKFRNNRVVVEGML
FT                   YRLRTGLPWRDLPSHFGPWKTVWKRHRRYAGDGTWDRVLTALVAMADAGGNLDWAVSVD
FT                   STVVRVHQHGANAARHTGGSTELHEPA"
FT   CDS_pept        328335..328904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03420"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55841"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD97"
FT                   /protein_id="BAH55841.1"
FT                   /translation="MRTPPATQGDLPNYTNLRDEPADHGIGRSRGGLTSKAHLACDGHG
FT                   RPLSVLVGPGQAGDSPMFAHVLEGICVPRLAGGAHRTRPVEVRADKAYSSRANRELLRS
FT                   RGIKAVIPEKTDQAANRVNKGRAGGRPPNFDPESYKGRNVVERAFNKAKQWRAVATRYD
FT                   KLALTYRAGFLLAGIVEWLKLLGDMP"
FT   CDS_pept        329116..329766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55842"
FT                   /db_xref="GOA:C1BD98"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD98"
FT                   /protein_id="BAH55842.1"
FT                   /translation="MVIIRFPGVYRPQHDSRLLLESLGDEQVHAGTRILDLCAGTGVVS
FT                   VWATRYGARSVTAVDVSRRALVSTWLNTAVRGHRVRVVRGDLVSRVRHRRFDLIVANPP
FT                   YVPAEHDGLPARGRARCWDAGHEGRALLDRICGDAPDLLDDGGRLVLVQSTLSGTEKTR
FT                   LMLGERGLHVEEARRVRVPFGPVLQARRDLLVDRGLIGPQQCTEELVVFRAVK"
FT   CDS_pept        329819..334276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03440"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55843"
FT                   /db_xref="GOA:C1BD99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BD99"
FT                   /protein_id="BAH55843.1"
FT                   /translation="MTPSGSSGRLVPLTAAQQAIWLAQQLTPDVPYVIAQYVDLTGPIE
FT                   VEKLCEAHTRAMDELGAEVVLADVDGQPYQRERTRSAGQVLVLDFRAERDPAEFAREWM
FT                   RRDCTVPLAMDDYSLIFSRVLRVGDDRVFWYSRAHHLSLDGYAAMLLMQRTAQWYAAAL
FT                   GGDEPDPHRVVGPEQLSRADRDYRSSPRFDTDRKYWARLAPDLPPVVSLAGRSAAPRPA
FT                   VRVTGHPTVVSSTPMPGGRSVLDRTAVLVAAFAAYLARMTDVDDVMVSLPVTARTTGPL
FT                   RAATGSVSNVVPLALPGIGATTVEEAIGIARAALIASLRHQRYRREDIGRERGTAAGEL
FT                   TSFGPVLNLMLFEPDINLGAVTGRVHVLTTGPTADLAVNIYPGTTDLMPRIDFEANPAL
FT                   YSQRQLSSHHRRFTHFLQTFLAEIGEDCAVADLELFLPGEREVLTPARGPADAEPATLT
FT                   QLLTTGTGASGERIAVRDRGRSFSYRDLDRHSTALAGTLLGAGIGPEDLVAVAVPRSYE
FT                   SVVAVWAIAATGAAYVPIDPTHPRARIQYMLDDCKPVAGLTSSDTRSQLPDTLRWLTVA
FT                   LDALDALDALDALDALDALAVPPPRPPRPVRRENAAYVIYTSGSTGAPKGVVVTHDGLA
FT                   NLAQEIRDHYALSATSRILHFASPSFDTALVEVLAAALAGATLVVTPPDVVGGHELADL
FT                   LRCEGVTHVLSTPSALATVDPAGLDDVELVLVGGEACPPELVARWAHHRTMRNAYGPTE
FT                   TTCSVTLSAPMAPDRPVTIGALMRGVDAVVLDRRLRPLPSGAVGELYLGTPGLARGYAR
FT                   RGGMTAGRFVANPFGKPGSRLFRTGDLVRWTPEATLEYVGRSDDQVKVRGFRIELGEID
FT                   TALREHPDVRFATTVVHDRAGDALLVSYVLLRTSSALTPAMLRTAVAQLLPDYMVPAVI
FT                   TVLDDVPLTPTKKLDRAALPTPDFGSAAPSARPPRTPDEHAVAGVLARVLCTDVVDAES
FT                   SFFDLGGDSLSATRVIAALNADFGTQLGVRDLFEFPTVAALAQLLAEEHPKSGELSSLR
FT                   AFATQPLPQRVPLAPAQQFLDRTATRPALYNLPFTVTIRGALDIEALRSATADVLDRHH
FT                   PLRTIYPDSVDGPHQRVLDAGDAVPDLTPTHVSASHLPAHTRPLLHRGFDVRSEPPLRA
FT                   TLFATGPEEHLLACVIHHISADGWSLAVLARDLLTAYAARAAGTAPSWAPLPVQYAHYS
FT                   LWRHDVLGDDADPGSLTARQIDFWKAELAGLPRELTLPADRPRPQRWTYAAGRLSFAVD
FT                   EETHAALLTTAHARRATLFTVLHSALALLLARLSSQRTIAIGIPTAGRTHPDLDEVVGM
FT                   FVNTLVLRSTVDPGTTVADLLDQSRATELNAFAHADVPFEHLVDVLDPPRSPSLHPFFQ
FT                   VALSLNNFTAATLDSDGLEFEIAPQPLDIAKCDLHFHFTDHHSAKGHPAGIDCELVYSA
FT                   DLFDHDTVAGFLPVLRTILAEAVG"
FT   CDS_pept        334314..335732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03450"
FT                   /product="two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55844"
FT                   /db_xref="GOA:C1BDA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA0"
FT                   /protein_id="BAH55844.1"
FT                   /translation="MSVTLNTMDRRSLHPGNWNVRVRSTAAAVLAVTVCLLLAGGALLF
FT                   VLYRNLEHSARGAADSRSHQIIEQLHSQPPQELDASLLATDGQIGAVHILDNQGSVLVT
FT                   SAGIPSSPVLAAPLPPGESAYLGNLHFGHERDYWVAAHGTMSPNGPVTVVTGADREPVE
FT                   GVLATVAALLAIGAPIVIGFVAVATYRLIGAALRPVERIRARVASISTDQLDERVPVPA
FT                   ARDEVADLAVTMNSMLARLEAGHLAQRRFVGDASHELRSPLATITAALELAQSRPELID
FT                   TALVDESLLPEARRMHALLEDLLLLARADEDSLTHLRVDVDIDDLILAERARLRGLPGI
FT                   VVAAAVDPVRVAGDAEQLARLVRNLVDNAVRHAHTRIALACRRCEGSAVIEVADDGPGI
FT                   ASADRARIFERFVRLDTPRTRASGGSGLGLAIAAEIVAAHHGSIEVRDHEGGGAHFVVT
FT                   LPIGDDSYSSEPIE"
FT   CDS_pept        complement(335708..336382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03460"
FT                   /product="OmpR family two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55845"
FT                   /db_xref="GOA:C1BDA1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA1"
FT                   /protein_id="BAH55845.1"
FT                   /translation="MRVLLVEDETRLAETVRRGLVADGCTVQVEHDGVAGLAAAVGGGF
FT                   DVVVLDIMLPGKHGYDVVREMRRQQVWTPVLMLSAKDGEYDLADAFDLGADDYLIKPFS
FT                   FVVLIARLRALVRRGAPPRPPVLSVAGLSLDPAMRRVTRGETRLQLTPREYSVLEFLMR
FT                   HAGSVVTKHDILQAVWDANYEGDDNIVEVYIGYLRRKIDAPFGTTSIDTVRGVGYSMGS
FT                   EE"
FT   CDS_pept        complement(336495..337025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03470"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55846"
FT                   /db_xref="GOA:C1BDA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA2"
FT                   /protein_id="BAH55846.1"
FT                   /translation="MHDEVAPERGGARQARLVARFQAALLALSVLSCAFVAIELASLRH
FT                   WRSTEQIVPWIVLSVLFCSTLIVVFNRSRIAIVQARLVALCAAPAALFGVYEHVSANLD
FT                   TGVLNHKYTWAELPGWEHLWLASTGAVGGTPATAPLVLALAGVLLGLATVGMAPGAARD
FT                   DLAKRVAVSRVRT"
FT   CDS_pept        complement(337040..337291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55847"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA3"
FT                   /protein_id="BAH55847.1"
FT                   /translation="MTPGGSGSATEVAQVDPNTASQSQIQAAFEAAGVSNAGKWAKEVT
FT                   EYGPYSPDTISDTLTKELGKYGIDQQTLDTILSVLAPQ"
FT   CDS_pept        337745..338476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03490"
FT                   /product="putative MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55848"
FT                   /db_xref="GOA:C1BDA4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA4"
FT                   /protein_id="BAH55848.1"
FT                   /translation="MAELLISELSRRSGVPATTLRYYEQVGLLPAARSHSGYRLYDEHA
FT                   EQRLRFISAAKRLHLPLPEIFELLTVWEDEACRSVKSQLRPALDARITEAANGIDELTR
FT                   LHTELVAARGRLDSLPDRADRCDPQCTFLLDPVTVQGMDVATADRPIACTLDGDDYRTR
FT                   IDAWHSLLDGCPREQVDTGVRVTVPAESAAELAALIVAEQHCCAFLDFTLGFDRDTVAL
FT                   TITAPADARALIDDLITPTAP"
FT   CDS_pept        338473..338802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03500"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55849"
FT                   /db_xref="GOA:C1BDA5"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA5"
FT                   /protein_id="BAH55849.1"
FT                   /translation="MTVARSVALFVLAAIFEIGGAWLVWQGVREQRGWLWAGFGALALG
FT                   AYGFVATLQPDANFGRILAAYGGVFVAGSLLWGMALDGFRPDRFDVTGALICLVGLAVI
FT                   MYSPR"
FT   CDS_pept        339048..339449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03510"
FT                   /product="putative oxidoreductase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55850"
FT                   /db_xref="GOA:C1BDA6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA6"
FT                   /protein_id="BAH55850.1"
FT                   /translation="MFLCCRAVLPGMIHARRGSIVNIASMAGFHYTVNHVAYAVAKAGV
FT                   VALTRDVGYEAAPHGVRVNAVAPGPIAAPTSSARERDILETLGNAVPLGGCADPQDIAD
FT                   AVAYLASDRARYIVGTTLMVAGGADLRVS"
FT   CDS_pept        complement(339805..340113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03520"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55851"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA7"
FT                   /protein_id="BAH55851.1"
FT                   /translation="MPMRWWRLGPWSRNRLMRRGDRLEAVIMLLAAVLMVMLVPFAAAY
FT                   GTATHTRLEQQAQALRRRASGARGSARGRPARPRQNRCLAPFRREPGLCPRPMVGGR"
FT   CDS_pept        complement(341042..342070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03530"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55852"
FT                   /db_xref="GOA:C1BDA8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA8"
FT                   /protein_id="BAH55852.1"
FT                   /translation="MNEYDGSQVVGIDLHRQRSVIVRQTAEGEQLSAVRIVNDPVALGL
FT                   QIEKAGANPEVVLEATYGWYWAVDALQAAGACVHLAHPLGVKGFRYRRVKNDVRDAGDL
FT                   ADLLRMHRLPEAWIAPPATRELRELVRYRAKLVALRSGLKAQVHSVLAKAGVLIRVSDL
FT                   FGVEGRERLTQVPLGVAYAQRVISLLELIDVLDAHEGRFFDRIAAELRGHPGYRAIQAL
FT                   PGVGPTLAAVFVAEIGDVHRFADPGHLCSWAGLTPKHRESDTVVHRGHITKQGSKLVHW
FT                   AAVEAIQREPAGTKISVDRQRIEARRGRNIAKVAAARNCSPSSTTGCVTERSARWPQRA
FT                   TA"
FT   CDS_pept        complement(342157..343032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03540"
FT                   /product="site-specific recombinase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55853"
FT                   /db_xref="GOA:C1BDA9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDA9"
FT                   /protein_id="BAH55853.1"
FT                   /translation="MKPEGVDEQAGPRAAADRCAHEGLDRPDEYLRGQEVRGQHRPSWA
FT                   AGFAGIRPHGRCHRGAHLDRLGRTGTDTLNLIHDLHQRGISFRNLADPIRIDSTNPDDL
FT                   MAQLALVLLALFRQMERTYAVERAAHARSVATEKGRRVGRPSVVTDAQLAYAIQLRNDG
FT                   ATVAEITDKTGLTRSILYRRLPQQPSESVMVTGTECGSTSTVAAEQLRAQIGPMACPTC
FT                   GHLPTTAATPSPTATTSLSSGCTSTPATVSASDITGLAVSPTATSWWSAAADVALLPAP
FT                   RPATNCRNRS"
FT   CDS_pept        complement(342804..343019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03550"
FT                   /product="site-specific recombinase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55854"
FT                   /db_xref="GOA:C1BDB0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB0"
FT                   /protein_id="BAH55854.1"
FT                   /translation="MSTSKQDLARRQIDALTKAWIDQTNIYVDKKSGVSTDRPGLQALL
FT                   GYARTGDVIAVHTSTGSAGPAPTPST"
FT   CDS_pept        complement(343042..343236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55855"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB1"
FT                   /protein_id="BAH55855.1"
FT                   /translation="MSPRDDDYAIRDGENRVPPPPDSVIERVTPVLRAALLLRAEPDCK
FT                   TDAHRRVRPSNCRTQPSRP"
FT   CDS_pept        complement(343418..343759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55856"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB2"
FT                   /protein_id="BAH55856.1"
FT                   /translation="MTFSVGFPALTGLVPDRVEVIVEQHLTGAFVPHPSPPTYQNRLRV
FT                   STTIAVPARSAVTSSPVRMGPSPHSVRAMSATRVVGSVGNGIELSPRRVGIREIGALVC
FT                   VGSSRVAGS"
FT   CDS_pept        complement(344583..345338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55857"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB3"
FT                   /protein_id="BAH55857.1"
FT                   /translation="MLILSGATLTATLGTPGSVVHLCVRVPSSDRSLTVGAVRTLLVAD
FT                   LTRRVLEDVHRSQVTLTLLAPCPGSLVTPGNLDAWMIRPPVGVFDSADAAAAAVGAPVV
FT                   LMVTAAGDETAEPALTVGGAVGSEPLDDLIHAGHDPLTLRCVLLSTHYRQQAPPTMETI
FT                   ADAARLLHRWRQRVADWSTHISVPMPADIIEAAYRAFDRNLDVPAVLDLMRHLESDAAI
FT                   APGAKFETFIHLDRVLAFDLTRDLGGPHS"
FT   CDS_pept        complement(345503..345700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55858"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB4"
FT                   /protein_id="BAH55858.1"
FT                   /translation="MSFHLDHTAPGVADPPIYLSTIGAVIAALIMHGAGSPETTPSPGN
FT                   PLFDRLTLWSIYVRGVSVSH"
FT   CDS_pept        345774..346118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55859"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB5"
FT                   /protein_id="BAH55859.1"
FT                   /translation="MARAGRRRWVDWRYEIGVTAVVGPCLDAEVPQCGVATRARSSREP
FT                   NSHADHDHSPPARYGRSGREGNAPAAPVPRAQEGCGGRVWIGDARNCESAPTALEGGAP
FT                   RRSEITPESR"
FT   CDS_pept        complement(346586..346990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55860"
FT                   /db_xref="InterPro:IPR035165"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB6"
FT                   /protein_id="BAH55860.1"
FT                   /translation="MRDQLPPGLPLDPFAGDPTDPAAALDALEPDRPLDPQERLAVEAD
FT                   LADLAVFEALLAPRGIRGLVEHCEDCRHDHYRDWDMLRADLLQLLVGGPARPHEPAYAP
FT                   TPEAYATWDYCCGYADAQVNDAVHGPRFDA"
FT   CDS_pept        347126..347401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55861"
FT                   /db_xref="GOA:C1BDB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB7"
FT                   /protein_id="BAH55861.1"
FT                   /translation="MVDVWQGYVFSVSIRYFLMLTSTFLPCSARSNLVRKPPESWEAFR
FT                   TRRRVVPHRFPTRRGGLRVVDIGRSVNPGSNHGRDAHVANRTGVHV"
FT   CDS_pept        347457..348704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55862"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB8"
FT                   /protein_id="BAH55862.1"
FT                   /translation="MTVTELVARRGDLKGELLDFAQHARFGRQLTTLMRAAADLGPLDE
FT                   GILVRTLDHFVLENRLRDGGTVVERFVAQQRPRLTEDESQMLLGWRDVVEGYFEVHPAG
FT                   DGIGTTVFHNLVDDLRYRVHSNIGPDVFATVRPKMFVYGRIVPVHPATGHWLISGHRGF
FT                   LSGLRRPDPGPGRMEVVAADPGLLRRNRDLYERAWQLQADDRAAFVDLFGSDLVILPPT
FT                   TAPARLIEHYRRRLAQVGASVEADGTPTHPAAPGALTAEEMGRLPEDYLDADTVGLIYD
FT                   ETEGLNYYRDFGRLDAMFADPALAGDHTHITVLRGYLDDDTVSALPLRRLAGRHPAAST
FT                   VLRVLLRRPGFSRQRDGEDLLRTRKGAFFGQPAAPRFTVTGDRLAELLYTPSSEEGTVA
FT                   SGDPGSMGRSVIGVTD"
FT   CDS_pept        complement(348779..349123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55863"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDB9"
FT                   /protein_id="BAH55863.1"
FT                   /translation="MTEVDHIDVVGAQSVLEVAEAVAAVLGARMEMGGEPGRIVVTGAP
FT                   DPDLRVVIGLAINDRGIPERWTRRITISHDRGSDERRRWTQHLHRALTERRDWTLTQIP
FT                   GDPPNPHTPP"
FT   CDS_pept        349332..349637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55864"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC0"
FT                   /protein_id="BAH55864.1"
FT                   /translation="MGTKGQRRADRALVAAYHEARLGELIECVAAEVDRFRAGEVDAYA
FT                   VDEALHHYHLAAKQLWTFCWSGSGAQVEFTARAVERLAADGEAIDWWERATPRRRE"
FT   CDS_pept        complement(349917..351179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55865"
FT                   /db_xref="GOA:C1BDC1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC1"
FT                   /protein_id="BAH55865.1"
FT                   /translation="MDAWTIRDFEPEDLEAVVRMDSSSTTTDQLPLFALSDVVGSLLNR
FT                   HPAVVAVRDGHIIGTAVARVDEDRAWVMRLSLDPEWRGQGLGSALLSQLEHQLLAKGVR
FT                   RVSALLPEGETGATALSNSGFTTRSGVTYYEKLGTVSPRTAGVLATLGGAVPPAGLWKQ
FT                   VAGMTREKSLIERKIVLPLSRPALAADHGVAAPRAVVLFGPPGTGKTTFARAIASRLGW
FT                   PFVELFPSRLAAGENGLAAGLGEAFASMGELEHVVVFIDEVEEVAARRRPGSQSVGVVN
FT                   ELLKSIVNFRERSGRLLVCATNSVRALDDAFLRHGRFDYVLPIGAPDSEARHALWERYL
FT                   GNEQVDVSALVAATEGYTPADVAHAARTVAQATFECSVDSGGRCHAGTQDYLDVIGTVR
FT                   PTLTAEMMQAFTEDIVGHART"
FT   CDS_pept        352124..352501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55866"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC2"
FT                   /protein_id="BAH55866.1"
FT                   /translation="MFMLGMREALLDKDVAADNIHYEVFGPDSWAAAPEVAKIIAAVRR
FT                   KPSTSAPPFVRPWAEQHEIGCPDDDKEVRAAGRRRAYPDRSARLSRAEQNREGQVRTAT
FT                   MTVFAAPVVQDGLGHCSFRLS"
FT   CDS_pept        complement(352700..352984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55867"
FT                   /db_xref="GOA:C1BDC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC3"
FT                   /protein_id="BAH55867.1"
FT                   /translation="MSVALYFVGISLIGIVGLSDLVRGSRQTAHHGLHTWSTSLAVAGT
FT                   LCWIAGAVLSGQPLWWKIFASVFVKTIGFLMAIRSRFVPDRQKKEPGNE"
FT   CDS_pept        complement(353067..353387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55868"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC4"
FT                   /protein_id="BAH55868.1"
FT                   /translation="MERTYAVERAAHARMVATEKGRRVGRPSVVTDAQFAYATELRERA
FT                   RHHRRDHRQDRADPLDPVAASATPAGGYNCGMLWEISVNSATDPRLPSLPTPHPAPPGN
FT                   EA"
FT   CDS_pept        complement(353999..354331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55869"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC5"
FT                   /protein_id="BAH55869.1"
FT                   /translation="MQRVSLEALARQQVKQAATAGGGHTADTVYGGHEKVLRQTVIGMI
FT                   EGAVLGEHANPGEATVQVLSGRVRLRAGELSWEGRAGDLLIVPDARHSLEALVDSAVLL
FT                   TVAKLA"
FT   CDS_pept        complement(354685..355059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55870"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC6"
FT                   /protein_id="BAH55870.1"
FT                   /translation="MRSVFAHQAVLVMTPDADTGAPGAAVTSALCTHWGRQPPRSLAPH
FT                   HTHADRLGDEVRIRIVFAVDPARQNAVRSRIDLALATGHTCGPDGTITRWQLRSCGPAA
FT                   PIRGRGERPLSRRGVSTTRN"
FT   CDS_pept        complement(355203..355382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55871"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC7"
FT                   /protein_id="BAH55871.1"
FT                   /translation="MRTRPPCVRHRLLGASDGPILTGVLAEATETGGLPDSVQRWLAST
FT                   RWHTGPALLCPDHT"
FT   CDS_pept        355391..355828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55872"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC8"
FT                   /protein_id="BAH55872.1"
FT                   /translation="MTSAEHARMVRVRVQPGDGEVGALVGGLGAGGRFVPQVGQARDVL
FT                   AVAVGETTSSAECASEPPVVRVFRCPYTVVRGTFSMAAIWATVCLSLFPADAVPECESQ
FT                   RSRRVPGLVRRGDHDVGIDDTDDVVAVSLDFALIHLGTETR"
FT   CDS_pept        complement(356008..356202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55873"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDC9"
FT                   /protein_id="BAH55873.1"
FT                   /translation="MYENEIHERRLCGDRRQWHGTTVLCTADKWHPGRHRAMAIDAAGH
FT                   LTTLCTWTDLNAPGHDLAA"
FT   CDS_pept        complement(356264..356551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55874"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD0"
FT                   /protein_id="BAH55874.1"
FT                   /translation="MVNDQPFTQVRANTVALAATEGYKVFGAIDASGTYPTLPPGDRDG
FT                   RMVKAPYSGVMTTDQLIIESNQRTQADATGSDSNDAHAERKLAATTATSR"
FT   CDS_pept        356804..357250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03760"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55875"
FT                   /db_xref="GOA:C1BDD1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD1"
FT                   /protein_id="BAH55875.1"
FT                   /translation="MRSRLTEQQRQAWRVYIEGSLRLETRLDEALRAATGLSMIDYHVL
FT                   LLLSEAPDQRLRMSELAARMVFSRSRITYQIGSMRKRGLVAREPAPDDGRGSRAVLTAS
FT                   GLRALHQAVPPHAQSARELFLDDLDPAELDCLERVFTRLTERLH"
FT   CDS_pept        complement(357722..358027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03770"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55876"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD2"
FT                   /protein_id="BAH55876.1"
FT                   /translation="MPRPSRRPDTVSWLGSEMLKTRVAHGYCSRHEASGACPYANICET
FT                   CDNFVTGPEFRGALEAHRTDIQALEADARDRGWLDEAARHHRVAGTLTDHLHRLDR"
FT   CDS_pept        358075..358314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55877"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD3"
FT                   /protein_id="BAH55877.1"
FT                   /translation="MRKLRSEMHRRMLGNGYCARPVGLDCHFESICESCTFFQTTIEFR
FT                   PTLQSQRDDAAEKGQLGRQKIFDGLLTRLDQSAS"
FT   CDS_pept        complement(358639..359112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55878"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD4"
FT                   /protein_id="BAH55878.1"
FT                   /translation="MFSVAGGVADSGLRYLGQIAGLRVRLASLFDTTRIHETVGTLVSF
FT                   EKVRANIDRGLVEAVAVATALGGDRRHRRFLAQAGACPWDVIPTPARSVSPPRTPAAGA
FT                   LPHQQEWTQAFATQTSCPLCTNVSRLVVARPGRLWPQPGTRPRSWVLTSRSVG"
FT   CDS_pept        complement(359539..359961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55879"
FT                   /db_xref="GOA:C1BDD5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD5"
FT                   /protein_id="BAH55879.1"
FT                   /translation="MTTTAPDSVLSTAECIRLLRSVPVGRMVFTENAVPALRPVTFATV
FT                   GGEVVIPTDDESFARFDGELLAFEAGDIDLITRIGWSVTAMGHATYVASADAVARFHHR
FT                   NAVPWSIHPGDRHLIIDMEYVSGRHVTLIRRDGDTR"
FT   CDS_pept        complement(360136..360456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03810"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55880"
FT                   /db_xref="GOA:C1BCE0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE0"
FT                   /protein_id="BAH55880.1"
FT                   /translation="MLLPPVEPGQYTAAAFVDVCRRHGIQLSRGRVGSSYDNALAESFF
FT                   QGLKREWLHGRSWTSKSQARLDLFEWLSYFNRRRRHSALGYLTPVEFEQRLIASSTLSV
FT                   AA"
FT   CDS_pept        360472..361872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03820"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55881"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55881.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        complement(361769..362512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03830"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55882"
FT                   /db_xref="GOA:C1BDD8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD8"
FT                   /protein_id="BAH55882.1"
FT                   /translation="MIVDYIDVHRSRFGVDPICTVLTEHGISIAPSTYYKAKQRGPISG
FT                   TDLTEAYAANAVHRVYVANKRLYGARKIWWAMKHAGHDIGRDQVARLMKICGIRGVVRG
FT                   KRRTTTTERDERAPRHPDLINRKWDVPDRPDQWWVADFTYVWTLTGFVYTAFCVDVFSR
FT                   RILGWQVMTCKTTVLVTGVLEQALFTRRRTDIRFTSTGLVHHSDAGSQGGFNRSSQHRA
FT                   VRTSVPVRQTLPLEFSNRALFGGGC"
FT   CDS_pept        complement(362509..362835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03840"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55883"
FT                   /db_xref="GOA:C1BDD9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDD9"
FT                   /protein_id="BAH55883.1"
FT                   /translation="MPAPKKYDAETQDRAVRMYRDRIDEHGGSKVAARRHVGELLDIAP
FT                   ATLRNWIEREESRQAPGASSSAPDVSAEVARLRREVTELRKANEILKTASAFFAAAEVD
FT                   RRLR"
FT   CDS_pept        363464..363814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55884"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE0"
FT                   /protein_id="BAH55884.1"
FT                   /translation="MDSRTARSPPRCSPSPGAEEAGLRCNKLTHKHTGLKDLFYALVRS
FT                   QDHRPKIADGLHADNDQLRTKLADLRAEHTRLTDQVATYARVIHVLEVENAQLREQSQT
FT                   NDVVRPLQRHTH"
FT   CDS_pept        363874..364230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55885"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE1"
FT                   /protein_id="BAH55885.1"
FT                   /translation="MIDNTRRLDTEGHFRSDPSYLPELRDYLDTLLRDRERVRAATELD
FT                   DWARDEAVPSEAEITRLRQSIRRVQHELDALTEDERGQIEEAVRVVRRTRQTVHLGLPT
FT                   TGPQTLDPHLETHS"
FT   CDS_pept        364227..364391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55886"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE2"
FT                   /protein_id="BAH55886.1"
FT                   /translation="MTSNSTEHLIAARRGDSNRRRQRVLDALSRLRTDGAEITISAVAR
FT                   TARVDRSFL"
FT   CDS_pept        complement(364522..364773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55887"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE3"
FT                   /protein_id="BAH55887.1"
FT                   /translation="MGTWWLWSAVEGCHQVSVGGAGGCEFVVAVLELVFPAEELLFEFG
FT                   GPLPEGADFVVSGETGAVENLFAENLGESVGEFRVLLP"
FT   CDS_pept        complement(365087..365992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03890"
FT                   /product="NlpC/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55888"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE4"
FT                   /protein_id="BAH55888.1"
FT                   /translation="MLPRLTFAPGNAFATFVPWLTKAGALCDGITAPTLAALYSAENGF
FT                   RYGATAPVSPVGAKGPGQFMDGTWRTYGKDADGDGTADILGVADSVMASGHLLCDMYNQ
FT                   IDTWKHQGRVRGDTLDLAIAGYNAGVGAVLASGGMPSGSPDYENQTKPYVAKIRAAQDY
FT                   FARLLSPFGGPALSELGARVVESAMNFLGLPYVWGGGNIHGPSQGGFDCSGLTSYAVYT
FT                   ATSGKVTLPRTSETQWNVGVERPLSEAVPGDLLFGNWSANGPGHVAIYIGNGQMIHAPT
FT                   TGDVVRVASVFADMRARHVM"
FT   CDS_pept        complement(366508..367560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03900"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55889"
FT                   /db_xref="GOA:C1BDE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE5"
FT                   /protein_id="BAH55889.1"
FT                   /translation="MGVEVSVSDLTKSFGSQRIWQDVSLTLPAGEVSALLGPSGTGKSV
FT                   FLKSLIGLLRPEQGSIVIDGTNILECSSKELYEIRKLFGVLFQDGALFGSMNLYDNVAF
FT                   PLREHTKKSESEIRKIVMEKMELVGLLGAEDKLPGEISGGMRKRAGLARALVLDPQIIL
FT                   VDEPDSGLDPVRTTYISQTLIDINAEIDATILIVSHNINLARTVPDNIGMLFRRKLVMF
FT                   GPREVLLTSEEPVVKQFLNGTMIGPIGMSEEKDEATMAAEQAMVDAGHHAGGVDDVEGI
FT                   VPQMKATPGMPFRQAVARRQERVRDIMHTLPESAQIAIQESFDEHELYSDFDSATEELG
FT                   AVDVHDWSAP"
FT   CDS_pept        complement(367629..368159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03910"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55890"
FT                   /db_xref="GOA:C1BDE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE6"
FT                   /protein_id="BAH55890.1"
FT                   /translation="MITYIARISSLFDTWSSRKRTLLVAGLGVLAVAVTVGSVTLTIRA
FT                   HEGRSQEDTRQQALTQAAQLVPDILSYDFNTVDDHFTGSLEHLGGEFRTQFESVSKDVI
FT                   IPSAKQRQVVTSATVVESSVVSASADAATVLMFLNQSTTSTDSPAPKLDGSRVQVSLHR
FT                   DGDSWQITEMSPV"
FT   CDS_pept        complement(368156..368770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-03920"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55891"
FT                   /db_xref="GOA:C1BDE7"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE7"
FT                   /protein_id="BAH55891.1"
FT                   /translation="MAKSAAALALDTIDDDNVLDRPERPPETSTDAAEDSGGPARRRGG
FT                   GLILAAVVFLGAIVLAGSVWGVRSWSDWRTTDAAAARDVSILDTATQMSTNLVTLRHQS
FT                   VDEDIKKVADGTTGPFHDQFATSSGGFGDVLNQGQVESTGEVKSAGIIDSSDDHATVLA
FT                   AVTSTVKNTEAPDGEMRVYRMKLTLDLVDGRWLVSDVEFVA"
FT   CDS_pept        complement(368746..370224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7F"
FT                   /locus_tag="ROP_pROB01-03930"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55892"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE8"
FT                   /protein_id="BAH55892.1"
FT                   /translation="MRSKLVRAQLVIFTLVAVVAVANSVYSYMGFNRLSGIGMYSVDVE
FT                   LERAGGLYASALVTYRGVDVGVVRSLDVTPDHVTVHLQLDSDHPIPKSTDAYVRSVSAI
FT                   GEQYVDLVPPTSQGPFLADGDVIDRSRTTLPVSAAQVVDEVSTLLEGLPKDDLKTTVDE
FT                   AYAAFDGAGPTLSRLIDSSRPLIALAQANLGPTTTLITDAEPVLTAVNSAGPDIARFST
FT                   DLASFTEQLTMNDAQIRGTLDNGPAFFDAFGGTLADLQPSLPLLLANLQSVGEVLRVNV
FT                   PGIRQILVIYPAMSAAINHMHQGVQGADRTYGQGPLDIKLGNTANPLPCTEGYEETQRR
FT                   DPSDLSPAEPATSSYCTLPPNEPRVVRGARNLPCATDPSVRTAEVGECPGGLPSSWPQM
FT                   LARPGQPYAPAPSAPPAPPTAAPEPQQSDNSQQAPVAATPAAWSSRQAPAVATAPYDPI
FT                   TGAFRAPDGALYSIDATSPTQSEEELTWQSLLLR"
FT   CDS_pept        complement(370224..371375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7E"
FT                   /locus_tag="ROP_pROB01-03940"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55893"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDE9"
FT                   /protein_id="BAH55893.1"
FT                   /translation="MISIRQLSACTALTLGVAVTATGCRFDGINSIPLPGNAISGDTYE
FT                   VTVELADIQNLVGNSPVKADNVIVGNIASIGGENWIARLTLELRADARIPANVGAKLAQ
FT                   TSVLGSQYLELSVPSGEQPVGTLADGAVIPIARTSQYASTEEVLSALSLVLNGSGLQQI
FT                   RTVTSELVRVLDGREQNLHELFGNLETVVGNLDQQRADIVRAIDGLDRLGAELAAQNAT
FT                   LDRGIETITPAAQVLNDQQKQLTTMLTSVGQFGEVATKVLDSSREDLHANLTALQPTLS
FT                   HLASVGDSIPEALKIAATLPFPVETTDRAIRGDYVNLFLTLDLTAETVGGKVLGSIPVS
FT                   ELAGLNPARQAANPLLVPTERPASAPPAATPAAGAPQPQGGQR"
FT   CDS_pept        complement(371372..372481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7D"
FT                   /locus_tag="ROP_pROB01-03950"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55894"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF0"
FT                   /protein_id="BAH55894.1"
FT                   /translation="MMATRTTSRVPAKILLLVVIVAALVLGTGAWVTGHSTHHITAFFR
FT                   STSGLYVGDRVMILGVEVGQINDIVPEGDQVRVEFSYDGKYDVPADAKAAIVAPVLVTG
FT                   RYIQLAPAYVGGDKMADGQTIPVERTAVPVEFDEVKEQVVKLAQDVGRTPEDPDGSLNR
FT                   FVTNTADALRGNGQTLHDSLVQLSDATSTLSKGGEDLFASVRNLQTFTSALATNEQQIT
FT                   AFSRELATTSSMLNDNRTELDALLNSMLATFNEVTAFLQNNRGALTTDVGKLTDLTRQL
FT                   VDREDTLASILHTAPTSLSNFYNIYDPDSNSLTAAIAVSDLPPDPRSLICALLTTANAP
FT                   ADECSKATGALATGLVQKAVAPAPSGGTR"
FT   CDS_pept        complement(372478..373476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7C"
FT                   /locus_tag="ROP_pROB01-03960"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55895"
FT                   /db_xref="GOA:C1BDF1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF1"
FT                   /protein_id="BAH55895.1"
FT                   /translation="MATKSFLERNPIRLGVIGTLVLVGVLAVALNFDTIPGIGPKTYHA
FT                   EFLDASGLVVGDTAQIAGVKVGKVREISLNGDKVEVEFDADSGDARLGNDTRAAIKVET
FT                   ALGRRYIELTPEGEGELGRGDTIPVSRTTSGYDVTRSLEEVTDKVSKTDTVDLSGALDQ
FT                   LSAVEEALPPDLKSSLTGLSRLSETVASRDADLRHLLTNTAGVSTVLAERSQRVAALLG
FT                   QGQSLFDSLNQRADSIHRILVQTREIADELTALKRDNEATLAPTLEQMDTLVTTLNNNY
FT                   DNINASLTGLERYAQQIGDVVGSGPFFSALLHNILPANLAGQVPGSLGGPR"
FT   CDS_pept        complement(373476..374480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7B"
FT                   /locus_tag="ROP_pROB01-03970"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55896"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF2"
FT                   /protein_id="BAH55896.1"
FT                   /translation="MTKTSPSLKLLIFVLVTTLTGFGVATVVGNLRFGSTHAYSAVFTS
FT                   ASGLGSGSDVRVAGVPMGKVTDVSVNSDGTALVTFSLSTERPLTAATEAKIKYKNLIGD
FT                   RYVDLSPGSFDPSPLQAPIPLAQTTAALDLDQVVNGFRPLLQGLDPDQTNQLSASLIQV
FT                   LNGQEASISQLISQIDTFTNALADRDQAIGQVIANFNAVLGTVNNRRDQFATLVDQLQQ
FT                   LVAGLNDDRDLISHSLGQIDDASNAMATVLTENRPPIAQDVSALGDLAGQLNAQTDTVN
FT                   LVLSKLPETYRLTARAGGYGSFVNLFVCGLAIKYAQGPGGVTPMFTAPAERCK"
FT   CDS_pept        complement(374477..375640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mce7A"
FT                   /locus_tag="ROP_pROB01-03980"
FT                   /product="putative Mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55897"
FT                   /db_xref="GOA:C1BDF3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF3"
FT                   /protein_id="BAH55897.1"
FT                   /translation="MSGHLAERSRRAYVALGLVMVAVGALATATSIAVYRGSFTSAVPV
FT                   KLYSTRAGLMLEPGSDVKMREVVVGRVTGVKLVDGHAEISMDIDKGRAHSIAANVSAAI
FT                   DPTTLFGRKFVTLDPPESPSPETISAGTVLSTGQVATEVNDLLESLVTVLRTVEPEKVN
FT                   GTLNALATSLHGRGDQLGDTLVELNTYLASFNNSLPTLRRDLVRGAETTDVLAAAAPDV
FT                   METVDQASTTATTLTDRQDQFKAFLLSFTSFGNSGRSFFETSGTPLTESLSSLAPTTEL
FT                   LAQRAPTLPCLVESLVQTNTYLERTLGGSDQPGLNILGTLLMGDPPYTNPANLPVVRAD
FT                   GPVACDDWSQPQGHTDFDDGSAAYRPARTPMDLIGNPFAQFFLGGLR"
FT   CDS_pept        complement(375642..376556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE7B"
FT                   /locus_tag="ROP_pROB01-03990"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55898"
FT                   /db_xref="GOA:C1BDF4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF4"
FT                   /protein_id="BAH55898.1"
FT                   /translation="MNSLQNPHVTDDGKLVSKSNQPSGTRRARAVALKVIDAPVSHLEE
FT                   MGRQFSFYNHTIAAIPRTFRRYRAETVRLLAEVSMGTGALAVIGGTLMVISLLTAAVGY
FT                   EVGQQGATSLGRVGIGALSGFISAFFNTREAIPAIAGIALTATVGAGFTAQLGAMRVSE
FT                   EIDAMETMSIPSLPYLVTTRVMAGVIAVIPLYSVALFVGYAATQLVTVYMIGEAKGTFW
FT                   HYFNVFLVPSDVIWSAVKVLAMSVVVMCVHCYHGYNASGGPAGVGVAVGRAVRTSLISI
FT                   MVIDLLIGIAVYGGSAGAVRVSG"
FT   CDS_pept        complement(376563..377363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrbE7A"
FT                   /locus_tag="ROP_pROB01-04000"
FT                   /product="putative YrbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55899"
FT                   /db_xref="GOA:C1BDF5"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF5"
FT                   /protein_id="BAH55899.1"
FT                   /translation="MQLLDRSVTPGERSAKARAALRVAPRAVGAFYATSLETYRCMFKR
FT                   PFHLREFLQQAWFIASVSIMPALLMAIPFCMMFVYQINILLAEIGAVDLAGAGAGVAIV
FT                   REIGPIVTVLVVAGAGSTAICADLGSRTIREEIDAMKVLGIDPIHRLCVPRVLASTFIA
FT                   IFLNGLVSAVGLVGGYIATVYMQGASPGQYVTAISIITGLGDFFVAEIKAAVFGMLAGL
FT                   VACHLGLNVRGGPKGVGDAVNQTVVFSFLLLFLANSIITTLAMH"
FT   CDS_pept        complement(377533..379161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="ROP_pROB01-04010"
FT                   /product="fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.-"
FT                   /note="protein synonym:acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55900"
FT                   /db_xref="GOA:C1BDF6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF6"
FT                   /protein_id="BAH55900.1"
FT                   /translation="MQGTMQSAPLSVASILHHAAGVHGDRRVISATEQGFRRSSYREIG
FT                   ERCANLASALRRLGVTGDDRVATFQWNNQEHLEAYCAVPAMGAVLHTLNIRLSAEQIRY
FT                   VANHAEDRVIIVDSSLVPLLAPVLPDLQSVRTVLVTGEGDVSALDGKGPEVLRYEEALA
FT                   GESDEYPWPTVDETSAAAMCYTSGTTGDPKGVVYSHRSMYLHSMAACTGNGLGICEADR
FT                   VLPIVPMFHANAWGLPYAALMAGAELLMPDRFLQAGPLTQMVHTERPTVAGAVPTIWND
FT                   VLLHAEKNPQLDFSSLRLVACGGSAVPRSLMEAFEEQLGVTVLQAWGMTETSPLASVAR
FT                   PPVGASPEEAWRVRSTQGRAVCGVEMRIVADDGAVLPHDGEAVGELEVRGPWVAASYYK
FT                   VADEDRFHDGWLRTGDVGHIDRGGFLTLTDRAKDVIKSGGEWISSVQLENILIGHPDIF
FT                   EAAVIAVPDPKWQERPLAVIVLREGAAIAPKELQSWLADQVPRWWLPEQWTFIEQVPRT
FT                   SVGKFDKKLLRADHADGRLTITNVG"
FT   CDS_pept        complement(379202..379609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55901"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF7"
FT                   /protein_id="BAH55901.1"
FT                   /translation="MGVFKNDAEVHKYIGGVFEKGLADPEIGPKLSASGVVLQINYTDP
FT                   DATVTVDLPNGKVFAGATDIKPDVELFMSADTGNGFWQGKVNLSVAMAKGQVRTKGPVQ
FT                   KILKLVPTAKLLFPAYRAMLEADGRSDLQQK"
FT   CDS_pept        complement(379673..381172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04030"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55902"
FT                   /db_xref="GOA:C1BDF8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF8"
FT                   /protein_id="BAH55902.1"
FT                   /translation="MTMMSVDIPEAVQSFLRSASASIVIGTEKLAAADGSEVPTTDPAT
FT                   GAVLANISAGGAIDVDRAVDSASVAFQAWRRLSPAARGRILLDVADAIEAHAEELATLE
FT                   TLDNGKPLSESLYIDVSLASQIWRYFGGWTTKLAGRTLPVSPAVGEALVYTQREPLGVI
FT                   GAIAPWNFPLLIASWKVAPALAAGNTVVLKPSEHTSLSALRLTEIALEAGLPPGVLNLV
FT                   TGFGPEAGQALIDHPKVAKVSFTGSTETGRRIITASAPSIKKLTLELGGKSANIVFPDA
FT                   DLNAAAQGALAAIFLNQGQVCCAGSRLFVHRDVHDELVAELEAATRAIQLGHGLDESTE
FT                   MGPLVSAMQLDRVEGFVRAGTREGATLVCGGEYPGGALSNGHFLTPTIFTDVRDDMSIA
FT                   TEEIFGPVLSVLTFDDEAEVVRRANSSAYGLAAGVWTDNLKRAHRVARELEAGTVWVNM
FT                   YNMLDPAAPFGGYKASGYGRDLGEESLLGYTQTKSVWISLD"
FT   CDS_pept        complement(381356..381670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04040"
FT                   /product="7Fe ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55903"
FT                   /db_xref="GOA:C1BDF9"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDF9"
FT                   /protein_id="BAH55903.1"
FT                   /translation="MAFVIGEPCVDVMDKSCIEECPVDCIYEGGRMLYIHQNECIDCGA
FT                   CEPVCPVSAIRPAQKVDEQWQPFQESSREVTKDLGSPGGSSNVDLPIADSEYVKTLDEK
FT                   "
FT   CDS_pept        complement(381717..382733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04050"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55904"
FT                   /db_xref="GOA:C1BDG0"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BDG0"
FT                   /protein_id="BAH55904.1"
FT                   /translation="MTTEISTADVAVDLLFVGAGPVGLFGAYCAGFRGLSTALVDALPE
FT                   VGGQVQAIYPEKNIYDVAGLPGVQGQQLIRNLTQQAEAFAPKHLLSQQADTLERLPAGW
FT                   RVTTSKRVVIDARAVVITSGVGAVTPRPLATGEAFLGRGLRYFVPRLDVLDGQDVVVVG
FT                   GGDSAVDWALAALPRARSVTLVHRRKQFRAHEHSVRLLRESACDLLLDADVAEIRGDDQ
FT                   VESVVVKVAGESSGREVKAQVVVAALGFLMNLGPIADWGLELEGRSITVDSTMRTTLPN
FT                   IFAAGDAATFDGKVKLIAVGFGEVATAVNNAAVALDPNASLAPGHSSDLVQPVLAEA"
FT   CDS_pept        complement(382816..383796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55905"
FT                   /db_xref="GOA:C1BC50"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033908"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC50"
FT                   /protein_id="BAH55905.1"
FT                   /translation="MAIDRVIEHGKRSGFGSLSEGGLRMNSFAMKLFRKGNKKFWDPEA
FT                   IDFSQDAQDFAGLSDEEKRLTCILAAHFIAGEESVAQDLQPFMSAMAAEGRLADEAYLT
FT                   QFTFEEAKHMQAFRLWFDAVGLSSDLHEYVDYSEPYQRIFTEELPKSLYALTTDPSPAA
FT                   QIRASVTYNHVVEGCLALTGYYAWAKVCKSRNILPGMQEVIKHIGDDERRHMAWGTFTC
FT                   RRHVAADDRNWDVVDERMQELLEPALQLIVRIFDTFDEIPFGITIDEMTDYGMDKLNRR
FT                   LESIESARGRPLEEIDEDYSPMQLEDKFAAEDELQLSQLLTSATS"
FT   CDS_pept        complement(383845..384951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04070"
FT                   /product="putative alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55906"
FT                   /db_xref="GOA:C1BC51"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC51"
FT                   /protein_id="BAH55906.1"
FT                   /translation="MKTKAAVLWGQNEKWQVEEIDLDPPGEGEVLIKLTASGLCHSDEH
FT                   LVTGDLPFPYPLVGGHEGAGVVEAVGANVADISEGDHVVMMFLPACGRCSYCVRGIGNL
FT                   CDSGAAVMLGPQLDGTYRFHARGEDVGQMCLLGTFSEYTVVPAASVVKIDDGIPLDKAA
FT                   LVGCGVTTGYGSAVRSGEVRAGDAVVVIGAGGIGMNAIQGARIAGARMIMAVDPVEFKR
FT                   TKSREFGATHTASSVDEAWNVVSELTRGQLADVCVITTDVAEGAYMTPALSLVGKRGRV
FT                   VVTAIGHPEETTITTNLLELTLYEKQIRGSLFGSSNGQHDIPRLLELYTLGQLKLDELV
FT                   TTEYDLEDINQGYADMRDGKNIRGVIRY"
FT   CDS_pept        complement(385326..386645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04080"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55907"
FT                   /db_xref="GOA:C1BC52"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC52"
FT                   /protein_id="BAH55907.1"
FT                   /translation="MSAVPWWRSSGSSMHSGTESFSDTDIRTIQRIIISVRCGVVLSVG
FT                   VLLAVGAGNVREHLGWALLLLGISTVYSLTGFYYPSTELGSMRASAIVTTLDAGLSLGF
FT                   IATTGGRESPTVALLFLVIIAAATRLSFAGTVLLSLALGVSYFLLALTVNSADTPLEVR
FT                   LQAGLWWPLYLLFTAALTAAFTLLTEGAAQAQAAARAEAAAEHAAAEEERDLRARLLKS
FT                   YEAQETGLQVILHELRTPIASLKALADAGQRNLPAHDTQRARDLIAAHAGHLSAMMDAL
FT                   GDVAASRRPTFSTGHRQLVLLHDFLLATADAVGLVPPQLRMTISPPDVRCRFDPQLLRR
FT                   VITNLLTNASRHGRGEPVDIVARVSRSELHLEILDRGPGLPPELASIVTKKFVSVGDQR
FT                   GSAGLGLWIADQIVISLNGRLHFGARTGGGLAVYLEVPIT"
FT   CDS_pept        386721..387383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04090"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55908"
FT                   /db_xref="GOA:C1BC53"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC53"
FT                   /protein_id="BAH55908.1"
FT                   /translation="MRDQKLILALIDDHDLFTQGLAMLLEAQDADRFEVGGITNRADEA
FT                   LALVGSCGADIAIVDLTMPPTGGMLAIRQIKSRYPDTKVVVLSGTTDYKLAEEALRAGA
FT                   DGFLPKSADPHVLVAPLLTVAAGLRVIAPDLLTVLLDSVRHPPQSLLDKLAVEEIRLWV
FT                   LLSRGLETTEIAKHMLVSERTTKRMVAALLNKLGAPNRVVAAGLAGHYGLLGTSTVD"
FT   CDS_pept        complement(387784..387972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55909"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC54"
FT                   /protein_id="BAH55909.1"
FT                   /translation="MPIVQPPWAEELTRRAIMVGRAPAQDVRVAAQVPYRRASPQRNRG
FT                   GVDGTEYLGLVASPPWW"
FT   CDS_pept        388031..391495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04110"
FT                   /product="putative serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55910"
FT                   /db_xref="GOA:C1BC55"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016236"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC55"
FT                   /protein_id="BAH55910.1"
FT                   /translation="MADAEPARTERDVALSVVSELEAEGFNDALEVGRGGFGVVYRCVQ
FT                   TALDRTVAIKVLNEGFERDERERFVREQRVMGRLSGHPNIVQILQVGVLAAGRPYIVMP
FT                   FHARDSLEAWVRRHGPLPWPDVLQVGIKLAGALHTAHDLEILHRDVKPANILITDYGEP
FT                   QLADFGIARVGGAFKTSTGHIAGSPAYTAPELLQGQAPGPVSDIYGLGSTLFTLMTGHA
FT                   AFERRAGEGVVAQFVRITRASIPDLRMRNFPPDVVAAIEHAMAKSPTDRPQSAVALGDE
FT                   LRGIREKHGLYSADMALAGPTGTDTFANRSADQPVGRAHEAGWMPAATSTPPSASTKFR
FT                   PPTSTRPLVVRRRLIDTLQSGAHRRLVLIHAPAGFGKSTLASQWRGVLVEDGASVAWLS
FT                   VDPDDNNVVWFLAHLVEAVRQVRPALARELGQILEDHPPDAARYVLSSLIDEIHSSGER
FT                   LVVVIDDWHRVSADETIEAMDFLLDHGCHHLQLVVTSRTQAGLPLSRMRVSDELVEIDP
FT                   DALRFDASEAKAFLLDVNGLRLSESEVTELAIATDGWAAALQLASLSLRGRDDPAEFIR
FT                   HLSGRHHAIGEYLVANVLHTLEPHLLDFLMATAIAEKVCGDLAAKLTGLQSGQALLEEA
FT                   EGRDLFLTSIDDDKEWFRYHHLFAEFLQRRLERVDPARARELHLTASTWFEDHGMLSEA
FT                   VDHVMAAKDFDRAAHLVESGGMELIENSRMATLLGLVAKLPPAVAYNRPRLQLTVAWGN
FT                   VLLQRPKVMQLALDRLSSSLDSESMTEWEQRAIAREANLVRAVAKVLADQSEGVQDLID
FT                   DILRDPDGLRPFVASAASDVASFLAIHNFEFAAARRWQDWARRYHEQTVGPFSAVYGHC
FT                   MAGVAAYEVLDVGEAENIFHTALALARQTGMHSHAARLAGALLGSVLYDKGAIDGAEEL
FT                   LDRSNELGPEGGVVDIMLATYGVGSRIKVLRGDRDSATIRLEEGARIAEKLHLPRLAKR
FT                   IVNERIRAGLPIDPSLEARLKDAGPREEMENGIAEVSSQFDEDSTIMLLLADRSDASIE
FT                   AALARGRALVESVKKQKRPRALMVSTLLLVHCLASAGRMDEAKRTLAPVASQCAVLGLP
FT                   RLLLDGGAEIPHVLSQLLEDVRSGDRWLRRWPDVTASFLTDAMGRDV"
FT   CDS_pept        391902..392771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04120"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55911"
FT                   /db_xref="GOA:C1BC56"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC56"
FT                   /protein_id="BAH55911.1"
FT                   /translation="MRQRAGLARALVLDPQLILCDAPDSGLDPVRRAYLSQLLIDINAQ
FT                   IDATILIVTHNISVARTVLDNIGMLFRRYLVMFGPQGGPPHQRLVSYAINSCFNLIYRG
FT                   MPRTGRPKAELMLTDNEREQLVRWSRRAKTPQSLALRSRIVLACAEPGMTNKQVAADLG
FT                   ISANTVNKWRGRFVDRRLDGLVDEPRPGRPPSILLDRVEDVVTATLETTPANATHWSRT
FT                   AMAKRTGLSPSTIGRIWRKFELTPHLTDGFTLSTDPQFVDKVVDVVGLYHNPPEHAVIL
FT                   CVDEEGQM"
FT   CDS_pept        392928..393341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04130"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55912"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC57"
FT                   /protein_id="BAH55912.1"
FT                   /translation="MISELHRRHRAVEFKKFLTAIDKAVPDELDVHLVCDNLATHKTPA
FT                   VGDWLAKHPRFHVHFTPTGSSWINQVERWFAFLTDQLLRRGVHKSVAALEKDVRNWIKT
FT                   WNDDPKPFVWHKTAEEILDSLAKYISRISDAGH"
FT   CDS_pept        complement(393822..394445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04140"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55913"
FT                   /db_xref="GOA:C1BC58"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC58"
FT                   /protein_id="BAH55913.1"
FT                   /translation="MMVVIGESLRMSYRRHMREEALRATQTLITEKGWNKVRFSDVAAM
FT                   IGVSRPTLYKEFASKNELGDALVLRETERFLTGIQTILDTNTDSVPRAITEAVQYTLDE
FT                   AVESPLLRAALTAPLDDLRGESSVLRLVATSTSMLELATQRLISWFDEHLPNHDRADID
FT                   HAVDVLIRLTVSHIVLPAADGNVHRENVETCRQISDVVLRFLRL"
FT   CDS_pept        394709..395227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55914"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC59"
FT                   /protein_id="BAH55914.1"
FT                   /translation="MGQWWGRFHQHHPTVRDGDELPPHHSWCLGCGPDNPHGHHLHARR
FT                   RGEGVVAEHVFDDRHMGAPGIAHGGAVTTVLDDMFGMLLYTVGEMAVTRRLDTEFHAPV
FT                   LLGTRYVITADLQRRRGRKLDVTARMEVATTGDLAASARALFIVVDLAHFTTSLTRAQS
FT                   TTDIDQDLP"
FT   CDS_pept        395187..396665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04160"
FT                   /product="putative cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55915"
FT                   /db_xref="GOA:C1BC60"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC60"
FT                   /protein_id="BAH55915.1"
FT                   /translation="MPSPPRISTRTSRDRLEHWGLLVDALLTDHGPAGPYAAFARLRGA
FT                   HPALSTRTGALILSRYDDCDAARRDRNLGKVDESLGFRLSEGPEELQRTAMRRFRRTML
FT                   SQPTRPRAVAPHRGRCVHPCHIDELRSSVIAQIELLLDKMSVRPHADIIADLALPLPVS
FT                   VIGTMLGVPDDDRAAAAQLVRDLVAPLEPSADAAAVARAAVAEDRLTDYFTGLLSAKRR
FT                   APGDDLLSRLATARGDNAFDDDDECVVPRCCCLPRASRPRPISSVTGVAALRAHPEQMH
FT                   LLRERPEIVGTAVEKLLRYDALVQTNGCTVLRPTTLASHDLTPGRAVLTLLGAANRDPD
FT                   VFDDPDTLDLTPTGRPPLAFGAGILPQPASLRMPNTGRPPRRSCRPRSGGGGASRIARA
FT                   ERSGDRSVRQKHARDPPSGCRRRPCRVLAGDGGEPRRALTVAARSLRGPQAYLVPAAVD
FT                   LITAPPRSTAPTSTYRSQDINRKLMFPTRPRSCR"
FT   CDS_pept        397045..398346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04170"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55916"
FT                   /db_xref="GOA:C1BC61"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC61"
FT                   /protein_id="BAH55916.1"
FT                   /translation="MTTETSGTTPTSATRRLARPYDETDLSSSAFWSSTAGEREVTFAH
FT                   LRATNPVSWHRPVEKLLIEDPNDQGFWAVMSHAALVEVTKRNEDFLSGEGIVMESMPQE
FT                   LLDAGQGFIAMDPPRHTKVRRLLTSAFTPKQITRINTQIRGNAKRVVDDLAPQGEADFV
FT                   TECAALLPMHNICDMMGVPEDVRRKVADEARYAGGWSDPELMGDQPPIPRLFEAMGYLR
FT                   EVAADLIGKRRNHPESDLLTNLVEAEVDGEKLSDDEIVSFFGLLTIAGNDTTRQSTSHA
FT                   MKALTDFPDQRAWLMDDFDARIKTAVEEMVRWATPIMTFRRTAAHDCELAGQQITEGDK
FT                   VVMFYASANWDTEVFTDPERFDLSRDPNPHVSFGGGGIHHCLGNQLARQQLAALFDELL
FT                   HRLPDIEVCGAPSYTVSTFFHGVNHLPVRFSPSH"
FT   CDS_pept        398359..398550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04180"
FT                   /product="3Fe-4S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55917"
FT                   /db_xref="GOA:C1BC62"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC62"
FT                   /protein_id="BAH55917.1"
FT                   /translation="MRIVLDENRCSSTGMCEATAPEFFEVGDDGALHILDANPADCHRA
FT                   LIEEAVGVCPTDALSIED"
FT   CDS_pept        398556..399752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04190"
FT                   /product="ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55918"
FT                   /db_xref="GOA:C1BC63"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC63"
FT                   /protein_id="BAH55918.1"
FT                   /translation="MSESGLVVVGASLAGLHAVQSARKTGYHGPITLLGAEEHLPYNRP
FT                   PLSKGFLAEGPAPAPTTFPGAASLPDLGVEVRLGCTATGLDTATHHIIAGDERINYSSL
FT                   IAATGSRPRTLPGEQLPGVHTLRTVEDAQAIRTALEAQARTVIIGAGFIGAEIAAAARR
FT                   RGLPVTMVEAAPLPLIRAVGPQMAVACAALHTRNGTDLRCDVTVTALTGTDRIEHVHLS
FT                   DGTVLDADLVVVGIGAEPVVEWLTDSGLDLDDGVVCDATLKAADSVYAAGDITRWNHPL
FT                   FGESMRLEHWTAAAEQGTLAARNALDPDNATPYQTVPYFWSDWYTDKIQMVGICAADDV
FT                   VVVGSIDDHDWLALYCRGDLLVGALAVNKPGKIMKYRAKIAAGATFADALTFAGAGVR"
FT   CDS_pept        complement(400205..401665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04200"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55919"
FT                   /db_xref="GOA:C1BC64"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC64"
FT                   /protein_id="BAH55919.1"
FT                   /translation="MVNLIHAPLDKARERVSSVVMLPAPRRIENALRSFSHKWPTRHLA
FT                   EPPSGSGLKPVEGDRGLPLLGHTLDYIRFGSDFTRDRYNQFGPVCWMGAFGTRMVIVSG
FT                   PDATQHVLTNKDKAFSQDGWTYLIDKFFHRGLMLMSFDEHRMHRRIMQEAFTRDRLAGY
FT                   ANQVGPCVRENVPTWPTDSTLRIYPRLKNLTLDIATEVFMGGCGGGEDAAAINQAFVAT
FT                   VRAASSIVRAPLPATRWRAGVKGRRVLEDYFARHLPETRSGDGNDLFAGLCHATTADGE
FT                   RFTDDDVISHMIFLMMAAHDTSTITTAACAYYLAKNPAWQQQARDESDALGDDLPDIDA
FT                   LEGLQTLDLIIKETLRLVAPVPIVMRKTVADTDVLGHYIPADTLVAVAPAVNHFVEDYW
FT                   TNPDTFDPNRFAPDRQEDQSHRFAWIPFGGGVHKCIGLHFGTLEVKAILHEMLRVYTWT
FT                   VPDDYTVRWDNTSLPVPVDGLPIQLSRR"
FT   CDS_pept        complement(403025..403231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55920"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC65"
FT                   /protein_id="BAH55920.1"
FT                   /translation="MRTLAIKLGDRTVVFEAGVTDDAAITAAADVTAERFGGIDVTIGV
FT                   AFVGVAFVGPCSPHLSNTSNAPS"
FT   CDS_pept        complement(403410..404009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55921"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC66"
FT                   /protein_id="BAH55921.1"
FT                   /translation="MTNSGNDLHGTRAGADHGDLLASGSTGRQWKTSHGVHGSRASRCT
FT                   ADFRALRPPAWKDAREQHLIEAVIMRELGKFLTDLQREADRYPRAEDKLTEGFVFTLAA
FT                   LRSHTLLNRLLESEPEALLPHLTVQGREFVRTCSDFLAAQFAQSLDDDRTGAELLIVAE
FT                   LTVRLILSFVLTPTTIVDLDDPDTARDFCRRYLAPH"
FT   CDS_pept        404105..404704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04230"
FT                   /product="putative monooxygenase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55922"
FT                   /db_xref="GOA:C1BC67"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC67"
FT                   /protein_id="BAH55922.1"
FT                   /translation="MPPAQTAARSAVFGMHEFMALGLVWHTAMTRLLQQISRLQLRRQI
FT                   KDPWMRRQLTPRFTAGCKRLLVTNDYYPALSRENCTLITWPIATLCPEGIRTADGLEHH
FT                   VDAIVFATGFDVAKSGTPFSIVGIDGRSLDEEWSSGAYAYKSINVAGYPNLFFTFGPNS
FT                   GARAQLGAGVHGGTDRLRRAGDPGHGTLESQVPRCT"
FT   CDS_pept        404619..404942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04240"
FT                   /product="putative monooxygenase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55923"
FT                   /db_xref="GOA:C1BC68"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC68"
FT                   /protein_id="BAH55923.1"
FT                   /translation="MYMEAQIDYAVQAIRAMGRWNLKYLDVRENAQRSFDALQKRLAKT
FT                   TGNSGCRSWYLTEDGFNATMYPGFATHTSNKWRTCGFRTTRPSPGGREAVRPRDEECAP
FT                   ELS"
FT   CDS_pept        complement(405089..405766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04250"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55924"
FT                   /db_xref="GOA:C1BC69"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC69"
FT                   /protein_id="BAH55924.1"
FT                   /translation="MGEKMIIENLVDDEDRLVDPRRARSRARLLDAATSLLSTGGIEAV
FT                   TIDAVTKVSKVARTTLYRHFTDSTQLLAAAFERLLPPVTAPPASGTIREQLIELLDRQA
FT                   KLIEEAPAQLTMLGWLALGSTQPDTVGTTSHPEDDRNPVSSLRTRVVNQYREPFDEILG
FT                   SPEAQQELGHFDTTLALTQLVGPIIFTRLAALPPTGPAERQQLVDDFLAARATAQTQTS
FT                   ITH"
FT   CDS_pept        405876..407474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04260"
FT                   /product="putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55925"
FT                   /db_xref="GOA:C1BC70"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC70"
FT                   /protein_id="BAH55925.1"
FT                   /translation="MAAGDRVLLSRAQKWTLVVSCLSVALVVASMAALYTALPDIAVAT
FT                   GATQTQLTWVVDGYTLALACLVLPAGALGDRYGRRAVLIVGLALFSLASAVPLLVSTPW
FT                   WLIAARAAAGVGAAFVMPSTLSILTAGFPEQQRGRAVGIWAGVAGSGGLLGILGSGLLL
FT                   DFWSWQSIFVGLTGVGVFLLLCAFTIPESRQENPPLMDVIGSVAVVFAIGLVVLAIIEV
FT                   PALGWSDPAVVAGFGLGVVATAVFVVWELRADHPLLDVRFFARRGFGSGSFSITIQFLV
FT                   TFGVFLVLVQYLQLIFGYSPLGSALALAPMMVPLVLLSAIAPWMAARLGLRLMTVTGLL
FT                   AIAGGFYVISRLDLHSTYVDVLWPTLLMSAGLGLTAAPATAAIVADTPVEKHGVAAAVN
FT                   DATREIGAAIGIAVAGSVLAAGYSHNIAPAIERLPPEARGPVTDSLAGALEVADRAGPV
FT                   GDQLADFAKSAFLHGTEQSAIVLAVIASAGAAILLFWAPGRAPRTPDTGASGNPAASGN
FT                   PAEPAQRSRSRAARR"
FT   CDS_pept        407500..407931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55926"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC71"
FT                   /protein_id="BAH55926.1"
FT                   /translation="MTQLPLPPHSPTCMGCGPDNPAGLQLEVFRSGDEVYTDVTFDERH
FT                   IGAPGLAHGGAVAAACDDLFGFTLWIALTPAVTRSLTVDYLAPSRCTGLFASPPRRGPA
FT                   RAGPLTRLKEDAWQCVTPVPVRTAGSSTERADECAALPP"
FT   CDS_pept        407912..408355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55927"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC72"
FT                   /protein_id="BAH55927.1"
FT                   /translation="MLPSRPDPAEAADAGRPVPVLLHVTNSTELAHQLSPQVFVDKLNR
FT                   LLAAVIAATESHHGLVNKFEGDAARQIRDRVLADVGNSTSGSDSLPAPSSPETSAPTSA
FT                   WNTPSSATRSTRHHASQTLAKHTPGWILAADTVIRAASEHERE"
FT   CDS_pept        complement(408515..408676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04290"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55928"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC73"
FT                   /protein_id="BAH55928.1"
FT                   /translation="MPESKTYYDRKRAEGKRHTQAVLALARRRSNVLWAMLRDGAAYRS
FT                   VSTVETAA"
FT   CDS_pept        complement(409156..409419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55929"
FT                   /db_xref="GOA:C1BC74"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC74"
FT                   /protein_id="BAH55929.1"
FT                   /translation="MTEVPDTGDTPALEPADATDKRRMDGRQLLSTAKGIVIALRGCSD
FT                   TAAFDELLRMAHRHHLSVLNARALVDLAVGDKGHTKHTRCAQ"
FT   CDS_pept        410677..410976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55930"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC75"
FT                   /protein_id="BAH55930.1"
FT                   /translation="MRNPGLESTEISPGGYLPADPRRLAGTLTSYDLKAVGGFTRVLLH
FT                   DALTTTRTRHHRHPRGLRRRPGRVPPLGDADVEHQGTRVFGRVVHARMGHHRDG"
FT   CDS_pept        complement(411309..412202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04320"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55931"
FT                   /db_xref="GOA:C1BC76"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC76"
FT                   /protein_id="BAH55931.1"
FT                   /translation="MSRFRFVDDHCDTVPVKWLCQILEVSRSGFYRWRSSAPARAERVR
FT                   ADQELAERIRAIHSDSDGTYGAPRVTAELREAGIEVNHKRVERVMREHGIVGVHLRKPV
FT                   RTTIPAPDAAPVPDLIRRDFTASAPNTRYVGDITYLPVGDGEFLYLATVLDLGSRRLAG
FT                   WSIADHMRTELVTDALRAAAACRGAAGLDGSIFHSDNGAQYASAEFADLCRELGVTTSR
FT                   GAVGTSADNAAAESLNATLKRETLQSRKRWNSAGEARAAVFRWITRYNTRRRHSTLGQI
FT                   CPVEFERRSATLATAA"
FT   CDS_pept        complement(412199..412540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04330"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55932"
FT                   /db_xref="GOA:C1BC77"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC77"
FT                   /protein_id="BAH55932.1"
FT                   /translation="MAMKAYSAEFKADAVALYLSDPSHTFDGIGNDLGVSRETLRNWVR
FT                   AERKRTGTSTDELRASGVARPTSRAGAVSSESVLEEENRQLKAQIRKLETEREILRRAA
FT                   KYFAGETNW"
FT   CDS_pept        complement(413124..413588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55933"
FT                   /db_xref="GOA:C1BC78"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC78"
FT                   /protein_id="BAH55933.1"
FT                   /translation="MKTKAAVCGGSERSWQVEELDLDDPKPGEAMVRLTASGLCHSDEH
FT                   LVTGDIPMHFPVVGGHEGAGVIPKIGSGSAISEPACHYPPTREIRRSSPAGPRAPAAQS
FT                   RSGLSPFPDGPAHRFFMDGFYAAYRAEFGRPPSDVIARTTPFPHTAREAP"
FT   CDS_pept        414120..415340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="ROP_pROB01-04350"
FT                   /product="alkane-1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55934"
FT                   /db_xref="GOA:C1BC79"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC79"
FT                   /protein_id="BAH55934.1"
FT                   /translation="MTTNVNTESHIPVEEWRDKKRHLWLLGLIPPTAVFLGAALVWGFN
FT                   ELGWNAVSPIWWWIGVMLLFGLLPVLDIFFGPDGQNPPEEVMERLENDKYYRYCTYVYI
FT                   PFQLASLVFACYLWSADNLAWLGIDGGLSWISKIGLALSIGVMGGVGINTAHEMGHKKD
FT                   ELERWLSKVTLAQTFYGHFYIEHNRGHHVRVSTPEDPASARFGETFWAFLPRSVWGSLK
FT                   SSWELEKTRMQRLGKSTWSIHNDVLNAWAMSVVVFGALTIGFGVEIVPFLVIQAIYGFS
FT                   LLETVNYLEHYGLLRQKTASGRYERCAPVHSWNSDHICTNIFLYHLQRHSDHHANPTRR
FT                   YQTLRSMDGAPNLPSGYASMIVLAYVPPIWRTVMDKRVLTHYDGDITRVNVQPSKREKV
FT                   LSKYGAK"
FT   CDS_pept        415340..415525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="ROP_pROB01-04360"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55935"
FT                   /db_xref="GOA:C1BC80"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC80"
FT                   /protein_id="BAH55935.1"
FT                   /translation="MARYRCPVCDYVYDERTGAPREGFPAATRWSAIPESWCCPDCGVR
FT                   EKVDFAPVDTDTTTRS"
FT   CDS_pept        415527..415712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubA"
FT                   /locus_tag="ROP_pROB01-04370"
FT                   /product="rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55936"
FT                   /db_xref="GOA:C1BC81"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC81"
FT                   /protein_id="BAH55936.1"
FT                   /translation="MNSDFKLYRCIQCGFEYDEAEGWPEDGIAQGTRWDDIPEDWSCPD
FT                   CGAAKADFEMIEVARS"
FT   CDS_pept        415709..416971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rubB"
FT                   /locus_tag="ROP_pROB01-04380"
FT                   /product="rubredoxin reductase"
FT                   /EC_number="1.18.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55937"
FT                   /db_xref="GOA:C1BC82"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC82"
FT                   /protein_id="BAH55937.1"
FT                   /translation="MTTMVIVGTGIAGATAAETLRAEGFSGRIVMVGDEPSLPYRRPAL
FT                   SKDLLAGTMTAERALLKSDTAWTEKDIDIRSGISAETIDPERRTVALSDGETLTFEALL
FT                   LATGGRAREFATRSGERIHTLRGLADTTSLRDAIIGAGSVLIVGGGLIGSEVAATARSL
FT                   GTEVTILEAAEAPLIRILPPAISKMYRQLHAEHGVTMETGVSLTSLTLDDHGVVATDTE
FT                   GRTWSAGMALVAIGMAPNTELAASARLSIDNGIVVDEHFRTSASGIYAAGDVANCPNPI
FT                   IGGRHRTEHWNSAMSQGAAAAKAMLGRPALFTEVPWAWSTQYGHNLQFAGWPRADDDLI
FT                   VRGSLDDRNFTALFSRNRMLVGAVSVGRPKDIRAARELIQHRSPLDQQALRDEDTSLAD
FT                   LAAIRRETAPRSVAPIDSVHG"
FT   CDS_pept        416994..417617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04390"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55938"
FT                   /db_xref="GOA:C1BC83"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC83"
FT                   /protein_id="BAH55938.1"
FT                   /translation="MIGRPRARARIPYAEATRSLLHQSILDAMGDLLRTKDWSEITMTH
FT                   VAASAGVSRQTLYNEFQSRHGLAQGYALRLTDSFVEALDEAVYTNTGDMHGALLGGFSR
FT                   FFAESGSDPLVQSLLTGDPKPDLLRLITVESAPLIERASGRLSTTFGHSWVQASTERAM
FT                   VLAKAIARLAISYISMPPDSYGDVAEDMAKLLTPYVLASTPVVE"
FT   CDS_pept        complement(418156..418434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55939"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC84"
FT                   /protein_id="BAH55939.1"
FT                   /translation="MTVGAVADASDAAQARIFLDQLDTEIDVLSQRIESTEALADRART
FT                   DHQRRLTDQLGAEVAGLRGELFEVHRLVDALVFRFPEVIRRDPPALA"
FT   CDS_pept        complement(418431..418634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55940"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC85"
FT                   /protein_id="BAH55940.1"
FT                   /translation="MNSAEEARQISQVTTRLLTKFPTASREAVGTAVEEAAAHFTSGRI
FT                   RDFVPLLIERAATAKLAALIET"
FT   CDS_pept        419011..419535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04420"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55941"
FT                   /db_xref="GOA:C1BC86"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC86"
FT                   /protein_id="BAH55941.1"
FT                   /translation="MDSAEDRDDAAWNRRVRNETDTQRLDRNWNNLLQELRVAQTGVQL
FT                   LTGFLLTLPFHQRFEELSGAQEVIYLVTVALSVTATMMLVAPVGIHRLLFRQHALPTLV
FT                   ATGQRLAIGGIAVLGFALVGVVLLIFSFVVDMTTGIIAAAAAMLMFFGLWILPALRSRC
FT                   STDDDQAPETV"
FT   CDS_pept        419666..421129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55942"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC87"
FT                   /protein_id="BAH55942.1"
FT                   /translation="MVSTQREREDKYDVGLHFMLPDLGGLVPAGGRIEAGAANLSSVYY
FT                   DTDDRDLLRQHVTLRRRTGDTDGGWQLKVPADKARTELTLPPADREAVPDELATLVTGV
FT                   ALGKPLHEVAALSTVRRTQRLLDRGEQLLAEVADDLVHATVAGDVAVVSEWREVDVELG
FT                   DGGGKSRRAKVATKVGKCLTKAGARPSPHASKLDRALAANQHARAADARATAERVLTEY
FT                   LDAQVQAIVAGDVWLRRGLDPIHSTRVGIRRFRSTLRVFGKLLDPTAGAKLDAELSWYA
FT                   GVLGEVRDRQVQRQRFAEKVADLPGELVMGPVAARIEGDLLAEQHRHRGHAMEAIDSDR
FT                   YRALMATLAQWRTDPPFTTPADSRSVRKATRKAGRKANKRLTTAVADTDDAALHRARKA
FT                   AKRARYAAELARPVLGKKKSKKKAAKYKKIQTVLGEHQDSVVAAETLRTLGARAGSTPG
FT                   ENGFAFGLLYGLELQAAQRARADATRLVS"
FT   CDS_pept        421834..422529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55943"
FT                   /db_xref="GOA:C1BC88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC88"
FT                   /protein_id="BAH55943.1"
FT                   /translation="MNPFSIPAAAPACVVLVHADVKQRLVDRIRTAGVRALDVAVLDLR
FT                   PQRRQAPDAVRTLRATRFEGAVVVIDQRRSSQERIAALEAGADDVLDVQMGEEELVARI
FT                   RAVLRRAQSRPQPTPNAQVLSLNWGCKTVEHHGLRRTLTQTEFNLMVVLTINAGRIVLR
FT                   RHLLLIVWGVASDSRAKKVLNTYIFSLRRKLASIGAPHAVQTIRGVGFSLHGAASTTER
FT                   SPAETPSSS"
FT   CDS_pept        422603..423067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04450"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55944"
FT                   /db_xref="GOA:C1BC89"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC89"
FT                   /protein_id="BAH55944.1"
FT                   /translation="MPASTTPPESLLRNPTFVIAELHRVGREDLEGVLAAEGLSLRTHW
FT                   ILCCLEEPGELSQKQVAEVLGVDRSDMVRLLDDLEERGFVARAKNAKDRRKHVLSLTKS
FT                   GRQVRERSEELTRKAFDQLYGNLSAKERQSLQRLVLKALGLPKKYADPPT"
FT   CDS_pept        423171..427049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04460"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55945"
FT                   /db_xref="GOA:C1BC90"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR012728"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC90"
FT                   /protein_id="BAH55945.1"
FT                   /translation="MSAPTRLDPFTAGDLAPAQRTLIDILTDTAGHHPDAPAIDDGEVA
FT                   LSYGELIERITAGARDLAARGVQPGDRVGIRMPSGSRELYLAILSVLAAGAAYVPVDAD
FT                   DPPERAELVFGESAVTAVVTADGIDTATGIQLSDLGAVEFQAPEPSDDAWIIFTSGSTG
FT                   TPKGVAVTHRNAAAFVDAEARLFVRDAPLGPGDRVLAGLSVAFDASCEEMWLAWRHGAC
FT                   LVPAPRSLVRTGMDLGPWLVSRAITVVSTVPTLAALWPPEALDSVRLLIFGGEACPPEL
FT                   AQRLAVDGREVWNTYGPTEATVVACAARMTGTGPVRIGLPLDGWDLAVVGAGGRPVAEG
FT                   EIGELVIGGVGLARYLDPAKDAEKYAPMPSLGWDRAYRSGDLVRLDRAGLVFQGRADDQ
FT                   VKLGGRRIELGEVDAALQALPGVAGAAAAVRSTESGTALLIGYLAAPPEFDLNQARTHL
FT                   AERLPAALVPRLTRVDELPTRTSGKVDRNALPWPLPGTETPDAQELGLGGTAGWIAGLW
FT                   TRILGAAVGGADDDFFAIGGGSLSAAQLVSALRERFPEVTVAQLYDHPRLGSLAEFLDE
FT                   LAPTVAATPRVVAPTPRRIQWAQIAATVPLTTLTGLQWVTWLAVANNILAWFVSVSWAP
FT                   TLSWWPVLVMFALFITPVGRMVIAATGARVLLRTLRPGTYPRGGSEHLRIWVAERLIEA
FT                   SGAANLSGATWMVYFARALGANIGRRVDLHTLPPVTGMIELGEGCSIEPETDLSGYWID
FT                   GDVIHVGSIHIGAGASVGARSTLFPGARIGAHAEVAPGSAVTGKVTAGQRWAGSPAVKV
FT                   GKAVHPWPEDRPPRSSRWVPIYGLTSLAVAAMPLLALAAGLVLLGWWIRDADDLGAAAL
FT                   KALPMLPAATVLTLVVFAGMTVVAVRLLGLGLRGGYHPVRSRIGWQAWSTERLMDSART
FT                   FLFPLYASLLTPLWLRLLGAKVGKNTEISTALVLPKYTTVADGAFLADDTMVGSYELGG
FT                   GWLRIEPAKIGKRAFLGNSGMTGPGRTVPKNGLVAVLSATPDKKGKSGSSWLGSPPVRL
FT                   RRSATEAAASRTFDPPTRLRVARAIIETCRLIPMIVTFGIGLGVLVALEAFAGSLGFVW
FT                   AALLSGLVLLVAGAVAGAVAAAAKWIVVGRIGVVEHPLWSSFVWRNEVSDAFVETVAAP
FT                   WFARAATGTAVLNLWLRAMGASIGRGVWCETYWLPEADLVTLGDGATVSRGCVVQTHLF
FT                   HDRIMSMDTVTLGAGATLGPHSVALPASAIGPGATVGPASLVMRGDRVPDSTRWQGNPI
FT                   APRPEHGR"
FT   CDS_pept        427204..427491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55946"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC91"
FT                   /protein_id="BAH55946.1"
FT                   /translation="MSMNPDPKSGRRRRFSVGTRVRTPHSLDPQIPEEQWPLAAGVIIE
FT                   DFTGSGGLSPKAYARDWAFSRRWAIALDDGNLIFRDSEDLDDEDPDTEAT"
FT   CDS_pept        complement(427516..427719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55947"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC92"
FT                   /protein_id="BAH55947.1"
FT                   /translation="MTNDEELLHIERVIDRLDTRYPDIARESIEEVVRSAHAHFVNGKV
FT                   RDFVPLLVERAARERIQGLVSS"
FT   CDS_pept        427952..428419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55948"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC93"
FT                   /protein_id="BAH55948.1"
FT                   /translation="MFVLVRHAHAGDKTGWPGRDADRPLSTLGYWQARGLVAALNGIDI
FT                   RALFASPATRCHQTLLPLAAARGLRIDDHPLLTVGAPPDELLAVLEAPEADGAVFCTHG
FT                   EVLDALAEFGRAQGSTGVPPAAATAKGGAWIVDRGAGPAPTLRYLAPTPTC"
FT   CDS_pept        complement(428442..428645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55949"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC94"
FT                   /protein_id="BAH55949.1"
FT                   /translation="MTDSSAWRCMGGHRGEHRDSVVADIPRDSVPAPGRTPGENGFTFG
FT                   LRYGLELQAARQARVDAAPLAD"
FT   CDS_pept        428780..429427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="ROP_pROB01-04510"
FT                   /product="putative phosphate transport system regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55950"
FT                   /db_xref="GOA:C1BC95"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC95"
FT                   /protein_id="BAH55950.1"
FT                   /translation="MRQHFSGQLENMRTDLTDLCSLTETAIDHATRALLDTDLGASEAC
FT                   ADVDTEIGYRAQEIDHRALTLIALQAPVAQDLRALISGIHNIADLRRMGSLAAHVAEVA
FT                   RLHFPAPVVPGELRGVISEMGVAAKAQAAAATEVLRDRDCERALELIRADDRTDALLRE
FT                   LFAVTKSDDWPYGAASAVNITLLGRFYERFCDHTVEIGRNVIFVVTGDFPVA"
FT   CDS_pept        429526..429840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55951"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC96"
FT                   /protein_id="BAH55951.1"
FT                   /translation="MVVWLRSFVGWLRAGYPQTGDPHGYIPLVALCGAALTDEQVEQVA
FT                   VMVDKIGAGPVEDVDIRVAITNLSHEMPTDSELRRVRDRLTARRVRPATGEDLPPPSLR
FT                   "
FT   CDS_pept        complement(430151..431308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55952"
FT                   /db_xref="InterPro:IPR005114"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC97"
FT                   /protein_id="BAH55952.1"
FT                   /translation="MTADHDGRKNGRDNPSATGVRSEQPPTGRAGGAGDESWNAGFAAL
FT                   RRYVERCGNAAPPAPTRATGIDLGRWVRRIRDVYWHGTLSPDRIRILEALPGWTWGPAR
FT                   PKSWRSGFLALRRFLEAHRTAVVPETALVDGVALAEWARTQREEHAAGTLAPPRVAALD
FT                   TLPHWQWDPEMYRWTQGLHTLRDHVRVHGSADVPRSAQSEGFPLGTWIGRCRQDFHAGA
FT                   LAPERIAALEQLPGWRWSRVDESWLAGLSELRRFIDTHGHAAPSQRYTVGQFRLGMWVA
FT                   RRRREYRAGKLAPDRVTELEALPGWQWNPADERWRQGFTALTAYAAAHGHASPAHRETV
FT                   NGDAVGKWVANQRRRHARGHLGADRVASLEALPGWVWAGRRHPQH"
FT   CDS_pept        complement(431305..432045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55953"
FT                   /db_xref="GOA:C1BC98"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC98"
FT                   /protein_id="BAH55953.1"
FT                   /translation="MSIDARRVDEVVTLTDRRASTSRDGRVLLAEPDPVIAAALIDSAD
FT                   GAGVRTQWCTDGAAALLAVGANLPAVLVVAPEMVGGVSAVQVIATVRGHSDVPILVGAQ
FT                   PGNETLTRQAIAAGATATTVRPYDFTDIRQFMQHPPAPPPRTALVAGPIRVDASGFEVH
FT                   VRDVEVLLTRREFELLSYLIEQRGRVASADQISRAVWGRATDTNTVAVHIRRLRTKLGA
FT                   DPDHGHIIRTIRGVGYRLAPSLCE"
FT   CDS_pept        complement(432166..432936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="ROP_pROB01-04550"
FT                   /product="putative phosphate ABC transporter ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="protein synonym:phosphate-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55954"
FT                   /db_xref="GOA:C1BC99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1BC99"
FT                   /protein_id="BAH55954.1"
FT                   /translation="MMATDGLGVSYSGLRAIGEVNLSFAANEVTALIGPSGCGKSTVLR
FT                   CLNRMNDLIPGAKVHGTVTYRDIDINDAAVDVIELRRRVGMVFQKPNPFPKSIYDNVAY
FT                   GPRVTGMKTHSMDEVVERALRAAAVWDEVKDKLKQDATGLSGGQQQRLCIARAIATEPE
FT                   VILMDEPCSALDPIATAKIEDLIDELSEKFTIIIVTHNMQQAARVSHRTAFFTAEADEH
FT                   GNREGKLVEFDITEKIFSAPADPRTEAYISGRFG"
FT   CDS_pept        complement(433097..434008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="ROP_pROB01-04560"
FT                   /product="putative phosphate ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55955"
FT                   /db_xref="GOA:C1BCA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA0"
FT                   /protein_id="BAH55955.1"
FT                   /translation="MTTTSVKKTPVDLGKVLVTGKRRNRTRSAVFAGILWVCLALSCLF
FT                   LFAVLAVIIVEGLARFDWNLISQQPSRLHPETSGVQSAIFGTLWVMLGTIILAIPIGIA
FT                   GAVYLEEYADSTKWWNRLIELNIQNLVAVPTIIYGILTLAFVVRGPISLGPVVLAGSVA
FT                   LALLILPVIIITTREALRSVPRDIRDASLALGATLWQTTWKQVLPSAISGIATGTILAL
FT                   SRAIGEAAPLLLVGATVFVTVNPEGFLDRYTVLPVQIFNLVKLPEEANQQLAWATILLL
FT                   MVILLAMNGLAIWMRNRFQRRW"
FT   CDS_pept        complement(434008..434988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="ROP_pROB01-04570"
FT                   /product="putative phosphate ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55956"
FT                   /db_xref="GOA:C1BCA1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA1"
FT                   /protein_id="BAH55956.1"
FT                   /translation="MSSGPITAGSPGARSGGLPPVGLPVDLSAQSNRIGERIIKVLLAG
FT                   SAFLSVVITAAIVVALIAPLFTFFQNVTIWEFLTGTTWTAGFGSKTSWTDKEWGVLPLV
FT                   AGTLSTTIIALLVAVPLGLGAATYLAEYADERIRRVVKPILEILAGVPTVVYGVFALTM
FT                   VTPLLQDWVGAQIFNNLSPGIVMGFMIVPTVASLSEDAMSAVPHAMREGSYALGANRMQ
FT                   TTVRVVFPAALSGIVAAIVLGLSRAVGETMIVAIAAGSQPQFTLNPLVGAQTMTGFIAQ
FT                   VASGDAPQGSPVYYSLFAVGALLFFLTLLINMVSITLVRRYRQAY"
FT   CDS_pept        complement(434990..435958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="ROP_pROB01-04580"
FT                   /product="putative phosphate ABC transporter
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55957"
FT                   /db_xref="GOA:C1BCA2"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA2"
FT                   /protein_id="BAH55957.1"
FT                   /translation="MTILHFQRTRVAAVAVAAGLTLAACGGNDSTGGGEGESISGPVVI
FT                   DGSSTVEPLSSAAAELFMGEHPDANVTVGTSGTGGGFEKFCAGETDISDASRPIKDSEI
FT                   AVCQSNNIQYSPLVVANDALSVVVNNDNTWTDCLTVAQLNKIWAPGSTVNNWNQVDPSF
FT                   PDEPLQLFGAGSDSGTFDYFTQAVNGTEGESRTDYNPTEDDNITVQGVSATKGALGYFG
FT                   YSYLEANADKVKGVKIDSGGGCIAPSTQTAQDGTYKPLSRELFIYVSDAALKKPQVVAF
FT                   ADFYLGSNQEIVEAAKFIPLTPAQLQVAQAELDALNAKAGN"
FT   CDS_pept        complement(436380..436628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55958"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA3"
FT                   /protein_id="BAH55958.1"
FT                   /translation="MSEKSVRKAAPPAVLTVGARLLVRRQSEATTTGEIVEDYAELTDS
FT                   AERGHHWAPVHRWAVALDDGRLVFADTEDLTADPGTR"
FT   CDS_pept        436937..438016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04600"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55959"
FT                   /db_xref="GOA:C1BCA4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA4"
FT                   /protein_id="BAH55959.1"
FT                   /translation="MARRCPVGCAPGSAGSDVLTERPDFALVGILRVPQLHGSPGRAIT
FT                   RRIGYALAALAVVVLIVYLGRVGYRDVQENPLSLLDCVYYATVSLSTTGYGDITPITAQ
FT                   ARLVNILIVTPLRIFFLIVLVGTTLAALTENSRQSYKIQRWRRRTRHHAVVVGYGTKGR
FT                   AAVAAMLGDGADPSNIVVVDTDPAVLETATGQGLVTVHGSATRSDVLRLAGAQHASSIV
FT                   VATSRDDTAVLVTLTARELAPEVKIVASVREAGNVHLLRRSGADTVVVSSETAGRLLGA
FT                   ATTTPNVVDIIEDLLTPETGFAIAERAVEPGEVGDSPRQLPDIVLGVVRDGQLLRSGTP
FT                   EVDSIEADDRLLYIRQITD"
FT   CDS_pept        438194..439366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04610"
FT                   /product="putative tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55960"
FT                   /db_xref="GOA:C1BCA5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA5"
FT                   /protein_id="BAH55960.1"
FT                   /translation="MTTMRAFPVQMPSGTRYWTVIDEDLLVMSVADAYLRYVRFGRDGA
FT                   ESTTKSYAGAVALYLSWCAATGQDWQAAAGKMPSFVLWLRHSPSQPGGATAGGVGTIVV
FT                   RGPRRINCVLAGVRGFLAFAVDHGDAPRGVLGQLYELADSQDLPAEARGEDGAWRLRMR
FT                   ARHRVPIVRQRPGRASDDDVLLLLRACRSARDRLLMLLLALAGLRRGEVVGLRREDVHF
FT                   LLDSSALGCSFPGSHLHVVRRQNINGAWAKSRHSRIVPVDSLVVQAHDQYVAERATKAG
FT                   AWESDFVFVNLFRAPIGAPMTPGAVNALLAAASRRAGLDRAVHPHALRHGFASNVLDAG
FT                   GSIDEVQELLGHASISSSQVYVHPAPERLRAAVERVGRAVGRGGTEDVTR"
FT   CDS_pept        439363..440265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55961"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA6"
FT                   /protein_id="BAH55961.1"
FT                   /translation="MSALPAGALAASTHEDELEAEQAKDIWAMSVFGHRGRLDFTAISQ
FT                   PWLREGTKRWAIQDLIRRRGDGVTTVLRAHVAALTGLSESLRIHRSDHGLIIGALGRHD
FT                   IEMFLQRLAHLEHCDKISALSRSLGCRKVHHALRQMRLLGLTRAGEPLGGLPDDFALRR
FT                   EDVPRRPDRPAPHRALPPEILAQLCDARALPAGALAASTHEDELEAEQAKDIWAMSVFG
FT                   HRGRLDFTAISQPWLREGTKRPVEAGHQRHVLGAAKSRCPTAPAANPRTSKLGVAPAHS
FT                   GSAASAATTSTPIPPICPS"
FT   CDS_pept        440262..440549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55962"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA7"
FT                   /protein_id="BAH55962.1"
FT                   /translation="MKAYLHDLLRDRERVLATADLENWARTEALPSEEEIRRVKDLVHR
FT                   VEEHLEQLTPAEQADIATAISAVRRTRQVTGLGMPSINRQPDLGKPLERP"
FT   CDS_pept        440754..441983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04640"
FT                   /product="putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55963"
FT                   /db_xref="GOA:C1BCA8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA8"
FT                   /protein_id="BAH55963.1"
FT                   /translation="MIGDGEPERDLAQLLVPRSGRLEATGNRYEPYQLLDPDGVPVVAV
FT                   TAYFRDLLASGRAESTLRSYGMDLLRWFRFLWSDTGVAWDRATRVEARDFCRWMQVAGK
FT                   QPRPHWRASGAALSSKPARGQAFAPSVRAHSETVLRSFYDFHRDAGTGPIINPFPLDRS
FT                   RRAGRAHAHHNPMEQHGNERSGRYRPKVPRRVPRSVPDSEFNEIFARLPSHRDRALIAF
FT                   YVSTGARASELLSTTLAGVDPGRQLITVVRKGTRELQELPASTDAFVWLRLYQVEMADL
FT                   IPKGRRQPLWWTLRRPARPLTYHAVHRMFERVNQQAGTSVTLHALRHTATYRMAEDPAL
FT                   PLTDVQFVLGHAQLTTTQIYLTPRKEDVIRRVLAHHAEQTRRAVERARPAPAPGYRPET
FT                   LDALFGNGVS"
FT   CDS_pept        441980..442810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04650"
FT                   /product="putative integrase/recombinase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55964"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA9"
FT                   /protein_id="BAH55964.1"
FT                   /translation="MTATVDEARLLAGRPPTGRDAARIRFPARPSPGTWPATGQSRDAV
FT                   WDRLTRAPFVVDNAHTQKIRLRGLTFLLDWLEAQPGGTWQERWLASGADSAGAGWRKIP
FT                   ARWLQEHGLVAEWRLEALTSALLVAISADLVRPALGWLVAKATGPGSLVRHLAQTRDPD
FT                   GFARLRILCDADPHVSSIANSHTLYRAAEIIAAKGGLLADVTVGDVLELLDVELDTLAS
FT                   VSGDAAVFYRLLRTAGVVGPDSPSTLREVRGESPRVLRRLGYLVPASARTGVSR"
FT   CDS_pept        complement(442768..443730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04660"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55965"
FT                   /db_xref="GOA:C1BBS0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS0"
FT                   /protein_id="BAH55965.1"
FT                   /translation="MEFVAAHRDEHGVDPICAVLRGTAAQIAPSTVRAHLSPQRTESAR
FT                   AVRDREVLSRIRGVHADNLGVYGARKVHASLKREGMSVARCTVERLMKADGLRGILRLK
FT                   GRKTTHADGAETPRPADRVQRQFVADAPNTLWVADLTYIRTHSGWVYAAFILDVFSRMI
FT                   VGWQVSTSMRTDLALDALDMGLWARRRVGQDVAGLIHHSDRGVQYRAVRYTERLDECDA
FT                   VSSVGSKGDSYDNAMAEAFNSLFKAECIRNPVMRPHGGWRGLGDVEWAVAEYIDWFNHR
FT                   RLHGEIDHVPPAEYETAYWSNHTAADYRETPVLAEAGTR"
FT   CDS_pept        complement(443733..444059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04670"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55966"
FT                   /db_xref="GOA:C1BBS1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBS1"
FT                   /protein_id="BAH55966.1"
FT                   /translation="MESMAAPRKYSVELKERATRMAVEARQDPATRPGALKRIADQLGV
FT                   HPEALRTWVKQAEVDGGVRPGTTTSDAERIAQLERENRELRRANTILKQASAFFAAEID
FT                   RPQR"
FT   CDS_pept        444071..445813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04680"
FT                   /product="putative integrase/recombinase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55967"
FT                   /db_xref="GOA:C1BCB2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB2"
FT                   /protein_id="BAH55967.1"
FT                   /translation="MRASDRPGAIQGTAGPRTPEELIDRYGLVCRPIRDVLVDYLRERQ
FT                   PSLDYSSMEGLACALGARFWKDLEIHHPGIDSLRLPDEVAAAWKQRLRTKQKTITAKTG
FT                   EKVTVDVPRLNYRECLIPIRAFYLDLAQWAVDDPGRWAQWAVPCPIKEEEANRRKLQRH
FT                   RKSRMDARTRERLPVLPTLVRTVNEHRKATEMLLQAARHTQPGEPFTAAGQTLIRSVTG
FT                   HKAIRGKVWAEDPVTGKRRDLELEEDHAFWAWAIVEVLRATGIRVEELLELSHHSFVQY
FT                   RLPTTDEMVPLLQIVPSKTDEERLLLVSPELADVLSAVIHRVRDHTGKIPLIASYDWQE
FT                   CVWLPPSPLLFQRRFGAERRRISPDVVRDILAAALVRTRLTDPSTDEPLRFTPHDFRRL
FT                   FITDAIMSGLPPHIAQVIAGHRDINITMGYKAVYPDEAIQSHLAFLARRRAMRPTEEYR
FT                   VPTDAEWQEFLGHFERRKVSTGICGRAVGTPCVHEHSCLRCSMHWPEPGQRQRIVEIRD
FT                   NLIARIAEAEHEGWLGEVAGLRISLAGANDKLAQIDRRSDNDSVNLGVPNTQRPKTSQT
FT                   HHNP"
FT   CDS_pept        445829..446236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55968"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB3"
FT                   /protein_id="BAH55968.1"
FT                   /translation="MNRSFLYRHRDLHAAVLVKAAEPTTTRTGGPSASRPSLIADLANA
FT                   HDRITRLSHENTQLRQRLSEQLGEQAWRESGLGPPDDIDRLHRRITELEQHTAEQRRQL
FT                   AERDDELDATRATNRELMTRLNRPHPDGRNH"
FT   CDS_pept        446468..446761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55969"
FT                   /db_xref="GOA:C1BCB4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB4"
FT                   /protein_id="BAH55969.1"
FT                   /translation="MDLGYARITTPKQELARQIDALTKAGINPPANVYADKKSGATTER
FT                   PELQLRSNGRCDRGAHPRPAAAPSASRGGSRTGLAAIATRGRSTASEPSRHE"
FT   CDS_pept        complement(446715..446951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55970"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB5"
FT                   /protein_id="BAH55970.1"
FT                   /translation="MKAHKSALKHGISENDGIYAAVHHVYTAGLDDDNPAREFRLGFDP
FT                   NGRLLELVVLRFDSGNELLIHAVKARSQYFDLL"
FT   CDS_pept        complement(446948..447214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55971"
FT                   /db_xref="GOA:C1BCB6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB6"
FT                   /protein_id="BAH55971.1"
FT                   /translation="MGMAEETINGAPVTDGMIEKWADEAEAGYDVEKLRKRGRPTVGDG
FT                   PGAVVPVRMDEALLKALNARAEQEHVSRSEAIREAVRAWTQVA"
FT   CDS_pept        447442..448404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04730"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55972"
FT                   /db_xref="GOA:C1BCB7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB7"
FT                   /protein_id="BAH55972.1"
FT                   /translation="MELGYARVSTSKQDLTRQIDAIRKAGVDQASIYVDKKSGATTERP
FT                   GLQALLGYARKGDAIVVHTLDRLGRTVRDTLNLIHDLHQRGIGFRNLADPIKIDSTNPD
FT                   DPMGQLAVVLLALFGQMERTYALERAAHARTVATEKGRRTGRPSVVTDAQLAYATQLRA
FT                   GGATIAEITDKTGLTRSTLYRHLPSRPPETRTPDTPQPENRTSPPPVAASSSPATGPSA
FT                   CPTCGYEPATRRDLVPHRADLAIVWLHLGDLGDLREARHCARCQPHGHVLVVSCSRCGD
FT                   GPLVTGTDSGTDEIPAAVRGWLAQQDWVVESDLLCPKHF"
FT   CDS_pept        complement(448408..450015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04740"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55973"
FT                   /db_xref="GOA:C1BCB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB8"
FT                   /protein_id="BAH55973.1"
FT                   /translation="MLHRGDPDMTAITAADLFAFGSAIRDFAARDDFNVLRRTLFANGQ
FT                   FHDDPDANRGFLRNHLANLHATHVLLYNVGQVTAAPRIGTRTIENWTDRLLPEPCPPKI
FT                   RAVIERYLQLRLDAKLDRPQTVHNARQALRRFVNWLGENHPQVSSFAQVDRATIEEYMR
FT                   WLPTCPSQHTGLPLATTTVKHELNAIAGFCRDTAVWGWAEVPGRPLLTPRDTPRRPESI
FT                   PRYLPQHELDAIMTAVDDLADPLQRAALLLLRWSGARRDEIRRLTWDCLDTYPGGHPRL
FT                   RIPVGKGRTELIVPLHPDAATALEHATSLARAQRSIARIDEVTGRRVDYVFVRRGKLLS
FT                   GKTLFDEAFRTVCAATGLVDDRGSPTVSAHRFRHTLGTQLAEGGARIQTIMAILGHRSA
FT                   TMSMIYSRISDPEIRRQYETALADGHRIAGPAADALLHDALDDDTVDWLKTNFLKTELE
FT                   LGHCLRLPAEGPCECDLILTCPKFLTTTEYAPRIRARLATEQVLIDDARTRGWDREAER
FT                   HEATCRRLQHLLDDRETR"
FT   CDS_pept        complement(450480..450719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04750"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55974"
FT                   /db_xref="GOA:C1BCB9"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCB9"
FT                   /protein_id="BAH55974.1"
FT                   /translation="MPRSCGCSPGGWTRSGYARWTKPQTPCGTHATAMWEAGMRELALQ
FT                   RRLGHASPESTRIDTRVSDQQVRDEYAAALRDRR"
FT   CDS_pept        complement(450514..451344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04760"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55975"
FT                   /db_xref="GOA:C1BCC0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC0"
FT                   /protein_id="BAH55975.1"
FT                   /translation="MGRRSRLGLSSVGSGGRLLVPSSVARVLAAVSSFYDWAIVAELVT
FT                   GENPMRRRRDVALAMVAERHRPFMGNASRQQPVSREVRVRLPHRLPRPMSGSEVTALLE
FT                   SMTCLRDLTMVLLMLDGALRPGEVLGLQLGHIAYGRRRVTIRKRDDHPRGVRAKSRHER
FT                   VVDLLEPRTLDAVNRYVLHERPVDAPSPFVFLVGGWGARRCEPLSYAALVRMFARRLDT
FT                   LGIRTVDKTPNALRHPRDSDVGGGDAGVGVATTPRTRLTGVDSDRHPGLRPAGS"
FT   CDS_pept        complement(451181..451603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04770"
FT                   /product="putative transposase"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55976"
FT                   /db_xref="GOA:C1BCC1"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC1"
FT                   /protein_id="BAH55976.1"
FT                   /translation="MHVQAVKTGGIVPSVVLVGPDGEPVPSVTRFLRYVLDSGRSPNTA
FT                   LAYGYDLRLVFEFFAERGIDWREFRPSLALELLGWLRRRPVRGPAQPAGPLVRRVRRAA
FT                   VGALECGASAGRSIEFLRLGDRRRTRHRREPDAAPS"
FT   CDS_pept        452350..453045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04780"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55977"
FT                   /db_xref="GOA:C1BCC2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC2"
FT                   /protein_id="BAH55977.1"
FT                   /translation="MELLVLTGDLDPESVLPALGLLAHTARSAPLEASSFLDTDRVDVV
FT                   LVDARADLAAARDLCRSRKTSDSAVVPVVAVLTEGGLVAVTPEWGLDDILLTGAGPAEL
FT                   NARLRLLAGRSGGAGPDGTVKIALGDLVIDDLTYTARVRGRPLDLTYKEFELLKHLVQH
FT                   AGQVFTRAQLLQTVWGYDFFGGTRTVDVHVRRVRAKLGVEHHSLIQTVRNVGYKAAAQH
FT                   HTGTTDPQS"
FT   CDS_pept        complement(454224..454658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55978"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC3"
FT                   /protein_id="BAH55978.1"
FT                   /translation="MKRIATALLVILAVGAAVYFLTRNPPQQPSPRPLEDRSFIINGRP
FT                   TTCGELIRQPCGFGLQTEYNRFGDRLENFVNSSDLGPFATDIGFAATAKLSLQACRLSH
FT                   TVGKTILEFVELGRLDHSDAGSPQLFPFWNRARESLCPGG"
FT   CDS_pept        complement(454733..454984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55979"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC4"
FT                   /protein_id="BAH55979.1"
FT                   /translation="MIDSARTATGVLEPGELPIDDYDELNVGIPLSGRRTSSTPPATPT
FT                   GRAADLLRRNDSPHSQCRRTTHPPDRRPQAPLERFAGT"
FT   CDS_pept        complement(454981..455739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55980"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC5"
FT                   /protein_id="BAH55980.1"
FT                   /translation="MPSTQKGRTRMSTTDTTTLLAQLRAVLDLTHTEMQVAETRIVQAR
FT                   TDAVRRELSENAANGRSRAEAIDAAIRQLGGVPELIGPFLGRAVAAVKALTEQAQPFDE
FT                   ALFGDLALEHQLLDHARYIKALAVAAGERDIENLAFRLIAAHSATVDWLTTVLAEDALG
FT                   GPAALRRTPLQAAAGAAVRLVNVPVTWSARSLDRALDTVRTTPPALNELLSRGARAGDV
FT                   AVKTLTASATRRSRPPNRSPVSKAPTASPT"
FT   CDS_pept        456008..456373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gvpA"
FT                   /locus_tag="ROP_pROB01-04820"
FT                   /product="putative gas vesicle structural protein GvpA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55981"
FT                   /db_xref="GOA:C1BCC6"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC6"
FT                   /protein_id="BAH55981.1"
FT                   /translation="MTTAGGPSSSSLADVIDTILDKGLVIDAYVRVSLVGIELLTIDAR
FT                   IVVASVDTYLRFAEAANRLAIGSEPKGLSDLVSDVKGSGSTKSKTKGVLEGVGETLGEL
FT                   LSGSGSEREPAPRRRRK"
FT   CDS_pept        456370..457623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04830"
FT                   /product="putative gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55982"
FT                   /db_xref="GOA:C1BCC7"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC7"
FT                   /protein_id="BAH55982.1"
FT                   /translation="MTSADDADDNDNDYDYDYDNDNDNDNDEGASAAVIYVYGIVPADV
FT                   QPEDDATGVHDAPIEIVEHGDIAALVSEIDPDQRLGTPADLQAHAHILDGTSHVAPVLP
FT                   LRFGAVVSDRDAVINELLAEHEDEFAAALNELEGFAQYMVKGRYVEETIVREIVDESPK
FT                   ATALLETIRDQPEAQHRLLGRTVCRVQRCHNTVHSGIAVCHRCFTRLSRLGMSPEDIAT
FT                   AMELPDEPAPATRCAGGAKITDAQLRVLCDGLRWRQVTSIAVDRAEITRNKSVRSLRAA
FT                   LTQHVRRVATTAPILSSPCPCVGVVRCAFPPRVMPTARRILASSSAAWGASTKPYKILY
FT                   TCGVKKIQFMGPRWRIFGVSPMRFVVGVVISWTVFSRGSSRRTGSRWWVWVLVCGRSGY
FT                   VMGRERSVSSTWRSSRTG"
FT   CDS_pept        457736..458017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04840"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55983"
FT                   /db_xref="GOA:C1BCC8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC8"
FT                   /protein_id="BAH55983.1"
FT                   /translation="MSDEIYGSVWDAIEDTPQEAENMRLRSTLLIALSRRIETEGWTQK
FT                   DAAARLGVTQPRVSDLIRGKIDLFSLDALVNMVSAAGLHVDMTVSAAA"
FT   CDS_pept        complement(458914..459147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55984"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCC9"
FT                   /protein_id="BAH55984.1"
FT                   /translation="MVGLPDPDRGMVVHAAVVLVPDVAGDEAEVSALQDFVKSVLAPYK
FT                   YPRSIEFISELPRIPNGKIQRYKLRESRPALS"
FT   CDS_pept        complement(459261..460052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04860"
FT                   /product="putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55985"
FT                   /db_xref="GOA:C1BCD0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD0"
FT                   /protein_id="BAH55985.1"
FT                   /translation="MDRSYLFAPGHNRKLLGKVFDAGADAVILDLEDAVPPTEKSTARD
FT                   NVASVITTRTAWVRINAPGTELADADLGAVATSAHGIRIPKVETLDDIRWVVDRAPGKP
FT                   LICAIETAKGVANAFAIADHPTVTHLALGGIDLQKDLGTGTGDAPMQYVRSHLVVAARA
FT                   AGIAPPIDSVYPHIDDTDGLVRQAAHSRDLGLFGKSAIHPAQLPAIHTTFSPRQNDIDW
FT                   ARQVVDAFENADGAAVRLPGGEFVDLPVAQRAKNILDSAHA"
FT   CDS_pept        complement(460052..461323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04870"
FT                   /product="CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55986"
FT                   /db_xref="GOA:C1BCD1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD1"
FT                   /protein_id="BAH55986.1"
FT                   /translation="MTAHPSDIRSPDDQADESTDGTSTPTRGPLHGIRVLDISTVYAAP
FT                   ITAMLLGDYGAEVIKIEHPTGDPARTHGARKDGHGLWWKVISRNKTCITLNLSTTDGQQ
FT                   MLRDLVVDADVLVENFRPGVLEKWGLGPDRLQDLNPGLIMLRVTGFGQSGPYAERRAFG
FT                   TLAEAMSGFAHQTGGEDGPPTLPPFGLADGVAGLAGAFGVVTALLHRNGPDSDGKGQVI
FT                   DLSLLEPLLGILGPGPTAYDQLGTIAGRNGNRSPNNAPRNTYLTKDGRWVAISASATSV
FT                   AARVMRLVGRPDIVEQPWFDSAGERSRNGDLLDEAVAKWIADRPLHEVTAEFERVGAAL
FT                   APIYDVAQLMNDPHVLARDCITTVDDEDLGPIKMQNLMLRMLGTPGAINFAGRRLGQDN
FT                   QQFYKDTLDIDPDRLTALAEKGVL"
FT   CDS_pept        461529..462449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04880"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55987"
FT                   /db_xref="GOA:C1BCD2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD2"
FT                   /protein_id="BAH55987.1"
FT                   /translation="MLDTNRMFTLREVAEHGSITAAAAALGYTTSAVSQQIAKLEKEAG
FT                   QPLLERHARGIVLTEAGRSVVKHTERILIELEAADAELAEIKGLRAGVLALGTFPTAGS
FT                   SLLPLVVKEFKTRHPGVELKVLSGRFAYLVDALRRRETELSLLWDYEWNRVDDPTLTYH
FT                   HVMNDPTVLLVSERHRLADRDSIRIAELRDESWVVRADDHPVAQTLEKLCQQGGFTPRT
FT                   SVFAHDYGEVQAMVAVDLGVAIAPRLAVLNLRPDVRSIPLATRPPQRRILVAHLTERRL
FT                   SPAAQEGIAVCAAAAHQLQEGFETG"
FT   CDS_pept        complement(462456..463313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04890"
FT                   /product="putative citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55988"
FT                   /db_xref="GOA:C1BCD3"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD3"
FT                   /protein_id="BAH55988.1"
FT                   /translation="MRIRTPENVAIARREIDARIARSWLLVNGTRTDLFDQADRSCADQ
FT                   IVLDIEDAVDPQLKSDAREEVAAWLENTSAWVRINDRSSAYWSDDVDSLTGLPGLAGVM
FT                   LAKTEAAEHITETFDRLGRSTPVLALVESALGIDQARDIARTRGVFRLAFGSGDYRRDT
FT                   GTSADDLAMAYPRSRLVVASRIGNLPGPIDGPTVSNSHTVLREQSAVSVSLGLTGKLCL
FT                   DTEQLPVINETVSPTPSDVTWAREFLADFEARGRIVRDGSDPPRLGRAEKITHLADCFG
FT                   IGRS"
FT   CDS_pept        complement(463310..464464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55989"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD4"
FT                   /protein_id="BAH55989.1"
FT                   /translation="MGRTVFTLHGTWMRGGTSKCWLFNAFDVDPLIAQAGGLDAILTSA
FT                   FGSGDPRQLDGVGGGSSTTSKAAIVRRSSEPGIDVDYLFAQVAIGDRQVEWGSNCGNCA
FT                   TAIGLYALQSGFVPVDSATTTVRMRNQNTGAILNAEIATPGGMIPTEGDAAVPGTSALG
FT                   VPVGLTFTGLAGGAATLLPTGASIDRVTIAGRSYHATMVVAGAPAALFDAADLGLTGAE
FT                   DNQTIAEHLPLLLSLRRESSLRMGLSKPGDPISHAIPKVGVVGPPADYRTSAGVDIRAE
FT                   DYDISVRMLSMLAPHPAIGLTSAVAVAAASTVTGGVVTDNTQVRWPGSLRVGTPAGVLD
FT                   VDLSVSLDGVLESVTLHRAARRIASAELFVTAPAPAPALVGSAR"
FT   CDS_pept        complement(464637..466031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04910"
FT                   /product="putative dicarboxylate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55990"
FT                   /db_xref="GOA:C1BCD5"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD5"
FT                   /protein_id="BAH55990.1"
FT                   /translation="MTSIEILPLIALVAMFVIATFFPINIGILGFIGAFVVGAFLLGYD
FT                   DKEILAEFPSSIVLTIIGVTYFFGMAKKNGTIDLLVNACIRGVRGRVTIVPWVFFFCAS
FT                   VLTALGTFSPAAVALISPAAMSFAARTRMSPLVMGIMTINGAHAGAFSPISVSGVLVRD
FT                   IVESSGLTIAPWTLFFASYGINLLLSVLTVVGYAVLARVRNLEFSATGSSAGIDSDGGG
FT                   SALSTPTAGPGGTPAGVSSSGGGTQVLIRTPRTEVVTDHDVQPVTGVQKLTLVLIAAVL
FT                   VLVLVLHMPISFVAIAAGAILAFTDLSKQSEAIAGISWSTVLLVAGMVTYISLMEEIGT
FT                   IDHLAEMAITIGAPLLVAVVLCYVIGVTSAFASSTALLTAVIPLALPLLQTGALPVVGV
FT                   VAALAISATVVDVSPFSTNGALVLANAQNIERPRFYRQLLLNAGIVVAIAPALCWLVLV
FT                   AVPTLV"
FT   CDS_pept        466454..467374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04920"
FT                   /product="putative LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55991"
FT                   /db_xref="GOA:C1BCD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD6"
FT                   /protein_id="BAH55991.1"
FT                   /translation="MRDSFDVVTLFLLLDIAEAGSLTGGAERANVTPSAASQRIAKLEQ
FT                   EIRQPVLTRLPRGVRLTEAGDILVTRARLFRQEMRAARGDLESLQGLERGTVRLGSFPT
FT                   VSASLLSDALKDYHAHWPGIDVRVQSAVRPRLLEMLHSSEVEMALLWSYDWTEETEKSL
FT                   ALVPLMEDETVLLVPLDGPYADDVAVASLRSAKWIIRNTNHPAAEVLYRSCETAGFTPN
FT                   VVYEAHDYQEIEAMVAAGVGIAMVPRLAVTHHRPDVYAVRFRPTDRVPTRSIYIASLAR
FT                   RQYTPGMHAVSRALHDAADAITAQR"
FT   CDS_pept        467541..468008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55992"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD7"
FT                   /protein_id="BAH55992.1"
FT                   /translation="MSVGEVPFSDIQNKGKATLSEWQRSGARPLRVTRRDDEDLVLMTA
FT                   VRADQEREVLAAATAMVDALLHSDDGVLVRKVVAAAFPWVSYLSGEEVADFVDELIASL
FT                   RAGSSLDNPAPPARTIETWRHTAEVYADPDLARILSAPSAGDFGAVPVPEL"
FT   CDS_pept        468005..468358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55993"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD8"
FT                   /protein_id="BAH55993.1"
FT                   /translation="MSPKLGERVAPPAAGELWELRFATSDAAKGWDELCRQAPANTLVA
FT                   YEELRRRAVAGESTTRHHRLKGRLATGVHNGLEMEQWQYEVTAGGRIWYVMDIEHRTLW
FT                   LKYAGTGHPKQTE"
FT   CDS_pept        complement(468982..469533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55994"
FT                   /db_xref="GOA:C1BCD9"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017520"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCD9"
FT                   /protein_id="BAH55994.1"
FT                   /translation="MGSPITSLYARVAQDFTDRLLGCPQDRWNSASPCPGWTAWDVAAH
FT                   VVGNHRRACAGLRGNDYRVPTAGEDVVAAWLDATAGVQAALQSEATAQQVLGAEFGNLP
FT                   FEQFVRRMACADTLIHTWDFARATGQDEHLDPEAVELARTFLVAEDDRIRLPHAFGAKV
FT                   APTDNADIQTQLLNFLGRTT"
FT   CDS_pept        complement(469925..470245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04960"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55995"
FT                   /db_xref="GOA:C1BCE0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE0"
FT                   /protein_id="BAH55995.1"
FT                   /translation="MLLPPVEPGQYTAAAFVDVCRRHGIQLSRGRVGSSYDNALAESFF
FT                   QGLKREWLHGRSWTSKSQARLDLFEWLSYFNRRRRHSALGYLTPVEFEQRLIASSTLSV
FT                   AA"
FT   CDS_pept        470261..471661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04970"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55996"
FT                   /db_xref="GOA:C1BBV0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV0"
FT                   /protein_id="BAH55996.1"
FT                   /translation="MGMGRPPGWAAALTGRAVMRSPGRPPIRRDLERAFWTRIAEGLTS
FT                   DDAATTCGVSGPVGTRWFRQAGGMPPIELTPVSGRYLSFTEREDIALLRAKGMSMRDIA
FT                   DRIGRSPSTISRELRRNAATRNGKLTYRASTAQWKADLAARRPKPAKLAEHDRLREYVQ
FT                   DKLSGVIRADDGTVVSGPDAAWIGRNKPRRGDRRWATAWSPEQISNRLPIDYPEDPTMR
FT                   ISPEAIYQSLYIEGRGGLERELVACLRTGRALRKPRARARKQRTGFITEEVTISARPEE
FT                   VESRKTPGHWEGDLIIGLTRSAIGTLVERTSRYTTLLHLPRLKGYGTAAMVKNGPALSG
FT                   YGSESVRDALAATLSPLPEHLRRSVTWDRGKELARHAELTASTGIRVYFCDPYSPWQRG
FT                   TNENTNGLLRQYFPKGTDLSRYKFRELQAVADALNNRPRKVHGWRTPAEVFAEQVHSSS
FT                   RHGVATTG"
FT   CDS_pept        complement(471558..471818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04980"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55997"
FT                   /db_xref="GOA:C1BCE2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE2"
FT                   /protein_id="BAH55997.1"
FT                   /translation="MIDIFSRRVVGWSIADHMRTDLVTDAIEMSVRTRGGDVGGVIFHS
FT                   DRGSQGGFNRSSQHRAVRTSVPVRQTLPLEFSNRALFGGGC"
FT   CDS_pept        471899..472954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-04990"
FT                   /product="putative transposase for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-04990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55998"
FT                   /db_xref="GOA:C1B684"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B684"
FT                   /protein_id="BAH55998.1"
FT                   /translation="MSMILEEKWPVLCRHERAAEWLQIWTDLGRAPRTIDAYARGLAEY
FT                   LLVCEREGVDPVVATRAQIALFVRDLRTRPSRRGTNVVALDSGSGLANATLQQRLVPVR
FT                   LFYDFLVEEGVRESNPVGRGRYTPGRHFGGQPRPLVPRMVKLPWIPGEAEWLQLLDVFR
FT                   LEPIRNRLMLALAYDSALRREELCSLRTDDLDPAHRMLRVRPETTKTRRGRVVPYSAAT
FT                   GVLLSGYLAHRAGISRARGPLFLSESRRNFGEPLSLWSWSKVVRRVALAADVPQFSTHT
FT                   TRHLCLTDLARMGWELHAIATFAGHRSTESTLTYIHLSGRDLAEKLNRAMTHLHAQRIS
FT                   MLTAPDGTGPA"
FT   CDS_pept        472951..475287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05000"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH55999"
FT                   /db_xref="GOA:C1B685"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1B685"
FT                   /protein_id="BAH55999.1"
FT                   /translation="MTAAVRAVGEADATWPASTFPVSLERYDRREELTDAERRALRDLS
FT                   PKALRRNRARGIPRRTATHWTALVRLVEPLDTARAGLHHGDDARFRRAGAHAAAIILQN
FT                   CADTGRSYWAWTSEDWAQLCGSSAEAFVAARELPTETTVRPFLVALAYLLGSFDAFQLL
FT                   GTFNRLHLARLVFGAEAIEESMRQASAVLDQWGYRGVFIGKHRLRGGLSQALLINRSSR
FT                   LEDLDTAAFDRLRVHPATNDHQGEMLYALQRAVAALGHCDPPVRTGDNPYAVIEGTTDS
FT                   WANWVARWHDTSTLTPRVRRTIRTILAKAGRWLAAEHPEITEPGQWTRQTSAAWVAAVD
FT                   RMTVGDYVQRRDHLRARTGDPISPRTKAHILMATRTFFRDCQEWEWIDRRFDPARALAL
FT                   PRSVSALIGTNPRVIADDVWAKLLWAGLNLDSSDLPGNSAHTYYPMELIRAITLTWLFG
FT                   GLRSDELSRLRVGCVRWQHDGQPIAADSPDVLAEDAVCLLEVPVHKTGTAFTKPVDPLL
FT                   GQALEAWQALRPPQPKTLDRKTSEQVDMLFAFRAHPVAKNYINRTIIPALCAKAGVPSS
FT                   DVRGNITSHRARSTIATQLYNAKEPMTLFELQAWLGHRTPNTTQHYAKITPNTLSKAYN
FT                   EAGYFARNVRTIEVLVDRDAVTSGGAATGQPWQHYDLGHGWCSYTFFEQCQHRMACARC
FT                   DFYTPKDSSKAQLLEASGNLQRMLTSIPLTDDERAAVDDGHTAVAALLERLTDLPTPAG
FT                   PTPREIGTSPTVTLLPIVQVRHGEP"
FT   CDS_pept        complement(475038..475772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05010"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /note="fragment"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56000"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE5"
FT                   /protein_id="BAH56000.1"
FT                   /translation="MKTRRWDFISDHRAEFGVQRLCRVLGTSRSGYYKHLITEPARVER
FT                   QAEEAATVAEIRAIHAEHRSAYGAPRVHAELRSRGRKINRKRVTRLMRIHHVVGRHLRR
FT                   SKRTTVADKSAPSVPDLVMRDFTATAVDTKWCGDITYIPVGSSWLFLAIMWNQDCQVHQ
FT                   GSPCRTCTIGSRVTVGDVPISRGVGPAGVGRSVRRSSSAATAVCPSSTAARSSSVSGML
FT                   VSMRCRLPLASSSWALLESFGV"
FT   CDS_pept        complement(475769..476092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05020"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56001"
FT                   /db_xref="GOA:C1BBV4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1BBV4"
FT                   /protein_id="BAH56001.1"
FT                   /translation="MGRQSLYTEEFRKDAVALYRAADGKRTYAAVAADVGVSGETLRTW
FT                   VRKDTARNARSQDRSTGADGTEADELARLRAENARLRGAEKEWQLEREILRRAAAYFAK
FT                   EVK"
FT   CDS_pept        476270..476467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56002"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE7"
FT                   /protein_id="BAH56002.1"
FT                   /translation="MARTIVARGLHDECRHGCTELALMLVDGRKATDADGGAVGAAMPT
FT                   GGPERGCSPRSVTIVDLTLG"
FT   CDS_pept        476724..476894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56003"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE8"
FT                   /protein_id="BAH56003.1"
FT                   /translation="MFSGLLGMWPAGGLREVRFGAAVARVREALHRRNCGTVFGEKAVG
FT                   RQAHTTPCSAS"
FT   CDS_pept        complement(477328..477576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05050"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56004"
FT                   /db_xref="GOA:C1BCE9"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCE9"
FT                   /protein_id="BAH56004.1"
FT                   /translation="MVVVTAGALSTAGTFVATIFSAAVDFAPAVFAGDFLTVAFFTAVF
FT                   FGPVVFAGDFLAAVFFAGAFPSTIFFAAAFFAGAAFA"
FT   CDS_pept        complement(477682..478014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05060"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56005"
FT                   /db_xref="GOA:C1BCF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF0"
FT                   /protein_id="BAH56005.1"
FT                   /translation="MIVDTAGALPTAGTFVAAIFSAAVDFAPAVFAGDFPADAFFAGAF
FT                   SAAVFAGAVPAAAPFTGASFSTTFSTAVFLAAVFFAAVFCPVVFCPVVFCPVVFCPVVF
FT                   AGTVFA"
FT   CDS_pept        478052..478381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56006"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF1"
FT                   /protein_id="BAH56006.1"
FT                   /translation="MSPRGRISAEIEQAFHDAQATKAQAKTLPAKKTATKKAPAKKAAV
FT                   EKVVEKEAPVDGAAAGTAPAKKTAKEIREWAIGEGREVSFRGRISAAIVRAFHEAAAKL
FT                   PAVGG"
FT   CDS_pept        479055..479207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56007"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF2"
FT                   /protein_id="BAH56007.1"
FT                   /translation="MRVMLVISVASVAVLSVASRRGVAGGMPVTPHPSTTLLSRIAGGN
FT                   GGSDQ"
FT   CDS_pept        complement(479773..480882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56008"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF3"
FT                   /protein_id="BAH56008.1"
FT                   /translation="MTAYRSRLRHKATRTLVRVALCATVGTTATVLCAPTVWSAPTDSY
FT                   AVTATIPVNGLAEGIAISPDGSRAYVTHGDDGAAGQLSVIDTATKTVLNTLAVGNFPVG
FT                   VTVSPNGQTVYAGSNGDDTVSVIDTTTFAVTATIPVGDGPLGVTITPDGTKVLVASQFD
FT                   GHLTIIDTATNTVSSTLALGGTTMFLAVSPDSRTAYVTDSSGNAIDVVDIPTAAVTARI
FT                   PASGSPLDIDITDNGSTLCVTGVDGFSTGSASIIDTATRSVTATIPVAAAAGGIDVAPD
FT                   GHTAYIAHSTPTNAVTVIDTATRTVTATVPITENGQLIAVTPNSADAYVTSQSDTVSVV
FT                   SNTSAPTDPPTTTPPTLPGTGSLGTIFGS"
FT   CDS_pept        complement(482333..482536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56009"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF4"
FT                   /protein_id="BAH56009.1"
FT                   /translation="MPFETLSGSHDGAAGKGRCASVCVQRAERSNSRQRLFRIPEMCGD
FT                   LAIEEFIIRNGVAWIDYELTLD"
FT   CDS_pept        complement(482558..482761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56010"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF5"
FT                   /protein_id="BAH56010.1"
FT                   /translation="MTLLTVESAHQQVRSNLLLLTLFEMSIVDVCVTRCPLLSRFERGI
FT                   PVVDGSRARLSHFSNRTRPYRQ"
FT   CDS_pept        482907..483329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05120"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56011"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF6"
FT                   /protein_id="BAH56011.1"
FT                   /translation="MLCTPASRSCAPGFCTFQPVVDGGACPWALNCQGCDKFVLSGADP
FT                   LYWRRKREQWGQLAEGAPDDATANYPYQHFAPTARAIDGLENALAGLGLLDQALALDLR
FT                   KPQDYFHRVWSTAFRATDLTNTAIADNDETEGEACA"
FT   CDS_pept        complement(483478..483720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56012"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF7"
FT                   /protein_id="BAH56012.1"
FT                   /translation="MHWPEPGQRQRIVEIRDNLIARIAEAEHEGWLGEVAGLRISLAGA
FT                   NDKLAQIDRRSDNDSVNLGVPNTQRPKTSQTHHNP"
FT   CDS_pept        483976..485160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05140"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56013"
FT                   /db_xref="GOA:C1BCF8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF8"
FT                   /protein_id="BAH56013.1"
FT                   /translation="MPRYAWNTSPQEDKRRYFELIRQGHSGAKAAATVGVSLSCGSLWF
FT                   IDAGSMSYVESPISSRYLSQDDRIEIADGLARQESVKTIAERIGKSFQSVYKEIARNRK
FT                   SDGRYQPWYAHNQAHQRRRRPKVRVFTHDDTLRQLVAAKLGKRWSPAQISRWLRRRYPR
FT                   RTAWHVCVETIYEAVYRGLVLAATGGSLRTGRTYRRRRGRGRSRDGSLKQSTNMTPIAQ
FT                   RPAHVESRRQVGHIEGDLIIGAGQRSAIATLVERKTRLTILVAIRGGHSAQVVGDALIE
FT                   RFTQMPVSLRRSLTWDQGNEMFHHERIAAATGLKIYFADPHSPWQRGSNENTNGLLRQY
FT                   FPKGTDLSCWTQDQLDEVATELNDRPRLCLNDLTPNQAVRRWWPLHDYPMIRHD"
FT   CDS_pept        complement(485077..487188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56014"
FT                   /db_xref="GOA:C1BCF9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCF9"
FT                   /protein_id="BAH56014.1"
FT                   /translation="MTATVDEARLLAGRPPTGRDAARIRFPARPSPGTWPATGQSRDAV
FT                   WDRLTRAPFVVDNAHTQKIRLRGLTFLLDWLEAQPGGTWQERWLASGADSAGAGWRKIP
FT                   ARWLQEHGLVAEWRLEALTSALLVAISADLVRPALGWLVAKATGPGSLVRHLAQTRDPD
FT                   GFARLRILCDADPHVSSIANSHTLYRAAEIIAAKGGLLADVTVGDVLELLDVELDTLAS
FT                   VSGDAAVFYRLLRTAGVVGPDSPSTLREVRGTAGPRTPEELIDRYGLVCRPIRDVLVDY
FT                   LRERQPSLDYSSMEGLACALGARFWKDLEIHHPGIDSLRLPDEVAAAWKQRLRTKQKTI
FT                   TAKTGEKVTVDVPRLNYRECLIPIRAFYLDLAQWAVDDPGRWAQWAVPCPIKEEEANRR
FT                   KLQRHRKSRMDARTRERLPVLPTLVRTVNEHRKATEMLLQAARHTQPGEPFTAAGQTLI
FT                   RSVTGHKAIRGKVWAEDPVTGKRRDLELEEDHAFWAWAIVEVLRATGIRVEELLELSHH
FT                   SFVQYRLPTTDEMVPLLQIVPSKTDEERLLLVSPELADVLSAVIHRVRDHTGKIPLIAS
FT                   YDWQECVWLPPSPLLFQRRFGAERRRISPDVVRDILAAALVRTRLTDPSTDEPLRFTPH
FT                   DFRRLFITDAIMSGLPPHIAQVIAGHRDINITMGYKAGRIPLVVANHRVIVQGPPSSHS
FT                   LVRSEVIQA"
FT   CDS_pept        complement(487185..488414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05160"
FT                   /product="putative integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05160"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56015"
FT                   /db_xref="GOA:C1BCA8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCA8"
FT                   /protein_id="BAH56015.1"
FT                   /translation="MIGDGEPERDLAQLLVPRSGRLEATGNRYEPYQLLDPDGVPVVAV
FT                   TAYFRDLLASGRAESTLRSYGMDLLRWFRFLWSDTGVAWDRATRVEARDFCRWMQVAGK
FT                   QPRPHWRASGAALSSKPARGQAFAPSVRAHSETVLRSFYDFHRDAGTGPIINPFPLDRS
FT                   RRAGRAHAHHNPMEQHGNERSGRYRPKVPRRVPRSVPDSEFNEIFARLPSHRDRALIAF
FT                   YVSTGARASELLSTTLAGVDPGRQLITVVRKGTRELQELPASTDAFVWLRLYQVEMADL
FT                   IPKGRRQPLWWTLRRPARPLTYHAVHRMFERVNQQAGTSVTLHALRHTATYRMAEDPAL
FT                   PLTDVQFVLGHAQLTTTQIYLTPRKEDVIRRVLAHHAEQTRRAVERARPAPAPGYRPET
FT                   LDALFGNGVS"
FT   CDS_pept        488607..489587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05170"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56016"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG1"
FT                   /protein_id="BAH56016.1"
FT                   /translation="MRTCTLRISAGQRCIRRSAVGKSDDTQMTLAVHHALADVTDFDDI
FT                   EAVTDAITRQFFLWQVDPDNTRAPGRTCMKSLRNLRAGARWYDRDGAVESAGCGAVMRL
FT                   VPTAFAPDPYWLGLTALQAVITHKHPRAVVPALLLADATRHAPAQRGRYLEHALTTAAQ
FT                   IYNGTSTWTEDPYLQDVLAPITGDVSSFLVDGLNDDVADALMRAADSRDRLQDVEPASY
FT                   GDPCAGIGEGWESASAAALALLVADMATASGGDAPALTGPQALAWASTSNGDSDSIACI
FT                   AGGIIGSAHPEPDYWAANGLNPTFEPRYAEELAAAACQGTCRLPR"
FT   CDS_pept        489990..490532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56017"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG2"
FT                   /protein_id="BAH56017.1"
FT                   /translation="MRLDLSAPRIGFDGWVFVARLVEEEAGYVSFCAPGQNLDGWSRPD
FT                   TPHCDYCGKFRRRAMLYVLRHTDTGEIKQVGASCITLFLGVKVAGLWTLEFDLDEHLPT
FT                   LGGEEWGEPVTRGDRSLHKLDTIAVALASPRAGAATSPAPGPATSRSARPQTPSRPRCG
FT                   DCSSSATRSCAANSQKG"
FT   CDS_pept        490625..491029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05190"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56018"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG3"
FT                   /protein_id="BAH56018.1"
FT                   /translation="MNLRVLLAGDYVSAKSVCIAASLVAVYARQQQHEAARATIAPGFV
FT                   APKGAKVTDLDATVTVSRIIPGHYGAKTLLVLRTEGNRLVKWFATGLRDFEPGQRVRIL
FT                   RATVKDHETFRGQDQTVVTRAKLEDLEPAV"
FT   CDS_pept        491128..491967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56019"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG4"
FT                   /protein_id="BAH56019.1"
FT                   /translation="MIRPHFSYNDPTLTPPEPGKDLVLEVGLIFSRPGIGPKGGGQYGG
FT                   IPLSVGPTTTLFRRHDDIEMRLPNTDLLLWHTPFLTQAHYRGVTGLHRRPGWEWLTWTL
FT                   ADHIAYDTAVAVVPAHGVVPVTEETAASPLVIVPCGGRKRGEPAPAGALYTGSYHRLCQ
FT                   EAARRLAPLERIHILSGLHGLLDLDTVVAPYEMRLGRPGSVTADTVHAQAADRGLLGAP
FT                   DVVVLAGRDYSRIVTAVWPHARTPLAGSRSMGEQLQRLAAIAAVGGLDHIGLHQKSA"
FT   CDS_pept        492044..492670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05210"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56020"
FT                   /db_xref="GOA:C1BCG5"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG5"
FT                   /protein_id="BAH56020.1"
FT                   /translation="MLIVAMLALGAAFLGGALYPLLGVVRSWSDGDRSKNQATVAAMSL
FT                   VALYGLLFLYSGVAGLFGARLSATTILAFFAVTVLVGTVFALASLYSKRRAWSLDNELR
FT                   AASGRPDRRHWMPPLLVGLVWLMGGSIAQFGVLMLVASMSAGERSPETTTDDLGATVAI
FT                   VFMAAVMVIAAGAAGAQKWRLHREESRLQVSDRMLAQRGHGGGRG"
FT   CDS_pept        492667..493542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05220"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05220"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56021"
FT                   /db_xref="GOA:C1BCG6"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG6"
FT                   /protein_id="BAH56021.1"
FT                   /translation="MNEDNSIAATSLDWSTVVLKESEPPPARPAEDGLLSVLLGVVLLS
FT                   IGGTILTAIPLLFAGATVALAAFADVEVSFLSEHSDALWTLAGATTATFLVGVAAVGAV
FT                   TALGAVRNKRKPNEITGNQLAAAPHEVRALMSDAVLTVETIKDSRAWREGLFTDVDLRA
FT                   AIWDIGSRVLAATELHDAITAAGESGNGALAPEDDQTYVLSCARIADAVQALRDAAAAV
FT                   TQLSAELAAADAVAQLDAERAERAEQSAGRIERLVTAQAATPTTPATTVTDLSETITTR
FT                   TVAYRELRQA"
FT   CDS_pept        complement(493692..494471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56022"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG7"
FT                   /protein_id="BAH56022.1"
FT                   /translation="MTSRVRLGDLGEVRDHPLGVTQAGFRAGLTQSEAFARGRGPFPGD
FT                   AENVRSERELFVTAPDDEVLAVATITGVREHDGELVVDGDLVVDHERVGTRLLIRTPAE
FT                   NVFSCADEVSAWAGSVERARWVYVRALVEVATVKTASYDRRLASADPAADPEVTLATAD
FT                   ETMQVVPRYVMIHRSGKLRLGGPYADTADWDGHVDPWTDYGYVDCLRLDDVLGTSGDLD
FT                   IDVMRSLTSRAAAAELLESLGWDKVIRRFVDARTPAK"
FT   CDS_pept        494737..495960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05240"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56023"
FT                   /db_xref="GOA:C1BCG8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG8"
FT                   /protein_id="BAH56023.1"
FT                   /translation="MTGSASEKTISPASRAFWDRSFAGRRAMFEELRQRSPIEFHTETA
FT                   GPGFWSVVGYDDVVAVSRNPEVFSSAKGFTIDDVPAEILEFAMSMIAMDDPRHRRLRGI
FT                   VQSAFTAASVRGIAERVRGYAAQIAADLPRDAEFDFVPDVATRLPVQVICELLGIPESD
FT                   RPMILAAAADVIAGGGDQEFVTAPGGAAGLGQIYGYALELGEKRKADPGEDLTSRLVST
FT                   MVDGETLTPTEFGSFVILLITAGFDTTRQALAWALHLLSEHPDQKELLLADFAGHIDNT
FT                   IDEVIRFASPVPYMRRTASVDTELGGAHIAAGDKVVVWYLSANHDERIFDGPGRFDITR
FT                   ANAGKHLGFGAKDIHHCLGMNLARLELRVMLEELFTAHPALHAVGEPELLLSAFISGID
FT                   SLPVRTRD"
FT   CDS_pept        complement(496259..496504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56024"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCG9"
FT                   /protein_id="BAH56024.1"
FT                   /translation="MANPNRLTSQECIDLIKAESGTEISASTWRSYVARGQAPAPVEKI
FT                   GRTPLWKRGEVIEWANNRPGQGARTDVQKPRRRRSE"
FT   CDS_pept        496680..497141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56025"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH0"
FT                   /protein_id="BAH56025.1"
FT                   /translation="MWYLFMLATIHYYAVRYCWKVDLAKGRRCEMTQAAYLNTRPIEFA
FT                   KGDLVAWTVRPGVYTVVTRSRASVVLLPVVPEPYATPDGGWITHPSKLRPVDFVEVGRA
FT                   AHAEGETLSPALSAVVRRALEGLTVGDGLGRKIMSDFVDGWTAASLAER"
FT   CDS_pept        497180..497431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56026"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH1"
FT                   /protein_id="BAH56026.1"
FT                   /translation="MTNQLVQGRNVLDLRPGDVVRERNADWPEPFTAGEFYDYTVAEII
FT                   RVNTTTVHVAIVTDGFPAAVPYSPDQWVTVVEEVKASR"
FT   CDS_pept        497428..498150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05280"
FT                   /product="putative exonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05280"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56027"
FT                   /db_xref="GOA:C1BCH2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH2"
FT                   /protein_id="BAH56027.1"
FT                   /translation="MTPNCMSEGAVTMATEEETMTAAENGPREWATRMLAPGHAVILDT
FT                   ETSDLDGSILEVAVIDAATGAVLLDTLVDPGDVQIHPAAAAVHGISAAQLIGAPDWPTV
FT                   FSALAAVTADRVVLAYNASFDQSRIVYDCHRHGLDPLHLADTERWGCVMVKRSQAEGVE
FT                   KNIRLDGAHRACGDAEAARAVLQGIADGPTGTPAPSCGRDAAHRRDAVATTPSGELLAD
FT                   ASCPADAAPSVPGSYLHR"
FT   CDS_pept        498548..498772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56028"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH3"
FT                   /protein_id="BAH56028.1"
FT                   /translation="MNDSTAVITADIVTAARQLDWGSIVIRDGQIAAVALDDEVEGDEI
FT                   LADHFDLCELAESASDAAIAAELNANSRD"
FT   CDS_pept        498812..499006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56029"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH4"
FT                   /protein_id="BAH56029.1"
FT                   /translation="MSHALAEAITPDHPRDRIVGVHGYHRDEAGSRFATVRLADDSKTE
FT                   IDLLDIFISHPIREVAAAA"
FT   CDS_pept        499400..499927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56030"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH5"
FT                   /protein_id="BAH56030.1"
FT                   /translation="MPDRNDTRTPRRDYHALIDGREVQVVGHVHTSPHHPDRGAAITPF
FT                   EDLAEPGTGAHLFALVSVRCATDDTTVDLDTGVSHSKYFEGLFRTPNGTSWYLTPAVYD
FT                   PRSRTYALGSQALAAGLSIGALHVDVLEVVGGAGYAAPAGVRVHDFPVGAPAPRQPRAA
FT                   ALTTRSLTRGKQ"
FT   CDS_pept        499968..500237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56031"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH6"
FT                   /protein_id="BAH56031.1"
FT                   /translation="MKRAAFWGWATATTIPEALTNALDAAVSTMHQELGADAHPVNTSH
FT                   TTTILTDQVHQDPGLLKSLLGSSTAIVNREDHALVTVLLIGEVW"
FT   CDS_pept        500339..500716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56032"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH7"
FT                   /protein_id="BAH56032.1"
FT                   /translation="MTLNERNAPVPANRVIDEPWRTAVTDVLFARVNELTRLSRTGMNP
FT                   ADNPPPLASRLHRGEDLLPLAATTPATESGTARRKKLIFAPGLSQDALARRRTVRLDPA
FT                   TATPAGGTEVVRLGQPRAEPE"
FT   CDS_pept        500959..501384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05340"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05340"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56033"
FT                   /db_xref="GOA:C1BCH8"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH8"
FT                   /protein_id="BAH56033.1"
FT                   /translation="MLPTVTREIDSLRTELAGHDGDTSPVVGMFRRYLDLLERDGLMLA
FT                   DRDRFEIRRLLQRAQGRVTSTAVFLTGVVATILGVSCAGILMDYTAAALGPASFLLGAL
FT                   VGAVIAGTVMRVGTRELGSWTAHLADTAMARLDERLP"
FT   CDS_pept        501418..502413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05350"
FT                   /product="putative ATP-dependent DNA ligase"
FT                   /EC_number="6.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56034"
FT                   /db_xref="GOA:C1BCH9"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCH9"
FT                   /protein_id="BAH56034.1"
FT                   /translation="MSGAGNRLIAPMLSTPGEPPVEMDGWAAEMKYDGFRLLAGVGGGA
FT                   HPVLWTRNLNVVTSSYPEVTEALTEAFGGHGRIVFDGEIVALTQGRPSFARLQKRANTL
FT                   RPTTALRRQVPVIFLPFDVLRLDGDDLMGAPYLDRRAALTDLGHQLQGAVLPIQIPPHW
FT                   EGIEGMVMLEAVRSSGMEGAVFKRVSSLYLPGQRTRAWRKVLIRTRVSCVVLGWIPAGG
FT                   MQHNMVGALVLGAYDDQGALRYVGHVGTGFTQAGRRQLGEQLAALERPTSPIVAESAAA
FT                   EQHGVVRWVHPIVVVDIDIREYGPGGLRHPSYKGQRPDLDPEGVKWDSLQ"
FT   CDS_pept        502727..503176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05360"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56035"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI0"
FT                   /protein_id="BAH56035.1"
FT                   /translation="MILTSCSTTTDVPETFAATVTVTGEANLASAETGECTIGANRVSP
FT                   GDTVVILGDTGSASARSPLEVGSIDQKPDGMGVCTYTAHFDDIPANQRSYNITVTSPIN
FT                   VTNFGLQSFTSAELKSGATYRLLQNAPPPAGGGIGSEVQDSDGTP"
FT   CDS_pept        503741..504433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56036"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI1"
FT                   /protein_id="BAH56036.1"
FT                   /translation="MAADTTAGTWIIEHVHNFDHTVVALVPPVFPAYARIFHPANTIDD
FT                   EIVRWAANGTTAHPVMEWGSIVGDWHTSEQEGLWHDSPVRGSLPARTTRALADILRRFT
FT                   ATPDHCWFAHWEGSGYITAPSNYPRLPMPSRAMALFSGSIDLADTQFGADKQFPGGMSA
FT                   HLWWPGDHAWCVATDIDLMTTYLGASPECVDTVLTDDALEALPATPDQRITWDSDTINP
FT                   LPSSPSGL"
FT   CDS_pept        504670..504927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56037"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI2"
FT                   /protein_id="BAH56037.1"
FT                   /translation="MGAARGIAGSYGPEQKGCFLAAGEWERDWFVRMNNTGGAVDVWEV
FT                   HGIDDGDLVESPEGYYFFPGVIAAAELRLVQRDLPPAQNH"
FT   CDS_pept        complement(505164..506093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05390"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56038"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI3"
FT                   /protein_id="BAH56038.1"
FT                   /translation="MPVRGLVPCDDHLMRLSRLLPVLVAASVVLTGCADDSPPAPTPVI
FT                   VSFDDGWGQVFVANVDGSGLRQVTPTVADDMSDGRWGNNAALSPDGAQLAYTRGGRFIE
FT                   VVDLESGDVRTVHEDGYQPVFSPDGSSIAFSKSDGSISIMNTDGSDLRVIAPAESGSVA
FT                   TFSPDGSRVVFTADGYIVEVPTTGGESKVLLRDQFWNSDPAYSPDGSTLVFSSNRGGNH
FT                   GSEIYSMPAGGGEITRLTDTYAVHPQFTPDGSRILYTRATTQSGELVVDISTSNSAELA
FT                   SMNPDGSDQKRLTPRSITAQYPSIGGGQ"
FT   CDS_pept        complement(506136..506720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05400"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56039"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI4"
FT                   /protein_id="BAH56039.1"
FT                   /translation="MGAVGDAAVSVLREAGVTLAAGLTDSEIDSVHARFGVDFACDHLD
FT                   LLKTALPLGERWPDWRDGDDAELQRMLGWPVESFVWDVLHQPVPFWPASWGPRPTEAVE
FT                   IERTARKNLAKWPVLVPIYGHRYLPAAPAPPGCPVFSVYQTDVIYYGPDLVEYLRNELK
FT                   VGALPREKWTFRQRVPYWSQFVEVANRAECI"
FT   CDS_pept        complement(506841..508103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05410"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56040"
FT                   /db_xref="GOA:C1BCI5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI5"
FT                   /protein_id="BAH56040.1"
FT                   /translation="MTIHHRNPYRTAPAVRLRGIIGGDGRRRIDLTENGTAEVRASFVR
FT                   DVLGSLPGLDARIVEAFRSVDRAAYLDRFRMPGKPDWIDASQPLSAGAAAAIYRDQALA
FT                   TLTAENGMPSSSSTTPSLMLLMLHALSVAPGDRVLEIGTATGYNAALLAHLVTDAGSVV
FT                   TIDSKPEIAARAAAALETGGITNVQVRAGDGGAAEEILRGVFDRLIATVGCATVPSQWW
FT                   DCLTEDGVAVVPLRHGEAHPLCRLRKGTEPGHWYGAFTAAANFMLADGDTLHRPRGAEH
FT                   RVQLTEEQHLLDTGLGCHPSQGWAVDFFLALQAPHLKRITVKTAGPTPQIHAGCGIADQ
FT                   HGNIVLVSWGRLMATTGPDSPAVRELAGHLTAWKNLGCPSIGHYDIEILPHNATDIPTP
FT                   LAGRRWTQPDRHATRIVTLRT"
FT   CDS_pept        complement(509327..509845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56041"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI6"
FT                   /protein_id="BAH56041.1"
FT                   /translation="MLIRSRDLPDWRRPPKPDETSIATDDHQVTIYQREGLDLGVGNFR
FT                   VYDRGILFRIEALEPDPIGEVPTGADVMNFSYRIIPPSQPHRLRLLVYTEPGGTLLTNT
FT                   AHFGAFPDDPNTLWLAGGISGGGRRNPGMATWGEYFLSPRPTSASLTVILSYPEFDIPP
FT                   SGAVLTHPW"
FT   CDS_pept        510309..510872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05430"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56042"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI7"
FT                   /protein_id="BAH56042.1"
FT                   /translation="MVTTLRIIIPEELIMDGIVGIPQVGDSVDYTLQFYEAQPWINPEA
FT                   SNDVVALVEPLNEGRLSAEWTDPNGHVHPGTYSMMVHGDGWRAYFLSTRLYEGTAQLVG
FT                   SFEADWPGVLPSEAQVAGTVARCQLITRTNSTDAEGRSTEGWADTLGPVPEGQTGFRIP
FT                   SQDCPTPRVREIGILVDLAVTTSQ"
FT   CDS_pept        511205..512398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56043"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI8"
FT                   /protein_id="BAH56043.1"
FT                   /translation="MRRTVTGGHRSVAGHRSSCGALLESITKMSHRSMTSISTMAQWST
FT                   VEADHHQFTIGERQADTLAVAVESSLFDAGSDFLTVRTGVAYGPVSIGVEILRDQPDST
FT                   LFEDWENVAECTINASTLCVMTLQGDPVQDFTDLTVIEPGRYRVRVHARGRDANWDMDV
FT                   TEPTEDYLVQLWPVPRTQGFLRLKKTDTAWSEVDPKIPIATQAAARESVQAPNPQALGR
FT                   PKLKRLVNRNSVSRFQLRNFTAVSDVAHLDRLLAEKLLALRDDELRSVAQWLPRRALAK
FT                   AGLLDIEWVSNAVTVLEAGLWERPKDIYAAAVRAMTGGDPEIPVTQIVSVFDGQKPVDP
FT                   VFGAMNALIYGFDPDPAVATFLALHGTLLAYGPQWKDLVNELEAAFPRIATWTIEGS"
FT   CDS_pept        512605..513204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05450"
FT                   /product="site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56044"
FT                   /db_xref="GOA:C1BCI9"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCI9"
FT                   /protein_id="BAH56044.1"
FT                   /translation="MYIGYARVSTDQQDLTAQQHALLALGVSPDRIYVDHGLTGTNRLR
FT                   PGLQNALAACRNTDTLVVTKLDRLARSLPDARDIVDELTARHACLQIGASLHDPTDPVG
FT                   RLLFNVLAMVAEFEGDLIRARTREGMRIAKAKGHLKGKKPKLNPRQEGHLVELHGTGEY
FT                   STAELADLFSVGRSTVYRAIKRARRPHRDGYSEASA"
FT   CDS_pept        513305..514045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05460"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56045"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ0"
FT                   /protein_id="BAH56045.1"
FT                   /translation="MRQDSLMSADSGSGPDLDLVQVGPIEVDPAVLGGSGSSLWDLIGD
FT                   RRVEMRSPDEVLDLPRHGWRRLVPSRDDGAGSREVFAAPHGQVSEAWTLVFLSDSAGAW
FT                   RVSTDPGPIRVHRCRAARRVGLELRWPGEFTCKAGALPGVSIDLVNAGDRMWVNYAGDH
FT                   MTVHGWVLDEEGEPMKPGLSLFSQAPTLPDIEPGDRISLRVDIATRDIEDFPPGRYAVI
FT                   AELHDLGLMSSPGTLILVDPTPGT"
FT   CDS_pept        complement(514818..515315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56046"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ1"
FT                   /protein_id="BAH56046.1"
FT                   /translation="MPDWRRPPKPDETSIATDDHQVTIYQREGLDLGVGNFRVYDRGIL
FT                   FRIEALEPDPIGEVPTGADVMNFSYRIIPPSQPHRLRLLVYTEPGGTLLTNTAHFGAFP
FT                   DDPNTLWLAGGISGGGRRNPGMATWGEYFLSPRPTSASLTVILSYPEFDIPPSGAVLTH
FT                   PW"
FT   CDS_pept        complement(515843..516724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56047"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ2"
FT                   /protein_id="BAH56047.1"
FT                   /translation="MNAPYWDAPLKVRLAGRRGRCQHAICAVTWTAHASIDGMSKKRFN
FT                   FAYVGDPPPEWTAHLKWSARILRLAGESIPDKELERELEREEQEQREKRAQRPPGRREV
FT                   PEFRKRPDAFLTTEDDDPVLYEPKLSIPFKTNNGLDLRFTRAKVYENGVGFDLVAREPD
FT                   PDPTAGIPFDTETINLGYRIRPDKAHKTRIRLILAVSPTLGEHGFFGGTVLSSSFRQDD
FT                   FPDDPNEPWLSGGGDSRSRVRDLGVIETRAHYFLSPVPTKSVVHVAVAYPEFGLETTSI
FT                   EFYAANLRPPGR"
FT   CDS_pept        517544..518842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05490"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56048"
FT                   /db_xref="GOA:C1BCJ3"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ3"
FT                   /protein_id="BAH56048.1"
FT                   /translation="MSETNMGRVPVGDPIPLRFDPTTKQRLEELAAGIGPRRFGALVRV
FT                   AARRLLADPDRVPESLAQARRASADARRIPWAERPLDLDPATSTRLNELAHEFHTDRSA
FT                   IVRVALHRFLTAAGRFRHPVLREDARTDLTCRIRVYLNRSTLVRLEKLISRNGDALTAA
FT                   AIRVAVRRLLDDPGDLTADLGTIGTIRDLTPEDLGPRTNVHFDDDLRDQLDTLAERFDS
FT                   DRAELMRLAARQLLANPRDLEKAVTEEIYRGDANRDKLLARNTRRQTADQATAAPAVRT
FT                   APSPQGNPFGKRHVFRFDEDTKRRLEELADEYGPRRLSALLRVGIRRLIENPAADEALA
FT                   QARRVAAPPRTARVDVALDDELLAHLDALADRLGSDRQELVHLAATRILRFHHNIENRM
FT                   LDEMFRAPNNRKHLLATHARRERIRRMDRGSGT"
FT   CDS_pept        519370..519717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56049"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ4"
FT                   /protein_id="BAH56049.1"
FT                   /translation="MARKVVVELVDDIDGTVFGEDGESITFSVNGVDYEIDLKDKHASK
FT                   FHKQIGFFIEHATRVGDRTRRSDRPVAPDAPVRRRGNGKEIRAWATEQGYEISSRGRIP
FT                   AEVEQWFQDAH"
FT   CDS_pept        519734..520063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56050"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ5"
FT                   /protein_id="BAH56050.1"
FT                   /translation="MRSLRNPWYRASVRRAASEHWLTTGSRGLRGMTGEPVELSDTEAA
FT                   TVLAAVVETTGGRWPAHPSRIARTLRRLGIDGNTEQMAAAITALVRDPDWPHRAREITS
FT                   SASDW"
FT   CDS_pept        520314..520769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56051"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ6"
FT                   /protein_id="BAH56051.1"
FT                   /translation="MRRTVFQSVDRIQDLTVISQLYQIIFGDLMVMERIGCTISSCSAI
FT                   ELLVEPDQLASGLSHLGMSAQTFDKEGQYRDESSSFCAVDPLIFPTEGSIGACLWLPEE
FT                   LTCSIDRISLVVQFLGSDPRLLGHFTPVHSCYERLSWTVARCLARRQ"
FT   CDS_pept        complement(520927..521874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56052"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ7"
FT                   /protein_id="BAH56052.1"
FT                   /translation="MGTTFHGPSPWPHITRAIRVRGPRRAAIAYLGEDAPALLPLRAGD
FT                   LLVVNASRAAVRAHVTSPIALAYYVEAGVRVLSSPNLHANVIATSRRAVIGSANASHSS
FT                   TIADEAVVITDDPEVVAGVRAFIEGIEEITEVDRVFLDNATTEWQIGRSVPIPGVGGRV
FT                   RAELDFLPARVTRMFVRHIVEYEPSATEQQTWDTQARRHHTTTAGPAATYQLEWFRPGD
FT                   RRARLERGDVLIFVTDNEWIYPPAVVDSDAIAIPHTHRAFGHLLLVRADLQPVSVADAE
FT                   QQLADLGHPNPRLTTDHRIISASLRAALLRLWNL"
FT   CDS_pept        complement(522439..522852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56053"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ8"
FT                   /protein_id="BAH56053.1"
FT                   /translation="MDSPGARAPTPVDLENLANAAYEFREALIPLHGITPDRCDAAATE
FT                   LRNRALVAEERFFAAVAGLPRRERTLAGHWENAAVMRYRHGLEVFARAEDLGAEMLAQL
FT                   ATHRRPSLPALTELCDVCTHARTLDQHQRTEML"
FT   CDS_pept        complement(523408..523908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56054"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCJ9"
FT                   /protein_id="BAH56054.1"
FT                   /translation="MSADPGSIRADGHQTLPNLAVQDASADPHIITAAARTGTDIELQI
FT                   HTSVAPFDIAAEEWFPAATGFAVTVIVHIVDAQTSVPRYLPPTEPAEWARAIFSTVDNA
FT                   HGYFLGAVDPDTGVHRRGQLAYRLYLDTDRRAIPVPRQVATCPHYLLSAIDGRAEIAIP
FT                   TTA"
FT   CDS_pept        524038..524202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05560"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56055"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK0"
FT                   /protein_id="BAH56055.1"
FT                   /translation="MNVGDRVKVHTDATSEFVIVSIDGEDAVIESVRDDVPGRFPFHAR
FT                   LDRLVPVGS"
FT   CDS_pept        complement(524256..524558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05570"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56056"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK1"
FT                   /protein_id="BAH56056.1"
FT                   /translation="MLTPEPDDQKIVSLNALRQRRTDDLLSGHIPLTSLLYRRRDRIAA
FT                   NLLVTDVLTTYMRGSGIGPAGVMVMLGIADDARVRDLTAEQRGQITDAIAATSGR"
FT   CDS_pept        complement(524663..525355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05580"
FT                   /product="putative methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56057"
FT                   /db_xref="GOA:C1BCK2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016584"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK2"
FT                   /protein_id="BAH56057.1"
FT                   /translation="MSASAVTQAEKAGAAPYSRALLSVYDTVVLRWSNTLVWRCPRERL
FT                   LAHYNSHLGDRHLDVGPGTGWYLQNATYPTPSPMMVLLDLNPNTLQMTTARLADRGIAA
FT                   AAHTGSILAPLPTDSGVFDSVAANFVLHCVPGTWAEKGRAFGHIAQVMADDGVFFGSTI
FT                   LDTGVHHTPLSRALNHLYNGPIKLFHNRDDDLDGLHTALAAAFEGVEITIVGSVAVFAA
FT                   RRPRRLGS"
FT   CDS_pept        525747..526622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56058"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK3"
FT                   /protein_id="BAH56058.1"
FT                   /translation="MAYNVSPDAPPTRLDPEAGTSSTPASKPAGYRSADTYKDRAQERD
FT                   SARELDRMVEDAEFTRARKDLERAFPRATVPEVSERKRRDLPIPDSIRQPLSSRQRKVR
FT                   SVNKHRAQSRLPAVGYTAVQTLIDNPDRWNNVGEALSKARGDAQHLDEKTRSQVQRVDR
FT                   AIQTAERWGDRGHILYCAVTLPHTAPQEAVNLPSTLQPGSRLDFDRHTMATHAVHQLDQ
FT                   TLGERDVVFEIETDRGMYLGRSDTVDDTAHLLPRGMRFEVVSSGEGRYRRPDGSIGRRM
FT                   IVQLRDVTED"
FT   CDS_pept        526634..526843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56059"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK4"
FT                   /protein_id="BAH56059.1"
FT                   /translation="MGLFTDDKGRPELVVHPDIVLGRATFRPVDDEPEPEETPKQRGRR
FT                   ELKKRMTEERLAKQKTEGTNPEKG"
FT   CDS_pept        complement(526971..527399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56060"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK5"
FT                   /protein_id="BAH56060.1"
FT                   /translation="MMAKYLLLKHYRGAPASVNDVPMDQWTPEEISAHVQYMNDFAARL
FT                   ESTGEFVDSQALSAEGMFVRYDGEGRPPVTDGPFAETKDLIAGWMVIDVETRERALELA
FT                   GELSAAPGAGGKPIHEWLEVRPFLTAASTTTECGFHQG"
FT   CDS_pept        complement(527490..528281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56061"
FT                   /db_xref="GOA:C1BCK6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK6"
FT                   /protein_id="BAH56061.1"
FT                   /translation="MNAPDPGLDLAMLRGLRAPSVKAGPNAVADIAARIEAHLAAHDGY
FT                   VAFSGGKDSLIVLDLARRVEPEVPVVFFDSGLDYPETYDYLTELAHTWRLDLHRIPTDP
FT                   PLLQVLADSGHWDHCAPVGTPVDLHEVLITAPARRAHALLGPGELWGVRADESAARRHL
FT                   YTRGGRRDGVITRADGTTAYGPIWNWTTTDVWAHIARHRLPVNPVYAKLRELGVPEQQH
FT                   RLSHLIDGGHLDRGRLTWLRRGWPTLFEQLADVLPRLRQMS"
FT   CDS_pept        528300..528962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56062"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK7"
FT                   /protein_id="BAH56062.1"
FT                   /translation="MPPMTIAAPVDVVWAAYTAAVGIPDVAGAPDTRAAGCARCGHTTA
FT                   AMSPVGQVISRRFTGYESWTNLAGRSLCQVCVWAYRHRSLRTDAHIVTRDPVTLTPANP
FT                   ALLHQVFSTSVGTDTAVIAPLRPGRKHLLPDARWGTVTVDDTSLTWSAADAHRLAVLRR
FT                   LRAHGFAETMLRDDTPAYPVLSRVDADQWPQVFDDWHHLAPWRQATPWFEVGLRASR"
FT   CDS_pept        529122..529355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05640"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56063"
FT                   /db_xref="GOA:C1BCK8"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK8"
FT                   /protein_id="BAH56063.1"
FT                   /translation="MIDPTFIWTCAAITAAVELCRRFRWYRRALAHQRDGATRDWYSSE
FT                   FALRKTYAARFGAALTAVVLFGIVLTIGAGVA"
FT   CDS_pept        530111..530662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56064"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCK9"
FT                   /protein_id="BAH56064.1"
FT                   /translation="MTARRSHGTHRPLPDAEDAVAGVFGSRNLARFPRLAVMDTTGEDT
FT                   MSVTDRWLAAVPQLPPLIGPAAQVAERLVLLLHYGVDWSENNWVASRRGDYWDTLLPTR
FT                   IRLATYNSVNLHQWWTASAARLGSSPRTDEQRSELAMVLTSEPRPVLQVMRDQTTALTL
FT                   RTRIVADAVRAARTEQGLAS"
FT   CDS_pept        530659..531510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56065"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL0"
FT                   /protein_id="BAH56065.1"
FT                   /translation="MIVSRVWEIEMTARSPISHRGELIGTTAIGRRMKVLQADGSVELV
FT                   PVISGNSFRGVLRRIGEELLRDVLGYEGQLPLAVAHTLRNGGAIVKTQAEPITGRRLHQ
FT                   LRELIPHLSVFGGAIGAAPIDGCLRVGHVVPIVTEATPILRREYPGPLPSRFDIEALES
FT                   YSHLDDVTTGHAGTTVDPEAETGGSGSPVMRYDIETLAAGTRFESWVQLVRGSDLDHAF
FT                   AADVLAEFTRSGWLGGRTGIGHGQIATTIADQAGGAPVVDWREIVASRRSEALETLLAL
FT                   PA"
FT   CDS_pept        531531..532244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56066"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL1"
FT                   /protein_id="BAH56066.1"
FT                   /translation="MVPLLVRAKMAAGVAHAVPWGISLDGLLASEIRGNTKAAARMAGT
FT                   DYEPYSPDTVPEDLDLPLARCPGDGAEGWHWAATFAYPEDAVPGPHVQYWSARPDQQAL
FT                   DQMSAELPALVSERQGRYRSRVMPLPLTVCRHLVWRAVGDPAAVAELLAPIVSIGKKRS
FT                   AGHGHVLSWEITEQPDADPWEFAHLHPDGSLGRTAPTACLNAADDVRTGGEGQMGLRPP
FT                   YMHPACRAQVMLPAT"
FT   CDS_pept        complement(532337..532987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05680"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56067"
FT                   /db_xref="GOA:C1BCL2"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL2"
FT                   /protein_id="BAH56067.1"
FT                   /translation="MAVHLIRTRGGWSLVAVLATVGVLFGALGALAWRFTTPFGPPVNV
FT                   GIQPSPPPPATDGDDEYYFDVITGFLYNDPPQWFPASAWFLTFGVVAALIYSIVLASAG
FT                   WGLERRTPGKVSLAVLFAVFGAIFGLLVALIGHVVPPRFHSVVQEEPRDPTNPDPNPVQ
FT                   MSDHFHLEFGPTWITFTVVGLAAGLMIASLLVVAGFRATRSNRRGAVESMERP"
FT   CDS_pept        complement(533027..533524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56068"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL3"
FT                   /protein_id="BAH56068.1"
FT                   /translation="MELPFTATLLDSPGLEVSVLSPLHIYPSGLYITISWRLRRVDDGF
FT                   DAARTVLHNLSAARRIETPTDRLPTIEIDCGNEHVLTTQKVRPDCEDTEPTTDSALIFE
FT                   GMWWSLTDEGEYHYKSPLWVWPLPPANALTLTVAWPALDMQSQPVRLDGASIVSAAAEY
FT                   PR"
FT   CDS_pept        complement(533747..534331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05700"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56069"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL4"
FT                   /protein_id="BAH56069.1"
FT                   /translation="MSRAAAGCQVFWPAPFEVCGAILDKYNSLGGPNSFLLFPKSNELV
FT                   NPDGYGRRSEFMGGHIYWSGATGAHFVAHDFLTKWGNVGYEGGFMKYPVTDEIVNPDGT
FT                   GRRQVFQDGVIYWHPSTGAHVIHGRILQKWAEVGYETGEFGYPTSDEMASTGWWATQSQ
FT                   IEQRFQRGAMFYNGPTDSVILANFKVEVTAN"
FT   CDS_pept        complement(535000..535572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56070"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL5"
FT                   /protein_id="BAH56070.1"
FT                   /translation="MKTLRILAIAFTSILLLAGQQFASPVAYGQIPDDEPWNFPVNGQA
FT                   ITENTAWKDMSVNIIGRYCRTDGLGCGDPTDKITYRVTTNPGSITQNFDWNKTYSPNGG
FT                   NFKGGHIDVFAVIDGAVRGGGEQATETTSSGRKTWEHSSAASNSIITAYAFWALKPDGS
FT                   WQSATARTTGAKCEPISVGNVCKYNQP"
FT   CDS_pept        complement(536399..536950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56071"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL6"
FT                   /protein_id="BAH56071.1"
FT                   /translation="MRRGFKAEARRLAVELREEVGLGLQARFDPYALAELYGVDVVRLS
FT                   ELDCSAEALHHFSSVRSEAFSGAVLPIGTVIVMLENDGHTTVRRRSTASHEMAHVVLEH
FT                   PFAATMMSDDGCRSSNSEHEVEANWLAGELLIPTEAARTLGVRGVSNEDAATRFDVSVE
FT                   MARWRLNVSGGRTIRRRVSR"
FT   CDS_pept        complement(536947..537318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05730"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56072"
FT                   /db_xref="GOA:C1BCL7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL7"
FT                   /protein_id="BAH56072.1"
FT                   /translation="MSKSKIDVAALFAAIDGVRKQRGQSMRQLAKEIGVSPSLLSRLGN
FT                   GYRPDADGFVTLTRWLGMPAEQFIADDDTAVTPDQPELVAQLAPLLRARKDLAAEDVEY
FT                   LEDIIEATVRRTRAARIEQ"
FT   CDS_pept        complement(538266..538658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05740"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56073"
FT                   /db_xref="GOA:C1BCL8"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL8"
FT                   /protein_id="BAH56073.1"
FT                   /translation="MPGAGLMALAVVTAAALLSANATFDIVATLAYTIALPTARGLVAA
FT                   SSLPARTLVAVTGSMLPLTMTFFAISAPIDREFGWSNGLPAPDDYPLVAVAAPSPIGII
FT                   VATVTAALAALVVTRRSHVAPVPARP"
FT   CDS_pept        complement(539830..541023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56074"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCL9"
FT                   /protein_id="BAH56074.1"
FT                   /translation="MRSDREEIPAGATKEMADKAETMEARQRMSRVAVGCQTYWPFPYE
FT                   VCGAIRDKYNSLGGPGSFLSYPNSPEYTNPDGYGKRTQFLNGPIYWSAATGAHPVVNSF
FT                   LNRWGLNGYEAGRLKYPTTDEILLPDGGRRQEFQQGAIYVAFQNAVGSLVLNGPIRDKW
FT                   NTVGGAAPGGSFLGYPTEDQIAPLPDGQGQMARFQNGVIYWSPATGAYPITGDILSSWS
FT                   ESGSERGQFGYPTTDQISTPSAQFSQTFQGGTIDIESSPVLQLENTSGGYCLFTLNNDR
FT                   IHISTSKKDGVVVPPTVSSHGWWEPLANCPSNARANLRANLQYLDADGNWQNRADSYNT
FT                   ESNRGPGSGSTTWVAANSRCIHLGPRTWRIVVDAALVGAADVYSPKHYGNALELNCS"
FT   CDS_pept        541954..542211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56075"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM0"
FT                   /protein_id="BAH56075.1"
FT                   /translation="MGTVTAAAAPAPGPVHVQAADCKGYWPSPYQVCGEIKDLYDSLGG
FT                   PSSSLSFPKGNEVTNPDGSKRQEFLGGAIVWTAATGAYVE"
FT   CDS_pept        542389..543474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05770"
FT                   /product="peptidase M48 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05770"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56076"
FT                   /db_xref="GOA:C1BCM1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM1"
FT                   /protein_id="BAH56076.1"
FT                   /translation="MSTAPDRTRMEFPGISSRAWEHPADRAALVTLRTLKGFDTVLRTL
FT                   SGLLQERQHRLMYLGTSVRVDGRQFSDLNDLRADCVRILGADETPELFVLQTPVVQSFT
FT                   IGMDRPFIVVTTGLLDVMTYEEQRFIIGHELGHALSGHAVYRTILLHLMRLAGTIGWIP
FT                   VGGWALRAIIAALMEWQRKSELSGDRAGLLCGQDVHTALRVQMKLAGGSRVSEIDIDAF
FT                   LSQAAEYDASGDLRDGVLKLLNIELLAHPFSVLRAAELKKWVDGGGYAAVLRGEYLRRG
FT                   EDDDARIGDEFRTAARTYKQNFDASNDPLIRMLREIGTGLGGAATVVGNGVGEVATDIK
FT                   DRFNHWRRGSGNNNEGPETPE"
FT   CDS_pept        543578..543958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05780"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05780"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56077"
FT                   /db_xref="GOA:C1BCM2"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM2"
FT                   /protein_id="BAH56077.1"
FT                   /translation="MPYLGLIVLIVWVGCLVDVICAEEYRVRHLPKTVWLIIVILLPLV
FT                   GSVLWLVVGRPHGGGWSGPRLTTGASSGFPEYDRPGRQAGQQSESDEEFLRRCRQRAEE
FT                   QRRIAKEQEKRRREQGGDDPSV"
FT   CDS_pept        543993..544955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56078"
FT                   /db_xref="GOA:C1BCM3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM3"
FT                   /protein_id="BAH56078.1"
FT                   /translation="MMKNQRWFGALVQHRREELGLTPIQLHRIGGPSLETLAKIESGEG
FT                   TVKHTTLVRIDQSLGWPEGASLRILTGTDSVAPPEIYWGRTLTAADTLPEAVDGRGVGH
FT                   TASADPAFGDEAREVEDPAARAGLIRVRVDFEAFFVDIGIDGVVEAEKALIGWELAAVD
FT                   EQLATHRETATDQESERAHEQVQALLRRREVLEAELTEVEERYLRDVAAYTAAYAAAVE
FT                   AEARRLGWTGPVIVECVGAGAGAGVTEADADAADAVRELVERLRRHARTTTPLPGSSYG
FT                   TARAYSEMERRAADDYRTRLRHNRTQRSVLTSRVIRSSD"
FT   CDS_pept        complement(545561..546610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56079"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM4"
FT                   /protein_id="BAH56079.1"
FT                   /translation="MVYWPAWQYTVCGLIRVKYDSLGGPNSFLLWPASNELTNPDGYGK
FT                   RSVFNNGPIYWSSASGAHPVVNHFFAAWQRNGWEAGPLGYPTTDEIANPGTAPGRRQEF
FT                   QNTAAIYWKLNEAYAIRGAIRAKWNELGAEQGSLGYPLSDEIVPPPELSVAGTRMNKFE
FT                   AGMILWSAEQGAAEANWFVTQDGSSARTMDQPGDGVVKISPGKPRETECPAETVHPGTP
FT                   FNCEEAWPDSYDRTVVARFGRQNSQATPGHGAFGWMHALVDHNLDLDAMGKIINVSQKV
FT                   PIGDRLEYQAEFKARGQTIIRAAVRTREVAMDEDGHLDEFAQGVVTGYCKTGSEAGEGW
FT                   CPDWVNGTL"
FT   CDS_pept        complement(547503..548522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56080"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM5"
FT                   /protein_id="BAH56080.1"
FT                   /translation="MTDSEIAPYVAVYQNTDFIGGLTQSATNSGISLSGESEYTEGVEH
FT                   GDQRGRGGKTHLTARAAMPGLGEAGLDVGGNLDKATTDKNTSATRHRLSVSYDMAFHLH
FT                   RLHELLEQHTTTVATPDDAEPLETGAIVKFTGKFNPDPISAILDIASPDLISEVARFAA
FT                   RTRRPAVDGETFNVDELKYKWELAEQNATTQADFARAITTALHTDFRRSTTIEFHCAIA
FT                   SGLTAIVVCETEHFTTADPDRLLDGEFTVLGKVVTSPETDIPVLRKNKFLRRLDTDWVR
FT                   WLFHSLGSSVDRLNDAEVTAFVRDHLNRNEAAAPPLDLHFPAVIEGRSFTVLPIGIYA"
FT   CDS_pept        548670..549479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56081"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM6"
FT                   /protein_id="BAH56081.1"
FT                   /translation="MLTQLTPRQQAALTATTANVRLAPFRRTYSGHEGPAAALYLLDAK
FT                   LASHIHAHLRIVEVVLRQQMHVALKVSYGARWFDSRTGANLSSEASKKVRDAYDTLRPQ
FT                   RQRRAAAGRAAPAQTQTPSADKVVAALMLGFWVALLRTPNDADHQTTLWTPALEACFNA
FT                   NRRPGAPAWTMSMTQKACQRLNWARNRVNHCESVVFGFPQPGQVQHGQIRYSPKSIVEE
FT                   CRTLVGRFDVDVEAWMRTCTVVDHLIADPAAQRALAYSAGQQGRTIR"
FT   CDS_pept        complement(549595..550587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56082"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM7"
FT                   /protein_id="BAH56082.1"
FT                   /translation="MEFRKRTLRQLADMICGNATSEDAHFLYRTSSSLTEFFEDLDTDY
FT                   RHDGSTRRDWVADVLTQILQEPTTGATTLPDTFSRVISHLMEPKDALNEGTDRPGALSL
FT                   LNVALEREQYEAFYGPDQICYLRHLPTNTIAIPGPNPHRPFSAAERERRELLIAYLDTS
FT                   SEDQLIEEVLLPLFRQLGFHRITAAGHKDKSLEYGKDVWMRYTLPSQHVLYFGIQAKKG
FT                   KLDSSGMTKTGNANVAEIHNQALMMLGHEIFDPEIGKRVLVDHAFIVAGGEITKQARNW
FT                   LGNKLDAAKRSQILFMDRDDILNLYVVTNLPLPNDALPATGTWPDGPPF"
FT   CDS_pept        550708..551832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56083"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM8"
FT                   /protein_id="BAH56083.1"
FT                   /translation="MRIFISSVRSGLEPERDSLPGLIQAVAHEPVRFEDFGAQPHPSRE
FT                   ACIRGVDSSDVYLLLLGPKYGHVFPETGQSATHDEWVAALTRGMPRLVFRKVGVDFEPK
FT                   QDEFARMVGDYSTGNFYGEFTDAVDLQSKVVQALRTLDTLPTALTYERLTEPVAFAWKD
FT                   QWDRPPAGPQRQDPYVELHVRPLDGEPRSARLMRTLPEQLISALRTAGALPPEAGASPD
FT                   ATSDAVVVELPTRGPAGFEQTRPTELRGVRVDGTGQCSLWWSLPYDSLSSIIDAEELTA
FT                   TTARHLRLIGAMKLLTGERFALGIGLGGKQRSITEDKVTGVPRSRVSLGFGSVPTVRVD
FT                   PDESLSAAAFDRGAEESAQVLVAGLLDAFRASTR"
FT   CDS_pept        552140..552613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05850"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56084"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCM9"
FT                   /protein_id="BAH56084.1"
FT                   /translation="MTTDDFVTSASSAFVGAEELNKRAVPLGYAVLTSAHGRLGREDGE
FT                   TFEAHYSVRPFGAEDGGEDRYFPDLEAVGKYLDHLETLPWWRLDLNDGSVEVDGVELTV
FT                   TDKSSGETIYLGGGWKWMITGSMTSGQVIGENLSQLQVRAEDPPKFGRWRKVG"
FT   CDS_pept        552884..553819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56085"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN0"
FT                   /protein_id="BAH56085.1"
FT                   /translation="MDETMTVPPILYHYTDAAGLAGIVNPSSWPVKYENNKLAYGVAAK
FT                   LWASDVRYMNDSSELKFGAEVFREQFTAAAADPAVSPELREVFAELARWFDPDRLFEWG
FT                   LRCFATCFCKKGNLLSQWRGYAGGVGGYAVGFSGESIALNTWAFHPGTTVMGTGTVRAT
FT                   LRQVVYGEDEAKKAAIQFVQGVVSGSGFHVAGPDGKLDMFMLAASAFREIAAVKDSAFE
FT                   QEHEWRLTTEGDVKYPANLRAGRSGLLPYLEMAVNIRTESDASSCPTISRLVVGPGPHQ
FT                   PAQVAAARELLRNNGHDPEVVVPSDVPFRG"
FT   CDS_pept        complement(553855..554406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56086"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN1"
FT                   /protein_id="BAH56086.1"
FT                   /translation="MLVHAFVDENTVRGIMVAAAIADPRSLAHARKVLTELRLKGQERL
FT                   HFKSERDSRRREICNQYALNVALRQLCWQKHEGYESEEEIRIAVMNPASDTRHERPSAY
FT                   GPRTVEYVELVNGDPTDHDATLIAATETVFALPILAVRIGPRNTPTKLTEDLNETARLL
FT                   DENGYNVPVVASTTPFLRGR"
FT   CDS_pept        complement(554517..554948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05880"
FT                   /product="putative acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56087"
FT                   /db_xref="GOA:C1BCN2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN2"
FT                   /protein_id="BAH56087.1"
FT                   /translation="MSATPAAIDVTDPDADGIIRLLTYAVGSADRDRLDVALVPYRTRS
FT                   AVLAVARTSRLPVGVIGYSATPDQLTLLHLATDPTCRQQGIGTALIHWVHARHPDIPLA
FT                   AETDADAVRFYEKTGFTSTSLGEKYPGVERFLVRRPPSS"
FT   CDS_pept        complement(555028..555552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56088"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN3"
FT                   /protein_id="BAH56088.1"
FT                   /translation="MMGSMPMPEWNQDSLVWRFAMTDDGPDFHDTPGFEPPDPWLLAIA
FT                   AVVRDLRCLRYGRDVQVHRLVWELAISDQYAVTIGWRGPGVGGFNLCHGVSMDAPYPQT
FT                   AVWVAETTQGELTGYEFIQWPSRGRHILYPRLRQEGPVWVDPHTDTAVAAIGELCAQRA
FT                   AWDALDRCQGG"
FT   CDS_pept        555899..556501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05900"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56089"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN4"
FT                   /protein_id="BAH56089.1"
FT                   /translation="MFPADGVFVEVCEGEAWTAGWLVADRTDVAALSVSGVAEDKRLVS
FT                   VALVPLSPDAPVWQGRVHPDQVVVASLQRPVPVWWERIATSLAEAMRDRREVAWLREHL
FT                   QANQKAHADWVEHIAKDAGTWADENNLCSEFDRFMEEHGLPPRSREFTVEALVTITTKV
FT                   SVPVSARSEEVAEDEVDGEVLARALGRRISGFRRHGL"
FT   CDS_pept        556564..556923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05910"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56090"
FT                   /db_xref="InterPro:IPR024559"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN5"
FT                   /protein_id="BAH56090.1"
FT                   /translation="MTVQAVRIGVDGRLEVIDLGAEVSTGAAIRSAIGCRWFDVVRLTP
FT                   DLDMWVDDEGAIQAAAQVNLMATAIARAHGAIWQPFCGAVVFAAHDGNGATVGLSDAQK
FT                   DALLTGAVFAPTVNH"
FT   CDS_pept        556944..557303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56091"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN6"
FT                   /protein_id="BAH56091.1"
FT                   /translation="MTTATANTNIPTTAEVYMSQGERALNRGTHFIEESIWVYLMRDWD
FT                   GIDRWVLDPVTVDGCGLDSGLENGARNSECMCEDKAECNAIRDRMDRAALPTADDLLHL
FT                   LAESLGYTVTRAVQA"
FT   CDS_pept        557300..557569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pROB01-05930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pROB01-05930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH56092"
FT                   /db_xref="UniProtKB/TrEMBL:C1BCN7"
FT                   /protein_id="BAH56092.1"
FT                   /translation="MTVEAVIVRDPDGPTSVWVFVGGEPVEAVESCIDAGAGWDWDDWC
FT                   EHRDEMLAGASPAARELMLTLLDGPPGGVYVEGRDDRPWLDPAA"
XX
SQ   Sequence 558192 BP; 95113 A; 180451 C; 186811 G; 95817 T; 0 other;
     gtcggggagg gtaccccggg ctgcgcccgg ggcctgaacc gactgggcgg caagccgccc        60
     aataacggaa ttcacccacg cgctgcgcgc tgggtcacgg gttagcttgt tgcataacgg       120
     aatccggaga aaacaaaatg atcacttcgg aagtcttcat taccaacggg attggccgaa       180
     tccagcggtg cggaaccgtc ccgttcgatc accgcaccgc tgattcgtta cctactggtc       240
     ctgatgggcc cgcaccgccg cggcacgcag ctgctcccac agtgccgggt tcatcccgtg       300
     gttgagaaac tgctcgaata gcttcccgaa ggagtgcgcg ggatcgagcg cacggcccac       360
     gttcaccgcc tcacgtgcca gcgcggcgtg acggctcacc caatgaaaca ctccggcaag       420
     aatgatcaac gcaccggcga gatcatgggg caatacggcc ccgacctgac gcattacctc       480
     ggcggcggca tcggcattgt gtgcgtcgat ccgggcgaac agcagatcac gcaccggcac       540
     atcgtgcatc gcggccgcga tgatcgaggc gtgctcgtcc gtgacgctga tgccccgctc       600
     ccccgctccg gtggttcccc ccacgtacgg tgccaacgcg aaatcgtagg cacggtcggc       660
     ggcgttctgc ggggccatcg cggccagaat cacgcgctcg cgcccgaaac cagcggccac       720
     gatagcggcg cggcctggac catgctgggc cggggcgaaa ctcgctcgca tctcggcgcg       780
     ggtcatgagc gtggtggagc cgaccacgag tgcctcggcg atgatcgggt gcgccgccag       840
     atcgaccggc atgcccggct gcccgatcaa ggacccggcc ccgtgccact gacgcaccag       900
     accatcggtg aacacgaaca ccggggtcac cgcatcgggg cgaagccgct cgaggatcgc       960
     gcccaccaca tcaccccgct cggccgggcc gaacaccacc gccagcatcg acggactctc      1020
     ctggaacggt gcggcgctct cgagtgcgtc caagatgcgc cccgactccc gctccgcatc      1080
     gtcacccaac tggaccagca tcaccgccgc cgggtggcgg tcaaggctca ataccgccac      1140
     ctcgtcgacc ggaagatgac cgcccaacgc gaccgcaccg gcaacaacat cggacggcga      1200
     agacatacga aaaacactca cagcaaaacc cctttgggtc gggtgggcga gctggtcaga      1260
     ctcacccgtg aattggactt acgaacacct cagaacctag ccgaaacctc ggacaaaaac      1320
     ccgcattgaa ctgcgtctat gtccccggca cacccggtgc cggggacata gacgcacgca      1380
     cagctgtggc cggtggccgg caccgcgccg gccacagctg cggattacgt gttggcgacg      1440
     ccctcggccg ctggcacggc cgcgcacaac tgatccgccg tcgacgaggt caatccggca      1500
     tcgagcatct gctccatcac ctgacgaagg tgtgatccgg gaatgcctcc agtccgcccg      1560
     agatggcctc ccgggccgct accgtgtccc gaacgatcca gaatctggcc ccgtcaatat      1620
     cagcggggcg gccgccggaa accgcatcgt cacggccgca acctgccgcc acatctcccc      1680
     tagcgcccgg ccgtgctcga cagtgatgcc cgccaacagt gcatcccgca cggtgtgcca      1740
     gggcgccgcc agcaaccgcg ccgcgtgctc atcgctgacg cacacccccg agtttcgcac      1800
     tcctcgagat acccgggcga tgccatcacg agagagctcc tccgccaccc tggacgcgtc      1860
     ctcacggccc actcgggtca cctccgctgt ggggggaggg tctcggtgac cacctgtgcc      1920
     aggcggggcg ggcggtgacg agtgtggcag acgtggtgtg agtgtgtcgg acacggtcag      1980
     ggagatcggt tccggcctga atggcaaacg caccgaactc cacatgtggg agaggcccga      2040
     ccgggttcgg gtatatcgag gccgccttgt cggtacaggg tcgtaccctg ctggtgttgg      2100
     acggtactga ggtggctgaa tcgccccggg ttctacggag gctcggctat ctggttccgg      2160
     cctcagcgag gaccggtgtc tcacggtagt cggccgccgt gtgattcgac cagtaggcgg      2220
     tctcgtactc tgcgggtggg acgtggtcga tctcgccgtg caagcggcgg tgattgaacc      2280
     agtcgatgta ctcggcgacc gcccactcga cgtctccaag gcctcgccag cccccgtgcg      2340
     ggcgcatcac gggattgcga atgcactcgg ccttgaacaa cgagttgaac gcctccgcca      2400
     tcgcgttgtc atacgaatct cccttggaac caacagaaga cactgcgtca cactcgtcga      2460
     ggcgctcggt gtatcgcacc gctcgatact gcacgccgcg gtcgctatgg tgaatcaatc      2520
     cggcgacgtc ctggccgacc cgtcggcgag cccacaaccc catatccaag gcgtcgaggg      2580
     ccaggtcggt acgcatcgac gtcgaaacct gccaaccgac gatcatccgg gagaacacgt      2640
     cgaggatgaa cgcggcgtac acccaccccg aatgagtgcg aatgtaggtc aggtccgcca      2700
     cccacaacgt gttgggcgcg tcggcgacga actgccgctg gacccgatcc gccggccgcg      2760
     gagtctcggc cccgtcagcg tgcgtggtct tccgcccttt caaccgtaat attccccgta      2820
     acccatcggc tttcatcaat cgttccacgg tgcaccgggc cactgacatc ccttctcgtt      2880
     tcagactggc gtgcactttg cgggccccgt acaccccgag attgtcggca tgaacacccc      2940
     ggatccggga cagaacctcg cggtcacgca ccgcacgtgc cgattcggtt cgctgggggc      3000
     tcaggtgagc tcggaccgtg gacggagcga tctgggcggc cgtaccgcgc aagaccgcgc      3060
     agatcggatc gactccgtgt tcgtcgcggt gagcagcgac gaactccacg atcagcgctg      3120
     tgggcggtcg atctccgccg caaagaaagc cgaggcctgc ttgaggatcg tgttcgcccg      3180
     ccgcagctcg cgattctccc gttccaactg ggcaatccgt tcggcatcac tggtagtggt      3240
     gcccgggcgc acgccgccgt cgacctcggc ctgcttgacc caggtcctga gcgcctcggg      3300
     atgcacaccg agctgatcgg cgatccgctt gagcgctccc ggccgcgtcg ccggatcctg      3360
     gcgggcctcg accgccatcc tcgttgctcg ttccttcagc tcaacgctgt acttccgtgg      3420
     tgctgccatg ctctccatcc ttcacaggtt tgagagcctc cgacagaccc ggggcgattc      3480
     aggctgatga tctggtgtgt gagatgaccg aggtgatgac gttgcggtgt gcccgcctgt      3540
     acgggcagcg cagtgcccgt cgcagtgacg ccgctgccgt gaccgccgcg ccggaccgcc      3600
     catgacggcc actgctgcac ttgctgatcc cactgccgac atcgctgcgc cggatccgtc      3660
     tcgggtggtg atccgggcgt tcgtgtacgt tctcgatccc accccggggc aggtcgaggc      3720
     gttgcgttcg aattgtgggg cacagcgttt cgcctacaac tgggcgctgt cgcaggtcaa      3780
     gtcgaacctc gatcaacgga ccgcggaacg atcctacggt gttccggatg cgggattgac      3840
     cccgtcgatg tcgtggtccg cgtacagcct gcgcaaacac tggaacaccg tcaaggacga      3900
     cgtcgcggtc aaccccgaga ccgggcaggt gtggtggtcg gcgaattcga aagaggcgta      3960
     cagttccggg atcgcgaact gcgcaaatgc cttgtcgaac tggtcagcgg cgcgttcagg      4020
     gaaacgtgcg gggacgatga ggtttcctcg attcaagagc aaacgtgctg catcctcgtg      4080
     ccggttcacg accggctgta tcggcttggt caccaccgac ggggatcgcc gccatgtcca      4140
     acttccccgg atcggggtgg tgcgcactgc cgagtcgacc cgcaagctgg cgcgtaaaac      4200
     cattgccggg acggcccgga tccggtcggc gactgtgtcg ttccggcggg gtcgctggca      4260
     ggtgtcgttc tccgtcgaga cgcttctccc tgcacgagcc ctcccgccca ccacgaccgg      4320
     tccgcgatcg gtggtcgggg tcgatgtggg ggtcaagcac ctcgcggttc tctcgaccgg      4380
     tgaactgatc gagaacccga aacacgctcg caagcaggcg aagaagctgc ggcgcctgca      4440
     acgccgagga gctcgccgca ccggcccgga ccgccgtacc cgccagcagc cctcgaatcg      4500
     gtggctccgc acgcaggacc agattcagcg gatacatgcc agggtcgcca acagtcgccg      4560
     cgaccacctt cacaaactca ccacccaact cgtccgcgtc tacgacaccg tcgtcgtcga      4620
     agacctcaat gtctccggaa tgagccgatc cggtggcgcc tacaagcgtg ggttgaatcg      4680
     cgcgatcggt gatgcggctc tcgccgaaat tcgacggcag ttgacttaca agaccgattg      4740
     gactggcacc ggtctgcatg tggcggaccg gtggtatccg tcgagtaaga cctgctcgaa      4800
     ctgtcaggca gtgaaaacca aactgcccct taatgttcgg gtgttcgtct gcgaccactg      4860
     cggttaccgc ggcgatcgtg atcacaacgc tgccctgaac ctcgctgcac tcgcggtgtc      4920
     cgttgaggat ggcacgtctc cggcgagttg cggacgagac gtaaaagcag cccgacagaa      4980
     accaaccata agacccgcca ccagcgggca gacggtatcg ctgcgggaac accacacacc      5040
     agtggtgaac gtggccggag caacccggcc actcatgccg agtacacaaa aaaacactca      5100
     gcgtgaacgg cagatggtca gtccgccccc gtccccccgt cccgtcgtcc ccgtcagcag      5160
     gacaacaccg aatctaccca cttgtgtagg aaaaaacact acctgaacag cgaaaacgtc      5220
     cccggcacac ccgggtgccg gggacgtttg gtattcagcg actgactgac gctgtaaccg      5280
     agtgactatc ccctcaacgc tgagatcggc gtttccgcgg tccagatccg cccaaggact      5340
     gcttccggac gctgtcgagt gtcgcccaca gcgcttcgtt gtccagatcg cttcggtgct      5400
     tctcgattgc agacacgagc tggtcaatca ctgcccgagc cggcggattg aacgtcattg      5460
     ctgccgcacc cgcccaggcg agcggttcgt cctcgcgctt caggatccga tcgagcgcac      5520
     cctcacaccg atcgaagaac ttctcggtgc gcttagtttg attgtcatcc tgatcgttgg      5580
     cttcgagcgc tccctcagca agatcgagaa atccattgat gatcctcgtc gcgcggtcac      5640
     gcagcaccgg gtcgaacccg agagatgacc agaatccgtt ccaccgcgtg cggtaactgc      5700
     ggtccgaact gagcggcaca aggtgatcgc gtatcagccg gccgaggctg ttctcgtcca      5760
     gctcacgcag ctgacgcgcc aagagtgctg gcttcgatgc ctcgggcaac ggctgcggat      5820
     ctttcacgcg caaccatggg tgcggcccca ccgaatcgat cacggcagtg agcggcccga      5880
     cgatgaccac gaaagatcga ccttacgacg gtgcgccccc tcggcgttgt catcgagcac      5940
     gaactccgaa agcagcgcct tggctcgttt ctcgacagag ctagcttcgt tgtccatgtt      6000
     catctccttc tcgtttgtca tctcaactcc ttcgacacag ctaacaccga cagatcgact      6060
     gccggcgcgt cgttcgacca cacatgcgta cgaccatgag gaagcaactc cggtagcggg      6120
     tgcaacctcc acggctcgat ctcatcgagc acttcctgag caagcacgac accatggaaa      6180
     cgcgtcggca ccgtcgtgac atcgacgatg gagccgcggc gtcggaactc actcatcgag      6240
     cgggccgaac cgttgctgat cacaatctgc ttccagggct tgccagtgat gtcaagaatc      6300
     gccacgacgt gtggttcgag ccaaccccgc tcacgccaaa caggcaaaat tcctttgtcc      6360
     ttcgggagag cgatctgggc gatcgcctcg cgggcgtagt cggtctgctg ccggccccgc      6420
     aactcagact cggcggctgg cagacgcagc tgctcgagtc gacgatgtgg gacggccgcc      6480
     aaccggcggt tggagccggc caaccatcgc ctaacggtgc gcgacgagac atgcatagcg      6540
     tccgcgaccg cctgcacgtc aacacttcca cgtgcagttt cgccgtaaca ggtccggagc      6600
     atcgcctcga gacgtttgcg cgtccagcga ggccctcgat ggacgaccac aacttaccgt      6660
     tccacgtcga agctgttaat ttgaaagaac tcccacccac cgacgtagtc ctgcgctcgc      6720
     gtgttcatcc agtcggtcat tcccttgtcg ccaccgcgtt catacgcact ccacatcgcc      6780
     tcgacctggt caggcgtcag cgccaaggtg atcaaccgat cccgggcata ctcccgcggt      6840
     cccggaccct gaacagcatc gatcctgatc ttgccgccgt acttggccaa cgccttacct      6900
     tgtttgctgc ttcgcatagt cgacatcgcc gcgcgacgtg cgctctgcgt agaggccgct      6960
     cgtttggcct tgtgggctag ggctttgagg gtctcagctc gtggtttggc gattcgctgc      7020
     cgaccttccg gggccaacca gcgttccacg gtgcgtcgag agaccccaag atcgcgtgct      7080
     gcggcggcag tgttgatttc gctccgtttg ccgggcccgt aagcggcaag tagctgagcc      7140
     ttgaggttgg cggatccagg tcgaccggaa gtgtcggagc ctcggcgtcc ggtcagcttg      7200
     ccgaagaatt ccgattgcat ctttccgcgc tcagcgcgca gcacttcacg caccgctgtc      7260
     tgggttacac ggagttcctt ggcggctctt acgacattga tctggttgtc caccacagag      7320
     ccgtagtccg ccagactgtc ggcgatccgc gaataggcag tgcggctgag gggcttccgt      7380
     gccatcacga gtcactttcc gcgctgatac cggcggacat ccactcagcc ggtgcgatca      7440
     gatccgactt gccccggtag cccttgccgt ccaggtactg ctgatgttcg gcgaggagtg      7500
     cggatccttc cggcttgtac tggccgaaac cacgtccgaa ttgcttcggt cctccaggcc      7560
     acgccagctt gggatcggat tcatccgaca cgtagagcac ggtgtctttg gtgactgcga      7620
     cgggccattg tccggtgtct tcgccgatct gagctatccg gtacatgatg ttggcccgcg      7680
     acttggcgac gatgtggtgg tgacgctctg gtgaatatcc tgggcgtcct gccaagtgca      7740
     gatcggaatt gagaatgccg atcgtgtgcg tatagatgac tttgttctgt tcgcgagcca      7800
     actgcgcgtc gagatcgtcc ttgatgtcca aggcgatgcg cgcatcccgg atccgttcgt      7860
     accacgggac gaggacccgt ccgtgatcag gccacacgta ggcctccaga atctcgggtt      7920
     cgtacccgag actgctggcg cgttcgaggg tgggtgtagt cacccacttc ggctcggaaa      7980
     ttgacaaacc catcgggttg agaggattcg ggaaccgcca gtccgcggac tcggggatct      8040
     ccacgagcca gtacccgggg agcttgcgat cgaacggtag tccgttcgaa tgatgcgcag      8100
     gttcgccgat cggaagttcg aggccggcga ttcctgccgc gtacgaaccg ccgcggtcga      8160
     aggcatggac gtaacggcac ttcgcttcgt cgtcagacaa ggtccgtgac cagtcgatat      8220
     ctgcctcgaa gatctggaac ttcttggcga actcggcatc ggagggtgcg aatacgcgct      8280
     tccattcctt cggccgggcg gcgatcatca ggtcgatgcc cgtcgatgcc gggctcacag      8340
     cccaggggaa acgcagagca tttgctagga gtgacaggcg tcgcgccagt gtggcgggtg      8400
     ccggcgagtc accaagaatg ggcatctcct tggggtcctg gctcatgccg gaggtcagtg      8460
     tcacccagac accacgggtt tcacctttcc acactcgcgt ccaagtgccg aggcggtccc      8520
     cctccttgcc gccgagctgc cagccctcgg agagagcctc tgtgacgaac ggagattgtg      8580
     cggtcagttc cttgagcctg tcgtttcgat tgcgcttgcc cagactgctg gtgtcgattc      8640
     ccatgtgctg cgccatcgcg tcggtgatcc agatctgccc aggcaccgac catttgtcgg      8700
     acgtccacgt gccgaggttc aacgtcgcta cgagctccgc gacatcgccg acatgggtga      8760
     tctgcgaggc aaggtcgtga cgggtgccgt cgggaagcca ggcgccatcg acgtcgagta      8820
     ctgccgcggg tgcggtgaag gtggtccgtg catctcctgc tgcaagtttc ggtgccgggg      8880
     ttgtcgtggt cggctggtgc gtggtctccg ccgtcgcgac gatggccggc gttgctgcag      8940
     cagtctcacg agacgtcgtt tcgacgggag ccgccaccgg ctcgtccttc accattggcg      9000
     aaacctgtcc gactgtgtcg ccggttgctg cagctgctga tcgggtggcg gcggtgcttt      9060
     gccaccagca gggaaggtgc atcaccaagc cgtcgatctg ccatccggcg tcctcgccgc      9120
     cacacagggc gcagatggaa accggtgaaa tctgcactcc atcagcggta tgcccttcgg      9180
     catcggtctc gatagccatc tcaggctcct gttcggaatg agagctggtc aggctcatga      9240
     cttcgttaga cgaatcaccc gaagctacgc cggaccctgg actgttcaga tcggcgatcc      9300
     aaccatcgaa cagagccgga ccaccgggca caggcgtgga agagtcgctg gaatcgccac      9360
     cgagtgtcgg gtcacttgat cctgcatcgc tggttacttg gtcttccgga ccatcgctac      9420
     cgagcaactt gtgcagccgc agtgcaacca tgcgctgcct gcggttttcg cacttgacca      9480
     tccgctgcac cgtgtaccgc ggcattctgc ctttccgttc ctccgcgatc agcacgccct      9540
     cgtcatagag agccctcaag gcggtaccgc gatcgatctg caaggtatcg gtcatcgtct      9600
     gaccagtggc tttcaacacc tgttcgaggg ccatcgggtc caacaagact tgtggttgac      9660
     catcgcacgg ccgcgggttg gccacgacat atcccaatcg aacgccacga ccttccgcac      9720
     gccatcgagg ggtgccgtcg gatgtttcac ccaccacact gcgccgccat ccaagacatg      9780
     ccgccatcga ccaatccgat ggagcttgcc cggtgtcgac gtcctccacg taggcgtgac      9840
     catttctcag tgcgtgtacc aacaactccc gtactcgcgc accggtccgc attggcagat      9900
     ctgggtcagt cgccgcagca gcggcatcag acaagcccat cgtgaccagg tccccgacct      9960
     gcgcgacttc gttctccgtt aacgccccta catcaacaag gaaacgtgac atcgcatgcc     10020
     agcccgccca cagagacccc aaagcgtctg cctgacgaac actttcgccg ctcgtgcgca     10080
     aacgctcgct ataccgctca ccttcggcga acgcctcggc gcggacaatg tccaaccgag     10140
     ggcataacca ttgcaggtac gtggccatca acaaggcgcg gccatgacgg gaatgcgcag     10200
     tatcgagttc cttcaaaacg ttcagttcga tttcccgcgc ctgcagcggc accacgagca     10260
     tccgctgagc tgcagatcct ggccgcggca tgatctcgga ggtgaccaaa gcagacgcgc     10320
     ggggcggggt tccgtccaga acccctagac catcacgtgt gcttctcgag cgttgctcac     10380
     cgttgtgcac catgcgagcg aactcttcga gcgccttctg cgcagtcccg aagtctcggg     10440
     ttggtgcgac atcgtccgcc cagtacagag catcttttgc ggcgttaagc ttgatccgca     10500
     atgcattcaa tgtgtcgccg ttgcccgaca tcgatgtcgc cggtcgccgg cgatcccatt     10560
     tctctcccca gtggtgcatc gccaatgacg cgagtgaggt cttgtagctg ttaggcgatc     10620
     cgaccaacgt aagaacccac gggttcggac ccaatgcgga cctgaatacc tgcccaagta     10680
     gagcggccga aactcgcgtc ggggtgcgtt cgagcatcga gccggaatga cgaaggaatg     10740
     cttctcggat ccttaccggg tcgggcgtcg gtgcgggaag gtcatacatc ttcagggggc     10800
     cggtcagcag aacaggggct acccgtccgc cattctcgtc gatggctccc ccagcatgaa     10860
     cgaagaacca cttgccctga tcatcgcggc gccaccctgt cgagcggtat cgcaccaccc     10920
     gtcggatttc gcgcccacct gcgcccttga gtgcatctcg cagcttcgcc actccgctgg     10980
     ggcgagagtc gtaggcaggc ggacccggca aggtatcgac ccagccgcaa tcccggtact     11040
     ccttcgccgg aatccggatc cgcagaaact ctcggctctc cggatgggtg tagccgataa     11100
     ccaccgcggt gagttcttga ggtgcggcgg ggttgacttc actctgaccg gccatcgctg     11160
     ctcgacccat caactccggc tcgtcgacgt cgatacccgc atcggcaact tcgagatact     11220
     ccatctcaac gatccgcgca tcgaggtcca gtacgagttt cgcctgttga tcaccgctct     11280
     tggtcgtgac gatttcgacc aagttcccat caatgatccg atacaccgga gcaataacat     11340
     tgcgcccccg gatgctgttc agcggcgtag ccagactctc cgagtcggac cagacccgct     11400
     gtgaatcaac ggggctgagc gagtcctgaa ccgcacccgg tacgggctca agctcgggat     11460
     cttgcagaat cggtggaaca ggaactcgcg cgacatcgtg tgtggcccga gctgcaacga     11520
     gcgcggcacg ccatgcggtc atggcattct cgaccgcttc tcccgcccaa tcggtgcctt     11580
     cagccgcggc ctgctgtcga actttgtcca gaagttcagt cagatcctcg aaacgtcgct     11640
     ccgattcgag cgcccaccgc tgtgcgcgtc ggaactcttc gtctccgtcc cgctcacttg     11700
     cacgatcaac tctggcggtc gcctctgcca gcgcaagttc gattagtgct tgcttctcga     11760
     ttacgtcggc agcgaagccg tgggcagcga cttccccagc ccgaacaggg atgaggccac     11820
     cccacatcga gtcggtcgac caatgtccgt catcgacgtg gtcagtaaaa tcagatttgg     11880
     gttccgccgt tgcggacagc aagagctgga cctgggcgcc actgccaccc aacagagatg     11940
     cgagttcgat acctcgcttc catccgacgg agtcgcgatc gagcacgatg cgaacctcag     12000
     cgccttcgaa aaggtcagca catgagagag ggaagttcag tccgccttga gcattggtcg     12060
     tggcaaccag tccaagcgac tcggctgtct cgacatcctt ctccccctcg agtaaccaca     12120
     caggcgaatg gctcgagatt gctgacagca gttccgggag tcgatacaag accggttcaa     12180
     aaccctccgg cttacgtctg agccgggtcc ctgcggcatc cacgaaaatc tgtcggaact     12240
     gcttgtgccg gccagcttca cagctcgtgc attcctcgcg gattacctcc tgcaccaaag     12300
     tgccgtctgc agatacatac gagtagacct tgactcgatc ccaccggtgt tgagcatcag     12360
     gtgtcacgtc cggaagcgcg atccgggcgg gaagtcgtcc acccttcggc cggcgccgcc     12420
     cggcaccacg tcgtcgggga gatcggccta cgcgtgtaag cgcatcgcga tcaggcagcg     12480
     gttcgtcgaa gaggtccgtc atcgacaaac ccagaccctc ggcgatctcc gagacgggag     12540
     cttcacagcc gtggcagtga agcagcacca ttcctcccct atgcccatcg acccaggtca     12600
     cggacatcga cgcgtgacgg tctccatgga tcgggcaccg cgccatcagt tgggtcgagc     12660
     cgcgttcgtt gaccccgcca ttgcgttcgg cagcagcacg aacccggtcg aatgacgaca     12720
     tccgaccgat ctgaatggtt ccagcagtga tagcagtcac gaagccgcct cagacacacg     12780
     cgccacgaga tctggcaagc gcggtgcggc ccgggttagt atgggcacag gtcccctcca     12840
     ggactcgtat ttatgaacca ggtcccctcc aggactcagt tcgtaatcaa cggaacgaag     12900
     gacccccgca ggccggcaag cagtgggggt ctttcgctat ctatggccag gtcatgccga     12960
     gattgaaagt tcgttgtcgg acgaatcgga gaccgcatag cgctcgtcgt gcgcccgtag     13020
     tttttccggg tccaacttct tgaggatgta gtcggggaca tccaggttgt acgcacgggc     13080
     catgacgagc agggcgtagt cgccgagctc gagtccgagc tcttcggcgc gtgcttcgta     13140
     gaagctgtgc tgttgaaggg gtgcacgaac tgatatgcac ttgcgcgttc ccttgtgtgg     13200
     ccgtcccatg cgaagagcct aaacagaaac tgcttcggaa acgttgaatg acgtgttgtc     13260
     ggtgtgtcgc cgttcatcgt gcatcccctc accttcacca aaaatccgct tctggtttga     13320
     ggaagatcct tcgacccagc gctgtgtgac agatgggaaa caaaatcttc gtcgccgcat     13380
     catgccgcgg tgcatggact gtttgaccaa actcgcccga ccgcggtttc agatgaacaa     13440
     caacccctac gtgtgacctg cggggcgact cggtggggag tggggggatt gggaagaaat     13500
     acctgatcaa acggtaaaat ccactcccca ctacggtggg gagtggggtg gggagtgggg     13560
     tggggagtgg gttcaaagac acctgaagtg ccttcgcacg caccaccgct gagctttcgg     13620
     gaagcgatca agaggtaggg cggcgaggtt ctactccccc accgccctac cccatcgtca     13680
     ctaccgagac gccgtccgaa gatgcagcga caagacgcca gcgagaagcc ggcttcggga     13740
     cttcgatccc accaccttca cctgagcgtc aagccagtcc ctctgtgccg tcgtgaaccg     13800
     gaaccacgtc tcaacgggac ccttgaccgc gaatggctcc tgatgcatcg ggatcccggc     13860
     tgcggatcgc cgggccaccg gctggaacag gctgcgaagt cccgcgatcc caacagaatc     13920
     gaaggcctcg atagccacat cagcgtgatc acacctactt tcggccgcgc ggctctgcag     13980
     tgcatcacgc gtggtgcgat ccaggtaagc cgtcacggtc accttcccgg tttccgtcga     14040
     aggttcgaca tcatcgtcga ggaccggggt cgggtccggg acaggctcat agattggatc     14100
     ctgcttttcg acgggtgcag gtggtggggt cggttctggt ttacgagccg gctcggagcg     14160
     aatgggcgcc gtagtggtag gagcgggtgg ttgggcctga gcttgtggcg gctcctgcgc     14220
     tgcaggcgcc ttctcgacat gccgagactc ctccgcggct ggttctacct cggtgatcgg     14280
     ggtagagcgc cgaggctggg tggggttgcc tgcagtcgga aggaggccgg ctaaaccctc     14340
     cgctcggtta cctttcggag cgaaagcact ggcaaggctc ttgcggcggg gagtgctggt     14400
     ttcggtcatg ccgatgccac ctcctcgctg atggtcgaca gacgaacgag gatttcgcgt     14460
     gtcagttctg cgtagtcctc ggccaacccg gacgcattgc gcgaaagtat ctgatccgtc     14520
     ggtttggcgc ccttcttcag tgcggcgaaa cgtgcgactt tggcgacttc ggtctgctgt     14580
     tccagctcat ggaccagcaa gccctcccgg cgggcatcgt aggccgtaga ttccatcgtc     14640
     cggatccggg attcgaagat gggggcggca tccccgatca tctcgttgac ggattggcgg     14700
     atcttcgccg tgagcttggt tgaacgcgaa cccacaccga acaggcaaat acctgccaac     14760
     tgcagccgtg ggttgacagc cggtagatta cggtctggat caccatcgcg tgtcgccgag     14820
     aactggccgg caattgtttc caacccgtcg aggcttgcgt cgtccgccct gactgggatg     14880
     accacagcct ggacgacctc catcaatgcc tccatgatgg tcaaatcacc gggcggagtg     14940
     tcgaagatga tcacgtcata gttatgcgca acctgcagga gcatggcgcg aacgagctgt     15000
     ccgagccgct taccaccctg acgctgctgg cgggaaacca tgacggcagc caggtcgaac     15060
     atcgcgggac cacccggcac cacatcgaga ttctcgcggc cgccgacatt gtggacgatc     15120
     ggaggcgcgg acccttgcag gagcgcggtg aacagttcgg atccgtcacg cttgtcgtag     15180
     cccagatcgc ggcacaggtt cccctggggg tcgaagtcac cgatcagaac tcggtatccg     15240
     gcggcggcaa ggagtccgcc gcagttggcg gcacagcttg tctttcccac tccccccttg     15300
     ccgttgaaga atccgaacga caccggcagt tcctgctgct ctgcagttga ggtctcgacg     15360
     acgtgcatgg acatggcagt tctcccattg gactttggtt gtgacgagtg gttccccagt     15420
     gaagctagca ggattcctgg acaacttgcc gtatgccacg cggggcagac cgtaggtaga     15480
     tctgcgtgag caaacgcgtg agatacaacg ggcgcaaccg tatgaggcaa cgcaggtagt     15540
     tcggcaggtc atcatgcctg gtaactggcg tgatagtaga cgtggtgatc ggcatgaata     15600
     ccagcgtgga atcaagtgtg tcattcggca ggtcaatcgg cgtggtcata cgcatggcga     15660
     cacgctggtt aacctacgtg aggacatgcg gcatggcacg cgtgaactct ggcggtatta     15720
     aacgcgtgac gagcacctag ttgtcctgcg ttgacttacg taggaagaca cgcgtgagac     15780
     gtcgcgtgag agcatgcgtg aagcattgcg tgtcataccg cgtgaccatc agcatgaaca     15840
     aacgcgggac agactgccgg atgtcaagtg ggacaaacta cgtggacaga tgcgtgatct     15900
     tctgcgatgg cccgaacgtg gctacatgct tgtgtcaaca cgtgcacacg ggcgtgatta     15960
     gacgcgggag accagtgcag gtgcttgcac gtgaactaat cctgtcgctt atgcggacaa     16020
     catcactggt tgtaatacgt gaaccgatac gtgccctcgc tgcgggtccg agtgcgaggg     16080
     ggtaaaccga atgagatgcg tgaccgagta ccgcaactgg gcgctaggtg cagtgcgtga     16140
     gatcgagctg gcacccgacc ggaaggctct gcggatcgaa cgttgagtgc gaggcctgac     16200
     agcgtgaaag gtgagaagtc ccgttcgcgt gaagatatag ggaatcactt gcgtgaacac     16260
     atgcgtgaaa cgctcgcaga actgtgtcct acctgtactg attcggtcgt ctgcggggat     16320
     cgccgaccgt gccgcgccgg cttcgttgga ggctgattcg atggtggagg cccgcgatag     16380
     tgatgacgcc gatcgcatcg gcgatgtcct gagcgcgtcg ctgtctgtcg agctcgacga     16440
     cgaggtcgat cacggtgtct tcgaggatgt tctcggcggc cttgtacagg tcccagagct     16500
     gcttgagctc ccatgcccga atcagagggt tcgagaagta gagaccatcg acgatgcgat     16560
     gaacccgatc cacctgggca tttgttctat ctgcagggct tgaccaggtc gcaaagtgtg     16620
     agctggccga gcagtcgtcg accgtcgagt ccagttcggc ggcgacagtc acccaggagg     16680
     tgggacagat agcccgtcgg gcttgcctga ctgcctcgcc gaacgcgcgt tgacagactg     16740
     cggcgtactc ggtggcagcg cgccggccct cgttcagctc gcgcagatcc atcagggagg     16800
     tgaagtcgtg gcggccgcgg gtgaactctg tggccgcgag aagcgcctca ctgccgctcc     16860
     attggaagcg agactgccta cattgatcgc ggtgccagcg cagatcctcg acccacggaa     16920
     ggccaagctc aaggccctcg ccatttggca ccgtcatatg aacatgatgc catcatgcgg     16980
     tgtgggtgtc acccatcgtt acgcaatcgt cccgaattct tctaagtggt agatgcagtt     17040
     cccaaacaag gtatcccgaa cgtgaaagta taggaaagcg gaaagcaatc aatattagtt     17100
     cgaaccaatc tctaggccgt cccatctgca tcccatgaga ctggcaagat tgcgtgtgct     17160
     ggctatcaag attgcataga aacatctcga aaattgtttc atcgctattt tgggatgata     17220
     ttggtacgac actgggacgg gtatgcatgt gaatcaactg tggaggcatg tacgtccgca     17280
     ctgctctctt tggtataggc atgagttggt ctatgttgtt catataacat cgcgtttcac     17340
     gttgaaggtg cgctcctagg gcactgttga cggtatgtac cgccgagccg agtagtccag     17400
     ggcgggctgt ataaaacaca tcaagatcat ttgggtacga gcgagtgcct ctcgctccct     17460
     gttcagcatc ggagtacatc gtcgtgacgc aggaacatgg tcgacctcaa gccactgggg     17520
     aacaccgtcc gttggcttcg acctttcgat cgccggctgc tcgatcggtc gaacacatcg     17580
     catcccagta catcgaggga tctgatgatg tggaagttga accgaatcgc gaagcgccac     17640
     ctgagcgtgg gtcggtggca gacgcggacg gcggtgggaa gtcgtcaagc gttcgggttc     17700
     cggcaaagtg ccacgcaaag cttgagcagc ttcgtgagca aacgggaatg accaacggtc     17760
     agatcttcat tgtcgcgatc gaggcgacgc atgagcgtct acccgagctg ttgtaccccg     17820
     gtggacgaat cgggggaggg ctcttcgcgc cccgtggcat tcgccccaaa tcgtcacgtg     17880
     acgattctga aacgcaagtg acataccgcc tgttcaagtc cgacttcgac gtcattgatc     17940
     aactcgtcgt cgatctcgcc gcgaagtcgc ggtcccatct gatcacagcg gctctgaccg     18000
     gatacttctt cggggacgac gaacgcacac aggcggcaga gtagcgccga cgagccctac     18060
     ttcttgtttg cgactactac ccagagcgcg agaacaatca tcggcgcaac agcgacgggg     18120
     acggccagaa gtgagtggac agtcgtcccg gtcgcggcca aaccatcgat cgcgctaacg     18180
     aaatagggcc gcaagaaacc cacaaccccg caatgtgacg accgcgaagg cgccggagga     18240
     ttcgggattc gcggtgggat ctggagatcg cgtcggggca tctgtcgctc agttcgtcat     18300
     cgggtcgcca gtggcagtcc gacctgcagc tgcgaaatgt tcgagcgcgt cgaagcaagc     18360
     ggcggccgcc tttgccatct gagcggcgct gtggcgggcg tttcggaggg aaacgcccca     18420
     gcagagaggt tgcatgtctg ttccgcagtg gtgtgtgggt cggtggtatc cctagagcgc     18480
     cagctgtcag tttcctgata tcagcgctct gatgccaggt gggggagagg ttgacctcgg     18540
     cgagcagtcg ggtgagcaat tgcgtgtgcg cgtcgccgtg gaatccgcca gcgatgtgcc     18600
     cctccatgcg tcctcgtgcg agtccggagg ccgagtaccg cactcgcgtc cgcagtgagc     18660
     tcgctgtgac tcggagaggt aatgttccag taccttccgg tgctcgtgtc gatgacggcg     18720
     atgtcccgca cctggtgaat gctgccaccg ctccctgacg tcgtcacgtg tacgacgaac     18780
     agatcgcgac cacggtattt gaacgatgaa gggggaggag cctggcgtgc aggctagttg     18840
     cggtcctgtg actgcgtcct cctcgatggg tcttgccacc cggggcctcg gtgcccgctg     18900
     gcccggatgc tctgtgcccg actacgccgt cgtcgtcgcc cgattagtgg ggaagtccgc     18960
     tcgaactgct tggacgaacg cctcgtattg agtctcggcg aatcgagcga aacgagaggt     19020
     tggggcgatt ccgtcgtacc gttgtccatc gaattcgatc gaggtggtcg gctgatcgct     19080
     gccgacgatt gagtactccg agatcggtct atgggtgacg gtgtcacgcg tccgcttgag     19140
     aggctccgat ccgccctgtt cagcgcgcag ctcgacaccc ttgttcatag cctcacgcag     19200
     gtgatctaga tctgaatccc tgcccgagcg tcgtattgga cagattttcg cagccgatag     19260
     gccgctgcag cacagaggtc cagacatgtc atcgctgtac gtgaggcgta gtcgaccggt     19320
     gccaacatca ggatgttgaa ctgttcattc gagaggcgct cctgcatttg cctgtggccg     19380
     tcccgctcgc gcgaccattc ggccatcccg cccgcgagcc ggacgaagcc gacctggaaa     19440
     cctgcggacg aaacgaggtg tgacgcggcc tggtatttat cgccgagctg cctgagccga     19500
     gcggagacga ggttcgagag gtccagctgc ttcacgttga cggcggagtc gcccatctac     19560
     tcagtctggc agtgggcgcg ccggatacaa caggtcttgc cccggatggc cggatacgtg     19620
     aggcgtatgg gaaacgtcgg gtcttccgtc tgtcccaccg cgaaaaggac cccggccggt     19680
     gggacccttt tctggcaata ctgttcggtg cgggcggtcg gctcggagtg tctgggctca     19740
     ccgaccggca tcgaaccaac ctccattcga tgtacgaccg attttggcca cggccttggc     19800
     gatcggatcg cggaagtggt tggtcatgtc ctgcagggcc gtagtgcctg atgaatcgac     19860
     gacgagctcc ccgtagttct ggtgagttcc ggacccgatg aatgaggcga acttcacccc     19920
     ttcagcaccg atctgggaaa gggcgtttgc accgtcagag cctgccaggg cggtgaggct     19980
     cgaggcgagc tttccaaggt ccccagcctg tgactgctgc atgatctgct gtccggtcgt     20040
     cgtggacgcc gacaccgaac cgagcttgga cgcgtcggtc ttctggccac cgctgagtgt     20100
     gcccaccgcg atcttcgcga agtcgaggat gtgggggagt gcgccgaggc cggctccgat     20160
     gatgtcgccg gtttcgatgg cgtgccagag ctgtttttgg agttcgccag cggtgttcgc     20220
     cagaccaatg atgtcgagat tcccgacgac gccgacgatc atcgagatga tctgtgcggc     20280
     gccggatggg tcgggaatca tcgcgatcag ggccgccgcg gtcttgtagt cgagcccggc     20340
     ggcgagcgtg atgagtggct cgaacaggac attgatccgg tcgaattcgg cgtggacagc     20400
     cttgaccttg gccatcggat cgagacccgg atcgagaaca atgtgcggga tccggttgaa     20460
     cacgatgtcg aggactgcag ggatgttgtt ggcgaggtcg aatgcgttcg tcccgatgtg     20520
     cgtgacctgg ttgatgagca cgctcggctt gatgatcgaa agtgcgtccg ccgcgagtga     20580
     cagaccatca gccggagtag cggccaaggg ggagacctga gtggacaagg tatccaccga     20640
     tgtctgcagc tgctgcacct gatccggcgt ggaggcattc tgaaccgtcc gcgcgatggt     20700
     gtccgcggcc tgaaatgcac tcgtaaggtc gatgcctttg accttgtcga cgagctggcc     20760
     ggcggcgtat tcgggagtcg acgcgtccgc ggtcttgagc gtctgttcca cagccggatt     20820
     ctgggtaacc cagctggtcg tatcgaccac cggaacaagg gtgttggcaa catctgtcgc     20880
     cgccgattcc atgctcttca ggtccggagc gccggactgc agctgttgct ggagggtctc     20940
     gatgttgccg gccaatcccg gaagatcgac cttcgagtag tcggacacca aggcgttctg     21000
     cagacccgcg gtggtgggct gaaatccatc gctctgctgc ggaccggaag cagtcggagg     21060
     ctgcgcaagc acccgtccaa gtccggcgag caatccatcc ttgccggcgt tggtcgagca     21120
     gtagaggtcg tcgggggcgc agtacgaacg cgtgactgca gcagtctttc cgaacccgcc     21180
     cggcctggcc cccgcgatcc caacaccgtc gacgggagga ccgacgagag tgttgtcgcc     21240
     attcgaactc tgccgtgggt cagcaacaag accgacagcg atcaacttct ctgccgggat     21300
     cggacccttg tcgtggccga tcaaccacgc caagtcgccg gccacgtccg caccctggct     21360
     gtagccgccg agtgcgaaca gagtgttcgg gcattgcgtt gcacgagtct gcatcacgcg     21420
     cgcgccggcc gcgatgccag atgccttact gatgccatag gtcttgccct tgttgaaggc     21480
     ggacgcttcg tacgccggat aggtgatctt gatggagcta ccgaacagct gggaaagagg     21540
     atcggtgacc tgcttgagca gacccttcgc gacgtcggga ttggcggtcg agtccgtctc     21600
     gaacgttccc ggcatcatca ccacttccac tgccgggcag cccgatgatg ccggcgccgc     21660
     cccggcctga cttggcgaca caaccgcgat gagcgaggcg aggagtgcag cgagcaagga     21720
     ggcgacgagc agggcaaccc ggccgctgtc gttggcgcga ccgtcctcag atgatggtgc     21780
     gtgaaggttt gtcatgagtg ttctctcttc gtcagcgata cagcgccggc acgatgaccc     21840
     gaccgctgtc gatatgagtg gtgatgtcgc ggggcagaaa gtcagcgaca gtgagagcga     21900
     ctctgctcat cacatgcgag gactcggcga gcagtccggg acgagcgatt gcggggcggg     21960
     tgagtgcagc atcgaatcct cgcgtcgctt cgaggagcaa ggacgtttcg gtcagaagaa     22020
     acgccgccgc gatgaagacc atgacggtga acagaggcgc gagactacgg atcatcagat     22080
     caccgcagta gtcgttgcag tccgacgacg accacgtgca aaccggggtc gaggagtcgg     22140
     cgggttggag gcgacgacac ttttgcgaat gcgtgtgacc gcgcggtaga gccgctggcg     22200
     aagcgctgcc ggagtcatcc caatctccgc ggcaatcacg gccaggtcgc aatcggtctg     22260
     ctcgaggtat gcccgctgaa tcagggtgcg atcgaggtcg ttgatgacct tcttttcgac     22320
     cgcccaggag agcagagccg gagcagagat atccgcttcc ggctcgttct cagcactgtc     22380
     ggactcgtcc atgacatcgg aggcggggat ctcctgggtg aaggtttcct cgcacgtgat     22440
     cttcttcagc gtgtgcagga agagcgccgc gtagacgttc tcaccggagg gcctgtaggt     22500
     ggcgatcagt gacataaacg tggccacagt ggaggccgct ctctcatcgc acgcgtaata     22560
     ccgatcgtgc ccactgaccc gtgcgtggcg cgtcagggag atgagcttgc cgagcatcag     22620
     ctgcagtagc gctcgcccgg caagggcgct tccttcctga tgcagtctca gcagcgccag     22680
     aagcacacca tcacgatctc ggcggtgcgc cgcggcgaga tcgttgagat ccgcgacgtc     22740
     acggagcgcg gcccggctca ccgaccacgt caagacttcg gcggcggggc gagcgcagag     22800
     gtacatccac tcggtgttca agcggctgta cagattgctc tgcgcggtgc tgcgaaccgg     22860
     cgttgccgat gacgctgtga tggcggtggg tgcgtgggtg gacgtttcca cgatcggtct     22920
     cctctgggcg cgggcgaggt ggtctcgcgc ccagtacagc aaccggatat tgcctctgac     22980
     ctgcgtgttt gttgttgccg gaggggctgt cgttattgcc agggcgttgt tgccgtgaag     23040
     gttccggctg tgcggcggtg ggccagggag tgcccctcac gtgcgctctt tcggctgagg     23100
     caataacccc ttggtgactg cagaaaaact tcaagaaagt ttcgcgaacg atgtcactca     23160
     agcccccgga cccggatctt cctccaagta gaagcccact ttttctgtgt ggcgctcttc     23220
     cacaccccag tcgccaggag gaccggatgc acgagctcga caactcgctg caagcccagc     23280
     tgcacgatct cggctacgtg cacgccgtca ccgaggagat ccgtcgagtc gcggcagccc     23340
     tggcggtgaa ccctctcgat gaagaggcga acacttcgct gtggctgttg gtgttcgtcg     23400
     aagcgccagc cgcgcgcgcc gcgctgtcgc gggcgtccgc attcgacatc gcggattccg     23460
     tccccgattg cagaacgtcc gacccgacga cagaagccgg catccgatga aaatcgacct     23520
     cgcgaaaatc aacaacttcg gccgcagccc caagagcaag accgatcccg cgactgaaaa     23580
     tagcgtcgac tccgttgtcg ccgaagccga ggagttggcg cgcgcggtgc gtgcacagtg     23640
     gggccttcgg caggtgtgga ccacccgact tctcaaggca ggaatccttg ccgcactcgg     23700
     cgccggaata gttgccctga tcctcgtcgt cttcggatcc tcgcccaccc cgaacctcac     23760
     cgacaacgcc accaaggaca ccgcagacgt cgacacaatc ggtcaagcga aagccgaaga     23820
     tcttgctcgg cagttcgtcg ttgcctggct ccaggcatcg cgtgggaatg aacaagaact     23880
     cgatcatttc gtctcgggaa gccccagcct tccgaccgcg ccgttgtttg ccgcgactga     23940
     tccggccgtc gcgtcgatcg actacgagca gaagtcacgg acatacgcgg tgacgatctc     24000
     ggtgtcagtt cgagccgcct cggacgcgaa tgcggccaca gttcgtcgct actttcaggt     24060
     gccggttgtg gtcaccgaag cgggcgtgag ggccgccgca ctccccgccg aagtagctga     24120
     accgtcgacc tcgatcgacg tcaagctcgg ctacaagtac cgggtcgcca accatcccat     24180
     cgccacgtcc gcgcacgagt tcctgtccgc gatgttgacc ggcaacgggg aagtagcgcg     24240
     ctatctcacg ccgggggttt cgatcgcccc gattgttccg gcgccgtatc gcagagtggc     24300
     aatcaccgat gtctattcgt cggaagacct gagtgctgcc agtgcatcgg caccgctgcc     24360
     tgacggtgat gttgtgcgcc tcctggtgac ggcagcgcag aaagtcgccg aggtcgattc     24420
     ggtcagtggg cagtacgcgc tgacgatgac ctcccgcggc ggccggtggg aggtcagcgc     24480
     aattgacgca acgccgttgt acccgccggc ggcaccccga acaccatcct cgtcaacgac     24540
     cgcaccgagc tcgaccacac caagtgccgg tgccccggag tccgcatcgc ctgattcagg     24600
     acagaccccc gcactttcgg tgccgactgc cggcgacgtg ccgctttttt ccccgtcagg     24660
     aaccgatcct cattcatccg gaaggtaacc catcatgtcc attgcgctcg caaccaccga     24720
     tcccaacaac gcggtcctcg ccgcagggct tttcgacaag gcgcaggagt tcaccagcaa     24780
     cggcaagctg ctcctccagt cggccgccgg ctgcctcgtt ttgttcttcc ttctcaagaa     24840
     tctgatggcc tcattcacag ttgcccggct catcacttcc gcgctcatcg gcggtgcagc     24900
     actgtgggtc gtcttcaaca tggacgtcct gaaggactcg acaggtgagg agttggagag     24960
     cgctcccgcc gtggtgcaca tcgtggccga gccgatttcc ggcttagacc ttcccgtgtg     25020
     atctccgctc gttcgcaccg gctgaaagat gccttgccag cactgacctc gttgcgccac     25080
     cgacctctta caaggagggc tcccatgttc gatgtagcta gcactgcgga agcgggttcg     25140
     cggcttcgcc ggcatgaagt cacgagtggg ccggtgctgc gatgagtgac gatcgcacca     25200
     ccggggaagt catcaagaac ttcacccgcg ctcgcaaggt gccgcagctg atcgggcgta     25260
     cacctgacgg aaagaagctg ccgttcggtc cctacaccgt tccgcaagcc gtcagcggcg     25320
     caatcgtcgg tgcgctcctg tggctcctgc atccactgtg gcttcgggac agcatttcct     25380
     ggaacgtcgg attcttcgcc ttctggtcac tgggcaccgt ctttgtcgtc ggcaaagtcc     25440
     ggtttgccgg ccggagcccc gcctcagtgg cacagggaat ctgcgccgca gccttcgcgc     25500
     cggccggtgc caagatccag atcaacggcc gccgggtgac catccggcca ccccacctcg     25560
     tgcgtccgag tggctacatc actgccgacc ccacggccgc cgaactcagc gccacggtcg     25620
     tcccgcaggc cgtgcacatc gccaccgccg aggtcaccga aaccgcatcg gcggaacctg     25680
     tcgcaccacg accgcagacc tccgctccgg tgcccacacc ggcaagcggg cccacccatc     25740
     gcgccggccg atcgagcgtc aaggaactcc tcgctctggc tgctgcaggc acctccgagt     25800
     agaaagcacc gccactatgg aacagccgac actgtcaatg gccgcgaaca tccggtggac     25860
     gaagtccggc gttgtctggg cggactacgt gctcacgggc atcgactacg gttaccgccc     25920
     cgatgtggac aagcgcactg ctcgtaccct gcacacgatg ctcgtccgcg cccttccggg     25980
     cgagtcactg ttgatgggca tcgcagcatc gttgagcgcc gaagccatcg tttcccgaat     26040
     gaccgaaggc gtcgatctcg atgcacaccc ggactgggca accgaatgcg aagcgactct     26100
     cgactcgatc gagctatacc gcccggggca gaggatctac tggctgagca ttccgctgac     26160
     cacacccaag gtcgtcgatc aggtcaaggc cgccgctcat tcggcctgga ccacactctc     26220
     cgactacatc gggctgccgc ggaccgcact tgacgatgac gagatccggg cccgtgtccg     26280
     gcaggccaac cggatcatgg ccgacatccc cggtgtcttc gatccgcaac ctgccactcc     26340
     cgctcagatg gtgtggctgt ggcagcacgc gatgacgcgc ggactgcatg tcgaccctga     26400
     cctgcccgac gcagccgtga cgccaggagc aaagtcaggt gccgccctga ccgcatgccg     26460
     gatcgacgag ggcgcccaat cggatcgaga gaaggcttcg ggttggcgag gcaaggtccc     26520
     gacgttcagt cgggtcctga aagtcgacca gccgtacgaa atcgtcgacc acccggcctc     26580
     ctaccaagtg ctcctcgcgc tcgctgacac ccccgccggt ggcgtctatt tccccggctc     26640
     ggagttcttc accctcgctg acgacttcgg cgatattgat gtcgatttcg ccgtacggct     26700
     caaggtaacc gccggtgccg atgtcatgcg agcgaacaag cgcgcactcg agaacctgaa     26760
     ggagcagtac gaacagcggg aaggagagtt ggccggcggc caaggtgttc tcgacctcgc     26820
     tgccgccgcg ttgaccgaat acacctcgtt gctcgagacg aaccgcgatg aggtcgaggt     26880
     tgcctggacg gcgttgttcg cggtaggagc tgattccgag gagcgtgcac tcgctgatgc     26940
     gaaggcattg gtgaaagcgt tcgaacagca ggaatacaag gtggtcgcgc cggtcggcta     27000
     ccaggaagac ctgtggtggg cgatgttgcc tggcgtcccc acatcgaaga tcgtccgcga     27060
     gttcgcgcag atcaccacat cgacgcattt cgcggcgtac atgccgttca ttcgcaacga     27120
     actcggcgat ggcagcggtc cgctgttggc actgaacatc accacctctc ggatcggtgt     27180
     ggttcaccac gacgtcgccg gaaagtccct acgcgaccag tccggatcct tcgcggtcac     27240
     cggtgagctc ggatcgggca agtcggtcac catgaaggtg atcgccggcc aggtcgtcga     27300
     ctgcggaggg caggtcatcg gcatcgacca aagcgatctc ggcgagtacg ccaactgggc     27360
     acgcgccgtc accgaagcag tcgtggtcga cctcgtcgaa cccgaataca gcatggatcc     27420
     actgaggatc ttcgaggccg gactcgcagc agaaatggcc cagtccgtgt tgttgacact     27480
     gctccggatc cagccttcct cagacctggg catcgcattg gcaaaagtga tcgagcccga     27540
     ataccgcgca gagcacccct accagggttt gggcgagctg accgaacacc tcctgtccgg     27600
     tgcttgcccg atcgcccacg cccaagatct cggcgaagca atgaacgtct acgcccgccg     27660
     cacctacgcg gcggcactgt tcggcaaaga tctacccccg ctgcccatta ctgctcccgg     27720
     catcattttc cgcacccaca aggtcgactt accaacccag ctgcagaccg agaaacaaca     27780
     cctctacgag aacctgccgc tggagaagcg gttcggccac gcggtgtaca ccctgatcgc     27840
     gaaggtcgcc cgcggacagt gcttcgccga ccccgaccag atggcgttgt tcctcgtcga     27900
     cgaggcacac cacctcctgg gcgccgacga cggagtcgac atcgtcgagg acttcgtgct     27960
     gcagggccgc aagtcctcgg ccgccgtggg actcggcgac caggactgcg cgttcggcac     28020
     cccgaagctg cgcggactga tcaagacccg catcgcgcac cgtcatacag acgaaaccct     28080
     cgccaagcgc gccattgaat ggcttggcct cgacccggac gactacggac tggtcaagca     28140
     atacatggag cagacagctc cggtaaccgg aaaagacaag tacgtcgaac ctcaccgccg     28200
     cggtgaaggt tacatgcgcg atggcagcgg aaacgtcggc cgtatcaaga cgctgctgcc     28260
     tgcaaccgag tctcgccgaa ttgcagtgtc gaccactccg aaggacaaca agctggtgaa     28320
     agcatgaccg cggccgcggc gtcctcccgt gaacgggagg tggtcggcgg ccccgaaccc     28380
     cgggagtatt tcagtgtccg cgccgcggcc aaacgctcac tgctgtggct tgtcaccgca     28440
     tggattccgc aatcctggct gaccgcactg atacacctga cccgtccagt aacccgctgg     28500
     ctgtgggcac gctggtggag ccggctactc atccgcctca tcgccggctg gcacgcggcc     28560
     ggcgccctct tgatgatcgt ggccaccccg gctctcgccg atcccgccgg cggcggcggt     28620
     gcgagcccgt tcttcgcctg gatgaatctg aaagattcgc acggcatcga cgcgtggagc     28680
     tatttcctgt ccatcgacaa aggcaacgcc tcagtgggcg gcggctggcg catgatctgg     28740
     gcgtacatca tcaccctcga atacgaggtc ttccgcttcc tgatggcaac ggccatctgg     28800
     ttcatcacct gggtgctctc gttcgaatgg ctcgacctga tcctcacacc cgtgcgcacc     28860
     atcgccgact cggtcaccac catcaccgac cagttcgcgc tgaccccgct gatgctcaca     28920
     gtcgccggac tcagcgtcgc catctggatc atccgcggcc gattctccac cggaatctac     28980
     gagctcctca tgtcctgcgt catcgcggcc gcggccgcgg gcgttctctc gaacccggtc     29040
     gatcgcgtcc tcggggacaa cggactggtg ctgtcggcgc gagatgccgg cctggaagtc     29100
     gcctccgggc tcgccaacgg cggtgatacc agcggaaacc cgcagaccga gatcgaaacg     29160
     atcgaatcga aactcatcga cacgttcatc cgccaaccaa cgcaactgat caacttcgga     29220
     gtcgttctcg atgccccgga aaacaacggg aaatgcgtca aagagttcga cgccgcgtac     29280
     ctcgcgaagc ccaaggagcc aggactcgca gacaaagcgc aggacgtcgt ctccgagatc     29340
     gcccctgggg caggcgtagc ccttgacctg atcaatcccg acgcgaaacc ggaagaccgc     29400
     gtcaaagatg ccatcgccaa atgtgagggg gaggacgggc cgatgaaggc ctatgccgac     29460
     aaccccggtc ccggacaagc gatgggcctg tttttcctga tcttcgccgg cgcactcctc     29520
     atggccttcg cgatctacct cgccggccga ttgatcatcg ccgcaggtgt ctcgatcggc     29580
     aatgccatca aatcgatacc aggagtcgtc ctcgccatcg caccctcgat gcgcgggcag     29640
     ttctggcgga ccatcgccaa cgtcgcaatg gcgttgctgc agatgatctt cgccatcgtc     29700
     ttcctcgtgg gatacgtcat ggtcgtcgag gatctcttcg ctgcagacga atcgaacctg     29760
     atccgcacgg tgttcttcgt cgacatcttc ctggtcaccg cacttctcct cttccgccga     29820
     gcggtcaagg gaatgaagcg aatgtcggac aacctggcaa caattctgac taaacggccc     29880
     aacgtcgcac cgaccgccat tagtcgctca acgcccacca cagcgcgcga cattgctgcg     29940
     atggccgcca acggacgcca catgtaccag ggcggaaagg ccgtggtgaa gggggcagga     30000
     gcactagcga agaagtccgg cactgccgcg gcaacgaccg gaaaagtcgc agccggagcc     30060
     acgtcgaccg cagcaaccgg cggggcagct gcagtgctgg ttgccggacg ggtcctctcc     30120
     tcgacggcga agcgagcgaa gaacaaggtc gactcgatcg ccgatcccga cagctacccg     30180
     aagtccacct caggcacggt cggtgcccag accagtcgtg gaaccgcggc tacgaacgct     30240
     gctgccgacg ctgtccggag tcgactgtcg aaaacggcgg tgtcggacaa ggccggcatc     30300
     aagcacccca tcggggtcgc cccgtcgttg ccggtcgcca accctggcca ggtccgcgcc     30360
     tcggccacca cgaccagtag ccctgacggt cgccgattcc gcgaattcac caccacatct     30420
     ggggcgccgg tgatgttgcc gactacaccg agccgcaccc cgcgaccagc cagacccgcc     30480
     tctcctgaaa caggggtccc caacggtgca gggtcgaaga ctgctcagct gctcgctgcc     30540
     gccgcgcagt ccggatccgc gccggtagtc acgccgagcg cactggctca ccgagctcgc     30600
     tgatggcgct cctcgacaca ccaccgtcga ccccggacgc acaggaaggc agctcgaaaa     30660
     agtggtggtg gctgctcgcc ggaatacccg ccttcgccat ggtcatcatg atggctccga     30720
     tactggtcat cctcgcgacg accggtagtg acacgaactg cggtcaacct gtgccagacg     30780
     ccgggggcgg cagcctcatg ggactcaagc ccggatccct cgcggtcccg atggccgaag     30840
     gcacctacac aatcagctca cccttcggta tgcgcgagac aggcatgcac gacggccagg     30900
     actacgcagc accactggac accccgttct acgccgccgg tgacggcgaa gtcatcgccg     30960
     ccgagcccgc cgccggctac ggacactgga ttcggatccg gcacaccatc gagggccaga     31020
     tcgtcgaatc cctgtacggg cacatgcagg cgtccggggt cctcgtccac accggagaca     31080
     aggtcacagc gggccaactg atcggcaagg tgggcagcga aggacagtcg agtggaccgc     31140
     atcttcactt cggcgtctac cccggaggct ggtcactggg cgggggagta gatcccattc     31200
     cgtggctcaa acaacaagga accatctcgc ccactcgagg accagcagag ctggtcgcac     31260
     ataccgattc caccggtgga gatctgccac cgctgcccgc cgacaaaggc agcgaagcgc     31320
     agatgcaggt cgactcgatc cgcgtcatgc gcacaatcgc ggcggccttc cccgagatca     31380
     ctaccatcgg cggttggcgc cccacggacg acgtcgccca ggaccacccc gccgggcgcg     31440
     cggtcgacat catgattccc gactccgcga gcgcccaagg gaaggcactc ggcgacaaga     31500
     tcgccctgta cctccaacag aacaaagcgg ccctcagcgt cgagtacgtg atctggcaac     31560
     agcgctactg ggacggcacc ggtgactggt cgctgatgga ggaccgtcac ggctacaccg     31620
     caaaccactt cgaccacgta cacgtcacac tcgagggcgg cgggatgccg accgccgact     31680
     cccactacgg cagcgctccg ggcggtacga ccaccacgga gccgtgcccg ccagaggtcg     31740
     gtgatcagac caggttcgcc cctggcagca tcccgccgca atacaccaac gcagtctcgg     31800
     ctgctgggtc tctgtgccca gaggtgagcc cggttctggt tgccggcatc gttcaacaag     31860
     agtccgggtt caacgaaaag gcggtcagca agggcgatgg cgtaaaccag ggcggcgccg     31920
     aaggaatgag tcagttcatg ccggagacct ggaaggcttt cggtacggat tccggtctag     31980
     atcgaagcgg aaaagcggaa ccaccgaacg ctgccgaccc gttcaatccg tatgacgcga     32040
     tcgcctcgga agggcgctat ctctgccaca tcgccgacta ccttcgaccg catcacgaca     32100
     gtggagccgt caagggcgac ttcaccgatc tgatcatcgc cgcctacaac ggcggggagg     32160
     gtgccgtcgt cacttacggc gggattccgc cattcggcca gacccaggca tacgtgccgg     32220
     ccgtgcgtga gcacatgaag aagttgacag cctgacaccc gccaggacgt tattgccaca     32280
     ccgagatcgt gcgcaaatgc cacccaccgc ccacgccgac ctacgtcgac tgcaccactg     32340
     acctacaggt tcccgcaggc caggaccgtt aatgggcctc cggtttgggg cagggtcgcg     32400
     ccccaccgct cggcgtgctc gcagcgaccg tattgagcct tactcggttt ccttcggatg     32460
     cccaggctcg catcgctcga gtagaactcg gccggcgttc ttcgcgcctt taggcgccgg     32520
     atcgacgaag aaccagatcc gcccaccgtc ggtcaccttg tactggtacc gagcgtaggt     32580
     tcgcccttgg tacgtcccgt aggcgtagtc gcccttgagc tgatacagcc gcgatgtctc     32640
     cactatcggt tctcgggtga gtgtgtccca tgcatcgacc gtggcgttgc gtgcggtcgc     32700
     cagcagatcg gtccagccct tcgcggcgtc acgcgtggcg aacacgagat gccattcgac     32760
     acgtttgatc ggacgaggga ccgggccatc cttcttgctc acgcgccgag atccggggct     32820
     tcgaccacct cgggttcatc gagatactcc aagtcggagc catcagctgt caaccgaggg     32880
     tcggcgtacg cctccgccgt ggccttccat gcttcgagca ggatcgcgag tcgatcgaag     32940
     cgggccacag cgatgcaggc acgcgccgtg gcctggaact cggcgacgaa ctccgcgtgc     33000
     aaggccgcag ggagtaaccc gatccacggc agtgtcacgg ccaggcgggt ggcgacacga     33060
     tcgagcgccg cctcatcgag ggaggcagcg aaaagctgcc cgacgacgcc gagggcgctc     33120
     aactccgcgc ggctcgccga ctcctgggtc aaccgcagag ctggagcatt ccggcgagtc     33180
     agaaccacct caccgctgtc ctcgaggacg ccaaggacat ccttgggtga cctcaaaaat     33240
     tcggagaatg tggccgtagt agtcgacttg ctcatacaca ccattacatc agaactagtt     33300
     cagatattcc aggtgccgtt gatcacgtag cctcctccga gcatgcctcc gcgccctaag     33360
     agagtcaccg ttggcaaatt cttcggccgc agcgtctcgg cgtccaagcc gcatgtggcg     33420
     tcggtgttcc tgcccgactt cctgccctac ttcgacaccg aggcgaccgc acacgtgggg     33480
     atcgagcggt ccgggcgatc cgaatccttt cgtcgtcgcc ggacaggctg aacttgtgcc     33540
     cgaccaacgg ggcgctcatc tgcgctgggt gcaacttacc gtccgcatcg ccggcagtgt     33600
     tctcgtcggc atcggctacc gcatcgttgt ggacgcccac cctgacatga tcagtcgata     33660
     gagcgcggtg gcactgctcg ttcgaagtac gttgccgccg aagacgaagg atattgcgca     33720
     ctgtcctgac cgcaccgagt tggtcggctt cggcgcggcc aaggctcagg agctcggtgt     33780
     cgaaatcgac tgacacaccc ttctcacgac tctcccgggg agtgaacggc cgacctgtta     33840
     gttgagagga gcaccacgga taagcccgta agtcaagcag tcttgatgtt gggacggcat     33900
     tgggacggtg ttgggacggt gttgggacgg gttcttgatc ggagtgcgag accagggaga     33960
     tcggcagcgt gggccacagt acggggacgt agccgaggct gaaggaacga tcaagacgcg     34020
     tgagagaggt tattgcctga gcggaataat tcccgtacgc gggggattcg ctccgatcca     34080
     tgctctcttc gttgcgctga tcggagcgta accaacgtgt caaggggtgg tggtgtaaat     34140
     cggggatttg tcctggctgt cggttctcgg tcgatctggc gcgtttctca cataggtggc     34200
     gcggcgttgg cgcagtttct cgcccgggtg gcgcatgcct cggtgctggg agagattgcg     34260
     cagttgagcc gtgccgatga cgagttcgag gcggtgttcg tctccgggtc cggggtggag     34320
     cgtcgggtgc cgtggcggtg gttgccggga ggtggtcgac gaactggaac ggccggtgag     34380
     gtcgttccta tcggttctca gctgatctgg cgggagttct cacacatgtg gcgaggctcc     34440
     tcatccgaag tggcggaagc ggtggaaccg cagttccacg tgttgcagtc gcgccgattc     34500
     gggtgcctct gtccccagaa tccgccagat cgcgtgagaa ggggttgatg acgacatgac     34560
     cgcgacaagt ggcgcaccgc agctcacggc agggcgccac cgccagatcg ctcaagaacc     34620
     gacactggct caatgaaggt ggcggaggat cactgaatct ggcgagtcgt gtcggctatc     34680
     tggcggacgg ctcagtggag ctgggagagt tggccgggcg agatcaccca gtatcacctg     34740
     gtgtagctgc gaatcggcga aaccttcatc tccatactta tttccgtact cgccaaattc     34800
     aatgagtcgc tcatcaaggc aacgacgcac cgagcctggc gaaccgctgg tcaggtccgc     34860
     cagattcatt gagtcaggac aggatttgtc ctgactcagt gcatctgatg atgccgactc     34920
     ggcgaatctg atgccgactc ggcgaatctg atgccggcgt cggtcaatct gatgcccggt     34980
     gtagtgaatc tgatgcggag ttccctggtc agcgctccga cagcgcgtgc tgccttatcg     35040
     agaggatcgc gacaacaggc cgccgttccg tgtgcatccg attggttaag ccacgcgcga     35100
     cgaggtcacg ccgccaatct gatgcatcgt agaacaggat cgttcccgca tcggtttcgt     35160
     tgagtcggga cacggcgatt gccgtaacag cattgcggtg gcgcaaggtc tggtcaatgg     35220
     gatgaggatg ggacgcctcc cagaggactc cgatatgagg cgatgagcgc acaacttcca     35280
     gatttggagc gagcacggac caggaaactt ggcagcgcgt gtcacacaag ctcccttacc     35340
     gggatcttcc tccgagtagg agagatcaat cagcggcgag gttgtgtgct cgctcgcgca     35400
     ggagggagca gcgtggaaat gcgaactgat cagcgatctg cgaacgcaag gttgccgcgg     35460
     caccgatcgg cagttggata cgccgagtca ggatcaggaa gtacgaattg gcgagcggaa     35520
     ggcgatcgcg gcgtcagtgc cggcacgctc gtaatctcct cgccgacttg tgacggcgag     35580
     gcctggcgat gacaacaaca cctccgcagc aaagtggtgc gcggttcgca cgctctcccc     35640
     gaatcagttc cttgccgccg cggccgcaca cctggctccg cgacagtttc tgcttgggaa     35700
     cgaccgcggt cggtgccagc gccgccgctc cgctgttcgg atacagcgcc ctcgcgatgc     35760
     ccgccgcggc gagcttgtcg atcgctgccc tctacgccgg attagccggc aaacgtaacc     35820
     agcttcgcga tgtcgacgtc gacgaagtga tcgaaagact gtgtccgatc gtggggctgc     35880
     cggaggccac ccgggcagtg ctgtcgacat cgaaatggag cagtggatgg ccgggacttc     35940
     cgaggaaact caccgtgcac tacgactcca cacaggcact gaatgacgag acgtggctcg     36000
     ctgatatctg cggggtcttc gaagatcaag ggtggggttt cttcgaactc gacaagcacg     36060
     accccgcccg ccggcgcctg atcttcacgc ccgctgccga gccggaacga gaagtttccg     36120
     acagcgacca ggttgtgcgc gcgaagagga tcatcgccca actgttgggc ccgaccgcga     36180
     ccgtaaccgt gatcgacgtc gccgccgaaa ccggcgaagt gacctcaatg gaagtacgtc     36240
     acgaacttgg tccgaaactg gaatcggatg gctaccggac ccgcgtcgaa cgaggaatga     36300
     gcgcgacatt gcccggtcgc tggcgagcac ggtggaacct tgaaacggat tgggttcgat     36360
     tcgagcaacg cacagcattc ccggacagtg tctggttgcc ggcaccggac ctcgaccccg     36420
     gtgccgacct catggccagc tacgactcgg tggaaattcc gtacggaatc gacgaagacg     36480
     gcaacgaggt tgtgtggcgg ccggcgatcg acccgaacct gatgctgatc ggcccacccg     36540
     gaagcggtaa gaccgtgacc gcacacaatc tgttggtcaa cttctcgcga cgtggatggc     36600
     cgatctgggt cctcgacggc aagtacgtcg aattcctggg attccaggac tggcccaacg     36660
     tacaagtcgt cgctacaacc atcgagcagc aagtggcgtt ggtccaccgc gcccgcgatc     36720
     tcatggagtt ccgctaccag aagatcgtta ccggcgaggc gacagaagcg gacttcgaac     36780
     cagtactggt ctttctcgac gaatgggccg agttccgcgg caacgtcgaa gattggtact     36840
     ccagggttaa accgaaaggt ggcgcccgac agccgccggt gctcaacatg ctcgcgtcga     36900
     tggcacgcaa ggcccgaacc tcgcgagtgc atctagtctt cggaactcag cgtcccgacg     36960
     cgcagtactt cctcggcgac atgcgtgaca acttcgccat gcgcatctcc atgggccggc     37020
     tctcaccaca aggggcactc atgatgtggc aatcaccgac gatcggtacc agcgtgcccc     37080
     gcaagtgccg cggccgcggc accaccgtca ccgacaacta tcagcccatc gagatccagt     37140
     gctaccgcgt acccgaccca cgcaagacgc gagccggcac cttcgagtcc gatctgctcg     37200
     acaccctccg acccccgata acacgccatc cacgattgct gatcgtccca ccggacgaac     37260
     ttccggacat cgacgccacc gacgacacgt cagaaccggc accgctgaca tacttcgact     37320
     acatcgaagc cgaatgggta ctggccaccg accgacccga cctcgatccg gtgctaagaa     37380
     gagcgaagat gacccacgaa accgatcggc gtctcgcgtc accgacggcg ctcctcgggc     37440
     tactcggggg ccgcgccgag cccaccaacg aagcagcggt agagctcgac gactaccgca     37500
     ccccgacagc cgccggcgcc accgatgccg cctcgttctt agaccagctc tctgctccac     37560
     aactcggtga atcctccgcc gctcgggcgg agtcctcacg cgctcgacta gccctggtca     37620
     aagagtcagc agcaaccgaa ccagagatac cggcggacgg cggagccgag gtcttcgaca     37680
     taccggagga ttcacctgac acctacgagg accagtacgg gccggtccgc gatgttcgcg     37740
     ccgccgatgt cgcactcggc gacctattgc tgatggagga catcgacgaa tgggtcgtcg     37800
     tagacaccga tcccgagccg gacatcatcg aagactcatt gctttcgctg acctggcgca     37860
     gcgacaccga tgagttcggc gacctcgcct tacctgacag ctcctacgta tcaattcgca     37920
     aacccatcca ggtatcgggc tgagctggca acgacgactg ctgtcgcgcc cgtcgcactc     37980
     agtatggctg gacactcgct cagcctccac ggataagacg aagcgccagg cgagaatgaa     38040
     ctgtgccgcc cattctgctc acccagttgc agccgaccga gcctccagct ccgccggaga     38100
     tcccggccga acctctgcca cctgctgaga ttccatcgtc cccgacgatc cccgtcacac     38160
     tcgaagactt gaagagcttc ctcgaagcgg catctccgac acccggattg ctgactcaac     38220
     catgggccac cctcctcgcg agccttgctg tcctcggatc cggatatctc gtatatagga     38280
     acggaaataa aacacgaaaa caggccgaga tacacttcgg aacctctcat gacctcgaag     38340
     tcactcgcag tctgcgtgac agatttacca ccatcgccgg ccaactcgcg gacccggcct     38400
     ccgccgttcg tactgctggc gtctacgcaa tggaagctct tgccaacgac tggctggcac     38460
     gcggggataa gtccgaggcg caagcttgca tcaacgtcct gtgcagctac gtccgcgcgc     38520
     cctacgcaca agcacagggg cgcggtcaga atcaaacgaa cagaataatc cgcatcagtc     38580
     ttacagaccg cgtcgtcgaa gaacactatg aataccgcca ggacgaccga gaagtacgtc     38640
     agagcatcat tcgcacgatc gctgctcact taaaagctaa tggtaagggc aactggagcg     38700
     atctcgactt cgacttcact ggcgcgcacc tcgacaacgc ggacttctct tacgcaattt     38760
     tcaacaaacc tgctcgcttc gaacgcgcac agttccttgg agcatctgcc cgatttgagc     38820
     atgcgacttt cacggcttca gccactttcg gtgaggctcg attctgcagc ggcctcacaa     38880
     tatttgacga tgcgaagttt cacggcccca ataacaaatt ctctggcgca aagttcggaa     38940
     gcaggtacaa cagattcgat cgagtcgagt tcacgggcgg catcacaaac ttcacggatt     39000
     gcgagttcga gggtgaggat acagccttcg atagcgctcg gttcgagagt aaaaacacgc     39060
     tgttcaccgg cgctaagctg ctcagcaaaa gaacatggtt cgtcgaagcc accttcgaga     39120
     gcgagatgac gtcgttcgat cgatcaacgt tcgatggaga agcagtctca tttgaccagg     39180
     ccaaatttcg aggaaagaat acgacgttca aaaatgcaga attttcgggc ggactcactg     39240
     atttcaatgc cgccgagttt cgcgcagaag cgacgcgctt cgggtatgcg aagttcaatg     39300
     gagatcaaac ttcgtttgat aaatcgacgt tcggtgacac aagggcaaag tttggtggta     39360
     cggagttcaa tagcgtgagt ggaaccacgt ttcatgaggc aagattcatt ggcggacgca     39420
     taactttcgg gtgggccatt ttcaacggcc ccgcatcgtt tgaacggccg gaagtgtggg     39480
     cgaacgtaga atttgactgg agtgcccaaa ttccatacga gatgagaaaa agaaagccgc     39540
     agaatgtttt gccggacgtc tggccccccg ctttgatgga ctcgcatggt gcggaggagg     39600
     aagaagagca ggactagcgt catcctcgcg cggcacacgt ggccccgccc aaccctgttg     39660
     tggaagtcga tgcacttttc ccaagggggg cggctggggt gaggatgcct cgcgcagaat     39720
     caaacgtact gcttgcagaa tctgcttgga caaactgctt gcagctctgc agtgagggga     39780
     cgatcgcggc ttcgggatac cgcgtgacct ggccgctgac ctttagctcg cgcaacgggc     39840
     ggttgcagct tcgaacggta gatgtgccgc gaggaatcga tgagacgtgc gacgacgtgg     39900
     actccggcgt gctccgatat cgtgactcca ctaatggctt tttgaggcgt gggcagaggc     39960
     ggtaaggaat cttgggaagg tcccggcgca gtcgaaagaa tggcgctgca caacaaccac     40020
     gcgcagggct ggcctcagaa cagttctctg agctgaacgc aaccttctat accggggatc     40080
     ccgctgagta cttgcgcatg cgtatcgagt cgttgtcact gacgctgtgt gacgactcgg     40140
     ccctagcgcc tgcgttcggc tctgcccgcc gtgtgggcat tgcggaattc ggcgcgatgc     40200
     agccgccgga cgaggatgcg cgagtccgct acgtcaggtc cgaagctgtt gtgatcctgc     40260
     atcactccgc ggaaacactc ctgaggatgt acttcgcgca cgtcgcttac cctcattgcc     40320
     cctgggtggg tatcgcgtcg tctcggacgc cgggtgagtt caaggacaag tgcctcaagg     40380
     tcgcacatca cggtgtgaag cgggacaacg tcgctacagt cttcatgggc ggcaccgacc     40440
     cgaggggtgc cgcagtacgc cttaccgacg accagttcga ggcgtcggtg gaggcgctga     40500
     ccagccttct tctcttttgc gctgagcgat tcttgtcgga gtccttcatc tacaacgctg     40560
     cgaagcacgg ctcgagcaca gtcaaccccg agcacccgct tcgaggttga acctccgggt     40620
     ggtggcgatc gtattccgat ttcgtcggga tcgatgctga cgtatctgca caaacccgag     40680
     cggcccgggt cacggtcggg cccagaatgg tttgtcagcg ccaccggcac tctcccggat     40740
     caggacttgg gtgtggctct gttgatccaa cgcgcggtct cctccctatg ggatgtcgcg     40800
     cgccgtcggt acaccggaca gtcgggcagc atcagcgtgt tctccccgac gatgattctg     40860
     gatacggtca acgggccagt gcagaactct ctcaacatag tccggacgat ttcattgagc     40920
     taccgaagaa gggcagcgat ggatccattt cggaagtgag agtgaacttc acccgtcagg     40980
     ctttggatga aggctgggat tcctccactc ctggctttcg accagtcaac cttgtacgcg     41040
     ttgatctatc ccgtcgacag agggatcttc cgccgatcac ggtcagcagg cagaatttgc     41100
     ttccgttctc accgaaaggc agtacacgag tctgacttcc cggtgggcgc gtcacggcat     41160
     tacaggctat atgatgacgc cgtcgcgggg gagaacctgt gcaggacagt cgcggacttg     41220
     tgggtggctg ccgcggcggc aaacaagcac gatcgagaga tatcacccgg ccgacttgcc     41280
     gatcgtagtc gcaacaccag ccaagaacgg tgagaccgat ggtatgaggt tgcccctcgg     41340
     gagtggacac cggatttcat gcggcgactg acagcgtaga cgacgcgatg agtcgttgtt     41400
     cgaactccac tggggtgagg tatccgaggg cggagtgacg gcgacgtcga ttgaagtacg     41460
     agagccactc gaacaggtcc agccgtgcct gcgacttcga cgtccaactc cgtccgtgca     41520
     gccactccct cttgagtcct tggaagaacg actcggcgag agcattatcg taactcgagc     41580
     cgacccgtcc tcgacttagc tgaatcccat gacggcggca tacatcgacg aaagctgctg     41640
     cggtgtactg ggcggattca accggtcgtc gcaacaccgt gccgtgagga cgagtgtacc     41700
     tgttcggcaa acacttccgc tggagttctc caaccgtgca cttttcgggg gcggttgttg     41760
     agcgcatcgg cgaccgcctg aagctcacgg aacttgtatc gggacagatc agttcccttc     41820
     ggaaaatatt gtcgcagcag cccattggtg ttctcattcg ttccgcgctg ccatggactg     41880
     tacggatcac agaagtagac acggataccc gtagatgccg tcagctcggc atgacgcgcg     41940
     agttcctttc cgcgatccca cgtcacggat ctgcgtagat gctcgggcag cggtgacagc     42000
     gtcgcggcca gagcatcacg aacggactcc gaaccatatc cggacagcgc cggcccgttc     42060
     ttcaccatcg ccgctgttcc atagcccttc agtcgcggca ggtgtagtag agtcgtgtat     42120
     ctgctggtgc gctcgacgag cgtgccgatc gcggaccggg tcagaccgat gatgaggtcg     42180
     ccctcccaat gccccggcgt cttccggctc tcgacctcct ccggacgggc gctgatggtc     42240
     acctcctcgg tgataaatcc ggtgcgctgc ttccgtgctc gcgcacgagg ctttcgcagc     42300
     gcccggccgg tgcgcaagca cgcgacgagc tcccgctcca ggccgccgcg accctcgatg     42360
     tagagcgatt ggtagatcgc ctcaggtgaa atgcgcatcg tcgggtcctc cggatagtcg     42420
     atcggtaggc gattcgagat ctgctccgga ctccacgccg tcgcccaccg acgatcaccg     42480
     cgccgaggct tgtttcggcc aatccaagcg gcatccggac cggacaccac ggttccatcg     42540
     tcggcacgaa tcacaccaga cagtttgtcc tgcacatatt ctcgtagccg atcgtgttcg     42600
     gcgagcttcg ctggttttgg gcgcctcgcg gcgaggtcgg ccttccactg tgcggtcgac     42660
     gctcggtatg tgagcttgcc attgcgggtg gcggcgttcc gccgcaactc ccgcgagatc     42720
     gtcgacggtg accgtccgat ccggtcagcg atgtcgcgca tactcatacc cttggctcgc     42780
     agcagcgcga tatcctcacg ctcggtgaac gacaggtacc tccccgagac cggggtcaac     42840
     tcgatcggtg gcatcccacc agcctggcgg aaccaccgtg tccccaccgg ccccgacacg     42900
     ccgcatgtgg tcgctgcgtc gtcgctcgtg agaccctcgg cgatccgcgt ccagaatgcc     42960
     cgctctagat ctcggcgtat cggaggccgt cccggtgacc gcatcaccgc acgccccgtc     43020
     aacgctgctg cccacccggg tggtcgtccc attcccacac ctccgttatc gaggtgttgc     43080
     ttccaccggt tgagcctggt ctgtgatccg cggtcgctgt ggaagataac gccaccgacg     43140
     tcaccaccgc gggtgcgcac cgccatctcg atcgcgtccg tgacgagatc ggtgcgcatg     43200
     tggtcagcga tcgaccagcc caccacccgg cgtgagaaga tgtcgatcac cgtggccatt     43260
     atgtggaatc aggattgtca agttcatcag ggttctccgt gtcggacttg cacgatcggc     43320
     agcagggtca cggtcgggga cgtaccgatc tctcgtgggg tgggcccggc gggtgtaggg     43380
     aggtcggtga ggcgctcgag cagcgccgcg acggcggtgt gtccgtcatc gacggcggcg     43440
     cgttcgtcgt cggtgagcgg gatgctggtg agcatgcgtt gtaggttgcc gctggcctcg     43500
     agtagctggg ctttgctgga gtctttcggc gtgtagaagt cgcagcgtgc gcaggccatc     43560
     cggtgctggc actgctcgaa aaaggtgtag ctgcaccagc cgtggccgag gtcgtagtgc     43620
     tgccagggtt ggccggtggc ggcgccgccg gaggtgacgg cgtcgcggtc gacgagcact     43680
     tcgatggtgc gtacgttgcg ggcgaagtag ccggcttcgt tgtaggcctt ggacagcgtg     43740
     ttcggggtga ttttcgcgta gtgctgggtg gtgttcgggg tgcggtggcc gagccaggcc     43800
     tgcagctcga acagtgtcat cggttccttg gcgttgtaga gctgggtcgc gatcgtggag     43860
     cgggcccggt gactggtgat gttgccgcgg acgtcgctgc tcggaacacc ggccttggcg     43920
     cagagcgcgg gaatgatcgt gcggttgatg tagttctttg cgaccgggtg cgcgcggaag     43980
     gcgaagagca tgtccacctg ttcgctggtc ttgcggtcga gtgtcttcgg ctgaggcggg     44040
     cgcagggctt gccaggcctc gagcgcctgt cccagaaggg gatcgacggg tttcgtgaac     44100
     gcggtgccgg tcttgtggac ggggacctcc agcaggcaga cggcgtcctc agcgagcacg     44160
     tcgggtgagt cggcagcaat gggctgaccg tcgtgttgcc aacgcacgca gccaactcgc     44220
     agccgcgata gctcgtcgct gcgcagtccg ccgaagagcc aggtcagtgt gatcgcccgg     44280
     atcagctcca ttgggtagta ggtgtgggcg gaattgccgg gcaggtcact cgagtcgaga     44340
     ttgagcccgg cccagagcag cttcgcccac acatcgtcgg caatgacacg cgggttggtg     44400
     ccgatcagtg cggacacgct gcggggcagt gcgagtgccc gggccgggtc gaagcgacga     44460
     tcgatccatt cccactcctg gcagtcgcgg aagaaggtgc gggtggccat gagaatgtgg     44520
     gctttggtgc gtggggagat cgggtctccg gtgcgggcgc ggaggtggtc gcggcgttgg     44580
     acgtagtcgc cgacggtcat gcggtccacg gccgcgaccc aggcggcgct ggtctggcgg     44640
     gtccattgcc cgggttcggt gatctcggga tgttcggcgg cgagccaccg cccggccttg     44700
     gccaggatgg tgcggatggt cctgcggacc cgcggggtga gcgtggaggt gtcgtgccaa     44760
     cgggcgaccc agttggccca gctgtcggtg gtgccttcga tgacggcgta ggggttgtct     44820
     ccggtgcgca ccggcgggtc gcagtgtccg agtgcggcga cggcacgttg gagcgcgtag     44880
     agcatctcgc cttggtgatc gttggtggct gggtgcacgc gcagccggtc gaatgccgcg     44940
     gtatccagat cctcgagcct ggaactgcgg ttgatcagca gggcctggct gagccccccg     45000
     cgcagtcggt gtttgccgat aaagacgccg cggtaccccc actggtccag gaccgcgctg     45060
     gcctggcgca tcgactcctc gatcgcctcg gcgccgaaga cgaggcgggc caggtgcagc     45120
     cggttgaatg tgcccaatag ttggaaggcg tcgaagctgc cgagcagata ggccagagcg     45180
     acgaggaagg gacgcacggt ggtctcggta ggcagttccc tggccgcgac gaaggcctcg     45240
     gcgctcgaac cacacagctg cgcccagtcc tcgctcgtcc acgcccagta ggaccggccg     45300
     gtgtccgcgc agttctgcaa gatgatagcg gccgcgtgcg ccccggcccg ccgaaaccgg     45360
     gcgtcatcgc catgatgcaa cccggcccgc gcggtgtcga gcggctcgac gagccgcacc     45420
     agcgccgtcc agtgggtcgc ggtccggcgt gggattcccc gcgctctatt gcggcgcaac     45480
     gccttcgggc tcaaatcgcg cagtgctcgg cgctccgcat cggtcagctc ctcccggcga     45540
     tcgtagcgtt cgagggacac cggaaacgtc gacgccggcc acgtggcatc cgcctcgccg     45600
     acggcacgaa ccgcggcggt cacgccggac ccgtcccgtc gggtgcggtg agcatgctga     45660
     tgcgctgcgc atgcaggtgc gtcattgcac gattcagctt ctccgcaaga tcccgacccg     45720
     acaggtgaat ataggtcagc gtcgactcgg tggaacggtg cccggcgaag gttgcgatcg     45780
     catgcagctc ccagcccatt cgcgccaggt cggtcagaca caggtgtcgg gtggtatgcg     45840
     tagagaactg cggaacatca gcagccaacg cgactcgccg caccaccttc gaccagctcc     45900
     acaagctcag cggctcaccg aaattgcgcc gtgactcgga caagaacagc ggcccccggg     45960
     cgcggctgat cccggcccgg tgggcgaggt agcccgacag cagcaccccg gtcgccgcag     46020
     agtacggcac cacccgccct cgacgggtct tggtcgtctc cggccgcacc cgcagcatgc     46080
     ggtgcgcggg atcgagatcg tcggtacgga gcgagcacag ctcttcacgg cgcagcgccg     46140
     agtcgtaggc cagcgccagc atcagccggt tacggatcgg ctcgagccgg aaaacgtcga     46200
     gcagctgcaa ccactcggcc tcgccgggga tccacggcaa cttgaccatc cgcgggacga     46260
     gcggccgggg ctgcccaccg aagtgccggc ccggcgtgta acgcccgcga ccgaccgggt     46320
     tggactcgcg gaccccctcc tcgaccagga agtcgtagaa caaccgcacc ggaaccagtc     46380
     gctgctgcag cgtcgcgttc gccagacccg aacccgagtc caacgcgaca acattggtac     46440
     cgcgccgact cggtcgagtc cgcaagtccc ttacaaacaa ggcgatttgg gcccgggtcg     46500
     cgacaaccgg atcgacgcct tcacgctcgc agacgagcag gtactcggcc aggccgcgag     46560
     cgtacgcatc gatcgtgcga ggcgcccgcc ccagatcggt ccagatctgc aaccactcgg     46620
     ccgcccgctc gtgccggcac aggaccggcc acttctcttc caagatcatc gacacagtca     46680
     acagggcccc tcagctcgtg gtgacaccgc gggacgaaca accgaccccc ggcgtgattc     46740
     cacgtaacta ataagaacaa ccacgaggat cccaccggga tgtaggttat gtccccacac     46800
     cacttggtat cgacagccgt agcggtgaag tctcgcatca ccagatccgg caccgacgga     46860
     gccgacttgt ccgcgacggt cgtgcgcttg ctgcggcgca ggtgcctgcc caccacgtgg     46920
     tggattcgca tcagccgggt cacccgtttg cggttgatct tgcgtccgcg ggagcggagt     46980
     tcggcgtgaa cccgcggggc accgtaggcg ctccggtgct cggcatgaat ggcgcggatc     47040
     tcggcgaccg tcgcggcttc ctcggcctgg cgctcgactc gggccggctc cgtgatcagg     47100
     tgcttgtagt agccggaacg ggaggtcccg agcacccggc acagccgctg cacgccgaac     47160
     tcggcgcgat ggtcggagat gaagtcccag cggcgggtct tcacttcacc tcctttgcga     47220
     aatacgcggc cgcccggcgc agaatctcgc gttcgagctg ccattccttt tccgcaccgc     47280
     gcagccgcgc attctccgcg cgcagccgcg cgagctcgtc cgcctcggtc ccgtcggcgc     47340
     cggtactgcg gtcctgcgag cgcgcgttac gggcggtgtc cttgcggacc cacgtccgta     47400
     gcgtttcgcc actgacgccc acatccgcgg ccaccgccgc gtacgtgcgt ttgccgtcgg     47460
     ccgcgcgata caacgcgacc gcgtctttcc ggaattcctc cgtgtacaga gactggcgtc     47520
     ccacctcgac atccctcctg gctctcctag aaccattgtc cggggtgtcc actcaaaggg     47580
     tgcagcctca ggtacgaccg gacggtcggt gaagatccca cgcaggcaag tggcagcggt     47640
     caaggacggg atgcttcgac ggcgcattga agggggtacc ggttgttctg ataccccttc     47700
     acttctctac atctcggcgt acgcgccccc tgaatccctg gactgaagaa gctttcctct     47760
     ccattccggg atgaataacg gccaatagat aattgacctc cacgttagtt ggagcctgat     47820
     gccccactct cgggttccct cgcccgatcc acgatctcgt tgagatggca ttgctcttca     47880
     ctggggccgc tgtagcggaa aggaaagttc gggttttccc tttggttttt cagcacatcg     47940
     atctgctgct gtgcgcaatt cgttacggct ggagtaggag gaggagattc gcccaccaaa     48000
     gtgaaaatcc ccgcaacaat tgctgatgcg aacaggaacg cgccagttat tacggcgatt     48060
     gacccaggtc ggtcaatgga agacgttagg gcggggttcg gttgaggggg tgctggttgt     48120
     tggtgtaaga cgatgttggg tggggtgttg ttcagaaaaa accgtccgat agccgcctgg     48180
     atttcggcat ccgatgttgt caactactcg gcctattgcg aggagcgggt gagtcaagct     48240
     ggtcaaacgt aagcgcagct tcgcgcgaaa gttgcttgac tgcgtcctcg tatcgataac     48300
     gcacgcgtgg gaattgatat acgacataga taactagggc tatagctcct ataagagtaa     48360
     gcgccatagt cgaaaggcta agtggcgact gttggagcgt ggtccacttc agcgcgatga     48420
     tcgtcaggtc aatgaccaat gttgcgattg ccatgccaag gcctagacgg agtttcgcac     48480
     gggacgcgtg gaagcgagag cggagctcct tggagagtcc gttgacgctg tctttgtaga     48540
     tctcctgcat ctcgcggatc tgccacacct cacgatccat gtcgggatca tacttgtcgg     48600
     accggatgct tcggggcgga tctgagacag ggtgaactct agaacgccag tacctcggct     48660
     tcatgcgaac tcgcgacacg acacactacc gtcgactcga ccggcttcgc cgccgggtcc     48720
     ttgcggaccc acgtccgtag cgtttcgcca ctgacgccca catccgcggc caccgccgcg     48780
     tacgtgcgtt tgccgtcggc cgcgcgatac aacgcgaccg cgtctttccg gaattcctcc     48840
     gtgtacagag actggcgtcc cacctcgaca tccctcctgg ctctcctaga accattgtcc     48900
     ggggtgtcca ctcaaagggt gcagcctcag gtacgaccgg acggtcggtg aagatcccac     48960
     gcaggcaagt ggcagcggtc aaggacggga tgcttcgacg gcgcattgaa gggggtaccg     49020
     gttgttctga taccccttca cttctctaca tctcggcgta cgcgccccct gaatccctgg     49080
     actgaagaag ctttcctctc cattccggga tgaataacgg ccaatagata attgacctcc     49140
     acgttagttg gagcctgatg ccccactctc gggttccctc gcccgatcca cgatctcgtt     49200
     gagatggcat tgctcttcac tggggccgct gtagcggaaa ggaaagttcg ggttttccct     49260
     ttggtttttc agcacatcga tctgctgctg tgcgcaattc gttacggctg gagtaggagg     49320
     aggagattcg cccaccaaag tgaaaatccc cgcaacaatt gctgatgcga acaggaacgc     49380
     gccagttatt acggcgattg acccaggtcg gtcaatggaa gacgttaggg cggggttcgg     49440
     ttgagggggt gctggttgtt ggtgtaagac gatgttgggt ggggtgttgt tcagaaaaaa     49500
     ccgtccgata gccgcctgga tttcggcatc cgatgttgtc aactactcgg cctattgcga     49560
     ggagcgggtg agtcaagctg gtcaaacgta agcgcagctt cgcgcgaaag ttgcttgact     49620
     gcgtcctcgt atcgataacg cacgcgtggg aattgatata cgacatagat aactagggct     49680
     atagctccta taagagtaag cgccatagtc gaaaggctaa gtggcgactg ttggagcgtg     49740
     gtccacttca gcgcgatgat cgtcaggtca atgaccaatg ttgcgattgc catgccaagg     49800
     cctagacgga gtttcgcacg ggacgcgtgg aagcgagagc ggagctcctt ggagagtccg     49860
     ttgacgctgt ctttgtagat ctcctgcatc tcgcggatct gccacacctc acgatccatg     49920
     tcgggatcat acttgtcgga ccggatgctt cggggcggat ctgagacagg gtgaactcta     49980
     gaacgccagt acctcggctt catgcgaact cgcgacacga cacactaccg tcgactcgac     50040
     cggcttcgcc gccggttggc aggtggtggc gcggcagtcg tacggcactg ccgatgcacc     50100
     ggccatccac tgacgaggaa tcaccccgaa agaaccactg gacagcagat atctgcccgg     50160
     tgttctcgcc cgagagagta cggggagcag cgtccggcgc cgtctcggat gcgtggcacg     50220
     ggacttgttc aaaaagaacg ccgcagtctg tcacacaagc ctcttcgaac ggatcttcct     50280
     ccagatagaa gcccacttca ggaggagatc ccatgcaccc cagtcaacct cagcagccca     50340
     tcaagccagc acggaatgca gcaggcctgt ccgacgagga ccaactgtct ctgttgatgg     50400
     cggccccatt gattctgggc ctccttgtcg cggctcttcc ggcgatgtcg accaaggcga     50460
     ctgcgtggct gctcgctcac gatctcatcg ttggggcttc ggcgtcaccg ttggtgacta     50520
     tccctggcac ggaaggtgcc ggcctcgacc tccgccggtt gatcatcgtc gtggcagttc     50580
     ttgtgctcgc tgcgactctg gctctcagcg gagtgcggcg ctccatcgat cgtcgccgac     50640
     agcagcggtt gcgccgcggg gacagtgcat gagcacaggg gtgattgttg ccgagctatc     50700
     gagaaggaag cggtcgattc cgtgcgcgga tgaatgcgtc acggattgtc cgttcttcca     50760
     ggcgcagagc ctcagcgagt gctgtggtat gtcgatcgga caggcttcct tcgccccgct     50820
     cgattcggcc gatggtggtg gtgctgagtc cggttcggtc tgcgacgtgt ttctgcgtca     50880
     atcccgcaag attccgcagg tcggcgatgg tccgactgtc ttccgggacg acgacgaggc     50940
     ggtcgagggg tattcccagc ttttcggcgg cccgggcgag gtggtcgggc tgagggtgcg     51000
     ttcgcgaggt ttcccagttg tggatggtgg tcgggtcgac gcctattgcg cgggacaggt     51060
     cgccgcgcgt gattccggca gtagtgcgcg cgtcttcgag ggcctgaggc ttgaagccgt     51120
     tcaggggcgc tctcactgcg attttccgtt catcgctgga catcctattg aagatgtaga     51180
     taccatcgtt gcatgccggg tttaaattcc agtggtaaat gcgatgcggt gcagcgctga     51240
     cgatcactcg ctgaactcga acccggtgcg ctcgagtacg aacagttccc acgtacatgc     51300
     ggcctgacca gccgctaaac ggaaaagagc atccgatgac gactaccgtt tcagctgccc     51360
     cacccttgtc ccagacttct gcgcatcgac gcgacgcacg ctcgtccgta tgcgccgctc     51420
     agctagctag actgaatgca gccggattcc ccgcccggtc tgctttgccc agtcgcgacg     51480
     acgggtggtt ccagacatcg cgacagtcgg gtttaggggg acgtgacggg caggcttgga     51540
     cacctgcccg tcgcgtcgat acatctgtcg acacggttga tgtgcgctac cacatcaacg     51600
     ccctgatgtg cgccggcatg acgaccgctc tgatcgctga cctggcctct gtgccggtcg     51660
     cgacaatccg gtcgctgagg agcacttcga ctcgcacgac cacctccgtc atcgcggacg     51720
     cgatcctctc gatcactttt cgcccgagcc gtgggcgtga tctgacccca gcagtggggg     51780
     ctcgccgccg actgcgcgca ctcaacgcca tgggctacgg cgattcgagc ctcgctcacc     51840
     ggttgaacgt cgaggtcgac gtcgtcactt cgatgccgga aaaaggtctc atcccgagcg     51900
     agctgtggga agcggtcgac gagatctacg acgagctttc catgcgcccc ggacctgacg     51960
     ccgacctccg tgaacaagca cgcgcagaag gactggtgcc gcctctcgga tgggacgacg     52020
     acgagatcga caatccgaag gcgcgtagtc acgagcgcga gcgggccacg ggagcggtcg     52080
     cggtcgacga ggtcgtcatc gttcgtcgcc tgagcggcga acaagtcccc atgcgcaact     52140
     gcgaacgacg agaaatcatt cggatggcct acgagcagtg ctggtcaccg agcctcctcg     52200
     cggacaagct cgccatcaag tacgactcgg ccgtgacgga gctgagccgg taccgccgag     52260
     ctctcatcca gacggatgtc tccggttccg atgatccctc cacggcggag acgccgacca     52320
     cgaccgacgc gcctacgggg gagcgtggaa agggcgagac tgccgcagtc gctgccacgg     52380
     ccgatcacgc aaccgatttt gactctccgc gagaagcagc agctacgtcg gatgccgccg     52440
     agtcacagtc gcccgccggc tccagggtga acgcgccggc gcgggcttcc tccaaccgag     52500
     tgagtgcgat caggcgccgc tggaccggcg ccttcacggc aagcgcacag ttccacgatg     52560
     caacgatcga ctgtgctcgt tcagcgccgg aaggtggggt gccagggagc tggccgatag     52620
     cccggcgctc gaagctatgg cggccggcct gccggttggg ttcaacgaga gccgtaggtg     52680
     ccgagcagaa ttggcctgac tcagatgagc gatggcggct gtcgtcgggg tggccctctt     52740
     cgcgtcaacg atggcatcgc ctcgccgaac aggcatcggc accccgaccc ggtcgaccag     52800
     gcaggccttg tgccagttcg ctgatacctg ttgacgccgg cgaccgtgtg aggcattgct     52860
     gtgcactcca gatcgcgacc cttttgaagg agaccagacc cgatggccct catagaaatc     52920
     cccgaggact tccacgcggc gttcattgcg gccgcccacg acgcgaacga tcacaacgac     52980
     cttgacctcg ccattgacga ggaccgcaca tacatcgccc tcagcaacct ctgccccgga     53040
     ttcgtcccgg ctcttcggct catcacccgc ggtgagcatg aagccacggt tgaaatctgg     53100
     tccatcgtcg accaccaacg agacgacggc agctgggagc gcaccgaggg ggttgatgcc     53160
     accactgcgg tcgacctcgc cgatccaacc gacgctgcca tgcgcgccgt cgagtgctgg     53220
     ttgacaacgc tctgacctcg gtgggactcg gtcgtgcacg ctccgcagtg cggcgtttgg     53280
     caattaccac aacaggtttc aaccctgcgc ttgatcctca cgtcccactc gcgggacacg     53340
     gagacgggaa acgatcatgc atgagtcatt ttcttccgct ctcaacgaga tgtcggtcgc     53400
     cgatgcagtg atgcagctgg cgtccggaac cgttgaactc gcgctcgaag acgcgcacga     53460
     gttcgctcgc tggtgctggt tcgccgacgt gctcgactca ggctggggct tgaccggcag     53520
     gctcccggcc gccggcgatg atgtattcca cgcacttgag cgcgtcgccg gtatgtgccg     53580
     aacatcggaa acgaaggcgc tcagccccga tgcgtggcgc gcggcgtacg aggccacgga     53640
     gagattggcc cacagctcgg ccgtaaccag ttcagaggcc acctatctgg cactttcggc     53700
     ggcgaacgac atcgcactcg aatgcatcga cgaaacgcac cccgagttca cagtcgcgat     53760
     agcgctggca ttcgagtccc tcgccgcctg tgcggcggac tccgcggtag cgcgatgctg     53820
     gatcgcccgc gctctgaccg aatggacgaa ccgaacgcac ccagtcgcgg gcggcccgcg     53880
     aacgggagaa gccccaccga tcacggacac tcggcagaac gcgtcgatac tctccgcagg     53940
     ttgtggcgag agggtcttgt tgagagtgag cggcaacctc tgaaaggggc accggcaaca     54000
     gcgctccttg agactcgcct gggtgcggca tgtgctggtc cggttgtctg ggtggtcggt     54060
     gccaccggct ttggtgttgc ggatgtggtc tacctcggtg gctggttgtc cgcatgtggt     54120
     gcaggttttg ttgtcgcgtt cgaggatggt tcggcggagt ctgcgccatg cggcggtgct     54180
     ggttcggggg tcgcctgagc cccagttgtg tgtcatgcgt tgtccttcgg gttggggcat     54240
     ctctcagccc tcggggagta acggcggtca ctccgtcagc gatagtcagg caggtcggga     54300
     ggaccaggag acagtcatga tcggcaatgt gttcgacata ccagtgttcg gtgacccgat     54360
     ctggcctccg ggtgtttggt acgtcaactt cgccaactgg tttaaccagc tctgaggggc     54420
     catcatgaac accctgtggc tgtggccctg gaacatcgtt gaaatcggta ccagactgct     54480
     gttcagccag atcggtggtg gttcgtaatg ttcgggctac ttactgatat ggccgattgg     54540
     ttcagcctgc acgtcttgac gccgactcag cacctatggc agccattgtt gcaagcatgg     54600
     atggactggc ggtactgaca tgatcggcaa cctgcctgac tacaactggt tctatccagg     54660
     tctcggtgga atcagcgtgt tcatgttctg gttcttcgac gacgtgaatc gccccgggtt     54720
     ctacggaggc tcggctatct ggttccggcc tcagcgagga ccggtgtctc acggtagtcg     54780
     gccgccgtgt gattcgacca gtaggcggtc tcgtactctg cgggtgggac gtggtcgatc     54840
     tcgccgtgca agcggcggtg attgaaccag tcgatgtact cggcgaccgc ccactcgacg     54900
     tctccaaggc ctcgccagcc cccgtgcggg cgcatcacgg gattgcgaat gcactcggcc     54960
     ttgaacaacg agttgaacgc ctccgccatc gcgttgtcat acgaatctcc cttggaacca     55020
     acagaagaca ctgcgtcaca ctcgtcgagg cgctcggtgt atcgcaccgc tcgatactga     55080
     ccaggctcaa ccggtggaag caacacctcg ataacggagg tgtgggaatg ggacgaccac     55140
     ccgggtgggc agcagcgttg acggggcgtg cggtgatgcg gtcaccggga cggcctccga     55200
     tacgccgaga tctagagcgg gcattctgga cgcggatcgc cgagggtctc acgagcgacg     55260
     acgcagcgac cacatgcggc gtgtcggggc cggtggggac acggtggttc cgccaggctg     55320
     gtgggatgcc accgatcgag ttgaccccgg tctcggggag gtacctgtcg ttcaccgagc     55380
     gtgaggatat cgcgctgctg cgagccaagg gtatgagtat gcgcgacatc gctgaccgga     55440
     tcggacggtc accgtcgacg atctcgcggg agttgcggcg gaacgccgcc acccgcaatg     55500
     gcaagctcac ataccgagcg tcgaccgcac agtggaaggc cgacctcgcc gcgaggcgcc     55560
     caaaaccagc gaagctcgcc gaacacgatc ggctacgaga atatgtgcag gacaaactgt     55620
     ctggtgtgat tcgtgccgac gatggaaccg tggtgtccgg tccggatgcc gcttggattg     55680
     gccgaaacaa gcctcggcgc ggtgatcgtc ggtgggcgac ggcgtggagt ccggagcaga     55740
     tctcgaatcg cctaccgatc gactatccgg aggacccgac gatgcgcatt tcacctgagg     55800
     cgatctacca atcgctctac atcgagggtc gcggcggcct ggagcgggag ctcgtcgcgt     55860
     gcttgcgcac cggccgggcg ctgcgaaagc ctcgtgcgcg agcacggaag cagcgcaccg     55920
     gatttatcac cgaggaggtg accatcagcg cccgtccgga ggaggtcgag agccggaaga     55980
     cgccggggca ttgggagggc gacctcatca tcggtctgac ccggtccgcg atcggcacgc     56040
     tcgtcgagcg caccagcaga tacacgactc tactacacct gccgcgactg aagggctatg     56100
     gaacagcggc gatggtgaag aacgggccgg cgctgtccgg atatggttcg gagtccgttc     56160
     gtgatgctct ggccgcgacg ctgtcaccgc tgcccgagca tctacgcaga tccgtgacgt     56220
     gggatcgcgg aaaggaactc gcgcgtcatg ccgagctgac ggcatctacg ggtatccgtg     56280
     tctacttctg tgatccgtac agtccatggc agcgcggaac gaatgagaac accaatgggc     56340
     tgctgcgaca atattttccg aagggaactg atctgtcccg atacaagttc cgtgagcttc     56400
     aggcggtcgc cgatgcgctc aacaaccgcc cccgaaaagt gcacggttgg agaactccag     56460
     cggaagtgtt tgccgaacag gtacactcgt cctcacggca cggtgttgcg acgaccggtt     56520
     gaatccgccc tgcacgccgc ggtcgctatg gtgaatcaat ccggcgacgt cctggccgac     56580
     ccgtcggcga gcccacaacc ccatatccaa ggcgtcgagg gccaggtcgg tacgcatcga     56640
     cgtcgaaacc tgccaaccga cgatcatccg ggagaacacg tcgaggatga acgcggcgta     56700
     cacccacccc gaatgagtgc gaatgtaggt caggtccgcc acccacaacg tgttgggcgc     56760
     gtcggcgacg aactgccgct ggacccgatc cgccggccgc ggagtctcgg ccccgtcagc     56820
     gtgcgtggtc ttccgccctt tcaaccgtaa tattccccgt aacccatcgg ctttcatcaa     56880
     tcgttccacg gtgcaccggg ccactgacat cccttctcgt ttcagactgg cgtgcacttt     56940
     gcgggccccg tacaccccga gattgtcggc atgaacaccc cggatccggg acagaacctc     57000
     gcggtcacgc accgcacgtg ccgattcggt tcgctggggg ctcaggtgag ctcggaccgt     57060
     ggacggagcg atctgggcgg ccgtaccgcg caagaccgcg cagatcggat cgactccgtg     57120
     ttcgtcgcgg tgagcagcga cgaactccac gatcagcgct gtgggcggtc gatctccgcc     57180
     gcaaagaaag ccgaggcctg cttgaggatc gtgttcgccc gccgcagctc gcgattctcc     57240
     cgttccaact gggcaatccg ttcggcatca ctggtagtgg tgcccgggcg cacgccgccg     57300
     tcgacctcgg cctgcttgac ccaggtcctg agcgcctcgg gatgcacacc gagctgatcg     57360
     gcgatccgct tgagcgctcc cggccgcgtc gccggatcct ggcgggcctc gaccgccatc     57420
     ctcgttgctc gttccttcag ctcaacgctg tacttccgtg gtgctgccat gctctccatc     57480
     cttcacaggt ttgagagcct ccgacagacc cggggcgatt caacgtgtgg aacccgctat     57540
     gaccggcaac tttcctgact tgttctacat gatggggcta ttccttacgt ggaagcgtgg     57600
     aacaacttcg ccctctggtt caatcagttc taggagaaat catgatcggc atcgtgttcg     57660
     atcttccagg gttctttgac gtcggtgact attggacacg caccgttcaa tggaacatgt     57720
     tcgcccagtg gtggaatcag ttttgacccg tcgagcgggc accacctcgc ttggaagtga     57780
     tgcccgccca cgtcgtggcg ctgctaaccg gctctgctcg gaaaggtgag cgtcgtggtc     57840
     agtgcatggt tccgtccggt gtccggtgac tttgacgccc tgtcagttgg tctgtggtca     57900
     gtcctcgtta gcgaccttgt acgggttcac gtgcacgtca gggacgaacc cctcagcctc     57960
     gctcattcgt cctgagcggc ccggtgtgat cgacgcatcc gacccgggga tagtcacctc     58020
     accctaggat cggctacgtg ccgacagtga caacgcccga cgccgacatt ttttacaccg     58080
     acagtggggg agaggggccc gtacttttac tcgggcacgg gttcttcatg gactcatcca     58140
     tgttcacgcc ccaggttcgc gatctatctc cggacctccg ggttgtgagt tgggatgcgc     58200
     gccgccacgg aaagaccacc gatgcgggta tgccgttcac atactgggac ctcgcacgcg     58260
     acgccctcgc cgtcctcgac gacctcggcg tcgagaaggc aatcatcggg ggcatgtccc     58320
     agggcggcta taccgcgctg cgcacagcac ttctcgcacc ggggcgtacg agggctctga     58380
     tcttgctcga cacggaagcc tcagcctgta ctcctgagca gaagtccgga taccgcgtcc     58440
     tgttcgatca gtggtgcagc acagagccat tcgaaccgct caccagcgca cttgcccccc     58500
     aactgatcgg tggagaacct gcggattgga cgtcgtggat cagcaaatgg aacagcggag     58560
     atcgcatggc tgtccgacca gccgcagagt gccttatcga acgcgacgac atcgtggacc     58620
     gactctccga cattgacgtt ccggcattga tcatccgtgg ggaaaatgac ctgtcagcgc     58680
     ccgcagagaa ggccgacgag ctcaaagcag gtcttcccgg tgctgcgcca gttgtcacga     58740
     tcccggttgc tggccatgcc gcaaactgga cacacccaga gccggtcaac gcggcgatca     58800
     ctgcgttcgt caaggcgctc cgctagttca ggaggcgggg aggcgcactc cgaggtacat     58860
     ctgcagcgga tacttgcccc gcatctccgc gtggacctgc acgtgcacgc tatagtgctc     58920
     accagtctcg gcgtcgcgga ggtgcatgaa cggctggtgc cggccaaacc ggacttcttc     58980
     gcgtaaccac agttcgcgga agagagggaa ctcgctcaac tcttcgaggg tttccaccgc     59040
     ccagtcgggg ttgtagtagc gacccatcaa cgctcggaac cagctgacgg tcaaggcggc     59100
     ttccgcctcc cactccacca tgaccgtcat tgatgccgga gtcgagaaga accagcgcaa     59160
     cacgtttccc tcgtcgacca gtccagggaa cgccttgtcg tacgccgagt tacagtcgat     59220
     gacattccag cgttcgtcga ggtacgccac caggtgcggg ttcagcgccg cgatggcggt     59280
     ctccatgtcc ggtgtaatca gtgtccgata gtcggcgatc gtccacggtg tcgtgatgtc     59340
     ctcacgctcg gtctgggtcc gccgtgccag attgaaaagg tgccgacgtt ctgcatcatc     59400
     gagacacagt gcgttggcgg tggcgtcgag aaccggtgga gaaggactcg cgtccttaac     59460
     gtttccttcc agccgcgcga tgtagctgac actcaaatag ttctcttcgc ccagttgggc     59520
     ccgagtcata ccatccgggt gcttcggcgt tgcccgggtg cgccgagcac gaatgaaatc     59580
     accgagactc ggcggactga tcgagtccat tggttggcct ttccgatagc gaatacagcg     59640
     gcactaccct actcccgggg aatgtcaagc cttgtaggta acactcttga gtgttacccc     59700
     cctgctggac aacgcagttc ccgacctgat ggaatgtttt cccagaagac tcacagctgc     59760
     gtggcaggca gacgagtgcg ggtcgacagt cgcgccgagg gggagggccc aggcgggttg     59820
     cggaggggaa agcgtttatg ccacgtgcag cacaatgggg ttcacgtgtg cgatcgacgg     59880
     ggacggtgct cggcgttcgg ctactcgtgc tcgacgtggc acggcacgga tcgctaggcg     59940
     tgctgaggcg atggtcgagc caagcagaga cgcctaaaac ggtccgcagg catgtttact     60000
     atgaccattt caaacccgac tgcctatata gggcaataga agtagtcgga caacggcatg     60060
     ccgcgcagtt tgcccaacgc cggatagtcg gaaccgtcgt ctccggcacc cgaggtcggg     60120
     atatcgccgg acacacaggt tttcatgcac ataccggcga aaacgtagcg gcgtgcacaa     60180
     ctgccatggc gagcaacacg gtcgccgccc caccgaaatc cgccacgcaa cgcagctggt     60240
     tcacgcgccc agcggcgccc tcacacgcac cggaccagtc gcaccggatg gcgtcaccag     60300
     tccgttggag ctttgcaggt gacgtggtcg cagcgaacgt gtccaggtac ctctctactg     60360
     ttcgccatac gaaagtctcc gatacgtcca cacgtccact gtgaaggacc accacatggc     60420
     atccctgctg accaagaaaa tcgacaagct ccgctcgtcc ggggatgacc tgcccccggc     60480
     tcacaacgaa gcagatcagg acgacccacc cgatctgaat acccgcgcgc gcgtccgacg     60540
     acgccccatc tacctggcaa tcggtgtcgc actcgtcgtg gtggcagtga tcggcatgct     60600
     caccgcggtc aacgcgatgc gcgcaaccac cgatgtgctc gtcctgacga acgaagtgca     60660
     gcaaggcgag accatcgagt ccaaggactt ggccgccaaa tcggtcaacg tcgatgccga     60720
     tctcggtgcg ctgcccgcca gcgaacgcgg ccgcgtcgta ggaatgagtg ccagcacccg     60780
     gttgccggcc ggcaccgtcc tgctcccgtc cgcgatcacc gatcaggttg tccccgggga     60840
     aggcctcacg atggtcggca tcacggtgag ctacagccac ctcccctccg agccgatcgt     60900
     ccccggcgac atggtccgtg tcgtggacac accacgcgac caggacgacc cgcccgtaca     60960
     gggcccgatc aacacgaagg cgcaggtgta ctccaccaaa gagatccccg aagccggcga     61020
     gacaacgctc aacctgctcg tgcccgaggc agaggccaac tgggtcgccg cccgcggcgc     61080
     aaccaagcgt gtcgcgatcg tcctcgacaa ccgagtgcgg tgatcggcga tgtttctcgc     61140
     actaacatcc gcctcacgct cacccggtgt gagcaccacg gcgctcgccc tggccctgaa     61200
     ctcaccgacc gaccggactc tgctcgtaga agcggatgcc atcgggtcct cgccggtcct     61260
     ggccggatac atgctcggaa accactatca cgatcgttcc ttgatcaatc tcgtcgacgc     61320
     gaatcgtcac gggcgcctca aggctgctct ggccgagcaa ctcatccaga tcccggaatc     61380
     gtcggtgtca ttgctcccgg ggctggtcca ctccgcccag gcagatgcga tgcggcccgt     61440
     gtggggaccg ttgggtgtcc acctggccgg attgagcgtc gacgacacca acgtgatcgt     61500
     cgacgccggc cggatcgggc aacgcggcgc tccagtcgaa ctgatcgtca acgcgacaac     61560
     gatcgcaatc gtcacccgca ctgagcgaac ggcaatcgca gcgttacgcg cctcgcagaa     61620
     cgccctgcga cagcagctct ccgcggtgca atcacgggca agtctggggc tgatcctgat     61680
     cggtgagtcc ccctacaacg cagaagaagt cacgaaagtc accggacttg acgtcatcgc     61740
     agtcctgccc gactccgatg acgccaaggt cttctcggac gggttgtcca tcagcaaatg     61800
     gcgccgtcgc cgctcgatct acctgcacac cctccaccgc agtacctggc cgaagatcac     61860
     caaattcgcg gtgagccatc aggcggactg gaagtccggt cccacgctca atgcggcgct     61920
     gccgacactg acaggagaac gtcgatgaac tccgacgacg cgactcagcc tccgcagaac     61980
     aagatcacgg aacttccctt cttctcagcc ccgatcccgg acgccgacct cgcaggtggg     62040
     ggccgcagtt ccatatcgga aatcacgctc cccgacaccg atccgttgcg atcgcttcgc     62100
     ctacacgaac tgccaccggc cagcaccaaa gggcacagcg gcactgcgcg acggtccgtg     62160
     ccgccggccg cgaaggtcaa ggtcgatcgc gccctggtcc gcgctctgca gaaagaagct     62220
     gcggaactgt tgcgtgacta ccggtcagcg cgtgaccgcg agcgccacga cccgaagaac     62280
     gccggcaaat acttcgcccc gttcaccgag gaggaagaac gcgagttcgg ccgtgagacg     62340
     atcaccggcc tggtcaagaa ccacgtccag aagaccatca actccggcgg cgaagccttc     62400
     acaatcgtcg aagaagaagc cctgatcaag gccatcttcg acgcgcagtt caacctgggc     62460
     ccgctgcagg aactcgtcga agagccgcac gtcaccgaca tcttcctcaa cggcgcggcc     62520
     gtctacgtca agttccccga cggacactat gaacaccgcg acccagtggt cgacaccccc     62580
     gaggaactcc tcgagtggat gggactgctg gcctcacgcg ccgacaacgg cggccggcca     62640
     ttctcccggc tcaatccgtc actgcgtctg acaatgcgcg gaggccaccg actgtcggtc     62700
     atgggctact cggtcaaacg accctcggtg gcaatccgca tccaccgcct caagaacatc     62760
     gccctcgatc agctcgccat cgaacatcgg atgatgccga tcgagctcgc gaccatcctc     62820
     tcgtgcgcgg tccgcggcgg tgcctcggtg gtcaccggcg gcggaatggg cttcggaaaa     62880
     acgaccttca cgcgtgcact ggccaatgcg cttcctctgc agacgcgaat cggaatcgcg     62940
     gaaaccgaac gagaactctt catcgacgaa ctgccaggcc gcgaggattt cgtggtcgac     63000
     gccgagacaa tcctcggcgg cggagaacgc ggtgcagacg gcgagctcgc cggcagctac     63060
     accctctcgg acatcctgta cgagttcgtg cgacagcagc tcgactacat gatcgtcggt     63120
     gaggtcgccg gtcacgagat cctcgctctt ctcaaggcac tgcagacggc cagaggaggg     63180
     ctatccacga cccacgcgta caccgctcgc ggtgtcgtcg accgtctggt gaacctggcg     63240
     accgaacccc cgatgaacgc gacggtcgac tacgtcgaac gccagctcgc agagcacatc     63300
     gacctgatcg tccaactcgg cacgaaggtc cgcgtcgatg gcgaagggtc gcgcacctcg     63360
     gtccgctacg tcgacgaagt cgtctacgtc gagcccggcg acgacaagaa gccgtccttc     63420
     tccacgatct accggggata ctcggacggc acaggagaat tcggatccat tccacaacct     63480
     ctgctccgca agctgctcgc cggcggattc aagcgaatcc acctccccag cgacagcctc     63540
     cgccacttcg acgaagaacg cgacctctac gacgatgaag aggtggcgtg atgtatcagc     63600
     aaatcggcat cttcctggta ctgctgctgt gcgccggggt cgcctgcatc gtcatgggat     63660
     ggaaagaccg ccgcgatccc accgcgccca cgcgtcagcg ccggcgccgc agctcgtcga     63720
     agatcccgcg tagcacccag atcctgctcg tcgtcggctt cgccgccggc atcgtcgtgt     63780
     cgtccctctc gggttggctc ttcaccctct ttctggtccc ggcgctgctg gtcggcttgc     63840
     cgtacctgct cggccgtccc gaagcagaac agcagatcag tcggctggcg gccatggatg     63900
     agtgggcccg caacctgtcc agcagcatga aggctggttc gggaatcgag cacaccatca     63960
     tctccactcc gatcccggag gcgctacgtg aggagatcac cgcgttcatc agccgcctgc     64020
     gcaacaacgt ccctccggtg gatgcgatca cacgtttcgc ttcggacctc aacgacagtg     64080
     tcggcgacaa gatctgcggc gccttgctac tgagcatgca actgcggggc gttggacttg     64140
     cagccgtgct cgaaggcctc gccgaagacg tcggtgacat ggtcgcgcgc cgacgccgca     64200
     ccgaggccga ccgcaaatcc agccgtacac aggcgaaatg ggtcaccatc atcgcgatca     64260
     caacactcgc ggcagcgttc ctgttcacca acttcatgga accgtacaag tcgggcggaa     64320
     tgcagatcgt gctactgatc ctgctgaccc tgttcgcggc cgacctgtac tggatgaagc     64380
     aggccaccaa accgccgacc tacccccgct ttatcggcac caatgatcgc gtcaaccgca     64440
     ccgacctcgt aggagcgcag cgatgagcat tcagatgacg gtcatcctct acacgagcgt     64500
     cggaacaatc ggcatctacc tggtcgccct ctacttcatg cgcgcacaac ccgcactcag     64560
     cgatgccatg tcgcgcctgt ccggaccggc cccggagcgc acgtcgacag ccggaacctc     64620
     cctgatcgac gggatggcga acaaactcgg catccgggtc cacccctacc tgcaggacag     64680
     caaattcttc acgctcccca acgccgatct cgccctgctg caccgagatc ccgcccacgt     64740
     actcggggag aagctcgtcg cagcactgct cggactgctc atcttcccct tcctcaacct     64800
     cgttctgact gcattcgggg tcggcctggg atggtccatc ccggccatcc tgtcgattgc     64860
     gaccgccttc ctgctcttcc tcatccccga catcgagatc cgacgccggg caaccgcggc     64920
     acgagcggaa ttcgcgcagg cgctgagctc ctacatcgat ctcgtcgcgc tgtgccgacg     64980
     cggtggcatc ggcaccaccc agagcctcga gcgcgctgcg caggtgggag attcatgggt     65040
     gttcctgcgc ctcgacgagg aactgtacga agccgggcgc tccggcgaag ccccgtggaa     65100
     tgccctgaca cgcgtctccc atgagctcgg cctgaccgag ctgggcgacc tggccgacat     65160
     catgaacatg accggagaca aaggcgcatc cgtctacgca tcactgcggg caaaggccgc     65220
     gggcctgcga tccgctcagg ccagcgcaga acagggtgcg gcagcggagg ccaccgaaaa     65280
     gctggctatg ccgctggccg gacttgccgg cttgttcatc atgctgctgc tcatcccggc     65340
     actgaccatc atcaccggct agtccgattc gatggcgcgc agccagcgcc gcgaaaggag     65400
     cgagacgccc agaccaccga gcctggccgg tcacgatcat ccagtccagc tcacctgcta     65460
     cacatcgacc aaacacaagg agcccaccat gagcatcacc accgtcgcta ccgccacccg     65520
     gcgcaccgcc cgcgaggccg tgacctccta catcaccctc acgatgatgt tcgtcgccgc     65580
     actggcaggc accctcctcc accgcgccgg cggcaaagac tcagaccgcg gaccctccac     65640
     cctcgagtac gtcttcctcg ccgtcctggt tgtcggcgcc gccgccgcag ccggtgcgat     65700
     cgtcgtccgc aagatcatgt cccgcgcaaa cgcaatcccc gactgaaatc agacagcgct     65760
     gcatcgattg gagagacggt gagtacgtga catacctcgt gagggtcttc caggccgctg     65820
     cgatggtggc agtcgctgcg gtgcttgtgc agctcggaat cgattcctgg ccgtggccgt     65880
     atatccctat tccgtcctga aaagccagcc gtccaacaac tatcggaaag cagaccatgg     65940
     tcacactgga acagttgatc gaccgatggc gccgcgatga ccgaggcccg gcgacgctcg     66000
     tgacggtcat cgcgatggtc gcattccttc tgatcttttc ggtcctgctg caaaccgctc     66060
     tgttcttcca cggccgtgac gtcgccaaca gctgcgccga aaaggcactg aagaacacga     66120
     gatcccagta cggcaaccaa gcgctcggaa cagctgccgc ttatgcctgc atcgcccagg     66180
     caggaaccgg tgacctgcag atcccggttg tcctcgtcag caagaacatc cgcgaaacaa     66240
     ccgtcaacat caccggaaaa gccccttccc tcgtcccggg tctcgaattc cccatcgtcg     66300
     tcaaccacac caaaccgact gaacgcgtca ccaacccggg aggaatcgga tgagaggcac     66360
     ccgatggata tcccgcgccc gccgagatga ccggggcgac gtcacgatcg agctgtgcct     66420
     cgcaaccgtc atcctgatct tgctcctggg ctggatgtat gcgtacggcg tcaaccgaca     66480
     ggcgcaccag aaggttgaac acgccgccac cgagggtgcc cgtgcagcct cactcgcccg     66540
     caccatcgcc acggccaccc cgctggcgta ccaagcagcg gccggcagca tggacggaca     66600
     aggcctcaag tgcgccacca tgaacgtcaa cgccgatacc agcggattcc gcaccagacc     66660
     tggtgtcccc gccacggtcg aggtcacagt gacctgccag gtctccttcg acgcacttgg     66720
     atggcccgga gtcaatggtg cccgcaccgt caccgctacc gcaatctcgc cgatcgatac     66780
     ctaccgggag cgcacccgat gaccaacgcc ctgcgtaagc gactcgcctc ccgactgccg     66840
     gcggagcacc gcgacaaggg tgccgtcacc ctgatgacgg tggtcttcgc ccctgtcctg     66900
     atcttcttcg tctggggact gatcgtcgac ggtggcggca tgctcaccgc cgaccagcga     66960
     gccgacaacg tcgccgagga tgctgcccga gcagccggtc agcagatcat cggatcggtg     67020
     agcgcccgcg gcatcggcac ggtcgtcgac ccggtccgcg cgaccgcagc cgccaagaga     67080
     tacctgttcg aggccggcgt cgacggtgac gtgatcccca ccggcccgcg caccctcctg     67140
     atcacgaccc gcatcgtcta caactcgaaa cttctgccat accccagaac gaaactgctc     67200
     atcggtacgg ccgctgtgaa tctcaaccgc accaacgccg gggaggtgta cattctgtga     67260
     gcgcaaacgc cgcgcggtca cgccttgccg gactcggcta cctcctgatc ctggtgatgc     67320
     ttgtcgccgg gatcccggcc gcgctctggg cgctgcgcgg caatccgctc gacataccgt     67380
     ggtcggattt cgaaggtttg ctcgcgagtc cagatgacgg cagtcttctc atcgcccttc     67440
     ttccccttgt tggctgggct gcttgggcca ccttcaccgt accgattctg ctcgaactcg     67500
     cggcgacact gcgtggcgtc aaaacgccga agctgcgcct tcttcgctca caacagcgga     67560
     cggcgacgtt cctcgtcagc ggcgccctct tgctcctgac cgccggaacc gccaccgccg     67620
     cacccgtcct gacccagcct gcggacgtgg gaagcacgtc tccgtacgcg ccgcactcgc     67680
     agcaggaaga tccgagcgcg ttaccgcaga cgcaggtgga tccgcgggct acccgggtgg     67740
     cggtacaacc ggcggggccg acagtgacga ccgtgcgggg agacaccctg tggggattag     67800
     cccagcagca tctcggagag ggccgccgct acgccgagat cctggacctc aaccggactg     67860
     ctgtccccga gccagggttt ctggccgaag ggttgaccct gcagctgccc gcatcccagc     67920
     tcgaggtggt acgcggcgcc tatacggtca agcagggcga caccctgtgg gatatcgccg     67980
     agcgagagct cggcgatcct ttgcgtttca aggagatcac gactcccgac ggcaccccgg     68040
     ctggcgagct gatcacggtc ggccagcaat tgatcatgcc caccgccgcc tccgcggcgg     68100
     ctgacgctac gccggcgccg gccttggtgc cgccggctga tgctgttccg gctccggctc     68160
     cggctcccgc tccggctccg gaagctgttc cggctcccgc tcccgctccg gaagctgttc     68220
     cggctcccgc tccggctccc gctccggctc ccgctccggc gcccgcgcct gtggatgtcg     68280
     cccccaactg gcaactcgac cccgtcgagc ctcaaatgcc tgccgacctc gtcaccaatg     68340
     acgcgccggc agagaccgat accgaggacg gctcatccga cgtcgtgttc atcggtctcg     68400
     gaatctcagc ggttgctgca gctggactca ccgggcacct cgctcttcgt cgccgcaagc     68460
     aacaacatcg ccgccgccgc ggcgagcgca tcgcccttcc cgccgaaacc gcgatccagg     68520
     cggagcaagc actcacggcc gccgctgatc cgctcaccac cacccatgtc gacatcgcat     68580
     tgcggcacct cgcgcaccac tgcaggtcca cgggtatcgc tctgccgggc ctgctggcgg     68640
     tcttcgtcgg tgacaacgac atcgacctcg gactcgtcga acaggtctca ctccccgcgc     68700
     cttggacaca gatcgacgac accacctggt cagtagatcc gagagcgttt ccgcgcggcg     68760
     ttcccgaggc cgagatcagt ccgtacccgg cgctgacggc agtcggaacc agcgacgacg     68820
     gtcgcgacct cttgctcaac ctcgaacaga tcggccacct cgccatcagc ggcaccccga     68880
     ctgcaacagc cggggtgctg cgtgcgctcg ccgtcgagct cgcagtctcg cccatcgccg     68940
     acagcctcca cctcaacctc gtcggatact gcgccgacct gccggaggca atcgacaacg     69000
     gccgcatcac ccactccgag gacgccgaca cggtactgac gacactcgcc aatcacgtca     69060
     aactcgactc cgaaatcctc gcggacaacg acttcgagtc aatcgcgcag gcacgcacgt     69120
     cgtacaccac cagcgagctg accgcacccg agatcgttct gatcgccgat ccggtgaccg     69180
     aggcacaggc cgggctactc gccggcatcg cacggcacgc accccgaatc gcgttcgccg     69240
     cagtgaccac cgagagcgca cataccaacg ccaaatggac cctcgaggtc gacgacaacg     69300
     gctcggccgt ccttgctcgt ccaggaatcg cgtcggccgg catcacagtg accaccctcg     69360
     atgaggagag ctacgcgtct gtcctagacc tactgaccac cacctcacgc gaacctcgcg     69420
     ttgcccacaa gggcgataac cttgacattc gatgggaagc agcccgtctc gacaacgaca     69480
     tctcgaccga cgagttcatc accagctccg atcccgcaac cttcagcgtg gtcgggaacg     69540
     aggacctcga ccatgccgtc gaccgaccag agccgtccga ttcggatgag gtcaccgcag     69600
     aaggcgagct gccggaggcg gatcacatct ggatcaggct gctcggcgta cccgccgtca     69660
     cacccccgtc accagggccg gccgaaggcc gagagaagag cctgaccgaa atcgccgcgc     69720
     ttctcatcac cactgatggc ggagtcctcg ccgcggacat cgacagcaaa atctggcccc     69780
     atgacgtcga agccgccaga accggcacag ccgagcagga gaaagaagcg aaggcccggc     69840
     tccgccggcg ccgcaacgaa gcgctctctc gcctgcgtaa gtggctcggt gacaccgaga     69900
     ccggtgaacc cgccctcatc aagtccggag atcgaaccgg tcggaccccg caacggctcc     69960
     acgacgccgt cacgaccgac tgggactact gggaggaact cgtcaattcc catcccgctg     70020
     acgtcgacat cgcccggcta tccgcagcac tagctctggt caccggtcaa cctttcagta     70080
     gcgatgaccc caccgcctac gggtgggccg accacaccaa gcaggacatg atctccgccg     70140
     ttaccgacgt cgccgaggag ctcgccaccc gctacatccg cggccaacaa gttccccagg     70200
     acctcgcggc tgcacacgcc gccgcggaga cgggcctcga ggtcgacata gtccacgaag     70260
     ggtgctggcg tgcggcgatc atcgccaccc acttttcggg tgacaccgag atcacccaaa     70320
     ggttgatcga tcgcatgatc accgagctcg acgcccttga agaagagccc gaacacgaaa     70380
     ccaagatgct cttgagtcag ctcgactcca cctacgggag ccactaccgg atcggagcag     70440
     catcatgacg cgccgcatcg ccgcactggc gacactcact gctgcgatgt gcctgacagc     70500
     cagctgcagc atcctgaccc cagaaccggt catcctcgaa accaacgccg gacccacgtt     70560
     caccgggccg cccggctccg gaaagtcccc cgagcaacag gccggtgaag ccgcactggt     70620
     gaaggtcaac gagtactaca cggtgctcgc gcgtctgagt gccgatcccg ccgccaaccc     70680
     cgcagatctc gacaatgtcg cggccggcaa cttccttcaa tcgacgaagc gggacatcac     70740
     cgcgcatcgc atcgaggcgg acgcaggcga ggtcaaggtt ctcaagaaca ccatcacccg     70800
     ccacaacatc ccgatcgacg aaaacggcat ccctacgccc ggcaccgcga ccatcgagat     70860
     ggacgtctgc ctcgcccgcg ctaccgacgt tctcgagctc gggaagccga tcctgacgaa     70920
     cgccgcttgg cccgacccag caggatggag agtcacagcc gactacacac tgcccggtac     70980
     gccctgcaat gccggacttt tctaggagat acgactatgg cacacaccac catccgccga     71040
     accgccgtcg ctgccttggc tgcgacggcc ctattggtcg gcgtgaccgc ctgctccgac     71100
     accgacgcgg cggatccggc ggtagagctc actgtcaccg gtgacccggc gttcgagggt     71160
     cccgacgggg cggacacgtc gaacaagact cctgacgagt tggcacggga acaggcgctt     71220
     gcgaaggtca atgactttta cgctgtcgtg ggcaagcttg atggcgatgc cgctgcgccg     71280
     attgagcagc tcgacaccgt tgccggtggt cccgtgctgg atagctggcg gggagatatc     71340
     accctgcgtc gatcgcagaa cgtggtcgga gcgggcgacg tcaaggttgt cgatgcgaag     71400
     atcaccgacg ccggcatacc tgtaggcgac gacggcaagg ctatctccgg gcccgcctgg     71460
     gtccacgtgc gcgcctgcac cgacatctcc ggtatgacct ggacgaagtc agacggtagt     71520
     cccgcctacg acgtcaaccg gccgcagttt gtgctcgccc agttgaccgt ccggaatgcg     71580
     gattggcccg atgcaaacgg ctggcgagtc accagcgatg cagctgcccg atacgcgccg     71640
     tgtgatgcac cataaccaag gagaacacat gccaaatcgt cgtcgttttc atgcggccgt     71700
     gatcggcgcg ctcgttctgg ggagcctggt tgcgtcgcca cactcagcgc ttggacaacc     71760
     cggcttcggt tctggaggaa tagacgtcgc tcccggttcc ggaaatctgg gtgcgaacat     71820
     tgtcgttcaa ggcagctacg tccaggtacc ttcggcgtcg cctggctccg gcggctcctc     71880
     aggggcgagt gcagcgggga cgggcggcgg tgggtctgga tacagcggtg gtggtgacgt     71940
     cgtggccgct cctacgggac ctccggttcg ggagcagttg aaggcgtgcg gccgattcac     72000
     ggactgcgtt ccgctgagtc cggatgtggg tatgccggcc accccggtga gcatggcgca     72060
     ggtcatgaat gtggtgggaa cagccgtgac cgggatgcag cttgaggagc cgccgatgtg     72120
     ctggaccccc gaacctgcca acttccctgg tgggagaacc ggtttggtcg gaaagaacgc     72180
     gtgggcgtgg gtttgcccgg atcagatccg ggagagcacc gtcggtcccg tgacacgggt     72240
     cgtccctggt ccgggaggcg tcgtggtgac cgccacagct gtcaactcga gtgtcacgat     72300
     caactggggg gacgggtccc tcccgacaat ctgcccgggc gcgcttctac cgttcacccc     72360
     gtacaacgac ctgatcgacg ccagtccgct gaccccaccg agtggattgc catccccgac     72420
     atgcggtcac cacatcgaga agacatcgat cacgcagccc ggcggcgtga acaacgtatc     72480
     ggcgacggcg gcctggattg tgaactggac agcagtatgg ccaggtggcg gagcaggtgg     72540
     agtcgtgcct gttccgttga cctccaacta ccaacagcga atcggtgagc tacaggtgct     72600
     ggttacgccc aattgattcg acgtggactc cgttcgatgt tggtgcggcg tcggtccggt     72660
     cagaaactca gtggcgctgg acgcgcagga ctgagtcccc ggatcgatgc cctcgcgtcg     72720
     ctgcggtgtc gacgtcgcga gctgtgcaat gagccgtgaa gtagctcaga tcaggaagtg     72780
     gtgctgctgc tggagtttga ttgccaaatt gagtgagggt gtgatggaga agcccactgc     72840
     tacgttctgg ctcgctaacg aggagacgag ttgttgtctc ctgcggaaac caacagaacg     72900
     gagaacagca tgaccgtaga gcaggcggtt acgaccactt ccgcaaccaa gccggtgagc     72960
     acccttgcgc agaaggtcac ggccgtcgcg gccgtcgcga tcgccttgtt gatcgtgctc     73020
     ggcggctttc tcattgggac aatggtcttc accgcggcgg agggcgttga tcgaacgatc     73080
     tcgaacctgg cagatgtaga cgacccacga gttgtacgac aggcgatctg cctgccgtac     73140
     tccgatttcg ttcttcggca acatcaggca ggcctgtcta catcgcagat ccaaggcgtg     73200
     ctggattatg ccggacacga cggagagggc agcgcagtcg acaactcgga tgtctgcggc     73260
     agcccgcaat ctattctcga cgcggcgggg atcaagtagg tagtcagacg gcaggctgcc     73320
     ccacggcact tccacaggcg ttcaacttgg ggagtacgta gccacccgcg ctgatgagta     73380
     tcgaagacgc ccgccaccag tctttatggt ggggggcatg cgtcgagcga tcgacgaacc     73440
     gctagagtta ttggtgttct ggtgatcatc cccccaattt tgttcccaga acccccctct     73500
     gccccggcgt caaccgatgc cggggcacat tcattgcagt gaggacggat cgagggtgac     73560
     ggagacgagg ccagggcgga tccccgtggg cgatcccatt gcactgcgct tcgatccaga     73620
     gcccaagcgc aagctcgagg acatggccga ggggatcggc ccccgtcgat tcggggcgtt     73680
     gattcgtgtt gcctgccgac gactggtcac ccagcccaaa gctgtcggca ctggcctcgc     73740
     cgaacagcga cggctttcgg aagcgctgcg ggcaatcccg ctggtcatgc tcaagattaa     73800
     gctggagccg gacacagccc aggagttcgc ggcgctggcc gccgcgtatg acactacggt     73860
     cagcgcgctg atgaggatcg cgctgcaccg attcctgcaa gcgcctggcc gctacaagca     73920
     tccgatgctc cgcgaggccg agcggacagg tttgtccgac tgggtcgacg tgatggtcaa     73980
     cccgtccagc aagcagcaga tctggcgact cgccggccga tacggggaca agctcaacac     74040
     gtccttgctc cgggtcgcac tacgacgcct gctcgaggag cccggtgacc tcgccggaga     74100
     cctggaaacc atcgcgccgc tgcgcgatct caggcccgaa atctacgcca gggcgaatgt     74160
     gcacttcgac gagcctctgc gcgacaagct cgacgggttg gctgcacggg tcgggtccga     74220
     tcgcgctgag ctgatgcgcc ttgccgcgag acgggtgctc gaggaacccg gaaagatcga     74280
     acaagcagtg aacaacgagg tcttccgcag cgagaagaac cggaagcacc tcatggccag     74340
     gcacgctcgc cgccaggcgc gacgccacac gcagcccgac tgatcaccgc ggacaacctt     74400
     ctgttcccga cgctaagtca cctgcggtgc tcccatgatt ggaaaccctc gcaagaatgc     74460
     tgcgttcggt ggccggcttt cgtgcccaca cgagggtggt ggtcaccagt ctgcgaagag     74520
     gttgtagagc gcatggctcg cgattgaggg gagcagcgac tttgtccaga tggcgagggc     74580
     tccccagaga aggccggcga ccaccatgag tgctgcgttc aaggcggaga aggtgtcgtg     74640
     tccgatgccg aattcatagc caaggaaaat ccaaagaatg gcgatcagga tgcgagctgc     74700
     ccattttggc cagccgctgc gaaagtatct gcgggcaaag acgaccgcag cgacaagtgg     74760
     tcctcggaac atgagttctt cagtgacgac cccggacatc agcgtcagac cagggatgtg     74820
     gccggcccaa cccgacgttg accaggtgga cctatcagcg tccgcggcac gttgcgcagg     74880
     tgattggtcc gttcctgctg tcgcgaccac gaggtcggaa atcgggcctc tcagcagtgc     74940
     cgtcactgcc agggtgacga ttgtgacagc aaggagcatc acgatagtcc gaggctgtgg     75000
     aagtgcgcag ccgatgctgc gtgctgccca gcgggcccgg gcgaccgtgg cacggacgcc     75060
     atgggaggaa cccaacagag caagcatgca gagcaggaac acgccccaga tgatggcaag     75120
     aacaagaagg ccgagtccga ccgcgttccc ttcttgagcg gatatggtcg gtacgcccgc     75180
     aaaaaagatg aggaatgtga ctgtaaggaa ttaatgtgcc gattcgggtg tgtcgccctc     75240
     tcgtggtggt atggcggcga ggagggcggc ggcggtgcgg tagcggatgg ttgccggtgc     75300
     cggggtgtag ccgtcctgtt cgagcagtgg ccgcacgtcg agcagggcat tgccgatggt     75360
     gcgggggctg acctggaaca gttcggccag gacggcgcgg ttgcagagct ggcgtatatg     75420
     cagaacggtg gccaggacgc gttcggcatc ggtgatcttc tggaggaaga ttccgccgcg     75480
     gccccctggc atgcgttcgc cgccgcgttg ggcgtagcgg cgtcgctcga ccatggcggc     75540
     ttgccggacg gcgaggcgtt cgacgaggtc gcccagttgc cggcgactca tgccggtcag     75600
     agccggatgc gacagtgcct cggggagcgg ccgattcggt gtcgggtcgg gtgccgtgcc     75660
     gtcacggaga aatcccgcga ggtctgcagc ggtgctgaag cgcagcccga tggtcggggt     75720
     gacgtgatgg ccgtgttcgt cgagcagcat ccgcgtttcg gcgatgattt cgccgatgga     75780
     gttcggattc accccgagca gatccgacag cacccgctga gggcagacct gccgcagata     75840
     cacgacggtg atcagcaggg ccgcggcgtc cgacagcagc cgtcgcccgc cggcacccgg     75900
     ggcattgcgg cgccggccgc cgcgttggtg ccagcggcgt tgctcggcgc gcgcggcctg     75960
     ggccggtgcc agccgtgcgg tgagttcgtc cagctcgtcg cccgtcatgc cggtcagacg     76020
     cgagtcggcg agcatcgcga cagccgcgac gcgctcgcct tcccggtccc ggccgggaac     76080
     cggagcggcg tcggcgtgag tgggttcgat ggtgtagttc cacgttccgc actgggcgtg     76140
     cggtcggatg ggcaacgcgc gcaactcgtc tcgaccaacc gagatcccga tcgggtagtc     76200
     gccggtgtcc agctcggcgt ccacgcgcaa cccggtgcgg gtgcgggtgg aggcgatggt     76260
     cttgaccacg acctcatggc tggtcagcgg ccgccctcgc cagttcatgg tgatctggga     76320
     gaacaaccgg tgctcgatct tgttccactt cgaggtgccg ggcgggaaat ggcagaccgt     76380
     gatcgccaac ccggtctcgg ttgccagcgc agccaattcg gccttccaca accggtaccg     76440
     gtagctgttg gagccaccgg cgtcggcggt gatcagcagc cggcgcgcgt gcgggtagtc     76500
     ggcggcgccg cgggcctgcc accagcggcg gatggaggcg accgcgaacg cggcggtgtc     76560
     gtggtcgacg ccgacattga cccaacctgc gtcggtggtc aagtcgtaga cgccgtacgg     76620
     gatggcccgg tccgcattcg gtccggtgaa gaaactgtga tcgaccaccc gcaccggatc     76680
     gccctgcggg cgccactcgc gccccggggt gggcagctgg ccgagttgtt ccttcttctt     76740
     cgaatcgacg ctgatcaccg gctcgcccgc gtcctggtgc gccttgacct gctcgttgat     76800
     gtagcggaac tgcacgtccc ggtccgggtg ctgctcgcct tccaacgtct tggcgttggc     76860
     ctgcaaactg aatccgttgt cccgcaacaa tcgtcccacc gtcggcgcgg acaccggatg     76920
     gccctgccgg gtcagctcct cggccaggtg tcgcagcgac ttggtcgtcc accgcaacgg     76980
     agactccgga tccccacgct catccggctc gaccagcgcc aacaacgcag gcaccagctg     77040
     cggattcagc gcgtccgcac ccttgcggcc cccacccgga cggcggaccc gacccgtcgg     77100
     cgccggctgc tcgccggcct ccaactcgaa cacgcccctg cgaaccgtgg tctcgctgac     77160
     accgaccgcc cgggccaccg cccgcacccc gccatgcccc agcgaccggg cctccgccgc     77220
     caacgccaaa cgccgctgcc gctcgttcag atgcggcaac aagacctcga accgctcccg     77280
     cagccgcccg tcgacctcgc tcacaaccgc cctaccgcac cgacccgact caaaccgcaa     77340
     aacaccatgt tattacctta cagtcacaat acccacagca agactgccaa gcacaatctc     77400
     gggaagccgg tctcgagtgt ggcgggccgt cgtggatttg tacttgctac gagcaggtca     77460
     cccgttgatg ttcggggctt gtcgttggac aacgagagct acctttccag tgaatgcgtt     77520
     tgtgcggtga tacgtctgct gcgagttgga ccgcagtcat gcgatcaccg gttgatgagt     77580
     gcagcgtggg gcgtagatga gctgcccagc tcgacagttc tgccccgcgg cacatccgga     77640
     cagcggggat cgtctcgctc agaaattcag gtggcgtgcg agacggctga tcggatgggt     77700
     ttcgacattc gcgggtcgac cgggcccgat gatgcgtacg ccaccgctca ctcggacgtg     77760
     ggcctcgcca tcgatgcgga ctgtggtggt gtcggtggcg gcgaccagag cttgaccgtt     77820
     ggcttggacg tggcaatgac tgtgcgcgaa gacgatggcg ctgtcttctg cgcggatcct     77880
     ggcgttgtcg gtgccgacga tatggctctt accgcgggca tcgacggtgc tgtcgtcgaa     77940
     cgcttcgatg tgagcatgtt cgtaggcagt gaccctggcg tggttggacg cttggacgaa     78000
     gcaccggccg gcggctgcga tggagccgcc ggcgattccc gcgcaggttt gtccgataat     78060
     tttgacctcg acttggctgg ggatgtgacc aaggtccagc cagttctccg ggtcggcgtc     78120
     gatgacgacg gttttcgctc cagcggcgag gcgcttggtg tattccgtat agctgcggac     78180
     cggcgatgtg gagcggccac aatgcggccg acgtgagttg cgcgtggttt tcttcactgg     78240
     tgcccccatg agtcaatagt gccttcgtct ggtgtcgttc gtgcgagcgc tgatgccggc     78300
     gcgtcgcgcg tgggttgcac gaggttcggt gtgccgcggt gttctgtgtc agtcgccgat     78360
     cttgacggca ttcccggtcg ggtcgacgca gtgcagatag gagtcggcgt gtgatcggtc     78420
     cggaaggtag ggccagctgc agttccaagc gtcgatgaca gcgaatcgcc cttgtccttg     78480
     tgcggcgacc gtgcggtcgt tgaggtagcg atcactgatg ctcagtgctg ctgggcagct     78540
     cggagttccg gcgatgatga tcacaggtgc agtcgcaccg ttcaggttgt tcgtgacgat     78600
     tccgcactga gcgctcgtgg gcggcaatgc ggtggcctgc gtagtcgtcg ccggctgtgt     78660
     ctcggatagc cgggtctgag cgtcggccac gccgggctga ccttgatcaa cggtagggtt     78720
     cgtcgaccac tcgacgcttg tggcagcagc agctggttcg gctgacgggg atacggtctc     78780
     ggcttctgtg ctgctgcacc cggtgaggat ggcggccgtg atgagggaca gtgcagcaaa     78840
     ttccgtggtg gttcgtcgat tcacgagtac tcgcttctat tccagtccga cagggaggac     78900
     gcaatgtcga gcccagtgat atgtgatgac ctggacaaaa cgacgcccgg cgcgaccacc     78960
     gccgcaccag cgggtcaagc tgcggtttct cgaagggccc ttccagtgcg cgggctcccg     79020
     catcggttcg gtggtgctga gactgtccac gtggacggct agtgtcgatc tatcccttat     79080
     gtctgtcgca cagttgcgga ggagtgccca agatgaccga accgacgtcc gagttggcgg     79140
     gcagtggtct cagcgaggag ccacaatcgc cggccgtcgg tgctgaagat gcggcagggc     79200
     aacgcagtga tcatctgccg gcgacggtgt acgcgcctgc tgggaatgtc gtcgtcgcga     79260
     gtgtggtggt gtggttcgcg gttcggtggt ttgatgccga atacggcata acagcgctgt     79320
     ggtgggctgc aagcgcctgc gctgcagttg gtgcggcgtt gagtgcggca atagcgccga     79380
     tgatggcccg gttgtgtaag gcggtcgata ttccatcaga ggcaaccggc cggcggatcg     79440
     ttcctgcggc tacgaccgcg ggaatgtggt ttggcgccgt gctgctcgcc cgcggcgacg     79500
     cgatcttgac agcctggctt gcactgagcc tgctgtgcgt gtgggcaggg tggatcgatc     79560
     acttcacgct gcggtttccg ttgacgttga tccggttgac cactgcagtg ggcctgatgt     79620
     tcggggcatt cgctgtggcg gtggatcaag atcctgcggc aggtgggcgc gctcttctcg     79680
     ccggaatgct ggtgttcgcg ttcaaccttg ccttcgcgat cgtcacccgc ggctaccccg     79740
     ggctcgccga cgtgcgtttg agtttcattc tgggtgctgc cctgggatgg gtcggatgga     79800
     tgaatgtgct ctcagggatg ttgctaccga acgtcctcgc gctcgtggtg atgctgtggg     79860
     tgaaacttat cggacgacgg aaggatttgg gggagttcgg tttcgccccc ttcctcgtct     79920
     ccggaaccgc gctggcgatc gcggtccccc cgatgtggtg gatcgtctgg atctaaacgc     79980
     cgcaaggagt cctaggtttt gcctggtggt ggccaagtgg aggtgcgatg cggatgaacg     80040
     tttcccgggg gtgttcccaa acacaaggga aggaaagggg gagggagtga gtgatatacg     80100
     ggtaaggccg atttcctatc gtgacgaggt tcttcgactt gttgctgtgg gaagtgtctc     80160
     gttagcgtgt gctgtcggtg tggcgttgtg ggcgctcatg gttgtcgacg ttcagggtgg     80220
     ggcaaccggg tggtggtagg ggtcggttgt tgggtcggct atcttgggtt gacgctccca     80280
     atcttcctag cttattcccc gaataacatc gactgcatca ggttcctcgt tgggcattac     80340
     gcgattgtcg tgagcttggg cgtcatcgcg actttgcgtc tatcgcaagg ggagtcgatc     80400
     gcgccctcat cgacggggat gtgggcggcg gttgctggag tgaccgtctt cattttttcg     80460
     gtcgcctctg ttttagctgt gagggagctt gatgcggctc ggcgtcgtgg acatagggcg     80520
     acgcggttga ccgatccgac actgcctgcg cagctgatcg gcattcgcga gttggtgctc     80580
     gaacttgctt ctgctaccga gggttcggac tcacaacgag attgcgacga gcggctgcgg     80640
     gaggccgtca aagggttgcg tctagttttc gggcatgtct atcggttgac gattaacttg     80700
     gtggcgtggt tccttctgag gggaaaacca gcccccgttc cagcggagag ggtggacgag     80760
     ttgcttgcga ccatcgatca gaggttgctg attctcgctt cggttccgta cgaggaggga     80820
     acaagtttgg gcgcgtgatg gatgagtacg aaacggcggc gagcaggttt cggaacgtgt     80880
     atcggcgacc accgatccga aattgagtgt ctgagcgggg tggtgatgcc gtgatcggcg     80940
     cgcgatcgaa cgtgttcttc ggctgaggtg tcgagggccg ggtgactggt ttcgagattg     81000
     ggaggtgttt cggtatggac gatgcggacc aatccgcccc gatgccgtcg atcgttcaga     81060
     cggaactgcc gtgtgagttc tgcgcggagc atcctcagta cttccccggt gaccccgtcg     81120
     gcttcgtgcg tgcggctcgc tgggcggtgg tcgtcaagga ttgctgccac ttcgacgctc     81180
     gcgtggacta cctcctgtgt gacgagcact gggcaatgat ccgacaccaa cagctgcccg     81240
     ggcagtgccc tcggtgcggg gcgatcgcct actcagtaaa ggacatcgtg tgtaccgaga     81300
     tccctctggg aaggacggtc gatggggcgt ggccggtgat ccgtcgatag gcgcggagcc     81360
     accgtgtcgt tgaccggcag actggccttc aaataggacg gccgccgccc caacggtgtt     81420
     ccgggcgcgg acatcatgct gagcgatgtc ggcctgtgga tgaagaccca tcggttctgt     81480
     ccaaagacat gtcacacaac cccagttgtg tggatcttcc tccagatgat tgggagtggt     81540
     ggcacttcct acgacggagg agcgtctgtt gtggcggagt tgccgatcgc tcgcggtcga     81600
     ggtggggcag tcaaggtccg gacctatggt cctcgcaatt gctgtcgtga ggactaagga     81660
     gtggtaccga tgaatgttga ggttcgccgt atccacccga cggatgcgaa gaaaatccgc     81720
     cgccaccttc attcagagtc gctcaccggg cgtcaccgcg cggaccagta tggatgcgga     81780
     tggttggctc gaggtctgga tggccagcga tgagggcccc cggggatcgc acacgcctcg     81840
     tcctcaccgc cgacggcacc tctcttgcgg tgcgtgagat cggatcccag atggcgccgg     81900
     tcactgtgat tttcgcgcac ggattctgtc tccacatgga cgcctgggca ccgcaacggg     81960
     cctacctggc tatggtctgg cgtgggcgtg cccggttggt cttcttcgat caccgcggcc     82020
     atggtggatc cggcgcggct gacaccgaca gttacacgat cagccagctt ggacgggacc     82080
     tggatgcggt gattcgcacg gtggcaccac agggtccgat tgtcctcgtc gggcactcga     82140
     tgggcgggat ggccgtgatg tcctacgtcg cccatcacca agaggccgcg gccgcgcaag     82200
     tcgtgggagt cgggttgatc tcgaccgccg tcgacaatgt cgccggcgcc ggcatcgggc     82260
     gcgctctgaa tacaccggcg gtgacgttgt tgcggtcggc atcagctcac gccccagggc     82320
     tcgtcgggcg cagctggaat ctctcacgtc gcatcttgtc gccggtggtc ggcgcaactt     82380
     gcccgcttgc tccgagtgca agtgtccgtg ccgccgccac gtcttacggg atggtccacg     82440
     cgacgccgat cgccaccgtg gccgccttcc tgcgtgacct gcggatctac gacgcttccc     82500
     cggcgctcga cgtgctcgcg aaggtgccgg cgtcgatcat ctgtggaacc cgggacaggg     82560
     tgaccccgat cgggcactca cagcgactcg cggcggctct tcccctcgcc gaactgatcc     82620
     cggtgagcgg agcgcggcac atggtcggac tcgagcgccc tgacgtggtg agcgagagtc     82680
     tcgatcgact gctcggccgc gcggtagggc gccgcgaaca ggacaccacc cgcagatcca     82740
     aatccgacct cgtcggggcg tgagatctgc gcgtgcctca gacctgacga gacaaccact     82800
     gatgggagaa gtggtgagta ttcaccagga cgttgacctg tcatccggtc cggcgcacca     82860
     ccggacggac aagctcgttc accgcggcgc gaggtcgtac acacgccatg ttctgaaccg     82920
     ggtggcagcg tgtggtgtgc aggtcggggc gcggcaccgg tgcatcgatc tgcatcacga     82980
     accgaagacc tacaacccat ggcaagacgt cacctattgc cgctgcggtc acatccggtg     83040
     ggccggcgat catgcgcagt tcgacaccgc cgtcgaagca ttcgacggtt tccctcatca     83100
     cccctcgggg aggccagatc cacggaccta tcccggaaag aatgacaccg aatcgcggca     83160
     ggtcagcgag cagcggccca tcgggcgaag cgagctacgc cgatgatccc ggcagaagcg     83220
     ggcgaccccg cggcccgcgc tgttctggac atgatcgacc gcgtcgagat cgaccctgag     83280
     agcgaccagt ttctgacggc gctcgaccgc atccacttac aactcctctc gccgagggcg     83340
     gccacaatcg tcgcaaggcg agcggagctg ggttttaccg cccacgacgt gaatacctat     83400
     ccccgacgga atatctggcg cacgcaggtc ccgttcgggc ggacgaacgg cggtgtcgtt     83460
     gtcgagattc ccctcgtcgt gatcgcacct gttctgatcg gcatgattcc tgtcctactc     83520
     aacatgaatc cgctgtttca gtctccgatc acagatctga cggtattcat ctccgcggct     83580
     gcaggtgtgg aggtcctcgc gatgtggtgg tggatccgcc gcgatcccct cagactgacc     83640
     gcggcggaca agcagatgat ccgcggcagc attgccaagc tcgatgccta cgtctcggcc     83700
     ggcggcgact acttcgaact tcgtctggcc atgactgcgt ccgcgatcgt cgacgatatt     83760
     cgtgaagtgc cggcatggag tcacgaggac ctcgacatcc accgcatccg gctcgacatc     83820
     gaggaccaac tccgaatgat tctctgccac tgcggtgagc tggcaacttt ccgggccagc     83880
     gtcggcgaac ccacgagggg agtcagtgcc gaggctgacg cggctcgggc cgcccaccac     83940
     gagcagcgac ggtggttcga acaggccaaa gaatcactga tcgggcgggt cgcagcgttg     84000
     tggacatatc accaagacct actgatgctt caggactcca tcgacggtac tgcggctctc     84060
     ggtcgcatcg acgctcacgc accggcgctc ggagaactgc tggtcaactc ggcgaatgat     84120
     gacctcgcag cgtcggcaat cggtgacctg gccaccgacc tggccgatca acaccaggcg     84180
     cgggaaaagg cgctggccca gctgcgcggc gacgtcaccg gattcgatcg gcgcaactga     84240
     tgggccgcag ccatgaccgg atcagcccag accgcggcaa cggtgtgttc gatcccgacc     84300
     ggggcgacag cgacgtcgcc acccgcaagg aaggcgccct gatctcgcag cacgcctacg     84360
     acacccgagc cgatctccgc agcggagcac gagaactcga caccgctacc gagaacctac     84420
     ccggattgac ccgagcgcaa cgggacctca accgcgccta tccacggccc acgccggcgg     84480
     caatcggaaa ctctcggcta cgcccccagc tgccaccggc gatcgaactc cgtcgcacac     84540
     tctcggcacg acaacggaac acccgatccg cggcgaagcg ccgcgtcctc gacgccatgc     84600
     cgaaaactca gtacacggcg ctggcgtcgt tgacttcgga cccgaagacc tggcgggaga     84660
     cgaacaacgc cctctccgct gtggccggcg acgctgtcga gctcgacgat gctcgccgca     84720
     agcaggtcca acgagtggac agggccatcc aacgatacga acgcgcatcc ggacgaggtc     84780
     atctcgtgta cacctcggtg agcatcccca acgcggtcgt gaacccgtca gatctgccct     84840
     cgacgctatc gccggggacg gtcctgtcct tcgaccggtt cactgcagca acccattcgc     84900
     tgcacgaact ggactcgacc gcccggccca ccgatgtcgt cttcgagatc cagaccgacc     84960
     ggggtatgta ctacgggcaa tcttcccgcg tagacaactc gcaccactta ctgccacgag     85020
     gaatgcagct acaggtggtg ggggctcatt ttgtgccgta cgagcgaccc ggacagccac     85080
     caggggagcg cctggtcgtc caactcgtcg atcacgagac gccatgacga gtcgaggcgg     85140
     ggggttcgag acagattcaa cccacgggaa ggaacacaca gtcatgactg cggacaagcc     85200
     gcgccaccgg cgccccgacc tgacctttca tcccgatatc ttcgctgcgc ccgcgcaatt     85260
     cagagtggtg aaagccgcgc cacacgacga tgcggatccg accacggaca caacgcaagg     85320
     gaaggagggc tccggcgcag acgctcatac cggacgacga gatggcaagg ggctgtgagc     85380
     agaaagaaaa gtcggaggcc acctacaaga tggtgtgcct ccgactcacc cagtgcattc     85440
     tcagtaccca caccctattt gatcttccgc atccggtcca attctctacg ccctattggc     85500
     cgattgtgga tgcccgactg ggttgccccg gttgtgagtt cggtcgagtt gtacaggtcc     85560
     atctctactg tcctgatcgc acgacaccct cgcggtcatc gagacaatac ttccgccctt     85620
     ggccgccaca ccctcggcta ggagacatca tggatttcgc atcgatcatc atcggcgtcg     85680
     cagtggccgg cgcatcagct gcccagggcg gcggagtgga ccccgcgatc accgacagcg     85740
     tcacgtcggt cgcacagaaa ctaccgccag ctctcgccca gtatgtcccg gacccgcagc     85800
     cctacctcga cgacgcggcc cgggccgtgc agcaggcgca ggagcagttg cccgacgagt     85860
     ggcaagccga gatcgagaac gccattccac cggaagtccg ggatgccgct gagggggcca     85920
     gggaacagct cccgcccgag gctcagggtc tgattcccga ggtggtcctg cccgccccaa     85980
     gtccggagcc cgggcccgcc ggcggtgtcg ccgacccagc gggacccgca gctcaggcac     86040
     cgtcatcgac tccgcagcag gagacgaatc cgttattcct gtctcctgtc gtcagcggag     86100
     cacccaccac tgcggccggc atcccctccc tgacaggaat gctcgccccg accgcagtca     86160
     gcgatctgac cttcgatccc cgctttcccc gcaacctcga gttcgcgcgt gcggtcatcg     86220
     aagcggcgat gcgtgcgatc ggattgccct accaatgggg cggaggcctt ctcaccggac     86280
     cgtcgatggg cgacggcacc ggaggagcta ccgccggcta cgactgctct gggctcactc     86340
     gcttcgccta ctacatcggt accggcggca cgaaggtctt gccgcgaacc tcacaggaac     86400
     agttccgggc aggccagcag atcagcatgg accgagccca gcctggtgac ctgctgttcg     86460
     ggaactggca ggcagacggg gccaaccacg tcgcgatcta cctcggtggc ggaagaatgc     86520
     ttgaagcacc gcagaccggg gagctcatcc agatcagcgc cgtgcgctcg gacatggtgc     86580
     ccgcccgctt cctgtgacca tcggggacag tgccctgtgc ttgatcccga agcggaacaa     86640
     tacgatcgcc actatagacc cagaccggtc aaaagtcgtg tcgcgacgtg cggcacgacc     86700
     gcagagacga aggagacagt gacacatgac gattacgcca gcagcccaca agaaggcaat     86760
     cgagaccgcg cgaaagaatg cggaagcact ggcgcagaag gcaatcgaaa ccagagtcgc     86820
     gcttgtcgga gccatcgggg aagcagtgga agagcttgcc gcactcgatt ccgcacgcga     86880
     ggcagctgta gatgcaatca ggacggccca cgagaacgcg atcgaaggcg gatggacggc     86940
     caaagagctc gcagccatgg gctacaccgc cccgaagaag cggaagaacg cctccagtaa     87000
     ggccgcgcgt ggtggcgcca gtaaggacgc gactgagacg accgacgtcg cagatgctgc     87060
     tgcaccgcag ggaggcgatc agccgccgag caccgacggg cagatctcca gcgagcgcga     87120
     acctgagcat tcctacagct aggaagctgt ccggtggggt ggccccagcc tctcgggcgc     87180
     cgtcgtcccg atccttgtcg ggagacggct cccgagcgct accaggaact tcgccgggct     87240
     ggcataggtg ccggagtgag aaccacatgt cagagggtgc cgtcacgatg atcatgagaa     87300
     ggaagtggca tgaccagtac acaaacgtct ccgcagcagt gggcacgggg catgctcgtc     87360
     cccggccggg cagcggtgct ggacgttgaa tcgaccaatt tggacggcag catcatcgaa     87420
     atctgcgttt tggacgcggc cacgggcaat ccactgctcg ataccctggt cgatccgggc     87480
     gacgttccga tgcacccgga cgcttatgcc gtgcatggaa ttgccctggc cgatctgatt     87540
     ggcgcacctg gctggtctac ggtccaccag gctctgattg cggtgaccac tgggcgagtg     87600
     acgctcagct accacagtga gttcgacagg gggcgcgttc tccatgattg tgctcggcat     87660
     ggtctcgacc ctgcgcacct ggccgacccc gagatgtggg gatgcatcat gcggatgcga     87720
     tcgcaggccg agggcaccga gaagagcatt cggctcgatg gcggacaccg agcccgcagc     87780
     gacgccgcgg ccgcgcgcac cgtcctgctc ggcatcgcgg agggcacctc ggcgccatcc     87840
     accaccgtgg accccgccac tacctcccac ttgccgctgt agtccaccga gtcatctgct     87900
     tctgagtctg ttctcttggc tggtgtcctt gctgcgatcg tgattgtgat ttaccctggg     87960
     atctggaggt ggttcgtgat gaccgcagca catccccggc cggatctgga ggcgtacaac     88020
     caggccgccc gtatgtccca gcccgagctg gtcaccgcgt tgcgggagct gctgggcgcg     88080
     aagctggtcg cctatctggg tcgggtcaag gagacccggg cagtgcgcca gtgggcggag     88140
     ggcacacgga cgatcggtag cgactcggat gtggaacggc tgcggatcgc gtaccgggcg     88200
     gcacggctga tcaccgcccg cgacaccccg gcggtggcgc aggcctggtt tcagggtttg     88260
     aatccgatcc tcgacgaccg cgcccccgcc ttgttgctgc gcgaggggga actcgccgat     88320
     gtcggcccgc aggtcctcgc cgcggcccgg cagttcgccg ccgtcggatg acccagctcg     88380
     accatgccct cgtcgccacg gcgcaagggt cgatgtggtg cgcccaccga tacggatgcg     88440
     aggtctatcg ggtcgggttc gcgccgtcgc cgtgggaatg gacaccgtgg gtgtacgcca     88500
     ccgacggccg gttcaccggc cggtgggacg acccggacgg ggtgtggcgc accctctatg     88560
     tgggtgccag ccgattggcc tgctacctgg aggtcctcgc ctacgcccgg ccgagcgcgc     88620
     aggtgatcgc agatctggac gagatcgtcg tcgacgacga ggatgccgcc gcattcccca     88680
     cggtcgaacc cggccgggtg ccacggtcgt ggtgcgagcc tcgcatgacc gcccacggcg     88740
     cgctgacggg gtggttcgcg gtccccgggc acccggagac gctggccacg ctgcgtgtcg     88800
     ggtttcggtc ggccgcgatc cggcacggac tcgatgatct cgacggcgcc gcgattcggg     88860
     acggccgccc gcgggcgttg acgcaggcaa tctccaagtg gatcaacacc cttggtggtc     88920
     cggacggatg tccgatcacc ggagtcgagt tcgactcgcg acacggtgac gggctgcggt     88980
     tgtgggcagt ctacgagcga ccgggtgacc cggtggtcag cccccacgtc accgcactgg     89040
     atcaggtgcc ggtggcaccc gacgacggtg accttgtcca ggcgatgcgt ctgctcggac     89100
     tcgaatggga cgacacatga gtcgtccgtt gtgggatcac gagattctcc gcagcgtcgg     89160
     ggcggaaacc acagtcgcga caccggttgt ggctgggtcg gcggaggtcc acaagcgacg     89220
     cgacaccgcg ctaacttctc tctctcgctc ttgtcgcggt cccgtgatac cccctcgcta     89280
     tcagacgaat tcgcggatcc gggggaggac gtgggcgagt tcttcgaaga gtgtcggcca     89340
     cccacgtcgt aggcgggtga tacggccgtg ttcgaggaag gcgccgtcga gcatgtggga     89400
     gacccgtagg tgtttttcgg gggtgccgag tcggcggagt gtgccgtaga cggggttcac     89460
     cggtagctgg tggtgggcga tgtaggtcca gatctcgtcg gtgttccagt cccatacggg     89520
     cccgaagaca cgggttccgt cggctcggtc gatgaggccg ccgtggtgtc ggcgttgctc     89580
     ggtggtgttg gtgcagcagc cgtcgcacat gcgtgtgacg tggctgctga gtgcgttgta     89640
     gtacagcgac cagcggccgg tccctttcgg ggattcgtcg gcgcgtacgc cccagatttc     89700
     tcctggcccg tgggctgcgt gcgccgcgcg ggagggggca ccgatgagga tgtcgcgcag     89760
     tttctggctc gtggctcggg tgggctggtg gtggtcccat tcgccggatt gtgcgaggac     89820
     ggtcagcagt ggtgggtcgg ctcggtgggg tgcgaggttc aggttccagg tgtcggcgag     89880
     tgcggtgatg taggtgtagg tctcggggta ctcgaggccg gagtcgaaga acacgacggg     89940
     gatgttcggt tcgacctgca gggtgaggtg gagtgcgacg agtgagtcct tgccgccgga     90000
     gaaggcgagg tatccgtcgt ggtcgtcgag gtgcccggcg atgcggccgg tgagttttgc     90060
     gaggtcgcgg cggggccggc gcagtgcccg gagggtgttc aggtccaggc cgtcgggttc     90120
     gggcttgccc gccacacgtc ctccttcacg gtgtccggtc ggtatcgaga tctcgcagct     90180
     tctgtcacac agtgtccgcc cggtagatct tcctccagtc gtaggggcgt ttgaagtcgc     90240
     ctgggcatgt gaggagtgtg gtgtggggaa actgtgcgaa gtggccggcc ggaaggacgt     90300
     cgtcgccgcg gcattcgcgt cgacgaagac gcgcgaggta gtcgaggtgg cgagggtggg     90360
     ccggtgtgcg agatgcgcgg cgtccccggt tcgggtggag gcggtgacca aggtggtgtc     90420
     ccgaacgttc acgggttacg actgctggaa agcgcccgtg gaaggtgggc tgtgcacgtc     90480
     ctgcgcctgg gcctaccggc acccggatct gcgcagaagc atgcatgtgg tcaccacacg     90540
     accagcgatg agggcagtga ccgcggcgga tctcgaacgg atcttgtcgc ggccacttga     90600
     tccggatacc gccgtggtgg tgcccttgcg gcccggccga aagcacatcc tgccgcacgc     90660
     gcggtggggc gggattgctg tcgaggacac gtgcctgccc tggacgtcgc gtgatgtcgc     90720
     ggcggtgaca gcgatgcgtc gactgcgggc gctggggttc ggggcccgga tgctcgccga     90780
     gcctgcggcc ccgtatccgg tgctcgccac gatcgccccc gggcggtggc cggcggtctt     90840
     cgcggactgg gatcgtctcg ccccgtaccg ccaggtcggg cagtggtggg agcttgcgct     90900
     gcgagccacc gtgtcggcga gtgcgaaagg aacgaaatga ccagcccgac cgatcgatgg     90960
     ctcgctgccg caccggcggg gctgccgccg ctcgagggtc cggcggcaac ggctgaacgc     91020
     ctgctgctgt tgctgcacta cgggatcgac tgggattcgg gatggatcgg ccggcggcgg     91080
     gaaacgtact ggacccagca cctgccgaac cgtgttcggg tcgccaccta tatcggtggc     91140
     ggcgatctcg accggtggtg gtcggtggtc tcccggtccc tcgaatcgga accgacgaac     91200
     accgaccagc ggctggagct ggcgacgttg ctgcgtgagg agtccgagcc ggtgctgacg     91260
     ttgctgcgtg agcgtcccac ctcgtacgtg ttgcgcacgc ggatcgtcgc cgaagcggtg     91320
     gccgccgctc ggacttcggg aacgaagaaa tgatgaggtc gacggtgcgc tgggatgtcg     91380
     agctgaccgc gctgtcctcg atctcccaga agggggagga ctccggaacg acgacgacac     91440
     tgttccggcg cgagccggtg atccagccgg acggaaggcc ggtgctggtg ccgatcgtgt     91500
     ccggaaactc tctacgcggc gggttgcgca ggatcgctga ggagctgttc cgcgatgtca     91560
     tcggctacga agggcagatc ccgctctcgg cggcgcacgc gctacgcaac ggaggctctc     91620
     tgacgaaggt caccggcgac ggtctgaccg gtcgtcggcg gcatcgactg cgggagctgg     91680
     ttcccccgat cggggtgttc ggcggcaacg gcggaggtca gccaccgatc gacggttgcc     91740
     tgagggtggg caaggtggtc ccgcgggtgc gtgagaccga gacgatcatg acccgggcat     91800
     atgacggccg gttgatgagt cagttcgagt tggtctccct ggagagctac agccgattcg     91860
     acgacaccga cacccggacg ttccccgaat cctccgcggg gggcggagcc ggcaaggatg     91920
     tcggctcgtc gatgctgatg cgattcgagg tcgaaacact tcctgcggga acccgtttcg     91980
     aaacgttctt acggctggac cgggccaccc ctctcgaaat ctcgttcttc accgatgtgt     92040
     ggggcagatt cgcgcgtgac ggattcctcg gagggcgcag cgcgataggt cacggacgcg     92100
     tccgtgccga atcggatcgg gtggtgttgg ccggcccgga cccacagaca gtggactggc     92160
     gcgtcgagct cgcaccactg cgtgatgagg tcatcgaagc gttgtgctgg ctgacatgac     92220
     gggcaccgag gagatggcac cgttcgttgt ccgggcgcac ctgtcgtcgg gactggcgca     92280
     cgcgacgccg tggggaatca gtctcgacgg gatcctcgcc gccgaactgt gggccgatca     92340
     caaggccgcg gcactcgacc gagtcgagta tgtgccggcg ctgacacccg agtgcgcccc     92400
     gcccgacctc gcgctgccac tggctcggtg cgagctcgca ggcgaggact ggcattggtg     92460
     tgcgacgtgc tcgttccccg aggacccggc cggtgatccc gtggtgcggc actgggcgtc     92520
     gcgggccgat caccgcgggc tcgagcaact cagtcacacg ctgccggcgg tgatctcgga     92580
     tcgacagggc cgctaccggg cccgctacat gcccctgatg atcaccagca ctcgcacggt     92640
     cacctggcgc ggagtcggag atctcgacgc cgtcgccagg atcctgggtg gcctggatgt     92700
     catcggcaag aaacgggccc atggtgaggg ccgggtcctg aggtgggagt tcgaacactg     92760
     ccccgccgcc gaccggtggg cggcggcgca cctacatagc gacggcactc tcgggcgcac     92820
     cacaccaccg gcctgtctgc ccgatcgacc cgaaccggaa tcggccggct tcgggttggc     92880
     tggcctgcgg ccgccgtaca tgcacccgac ccgaatgcgg caactccacc tacctcgatg     92940
     agccgccgcg tggtgcggtt cgccgactat tcggaacgcg ggaggtcggg cacagcgacc     93000
     ggttcgggca gcgtccagcg agcaagtggg gtattcgatc cgttcggagg atagagcgcg     93060
     acctcggcga tcgacacgtc gtcggtcagc ttgtccccga ttccggggaa caggacgagg     93120
     ccttcggcgt gaccgtcgag ggcgttgttc cccatcgcgg tggggatgtt gccccaggaa     93180
     ttatcgccgg tgatggtctg tccgctgagt gtgcggacct tccagttggt cgatgtcgcg     93240
     ttcagggttc cggagtcgac gtcgagcacg atcgggaaca acagtatccg cggctccccc     93300
     atggaggtct tttcgatcag ctggggctct ttcacctcga tgcgggcggt gacgtcggcg     93360
     gcggtaatag tctgagcggt tccgccgatg gtgtccgagt tatccgacga gatcgtggtc     93420
     cggttggttg ctgcggtcgt ggtcgtagat ccagtggtgg tcatcgctgc cgaggtagcg     93480
     gtctgactag tgggagtggc ctgttcgtcg ccattgccgc acccggacag ggtcagtccc     93540
     agtgcggtgc aggtagtcac ggcagcaatc gtggttctgc gaatgatcat cgttcatttc     93600
     ccttttctcc cctggctgac gggcgccctg tgaacagggt cgtggtcagc ctccatatgc     93660
     gtgccggttg tggcgcggac gacgtcatcg agagtagcgg tgtgggaccg gtgtcctggt     93720
     cacgggtgtc gcggaatggg ttggtgtgga ctgtgaccgg ccgagaacta ggtcggagcg     93780
     gcgtttccac ctgccctgat gagtagttga tggttcgtcg agcacgttcc attacgcgat     93840
     gtcactcacc acgtacgccg cggatcttcc tcccagtgaa aacaactcgc acttcgccgg     93900
     agaggtcacc acggatatga cagacaaccc aatcggactg gccccggatt ggtcgctgga     93960
     acctggtggg cgtcccggag gtgcgagttc gtgtggagct gtccaggtca ggcgttaccg     94020
     tccgcctcac cgagacacca tctgcgggaa aagggagatg agcgagatga ccgataccga     94080
     catacggccc aggatcgagt tggacgctcc ggagtggcgc gacttcgcgc tctgccgagt     94140
     gaccgatccg gaagcgttct tccccgaaac gggggagaac ggccgccccg cgaaacgggt     94200
     gtgcgcgggc tgcgaggttc gcgaggcctg cctcgccgag gcactcgccc acgatgagcg     94260
     gttcgggatc tggggtgggc tgaccgcggc cgagcgccgc aagcgatacc cgaagcgtcg     94320
     ccggtgaccg ccatggccat ggacttcgaa cacaccagcc aggccgaagg gcggcgaggc     94380
     accaaagcga tccaactcgc ccggtacctt tgggatcggg tcgtgccccg gccgacctgc     94440
     tgtcactatg ggcgcaacag tttcgccgac ttgcgcggcg ggtgggcatt catccgccac     94500
     gtttggcagg agacctgtta tggcacagcg agtttgccga agcagaagac gcggtgggcg     94560
     cgggcggagc ctgagcatcc cgctgctgct cgcgcgcgca tgacgagcgg gacttgtgga     94620
     tgtcgccgac gcagccggag ccggaggctg atgggacctg ttgtaatgga gaaccggcga     94680
     atggggggga agcgatgagt gacgcgttca tcctcggcgt ggcattggcc tgcggtgtag     94740
     gtgttctggg gttggtggtc gccctgttct ggggagcgga gccgagccgg acgtgccgat     94800
     gtgtagtcgg cggacacacc gaagcgtgtg acgctcggtg gtcttgacca gcgtcgctcg     94860
     ggtccttgcc cgtcacggtt ggtggtgtcg gtgctcaatc gaatgtgggc agggttggtg     94920
     tatccagcat ggccgtggac ccgagcgggg ccggttgtag gaggttcgcc gcgatggcga     94980
     ccgcccaatc actcctcgcc ttggcccgag cgacacgccg tgacacgccc gatgcggaat     95040
     cagttcgcta tgattcagcg gtgccgctgg cggcgccgct gttactgcac aacctaattc     95100
     atcggtgaca cggcccttcc gtccgcgcta cggtcatcgc atgcgtgatc tcctcgaaca     95160
     gtccgtccgc tacctcgaag ccctctccga cgccatcgtg gacgcggcgc cctccacaga     95220
     cgcctcgttc gtggctgagt tcgccgaagc cctccgcgag tgtgcggagg cggtcaagat     95280
     agcgcgcgag gacatgatcg acgccggtcg cccgatcagc cctgtctact cgcaccccgg     95340
     cgacgaggac acacgggaag aactcgcgtc gcgactgacc gcgcacctct ttaccgggta     95400
     gtccgctccg cttctcgttg aaccgcccaa ttacaaccta ttcggcgggg ccgagaaccc     95460
     ggataggtgg actcaggagt acctcccatg tcacgggcac ctcgtggtcc gggctttgct     95520
     gggaccagta gcaataggag tgatacgacg tcatcagagc ggtgccaggg gcgcggagca     95580
     gctccatgtt ggcccggaat ccgtcgtgat cggtctccac ctgccagatc ttcgctgctt     95640
     cagtcggatc gaaggcagtg cggaaggcgc gggcctcgtc gagtgtgtcc actgcgaagg     95700
     cagattgaaa acgagacggt gcggtcggaa agtgtgcccg acgcacgttc tcccatatca     95760
     gctcgatcag atgatctgtg acttgaaact gagcggccgc gttgacgaag ttaatctcac     95820
     cgtgcgcggc aacgccatcg ggaaacagca cgtcgaggtg ctgttgcagc gctgtcggtt     95880
     cgacgtcgtc gaagcgggtg agcccgagcg acagtccctc gtgaagggtc cctctccggt     95940
     cgacggtgta gaagcgcggc atttctgaaa acctctctag ctgtgagtga tagtcgactc     96000
     accatccgac cgcccccatc tcctcatggt cgaaatggtg tccaccagga gggacgtacg     96060
     tgcgggcggc gctcggctgg tcaagcggtg gtatcgatgg tgacctcggc tcggccgtcg     96120
     agggcagcga gcaggtagtg cgggcaggtg accacttgac ggggcacggg aattgtgcgt     96180
     cgagtgctgt cgaggtagag acgatatgcg agctgacttc cccggtggac gccggtcgct     96240
     gggtcgacgg cgccgagaaa gtacccgtgc ggggcgtcaa cggtggagaa gatcgtccgc     96300
     gcccactcgg cgggctcggc gggcggcaaa taccggggct cgcccgtctg cgcatcgacg     96360
     gtgtgcacga tgacggtgac agtgaacccg gtagccgcgg ggaaccacgc ctcggccgcg     96420
     gcgccgaacg gtgcgatgga cgtgtggatc tgcagctcaa tattcgttcc ggtgcgggcc     96480
     gccgtgatga tgtgcgaatc tgcccagacg tcatcggtgg ccaggtgcgg cagcgcttgg     96540
     tcggagtcgg tgtggacgct gccgcgatca gcgggcatgg gcttgtttgt cccgttctcg     96600
     gatgatctgg tcggccaggc ggtacaccgc cagttcgtcg gggataccga ccttggtggc     96660
     gcgctcttgg gctgcgatga gcgcgatgac ctgcttgttc ccctgtctgc gatctcggta     96720
     caggaactgg tggcgtccct cagcgaggtc ctcgagcacc aaccactgga agcggtcgag     96780
     actagtggcg atctaggcga tacgcacccg cttcgactgg actgtgcgcc accggtcaac     96840
     caggtccgat cccccgagca gtacaccgag gaccatagcg cagatcgctg tgatcattcg     96900
     gcgtcccttc tcgaggccac ggatttcttc ggatcactgg tgaccacgct cagggcgatg     96960
     gtcgccgcga tcgggacaaa cacggtgagc agcaggggca gcgagaactc gacacggtca     97020
     ccgccccgac ggcagcggcc gcgaaggcga gcacggcgag cagccagagg gctcgggctg     97080
     ccgaggcccg atgtgtgatc tgggtgcctg accagcgacg accagcacgg cgccgagcca     97140
     gagagttcaa atgggcatgg tgtgtggcgg gtccttccga cgtcggagag cttgaagtct     97200
     cgtgggacag ggtgtcatgc cgccggtgac cgccgtggcc tcccattcac tcttcggata     97260
     tctgcgcaac ccagtgatga tcgctgtcgg tcacgatcgg cataatcacc tggtgctgat     97320
     ggcctacatc gatgagaccg gtgacactgg attgatcgcc aagggcggta ccaactgtta     97380
     cgcgctcggt tgcgtcttga tcgacgactc gcagtggccg gaagcattcg acaagatgct     97440
     cgactttcgg cggcgtttgt ccaagacgta cgggataaat cagcgctggg agctgaaggc     97500
     gaactacctc atccgcggcg gaggcccgct gaaggctctc gcgttgcctc cgggcattcg     97560
     gcatctcgtc taccgcggcc atctgaagat gctccatgaa atcggcgcac gcgcattcac     97620
     cgtggttgtc gacaaggagg caaccaaact ctctggtcag gagtgtttcc acatggcgtg     97680
     ggaaacgttg ttgaaccgct tggagcgcac aagcaccaaa gagaagtcga cgcttatgat     97740
     ccttcatgac gagggtgagg accatgcggt gcgaagagaa tttcgcaagg cccgacggca     97800
     tttgaccgcg ggcagcgctt acggttctgg ccagatcagg tcaaagggga cgctgttcct     97860
     ggacgatcct gtgtcgcggg catcgcataa ttcgcagtta atccagacag cggacatggt     97920
     ggcgtacgca ggttggagaa cgtacatgcc tccgagcaag aaggtggctg aggtctgccc     97980
     gtcggacatg tggcgtcacg ttggtttggc gacgcacagg gtggtcaaca gtgtcactcg     98040
     caacggcgcg cctggcgttg tcatacggaa aagataaggc cccccagctc ggctgggggg     98100
     cagctagcgc ctagccaatc cattgggaaa ggttgagcgc tgtcgcccac gttacagggt     98160
     tgtgtgccaa tacggagaat ttcagcccag ggatttgctg atcgaggtgg gggcgacgat     98220
     tgacagacga agagatcaac cagtgggtca agaccgtcgg accggcgccc gacgacgtgt     98280
     tcgcgaagat cgttctgcgg ttcgcgaagg cggcacgcga ggggaatctc aagttcgacg     98340
     aaattgatcc gcaatcaggg gacaaatgat gatgtcaacc ctgccccccg ttgcctgctc     98400
     cgcgaactga tccgtcaact cggaaccgcc ccagtcgacc ccaggctgtt ggcactcctc     98460
     gagcggcaac gccgagaggg acgacgcgat agccgcggga gatggctgag gcagacctcg     98520
     tggtcgcggg ggagctgcgc cgctctgagc gcgccgaaga ggtcgacatc gcccgccagt     98580
     cggccttctg gaccaaggtc cgtggaatcg cggcactggt ggcggtcgcc accttgtgtg     98640
     gtctccctcc tcttttgtca gcgccggcct cctgtgtgtg agtacatatc gcgcacgcct     98700
     ccgcgcgata ttcgaggatc cggcggcctg cccgtggggt ggggtcagat ttcatgacac     98760
     cgacccctat attcatgagg tccgcgcgtc gagcgtgcga aatccccaga aagatgcagc     98820
     gtggggagac gagccaggct tattgacaat gagtctcgga tcctgcccac aaggaccagg     98880
     agcgatcggc agcaaaggtt tggttgctcc cccggtcacg gcgcgaagaa catgcggtgg     98940
     atggtcaccg tgtcttcggg accgtacgtg tgcgccgcaa gcgtggggtc tgcgaagcag     99000
     atggtgaact cgtggtgacc cttcacggtg tcgtgcttct ccgagagttt ggcgacgata     99060
     tgactctgac ggtacgttcg gccgtcgtcg tccgtggtgt cgacctccac tagcagtggt     99120
     gcttcgtcgg tgctctggaa gtcgagcaga tcggacacgg tgagcgtcgc ggacagaatg     99180
     cgagtcggag actcctggat ccgggggagc atgggtgagt gcctttcggt tcaggtcggt     99240
     gaagttactc agacgtacct gtggcgcggc ggagggcaac cacctcggct tcgagggcga     99300
     cgaccgcgtg gaacgtcgcc tcggacacag cattgctgtc cttgccgaac gtctcggcag     99360
     cctgccagat gcgggcgctg tgctcaccgc tggggcgcgg gatcttgaaa ccatgactac     99420
     tgaacgcctg cggttcagga ctggtgcgct gaatcagatt catgagcggc agcgtagacc     99480
     tcacctccga caacctctcc tctttagatc aggtctcgat cgaacggctc gtccgggggc     99540
     gtggcggaaa acaggattgt gccgcggccg gcgatgtttg atccctccgc ggggcccgca     99600
     gacgatcttt ccgcgcggtg cagggtgggc gctcgtcccg cgtccccggc acagggtgcg     99660
     ccggggacgc gggacgagcg caaaacccct atttctgcag gtcagaccgt ataatcgagg     99720
     agtctaattc ggtagcgaga ctgaccaact cgctcgactc tgaaggattt tctgtggctg     99780
     atttggcgac tgctgtgacg gtgttggatg cgaatgggcg ggctggtgtt ccgtcgttgt     99840
     tgatctcggg tccgggtatg ggtaagtcga gtctggttcg tgggttggcg gcgtcggacg     99900
     gggtgctgtg cgagacggtc ctcgggtcgt tgcgtgaacc ggccgacttc gctggcctgc     99960
     cggtggtgcg tgagcacggg gtgacgttgg aggctccgga ctgggcgaag cgcattcacg    100020
     ccgagggtgg cggctatctg tttctggacg agttgacgac gagtccgcct gcggtgcagg    100080
     cggcgatgct cgcggtcgcg ttggacctga aggtcggtga tctgcaattg ccgaagggaa    100140
     cgcgggtgat tgcgggtgcg aatcctcccg attgcgctgc cggtgggtac gaactggaag    100200
     cgccattggc gaatcggttc tgccatgtgg agttcactcc gtctgttgac gagtggttgg    100260
     atggtatggc gacggggtgg gctacgccgc ccgcctcgcg tgcggtggcg acggacgaac    100320
     agcgcgtggc gctggtgcgt agttcgatca ccggatatgt ccagcgcaac ccggaagcgt    100380
     tggacgcgtt cccgtcgtcg gcggcgcaga ccgggggagc gtggccgtcg cgccgcacat    100440
     gggcgatgtt ggcggcggtg ttgccgcatc tgcgtgacga cgacaacgcg gcgatcaatg    100500
     cggtggtgtt cgggctgatc ggtgagggga ccggtgtcga gttcctggaa tggcgcagga    100560
     atgccgatct gcccgacccg gtggcggtga tcgagaatcc ggaaacggcg ttcgactggc    100620
     agtctcgtcc ggacctggtg tgggcagttc tgtcgggtgt gacggcgtgg gctgcggggc    100680
     ggggcactgt cgaggcgtgg cgcagcgcgt gggggccgct gatcgcggct gcggaagcgg    100740
     gtgcacctga tgtggcgggc gctgcggcgc ggacgttggc gaaggcgcgg cccgccaagg    100800
     ctgtggttcc ggctgcggcg aaacggttct ccccgatgtt ggtggctgcg ggtctggtcg    100860
     gtgaggcggc gtgagcgcgg tgcgggtact cgacccggac gagttgcgcc cgtttcggtt    100920
     ggcccggttg gtctctgccg aacagatgcc gtacttcatg cgggcgttgt tcgcggcgca    100980
     acctgtggct gcgccggggc tgggcacgtt cgcggtggat gcgcagtggc ggttgtatct    101040
     tgatccggca ttgctggtcg gtgcgaacgc ctggccggtc ccggtggcgg gtgcggtcct    101100
     gttgcacgaa gtagggcacc tgctgcgggc acatgccgcg cgcgccgcgt ccttgccgaa    101160
     accggtccag cacctggcgt ggaactacgc cgccgatgcg gaaatcaacg atgaccttct    101220
     cgcggccggt gtcggactgc ccgaaggggt gatcaccccg gagtcgttcg gctgcgcatc    101280
     gggaggcatt gcggaggact actacacgaa cctggtcgat ccgtctgcct ctccatctcc    101340
     gaacgcaccc gcagacggcg acggtgatcc ggggtgcggg tccggtgcgg ggtgccctgc    101400
     cgtgcccggc gagttgggtg cggcagggaa tgaggtcacc gaaggtctcg acggcgcgga    101460
     ggcagacctg gtgcggcggt acgtcgcgca ggccgttcgt gagtcttcgg gaaagggcag    101520
     ggggagcgcc ccggccgggc tggtgcggtg ggccggtgag gtactggcac cgccgaccgt    101580
     ggcgtgggat cggttgctgc gtgcggcgat ccggcgcgtc ttggcggatc aggcggggcg    101640
     gacgaactac acgtattcgc ggccgtcgcg gcgcgggatc ccgggcatag tcgctccggc    101700
     gatgcgcggc ccgtcgatca cggtctcgat tgtggtcgac acctcgggat cgatgtcggc    101760
     agacgatctg gatgcggcga tgagtgaggt tgccggggtg ctgcgggctg gcggtgtgtc    101820
     acgggatcgg gtgcggattc tggcctgtga cgcgtcgagc acaacggcgc agccggttcg    101880
     gtccatcgcg gacgtgaaac tgatcggcgg cggcggcacc gacatgcggg tgggtatcga    101940
     cgccgccaat gctgcgcgtc cgcagccgca tgtggtgatc gtcctgacgg acggggatac    102000
     gccgtggccg gatcgcccgt cgcggtcgca tctggtgtgc gcggtgatcg gcagcgacac    102060
     ggctgcggca cgtacaccgt cgtgggcatc gacggtgtac gtgccggtcg gcgcgggagc    102120
     gcgtgcatga gcgcggcagg aaacggcgac ctggtccgct acgccgaccg agtgttggcc    102180
     ggtaccggga tcaccgcgaa ccaggtcgcg gcggtagtgg caggtgcggc gaccgatgcg    102240
     gcggcgacgg cactgcgcgc cggttggcgc tgtgccgcga atccggtgca gggaagcgac    102300
     gaggagcggg gagctgcatg agcgtggaat ggttcgacct cgctcagcga ctctatgccg    102360
     ccgaaacccg gtcgccggtc gctcggctca cgcacaccac gttcgcggcg tccacggcgg    102420
     cgctggcggt gcgcgcggtg gcacgtggcg gcagcgtcac cgtgtcagtg gccgggttcg    102480
     agggccgcga ggaacgcgcc cgcgacgtgg atgccctggg actgctggcc gcacacggcg    102540
     gcaccatcgt ggggcgatgc gacccggcac cgttgctcac cgacgacacc ggcaccctgc    102600
     ccgcgctggt gaccctggcg cgggcgcacg cacaccaccc ggacccgcag gtggccggag    102660
     cggcggccat ggtggcgtgg tgggcggatc gggcagacca tcccggcacg tcggcggtgg    102720
     tgaatctggt ggccgcgtcg tcggcgcggt acgtcctcgg caccaccccg gaggccgaac    102780
     gatcggcgac cacgtggcgg cagtggctgc gcatctgcga tgacggcgtc agcggcttgc    102840
     atgagtgggc cgcgaagatc agcggcgggc cgctgctacc actactggag ccgattcacg    102900
     aggacgaccg ctattcgtgg gaccgcgcgc tgtcggcagc gacggccggg catgactggt    102960
     cgcgtccgga caacactgcc agcgccgcca tgggactgcg cacccgatgc gatgccgccg    103020
     agttgaaatc tgccgccctg ctcgatgatc cgctctggcg gcaacgcgca gtccataccg    103080
     ggcacgtggc ggtcggggtg gcatcggtga ccccgccgcc gaaagggtcg cgtcggcgca    103140
     acgcatcgct gtcggtgacc tgtgatcggc tcgattcacg gttacgcgtc ggatccgagg    103200
     tcaccggctg gatgggcacc ccagcggaca agcccttcga gcggttcttt gtcgaggtca    103260
     cctcggcaca ggtcgtagag ggaaaattag tcctcggtct cggctcggtc ggcgcacacg    103320
     cccccgcacc gggagcaagg gtgtgcttga tgcctgggcc gccgtccccg cagacgatgc    103380
     gcgcgggtcg gggccgatac tggcggctct accgtgcccg ccgttcctgg ctctccaccg    103440
     gccaaacacc ggtcgctgcg cggcgtgagg ttcccctcga cgtgctgatc gcgggcgcag    103500
     aggactagcc ccggcagcct gcaccacaac ccaaaaactc ctgcttcaca tcacctttcg    103560
     tgaaaggttg caccgtcatg cgcatcctcg ccccccgacc cgatatcccc aaaccggcac    103620
     cctcgagcgc accggcaccc aggccgagcg cgccgtcgct cacgcagtgg ccgggatcgc    103680
     agatcatgtc cgatccgatc accgcacgtg tgctgttctc ggtgtggtcc ggtgatcccg    103740
     ccgtcgtcgt cccgtcgcca cccggtgcgg gcaagacccg actggttgcc ctgctcgcgg    103800
     cggcattggc gcaccgcggc gatctgcgtg tcggcatcgc ggcccagacc cgcgaacagg    103860
     cagtggagat tgcgcggcgc ctcggcaccc tcaccgatcg cgctgcactg atgtggaaaa    103920
     cgaaaccgcc gaaacccgac agcggcgaga cgccagcggt gtcggggcag aaggtgaggt    103980
     ggcccggcga cgtgggcgcg atcctgatcg gcacgaccgc ccgatggctg ttctcggacc    104040
     ccgaccgggt cggcgccgac gtgctgatcg tcgacgaatc gtggcaatgc acctacgccg    104100
     atctgggcgc actcggcgcc atggcaaggc aggtggtctg tgtgggcgat cccggtcaga    104160
     tcgatccggt ggtgaccggc gacgtgtcgc gatgggacgg cagcgatacc gccccgaacc    104220
     tgccgggacc gatcgcgctg caagccgcac acggcgacgc tgtgggcgtg gtccggctgc    104280
     gccacacctg gcgcttcgga gcggacacca ccgccctgat cgggccgttg ttctaccccg    104340
     acctgccgtt tacctcccga cgaccaccgg agcacctgac cgacgctggc ggagtcgtgc    104400
     ccgagttggc gcaccgcccg gtcacggtct gcggtggccc gtccgatccg gcgctggtga    104460
     ccgcgtgcgc acagcgggcg cgggagctgc tcgacgccgt cctggtcacc gccgaggacc    104520
     agcgaccgat gagcgccgcc gatatcgcgg tggtggttcc ccacgtgacg caggcggcgg    104580
     cgatccgcgc cctcctgtcc gatcacccgg acgtgctggt cggcaccgcg aactcactgc    104640
     aagggctcga gcgtgccgct gtggtggtgc tgcatccgct ggccggatac cgcaccgccg    104700
     aaccgttcag cctcgatccg ggccgcgcct gcgtgatgct ctcccgccac cgcgcccaca    104760
     tgagcgtcgt catcgatgac gcgagcgccg aggtactcgc caacaccgaa ccctcgaccg    104820
     cgcacgccac caataccgcc ctgttggccg cgctgcaccg cactcccgct gtgtagcaac    104880
     tcaaaaggaa agggatttac gcaatgtccg atgaaatcat gaccgcatac cacgcagaac    104940
     gactggcgga cgtcgactca ccagcccagc tggcagccgc attcgcgggg aggatccgac    105000
     cgaacttcac ctacgagtac gacgacgatt ctcaggtcca cgacaacggc gtccgcgcgt    105060
     tgcgggcagg ggacgggctg atcacctacg cccgaatctg caataccgat caggaggagg    105120
     ccatgacggt cttcggggac ttcctcggcg atctgcacca tctggccgat gcgatgggcg    105180
     tcgactggga cgaagcacag cgaaggggag cggtccacta caccgccgag ttgtacggcg    105240
     cggattaaag ggaactgacg gctggacggt cccaaggacc cgttcggccg gcagtccccg    105300
     gcaccgggtg cgccggggac cggtacttcc cgattcgcct gtggccatca cccgcatcga    105360
     ccgcgctgat tgatgcgtgt cactctgcgg gcccacctgc gtttcattcc gcgtgtcgac    105420
     ctgcgtgtca aaatgcgtgc agacacgcga gtaaagatgc gtgtgattcg gcgagtcctt    105480
     ctctagcatg aatgccgaag gtcccggaaa tacgcggccg taggcgggtt ggtcagtggc    105540
     cgtcccggag tgcagcagag gagcgaggca tggtgcaggc cggaaagcgg aagggcgctc    105600
     gccagcgtcc gacgggggtg gggaacggac gtgcagtgcg atcgcaggat gaagttctca    105660
     gcgcaggagg agattccgac gtgatggcac cgaccgtggg ggcgctagcg aagctggaac    105720
     cgcggagggg tccgaccaaa gtgcaactca atactcgggt tctggcctcg acggaggcgc    105780
     ggctgaactg gctggtgaag aaccgcaact tctcggttac cagcgtggtt gacgtggccc    105840
     tgcaggagtt gttcgaccgc caccacgtac cgccggcgga catcgagggc cggatcgtgg    105900
     agcagtaaac gtgacccgtc cgtgggagca gattgcactg ttcgacctgc acgaaccagc    105960
     acctcccgca cccgccccgg agcctggcga cgatgccacc gagattgcac cggaggaaac    106020
     agctccagcg gaaccagctt cggcggaacc gacgacaacc gccgctgccg caaatctgct    106080
     gaatgcatcg gcgaccgagc cggcggcaac accacccgca ccggtatggg aggcattgcc    106140
     cgcaggagag gaagccgatg gccatgcgtt gatcgtgacc gccgacggga cctacacgcc    106200
     gtccgggcgg gaactgaccg gttcggtcga ttcggtcgag aagctggaca agctgatccg    106260
     ctgggccgcg ctgacaccgt tgggcgcccc cgcacagatc tgggtcgtcg gacaggccgc    106320
     gtgcgaactg ctcgggtgga tcatcgaccc cggcagcgaa gacgacgtcg acgacatgga    106380
     agcccttcgc aaccgcgccg cccaagaact gaccgccgtc ctccacgcca ccctcacccc    106440
     actgctgaat gcagggtggg aactccgtgg cgaaccgggg cacgtggtgc acctgtcccg    106500
     ctcgatcggg aacttcacct ccatggtcga tgtggtgatc gaaccgtacg tgtggaccta    106560
     ctggaacaag gacttcggtt ggcacaaccg cgtcggcgac atgggcatcc tcggctcacc    106620
     caccgccgga acgtatctcc cggacgacga cctgtcggcg gcacgtgaac tcggtcgccg    106680
     gttggcctgg tgcgccaagc acctcggggt gctcccggga ccgacgcccg cccggaccgg    106740
     cgccgccctc gtcgacaaga tcaagcgtga acgcacccgc agcggcaaag gcatcgtcgt    106800
     caccgcaccc ggctcggttc cacccctgga cggcccgccg cggggagatc tcgaacctgc    106860
     tgtcggctgg acccgcgtcc cggagtctga cgacctcgac aacgcccacc ggttggtctc    106920
     gattgaccaa cgcgccgcct acctcgcctc cgcgggcatg ctcgaattcg gctacgggca    106980
     gcccacacac ctgaccgggg acgcggcggc cactgcggcg gtgggggaga agggtgcacc    107040
     gttcgggctg tggcggatca ccctgccgcc cgggcaaaca ctttcgctgc ccgagaagct    107100
     acctctgccg cacccccaca tgctcgcgga ccaaccggta cagacctggg tgaccacggt    107160
     cagcctcgac gggctgtgct caccagtggc agacggagga atcggcgccg accggggcga    107220
     cctcgacatc accgaggcct gggtctaccc acagcagggc cgggcgctgg acaagtgggc    107280
     caaaatcctg cgcgaggccc gcaaggccgc ggtcgatacc gaagacgacg cgacgaagcg    107340
     gttcctcggc acctgttaca agggctacat cgggcgaatg gtcaacccgg acatgtggac    107400
     tgcgaagcag atgcaacatc accaccaacc gctctggcgg gcgtcgatca tcgcgcactg    107460
     ccggtggcgc ggccgccgtg tcgcgatgcg gattgcccgc gagcacggcc gctggccggt    107520
     ccgcaccgtc accgactcct gggtgtacct cctcgccggc ggtgaggaca tcgccgacgc    107580
     aagcgaggcg ctggggaaga tgtcggtcga gaaggacgtg gtcctcaccg acaccctcct    107640
     gtccgccttc acttcggcgc aggacgttca cgaggtgaac ctcgcgatca aggccgcctt    107700
     cgccgacaac gaggacgccg ccgacgacga agaggaaggg gaggactgat ggccctgcat    107760
     ctcccgaagc cgcgcaccaa gaagcccgcg caggaggcgg tcggcctcga cggactcaag    107820
     gttaccgttg ccaacgccgc caccagcggt gtcgagaagt cgaagcaggt caagagtggg    107880
     ggactcgccg ggttgaccag caaggtctcg gtcaagcagt tgcgcaagga actcggcaac    107940
     gagggcctgc ggcaggcggc gatcgatgcc ggccgcacac ccccatcggc tcgcacgttg    108000
     cgccggtggg cgcagcaagg ccggatcccc cacccggacg tcctcgagcg agcccagcgc    108060
     cgtgccgcga tcgaacgcct cggcggtgtc gatgccgtgg ccgccaagat cggccggtcc    108120
     cgctccgccg tgtcccggta ccggtccggt gaaacgaacg agttgcgtgc cgacgcgagc    108180
     aagaaactcc gcaacgtgaa ggcgcaggac atcatgaaac gcgccggcgt gttgcgaccg    108240
     gacggaacac cgaagaaggc cgtcatccgg gtcaagggcg gtgtcatggt gcgcaacggc    108300
     gccgacgagg gatacgacta ccgggtccgc accctggatt tcgcgaactc cgacacaccg    108360
     ttcaccagtg aagagtcccg cgaactggcc gccgcactgg ccaacgacga tcacgcccgc    108420
     gtcgtggcac tgctcgagcg gcacgccacc ctcgactacc ccgagaacaa gggtttcgac    108480
     aagtacagcg accagttcgg attccacttc gaccacatcg actccgtcca catcgactgg    108540
     atctaacagt cctccactac ctcggctggc cgcgccgaag gtccaccggg ctgctagggc    108600
     atgtctccca ataacttgag ccactcgacg atgccggcga gcaggaatcc ggcgcggtag    108660
     gtgagggcga gtttgtcgta gcgagtggcc accgcacgcc actgtttcgc cttgttgaag    108720
     gcccgttcga ccacgttgcg ccccttgtag gactccgggt cgaagttcgg tggccgcccg    108780
     cccgcgcggc ccttgttcac ccggttcgct gcctgatcgg tcttctcggg gatcaccgcc    108840
     ttgatgcctc tgctgcgcag cagttcccgg tttgcccgtg atgagtacgc cttgtcggcc    108900
     cggacctcgt cggggcgcgt gcggtgcgct ccgcccgcga gccgcggcac gcagatgccc    108960
     tccagcacgt gggcgaacat cggactgtca ccggcttggc ctgggccgac cagcaccgac    109020
     agcgggcgcc cgtgaccgtc gcacgccagg tgcgccttgc tggtcaatcc gcccctcgac    109080
     cggccgatgc cgtgatcggc aggctcgtca ccgaggttcg tgtaattcgg tagatccccc    109140
     tgtgtggcgg gcggcgttcg caccgtgctg atggacccgg accactgtgg aatcgacaga    109200
     gaccgcccag tccaggttcc cgccggcgtc ggccatcgcg accagagccg tcagcacccg    109260
     atcccaggtt ccgtctccgg cgtagcggcg atgtcgcttc cacaccgtct tccacggccc    109320
     gaaatgcgac gggagatctc gccagggcaa cccggtccgc agtcgataca gcatcccctc    109380
     gaccaccaca cgattgttcc ggaacttccg cccccggagc ccatcggaac tgggcaacag    109440
     cagcgcgagc aactcccact gcttgtccgt caacacctca aaccgatcaa caacgtctgc    109500
     cacaccgaag agtctgcagc acaacaccac aaatcattgg gagacacacc ctagatcgac    109560
     accgtgctcc tcacctcgcc gtgggcgtgg caggccgggg acagcggtct gcccacccag    109620
     cgggtcaact accgctgtcc gccggataga ggggcgagcg cgcccattgc ctccatagac    109680
     aagagggtgg gatgtttatc ccacaggctg tgctgacatt cgcggccccc gtgggcgtgg    109740
     tccgggggag accccgaggg ccgcaagtgg acgcctctcg tcgtcgggca atgcgttggc    109800
     tcgccacttc ttcaccgcct ggtagagcca ctggcctacc tgttcaccgt cggcagtgac    109860
     atagttcgcg ggaacgagtg cgtcgccgtg ctcttcgcgg taggcggcaa tttcggaaag    109920
     catccgtcgc cgcttgccgt cggccggtga cacggcagga agtggaagat cgtcatcact    109980
     ccacacgaac ccgatcgcat cgagttgcgc aatgcgttgg ggcggaaggg tgccgagcat    110040
     acgggcaacc cgctggcggt cctgccaaag tcccagtcga aaaccgcatt cggtgacata    110100
     gtcgacgggc accacgattc gggggtgatg gcggcgaaac gcagcgtaga gctgcagagg    110160
     tgaggctgag gaccggtttg cccgcatcga aatcacatcc tttgtgaaag ccgtcaagcg    110220
     ttgcccggat agtcattacc ccaagtatgt caacctattt gacgatctgt cacggaagtc    110280
     gacacgtgtt gggttgcaac ttggcaggtg cgagagccgg tggaactcac aagtctgatc    110340
     accagcgtga agagaccttt cgcgctcgcg caccggcacg ccgagggcct gggcccgtcc    110400
     cccggtggag gaaagcgcgc tcccgcgtcc tagcgctggc ctgatcactc cagcctgtgc    110460
     cacggcgatg tcggtacgcc gtcaccctca tggacatggc gtattcacag gtcaagcctg    110520
     gaaacgtccg gatcggttct cggttcagag gttccagagt cggagcaccg cggctcgcag    110580
     gctggctgag acgatgcggt ggtcggtgcg cagccgggga ttagggtgcc cgacgtcggc    110640
     aagccatact tctgcgtcgg tcaccgcgat cggctccagg tcaattcggg tgcgcagttg    110700
     gtacgccacc gctcggcggg tgtgcgggat cgcgatcgga tcggagtcca cgaccgcggg    110760
     cgggtagagc cattcgttgt cggcggtgac ctggagcagg acgtcaccgc gctggagctg    110820
     cccgcggccg ccgggggtgt cgatgcggaa ccattcgagc tggtacgtcg ccgccggccc    110880
     cgcagacgta cggtggcggc tggtgtgggc cgcccgctcg tgttcctccg cggcgccggg    110940
     ttggtagtcg gtgatgtgcc acaggaacat ccgggttacc ggggtgggga ggaagtcggg    111000
     ttcggcacgg ttgcggccgc cgatcccggg cagggggacg gcgcggccga tctgccagat    111060
     agcggtggcg ttgtcgagaa acacctggtc gacctcggtg atctcctcga taccgtcgat    111120
     gaacttccgc acggcggcga caatgtcggg gtcctcggtg atgaccacgg cctcatcggc    111180
     gatggtggag ctgtgggagg cgttggcgga accgatgacc gcccgccgat cggtgacaat    111240
     cacattggcg tgcagattcg gtgacgacag cacccgcacc ccggcgtcca cgtagtgcgc    111300
     gagcgcggcc ggggaggtcg cgtgtgcgcg caccgcggcc ctcgaggcgt tgacgacgag    111360
     gacgtccccg gcacgcagcg gcagcagagt gggcgcgtcc tctccgaggt aggcgatcgc    111420
     gccatgccga ggtccgcgcg tgcggatggc gcgggtgatg tgcggccacg gactcggccc    111480
     gtggaaggtg atccccatac ccgaaaaggg tagcggggat gaccgcttcg gccggttgtt    111540
     ggccgtcgct gagaatgcag acgatggcgt cacggaattt gcagacgcag gtgtcgccgt    111600
     tcgtcggcag gctgacgggc ccgtcggcac ggtgactgct gtgcgtcatt gtgaacgccg    111660
     ccgatcggca cgatgacgga cgtacccggg cacggcaaga ccggacggga cagttttgtc    111720
     agccgctgcg gggtggggac agcagacgtc cctgtgtgta gatcccgatc aggtcccacg    111780
     gtggatcggg gaacccgaag cggcgacgat cctcgaccgc ggccgccgac aggacgcaca    111840
     gtgcgtcccc gagcggattc ccgacgtacc ggatggtgca gaacgcctcg cgggcgacga    111900
     ggcccagccg ctcggtaccc cggcgatgta gccactgcac atgctcaccg gtagtgcgac    111960
     gtagccagcg gcgcacggtc gattccgggc ggcccatccg ctcggcgatc ctccggaacc    112020
     ccaggccttt cgccttgtgg gccaacgcat tcccgatcac ctcggcggtg tcggcccggc    112080
     gcacctgcag ggcggtgggc aacaggatgt gcgtggcgcc gcagtcgcgg cagcgcaccc    112140
     ttgtgggcgc acggtcaggg tcgtctcgcg gacggtgcgg gcacgcccgt gtccccacct    112200
     ggccaccgtg ccccggcact gcgggcatcg catggtgccg gcgtcgagga aggtgtcggc    112260
     ctcctcgggc cggcgtatga cgatcacagc cgatgactcc gctcatggtg ggaccagtgt    112320
     cgacgactac atccaatcgc accaggggcc ggttcgtgtt ggtagcagcg cttctcacgg    112380
     cacgccgtca cgccggacga cgaacgacgt cgccgccgtc accgcacggt cgtgtccgcc    112440
     cgatccggca tcgctcatca cggctgttct cgttcctcgg cacggtgacg atgcagacga    112500
     tcggccctct gcccggaacc catctgcatc acgggtgacg gttggtggcc ccgtggtcgt    112560
     catatgcaga gacgctcaac accggtcggc cccggatgac ccggcgcaca agcaaggcca    112620
     ccatctcact cgtgaactac aggtgactgc tcactcgtga gtacgggtgt ctgctgtcga    112680
     aggacgtttc cccgtgcctc gggtggtttt ctcaggcaac acaccttttc ttctgcagtg    112740
     tgtcggcgca cgccgcgaga gccgatggcg tgtgagtgta ggagtttcag gcggtgggct    112800
     ggcgtcgaat gaagtcggcc attcccggga cggtgaacgc gatgcgaccg tgctcgggag    112860
     accagacgag gcccttcttg atggcggaat cacggacatc actgaccgcg gtcgtcgcca    112920
     cccccatggc tgcggcgacc ttcccggacc gaggagtggg ctccccggct tccgcgatgg    112980
     cgcgcaggta ccggcgctcc cgatcggtgg cccggatcca ccgagacgga aagaacccgt    113040
     catcgagtgc tcgacggccc tcttcgaccg cggtgtgggc gtcctcggca tcgaatgggg    113100
     aggtgggggc ggtgtgccag atcgccttgc cgaactcttg caggaagtac gggtagccgc    113160
     cgctggcttc gacaaggatc tcgagcgcgt ccggggtgaa cgcacccccg tgcgcctcga    113220
     ccgggacccg gagcgcgtcg gcggcatcgg ccggggagag cgggccgatg gtccggtagg    113280
     agaattgccg ttcggcgtag gagcggctgt cggcgagcac cgccggtagg ctgggcagac    113340
     cggcaccgat gacgaagaac ggccattcac gttggctggc acggtgctgc accgcgagca    113400
     aggcaccgag caaatcaggg tcgaggtcct gcatttcgtc gatgaacagt ccgaacgcgg    113460
     cacccttctt gcgcatgacg tcgctgatcg cttcgaccaa ctcctcgagg tcgaggtcga    113520
     tgtcgccgct ggcggcacgc ccaccgaggg cgatttcgat cttggccggg cccaggccga    113580
     caccgagggt gaaacccctc gcgagggaga cgagatcgtc gatgaccttg tgcagctggt    113640
     gtttgcggct gaagcggcgc agaccgacgg cgagttcgta gccgaggcgg gcgcggaccg    113700
     cggcgatccc ggcctcgttc ggtctggcct cgatggtgat cgccaaccat ccctgccgct    113760
     cggcgtgctc ggccaggttg ttgagcaggg tggtcttgcc gaccccgcgg agcccggaga    113820
     gcaccatccc gcggtcatag ttgcctcgct tgctgcgggc gacgagcaga tcgaactcct    113880
     ggcgctcctg gtcccggccc tccagagccg ggggtcgcag gcccgagccg ggtttgaacg    113940
     ggttcagcgc aggatccata tcggtaagta tagagggtta tgggaaggat gccataaacc    114000
     tctataagtt gcgataggtg ccgagaggtc cggttcctgt agggtctcga gatcggtggc    114060
     ggaatctcac ggcgagtggc gggccgatgg cggatccgcc atcggtgtga gacacgccca    114120
     ttttgaatgc aaggtcattg ggtcgaccgg ggtgatgatc gatggtgagg gctgcggtgg    114180
     tgtggcccgc ttcggcatcg aggttgtctg atggtcgttg atcttgatcc acgcccgaca    114240
     tcggttgtgg cgaacgtccg ccgcagcgcc gatggtgttg aatgcgaggc tgattgggac    114300
     gccctagtgc cggagtcgct ggtcggcgcc gctgcgccgt ggcgaacgtt ccgctggtat    114360
     cacggtcaga agcactattc cggtgcgtat tggtccagca cggagcaagc gttggtgatc    114420
     tacgagtcgc ggctggagtt ggctcgactg ctattggcag atttcgatcg ctcggtgcgg    114480
     cgcattctcg ctcagccgtt cctgctcgaa gccgacgtgg cgggcgcgcg acgacggcac    114540
     gtgccggact atctgctgct gagcgacgat ggtccggttg ttgttgacgt gaaacccgct    114600
     tggcgactgg cgaaaccgga ggtcatgcag acgtttgcgt ggacgcggca ggtggtggag    114660
     tcacgtggat ggcggtacca gattgccagc gaaccggcgg agacagaatt gagcaatgtc    114720
     cgattcctcg ccgggtatcg ccgtgactgg ctgttcgacg acgacttgct ggcggatctg    114780
     cgttcggtcg acttggacgg cgccacgctc ggtgaggccg tccgatgcct gtccgaccgg    114840
     ccggaacctg tcatgcgatc gactgtcctg cacttattgt ggcgacacca tttcacggtc    114900
     gacttgagca agaccctgag ttcggacagc gtgctgggag agcgttcgtg agcggcgcgg    114960
     gtgtgcgagt cggcgtcggg actcggttcc tctacgacgg cgaaaccgtc gaggtagtgg    115020
     agatggtgtc gaccgcttcc gggaacgagg tcgtcgtcaa ggacgcgacc ggccggcagt    115080
     atcgacgctt cgcgctgaag gaactcctgg cgtgcgaacg cgccagggtg atcccggaca    115140
     gccccggccc ggcgagcgac gatgatcagg aagtcgccag cgtagtcctg gcccagctga    115200
     ccacgaccga gcaggagcaa ctcaccgcgc gagcagccca tgtgcgcgag gtacttaccg    115260
     gatatcgatc cggaaacccg ctgatcgccg gccccggcga gcctcgcccc caatacagcg    115320
     agaatgtcgc gttgtcggac cggtatgccg cgaaggccgc cgagttaggg gtcggagttc    115380
     gcacgatcga gcgctgggcc ggcaagttcc agaaggccgg cgaggccggg ctggcggtgc    115440
     ggcgcgaccc ttcgtcagtg agttcgacga gaaccgatga ccggtgggtg gagacggccc    115500
     tggaagtgat ggtcgagcac accgatcagt cgcggccgtc gcggacgatg gtgatcgagc    115560
     gtgcgaatgc ccgggcggtc gcccggttcg gggcggacgt ggtgcggctg ccctcgcggg    115620
     caacggcgtt tcgggtgctc gaggagttgg aacggcggca tccgacgttc cggctgagca    115680
     ccaaacgcaa tcgggatatc gcggcccgac cggacgagcc gtacgggaag ctgcgcccga    115740
     cccgaccagg tgagtacctg ctgatggaca ccacccggct ggacgtgttc gccctggatc    115800
     cggtgacatt gcgctgggtg caggccgagc tgaccgtggg aatggactgg tacacccgct    115860
     gtatcgtcgg tatccggctg acgccggtgt cgacgaaggc ggtggacgcc gccgccacgt    115920
     tgtatcaggc gttccggccg cgaccggcgg gcaaggactg gcccgcgcat gcagtgtggc    115980
     ccgagcacgg cattccccgg tccctgctgg tcgacgcctc ggcgatcgac ggtccgatcg    116040
     ccggggcggc gagtccggcg ctggcgccgg agaccatcgt gatcgatcac ggcaagattt    116100
     acgtctccga gcatctgacc agtgtgtgtc agcggatggg gatctcgatc cagccggccc    116160
     ggttgcggac cggccgcgac aaggggccgg tcgagcggtt cttccgcacc attcgggagg    116220
     acctgttgca ggctttgccc gggtacaagg gaccggacgt gcactcgcgg ggggtggcgc    116280
     cggagtcgga ggcattcttc tacctcgacg agttggaggc gatcatccgg gagtgggtgg    116340
     cggtggtgta tcaccaccgg ccgcacgaga gcctgctcga tccgcatctg ccgtcggtga    116400
     agatgtcgcc ggcggtgatg ttcgagcacg gcatcgcccg cgccggctac atcgaggtgc    116460
     cccgcgatcc ggacctggga tacgagttcc tcaaggtgga gtggcgcacc ctccagcact    116520
     acggtttcga ggtgcacggt cgccgctacc acggcgatct gccgcccggg tgccgcgacg    116580
     gtgccagccc gtacccggac cggggaaagg gcaagggccg gtggtggccg ctgcatgtcg    116640
     acccggacga cgtcacccgg gtctatctgc gggatccgac ctcgcggcgg tggtatccgc    116700
     tcgagtggga gcacgcccgg tcgatgcaga tgccgctgag tgaggacgct ttggcgttcg    116760
     cgcgccggtt ggcgaaggcg aagtacacct accccgacga ccggatcgcg gtcgccgacc    116820
     tgctcgagcg ctggaacctc ggcctcgggt cgagcatgac cgagcgccgc atggcgttgc    116880
     gtatggcacg tgaggacacc gcgctcgacc tcgacccgga cgaaccgacc gacgcgaccg    116940
     gaccgccatc agtgacgcgt cacgacgcga cggcgccggt ctacgccgcg caggacggca    117000
     aggacatcgg tgacgacgac gccgaggacg agctgaaccg acccgacgac ggcgacgatt    117060
     tctacgcgga tgcgctggag tacctgtgac gatcgcgctg atccggcagc gtctgcagga    117120
     ctgcgcgccg ctgggtaatg tggcgctctc ccgtaaggag gggtggcggg agttcgccga    117180
     cgcgcccgct ctggtcgcgc cggcggtgtt gacccgcacg cagctgcagg cgttgagcgc    117240
     ggacgacgcc gaggtctaca accatttccg gcagctgtgg cacgcgaatc tggggccgat    117300
     ccggacgccg caactgaccg cgttgcacga gcagctctcg accgtggtcg acagcaacct    117360
     ccagttcggc gacaaggcca agggggcggt cgcgatcgac gcctatcccg gcctgggcaa    117420
     gacgacgtcg gtgttggcgt tcgccaaggc gtttcatcgc cgcgagatcc ggatcaaggg    117480
     cacccacacc cgcgacgggc accagcggtg gccggtgtgc cgggtcgggt tgaccggcaa    117540
     caccggcctc aaggagttca accgggcgat gctcgagttc tacgcccacc ccgggaccac    117600
     ccgcggcacc agcgccgacc tgtcccgccg cgccctggac tgcgtgacat catgtgagac    117660
     aagacttttg gtggtcgatg atctgcattt cctgcgcatg cacgccacca gcggcgtcga    117720
     gatcagcaac cacttcaagt acatcgccaa cgagttcccg gtcaccgtgg tctttgtcgg    117780
     ggtgaagctg gccgaacgcg gcctgttcgc cgaggcgcag acagcgcggc gcaccacgtt    117840
     ggtggggatg cagccgttcc tcatcgacac cgacaccggc cgccgcgaat ggcggaccat    117900
     gctgctggcg atcgaacagg gactggtgct cgccgacaaa tatcccggca tgctcgccga    117960
     cgacctctcg gactacctgt tcacccgcag caccggccac attgggtcgc tgatggtgct    118020
     gatcaaccgc ggctgtcacc gcgccgtcgt caccggccgt gagcgcctcg acgccggcgt    118080
     attggacggg gtgagcaacg acgaggacgc cgagaccgcg cggcgagaac tcgcggccgc    118140
     cctcgaggcg cggcgcatca ccacccggcc gacacgccgc cgccgatgac cggggtgcgg    118200
     tccctgccga tccgggtcgc cccgctgccc ggcgaggcaa tcgattcctg gctcgaggcc    118260
     atcgcgcacc gcaccggcac ggcgttcggt gacctggaca cggccctgca ccgcgaggac    118320
     cggactgccg ccgaaagggt tcggcgcccg agcgtgtggc cggtgcacct gcctccacgg    118380
     gaagtggaca ccatcgcggc ggcggcggaa ctgcccgcgg ccactgtcga agcgatgacg    118440
     ttggcccgct acgacggcat cgccctgtcg ctgaacggta ggaagggacg tgcggccgcg    118500
     ggcctgccgt ggggtcgcgg acgacgatcc cgatactgcc cggcctgcct cgccgtctcc    118560
     ggcgggcgat ggcaactgcg ctggcggctg gggtgcgtat tcgcctgcag cgaacatcac    118620
     tgcctgctgg cggatacctg cccgcactgc ggaggcttcc aacggtgcag gcgtcccctc    118680
     cgtgaggtga ttccgagtcc gggccgctgc gcccactgga gtgcggacac cgctgcgccg    118740
     agtgggctcg cccggtgcgg ggcggacctg acctcggcac cggtgacgcg gttacgcgcg    118800
     gatcacccgg cgttgtgggc ccagcaactc gtgctcgatg tcctcgcggc cggccagggc    118860
     accttcggtg tatacgccga gcgtcccctc ggggcccgcg aggttctggc cgatctgcac    118920
     gcagtcgcat cccgcgtcct tgtctacggc accgacgcgg agattgccga gcgggtcccc    118980
     gccggcctcg ccgacgcgct ggcccgggtt cggtcgtctt ccgcatcgga agcactgacg    119040
     tcacgaggat cggagctctc tggtgccggc ggagcgatcg caaccgccgt tgcggtgacc    119100
     gcggccgccg ctgtgctgga tcggcccgac atcgccgacg ccggtgaggc gttgcggtgg    119160
     ctggtgcacg gcggtcggcg cctgggccgg caggtcaacg ccggcgtcaa gggcgactgg    119220
     ggcagcgcca ccagcacgag attggcggcc gtccagctcg ccgcgttgcg gcccctgttc    119280
     gtgcgcgccg tcgatcagct gcggtatcgc agcgccgccg acctcccgag ctacccgact    119340
     gtcagtgcca ccgccgtgaa cgacgccgcc cgccgcatcc cgaccctgct ctggccggaa    119400
     tggtcgctgc ggttcacggt gccgccgtgc agcccggcgc aggtccgacc ggccttgtcg    119460
     gcagcactga tgctggtggg caccacgctc accgtcggcg aggccgccga ccgcctggga    119520
     tcggcggtcc gagccgacgg ggtcacccgc acgctggcat gcctgcggag ctctcctcgg    119580
     tgggacgaca ccctgaccgc gctgatccgg ctggcagacc acctcgccgc cgagccgcca    119640
     ccgatcgact acgagcggcg gcgccatttg gactaccgcg gcttactacc cgacgacatg    119700
     tggaaacaga tctgccgccg gaccggaaca ccccccggcg ccggtcagaa ggcggacttc    119760
     gcccgctgcc tgttgttcga acgactcagc gggctccccg ccgaccgttc cccgttcctc    119820
     gcggccggct acgacgtccg cgcgaaactg tccgagttcc cgcgcgccct tacccccgcc    119880
     ctggccgcgc aggtcgacgc ggcggcccac cggttcctcg acgatcaggg gctgggcgag    119940
     gaaccggtct actggcatcc accccgggac ttgctcgacg ggcttgacct gcccggaccc    120000
     gatccgaatt cagtggacct cgccgccctc cacgacctga cccgccgcga ccacaccgcg    120060
     ctgtcggaga tcgcacggca actggacacc accctcgatg tgatccgcca cctcctcgta    120120
     aaccacccag cacccgcatc gccccctgcc gcagagcggt tcggacgacg cgcaacccag    120180
     gccgcggcag aggaggcggt gagccggacg gagttcgtcg acctctactg cgtgcaacgc    120240
     cgcaccctcg ccgagatcgc cgcgatgatc ggagtcagca ggaaggcggc aggtcggctg    120300
     gcacgacacc acggcatcac accccagtcc ggtcggcccc cggtcgatcc ggcatggctt    120360
     cacgaccagt acgtcaccca gcggcgaaca ctgcgggaac tcggacacga gacggggcgc    120420
     agcgtgccgc aaatgagccg gatcgcgaag gattacggca tcccgattcg cccaccgagc    120480
     gaggcctgcc gtaccggcga cgctgcgcgc cgacaccgga cgtcccagtg agcgcggcga    120540
     tcccctgacg cgtcaggtgg cgtcggttga ttcgtcgccg tcggagtcct cgacagtgat    120600
     gtggatatcg cccggtcgca gcaatttcaa gacgggacgg tcgaggccta gcttggcgcc    120660
     ggactgggtg atggattcgc ggagatacgg gtagacggac atcactccga cacgctcgac    120720
     gaactctgtg atgatcgcat cggaggcttc gatcggctcc cggagggtga agaccgccga    120780
     ggcgtcggcg aggtactcgc cccctgaacc ggagacggtt gcccggcatc gaacttccag    120840
     gaggagttct tcgcggcgca gcgcaatctg gatggacagt ggagtttctt ccacgtcggg    120900
     tttgcgccga gcgcccgttt cgaagaacac gatatcggtg agctccgtca gctcgaggaa    120960
     ctcgcgggcg tccgcgacag tgcgaggaga cgatgtttct gtcatacggc tagtgcatag    121020
     ctcgactgaa agctgtcccc ggcccagtcg cggctgattc cgacaacggc aggggcgaac    121080
     ccgaccttcg cctcgagatg tccgctgatc ttcggcgtcc ttctcggggc accgacgagt    121140
     gccgcgtcga tgcggacatg gtcgtccatc gaggggaact cgatgtcgtc gatcttgtaa    121200
     tcctgtcggc ggagccacgc gacaacatct ccccacaacc acgcgccgcc accgaccagg    121260
     ttcaccggcg ccgggaaagg gtccgattgc atgcggtcac cgcgcaccca gtttccgact    121320
     gcttgccgcg atacctcggc tcggtcggcg atgtcctggc gggtgaccag gtcggggtac    121380
     gaccgcacga ccgggaggcc gcgtgacgac agcactgccg cagcgtccag cgccgcggtc    121440
     accgcgtcgt caccctcggc ggtcaccgtg gcaagcgtca aaccgctgtg cgactccacc    121500
     acgatgtcca gcagttcctc gaccgccgcg atccgggtat cacctgggcc ggagacttct    121560
     ggggtcacga aaataagctc gaattcggtc ggggacatga ccccagcttc ctcatccccg    121620
     atgctgttgt caactggaaa cagcgatcgt tatttcatca gctcgtgccg gtcagggcaa    121680
     cgtgatgcgg atcgtttgac ccgcttggcg gcgtttccgg ggttcctgga cgtcccgggg    121740
     agcgtgatga agttcgctcg cccgtcagtg caagggcagt agatcgcgta cttgtgcccc    121800
     tgttcccgca ggcgccagcc cttgttcttc acgaggtcct cgacgaccgc atagacctcg    121860
     ctgtccagcg accgccgggc atccttgagg ctgacttcat cccacgcctc acccattcgc    121920
     cggcctcggg tgcggggccg cgtgccgaga cgcgcctgtg cccacacggt ggcgacagcg    121980
     tgtgggttta ccgggctcgg tgttgatcgg aacctccaac gtcgtcgcgg ccacctgagt    122040
     caggaaacgg accttccaga acctcctgca ctgcgcacag agtttagggc tagacaccgt    122100
     caccgagcgt ttctgtcgga ccggcagtga tgtggacagc tcccacaccc gcggagcacg    122160
     atgaactgtg acatcaagtg cctgatacac gacggcacag agatcacggc gtcggttgcc    122220
     cctcagggac ttaccccgga acgaggcgat tccccgacgc gagtcggaga ccgggtcggc    122280
     acgacccaag gagggatcgg catgatcggc cggagcgaaa catactggca gcagcgcatc    122340
     cacgccgatc gttgcagcgg tggcgccgac ctcccgcccg gcgggattcc cgacgatccc    122400
     gtcgacctcc tcgagaacta tcggcccacc gcgaggtgtt ccgccgccgc tcggcggcca    122460
     cagcaccccg acctctgagc acccgccgcg gccccgaccc ggtgccggcg cgagccctgc    122520
     ggtgcgctga tgtgtgggcg gccatgtccg cgggtagacc cccagatgtc gcccggcgga    122580
     gggaaccccc gcgagcgacg ctacgactct ccaccgtcac gccgacccgg gcggcggttg    122640
     tcgacgttca ggtgtggttg gggcacagtg gatccggtgt catcgtccat ccgcgtcgtt    122700
     ccacctcgat tctgcgcgtg gtccaggaag gccctccgtg aacaacagca tcggatgtgt    122760
     gtcgcggcga ccacatgtcg gcgagtgcgg ccaacccgtg gcgcaggtcg cggctggtcg    122820
     cgtgcgtggt gggcagatac gggggttcgg cgccgaggct ggcgaccggg acagcggcca    122880
     gggcggcctc cagcccggtg cgggccgtgg ccggcatgcg ggtgccgatc agcaggcaca    122940
     gcgcgctgtg tcgcaccgcc tcgatcagtt cggtgtgtcc catggttccg gcgactccgc    123000
     agaacccggg ctggtcggtc gggtagacgt ccttggcgtc cggggcgacc ccgacggcgg    123060
     cgtccaccgc ggcggcgagg gccagcagcg gttcccgggc gtcgtcgcgg gccacctggt    123120
     caccggcgat gagcacgatc ttcccggtcc gccgcgccgc gacgagttgg tcccggatcc    123180
     gtgtcagccc gtccgggtcg tggccggatc ggcgcggcgg tgggtggaag gtgaatgcgc    123240
     cgacgacggt ggcttgttgg atgtccttgg gcagcaacag caccgcgggc ccaccgtctc    123300
     gtgccgcggc caccgcgcgt tccaggtggg cggcgaggtc gtcgggccgc tcgatgcggg    123360
     cacagtagcg ggagacctcg gtgaacagcc ggaccgcgtg gatcgagccg gatcggccgc    123420
     tcgaatcctg gaaggcgccg gtgccctcga ggggggtggg tggctgcccg atcagggcca    123480
     gcaccggcac tttcgaggtg taggactcgg cgagcccggc caccaggttc atcgcgccgc    123540
     cgccggaggt cgcggccacc accccgaggc cgccggtgct gcgggcgtag ccgtcggcca    123600
     tggtggccgc ggcgaactcg tgcttggcca ccaccccctg gacggggcgg tcggtggcga    123660
     acagggcgtc gtagaggtct tcgatgttgg cgccgtccac cccgaagatg tggtgcacgt    123720
     ccaggtcggc gacggtgtcg acgaggacgt cgacgacgcg tcgcccaccc tgctcgtggg    123780
     gccgggctgg agttcccatg atgttctccc ctgagcggaa taactgcggg cgttgttcag    123840
     acgcgagggc gttcgcggtg gtgcgaggtg aggggtgtga cttcgacgcg gggcccccac    123900
     cgtgcggcgc aggcccgccg gtactgcccg gcgagggcgt gcagcaggat cacccgcgcc    123960
     ggtgcgggca gcacgtgggc gacgagccga tactgctcgg cgtcgagtcc gtcgaggacc    124020
     cagggcacct cccgcgccag ctccagcttg ggtttgtcct tgacgatgtc gcggccccag    124080
     tcctcccagt gcccgacggt gatggtgcgg gacacgaccg gcatcatctc gtcctcctcc    124140
     cggcgcagat gcggcagcag cgccgcctcg aggccgtcga gtgcgacgac caccgcctgc    124200
     cgggcgtcgg tggagccgtc gtcgcggtag gcgccggcgg cggaacagag gcggtcgatc    124260
     tccggggaga tgtgggtgtg gtcggcgtcc atccggtcga gcagggtacc ggcgccgggg    124320
     ttgagtcgcc ggatcagcgg ccacaggttc tcgtcctcgg tgcggtggtg gtagcgcaga    124380
     tagtccatca tccacaggag gtggtcggcg acagcgatgc gttgggactg cgccggcggg    124440
     gtcggtgcgg tgaggacggt gcgggcccgt cccaggtcgc ggcgcagggc gtcgtgcagg    124500
     atccccatca tccgggtgtc ggcgggagcg gcccgatcgg tgctcattgc gggtcgcctg    124560
     cttcgaggag tgttctcgcg tgctcgaggt tgctgcggac gtcgcgggcg tacagtttcg    124620
     cgacgattcc gtcggcgagt gcgccgaata tgccgccgag ggacccggat tcctggtgat    124680
     aggtgacccg ggtgccccgg tcggtggatt cgaacagggt ttcggtctcg tacgggaccg    124740
     gactgtcggt gccgcggcgg cgcagatact tgccctgctc gatgtcggtg agttcctcgg    124800
     tgatctcgag ttgccggccg gcgacctcga ccacaccgtg cacgaccgag ccgacctcac    124860
     cggcctgacc cgagaccaac tcgtacgaga tcacattggt catgaacagc gtcacgttgc    124920
     cgggatcctg aatgaaagtg aaaacttcct cgatggggcg gtcgatgacg acggattcct    124980
     cggcgacaat catgatgact ccagtctgga aagggggttc attgctggga ctcgcagtag    125040
     tgcggcgccc tgctcgacct ggttttcacg atcgctggcg cagcatcatc tccccgaggg    125100
     cgatgtcgta ttcgcctgtc gtgttgtcga atcggacgct gtaggtggtg gggtagtagg    125160
     cggtgtgctg gtaggcctgc ggctgcttta cgggctcttg aatcgtcggc ctggtcaaca    125220
     gccacgcgtg ggtcatcatc ggctccatga aggtgtagtt cccgtcccag gacccgttga    125280
     tgaacgtctg ggtgaagtcg tagatgcccg ggatcattcc ggcggtcgcg tccatccagt    125340
     gcacccccat taacggcact gccagctcgg atgcgagcgg cccgggcggg gtgatgtaat    125400
     cgcgggggat gtacttgccg tcgggcaggt gtgcggcgcg ggccgcgtac tccggtgcgg    125460
     cgggatcgat ccccatggtc gaggacatgt cggtcatgta gaagtgcatg tcgaaatgcg    125520
     gtttgccgaa caggatctcg ggttcgtgtc cgtgcgggtt ccagttgagc atgacgtggt    125580
     cgaataccgt cgccgacgcc tgctcgggta agccaagcat gaacatcgca ctggtgtcgg    125640
     gcagcccctc caaggcagcc gccgacatcc ggagaccgac cgcggtcggc tcaccccgcg    125700
     tgtccacggt ggtgtagatc ctcaccgtcc catggccgac gctctgcgac gagccgaagt    125760
     aggtgcggat ctcctccggt ccggcggcgg ccgcgccgca cccggccacg gtgacgcagg    125820
     ccgcgagcag aagtcccagc aagcggtgca ttcgatgatg tcgcatgatg tggccacctt    125880
     gtcgagatcg gtgccggccc ctttcagggt ccgcacaagc tttccttgca cgcgcgccgc    125940
     gcgatcgtca cgagatccgc gcgcagcgca cgggcgagca gcggagcaac catcggcagc    126000
     atcagtccgc ccggccgcgt cgtcgcctcc accgcccact cgatgcgcac acgggtgcct    126060
     aacaccaccg gctcgaagcg catctcgtag acacccccga agggctcgct gagcacggca    126120
     ttgacggtcc gccgcgggcg atcgaacacg gtgtaatccg aggtgccctg cacggtcagc    126180
     ggaccgatgc gcaggaccat cgagtaccgg ggtgtgccat cggcgcggat gtggtagtca    126240
     cgcaccgccg caacccgttt cgacaggttc accagatgct gcccctgatc tgcgaagaag    126300
     tcccaggtct cctcagggtc gaatgggaag accatctcgg cgtgaaccgt ccggctcatc    126360
     acgctcaact ccagtgtcga atgccgcgat acggaacttg tgactggacc cagtgtgggt    126420
     cggcggtgcg tccccggacc atccctcacg tgggggatat taagagcttg tctcatgtgg    126480
     gaagtttctt gaagcaagtg agtgccgcgg cgaggtggag gaatccggcg aagtgctcgg    126540
     cgtggcgttc gtagcggatg gtcagacgtc ggtagccggt gagccaggcg atgatgcgtt    126600
     cgatcttcca ccggtatcgg cccagccggt cgttcctctc gattccgcgg cgggcgatgc    126660
     gtgggacaat tctctcttcg cgcagccacc ggcggtgctt gtcgtagtcg tagcccttgt    126720
     cggcgcgaag ctttccgggt ttgcgacggc gcggccctcg tcgggatttc accgccggga    126780
     tcgcgctgac catcggttgc agcagggtgc tgtcgtgggt gttcgccgcg gacacatcga    126840
     cgaccagcgg gatgccgttg gcttcggaca ggacgtggat cttcgacccc ttcttgccgc    126900
     gatcgaccgg actcggcccg gtcagcgatc cccctttttc gcccggacgc tcgcggcgtc    126960
     caggatcgcg gccgtccagt cgagttcacc ggcgcttccg agccggtcga gcacctcgcg    127020
     gtgcagtctc tcgaacaccc cggccgccgc ccaggcggta aatcttcggt gcgcggtagg    127080
     cacggtgacc ccgaacgagg gcggcagatg ccgccacgca catccgctgg tcagcacgta    127140
     cacgatcgcg gtgaacaccg cccgatcctc caacggcgca ctgccgcctc cctgtggccg    127200
     tgcggcgaat cgcggaatca acggttcgac gatctcccac aacgcatccg gcaccaaccg    127260
     cagtgacaac ccatctaaca cgcgtcacat tatgtcccat acgccacttc atccacatga    127320
     gacacgctct aagcaggccc tcgaccagcg gatactggtc acatgacgtc ggcccgggga    127380
     ggccgaattg ctgcgcgtgg gcgggtagga gttcctgccc catccccaag gtgggcggga    127440
     cgtttccgac tttgattctc gacgcgcgtt gcagtggccc gggagaggtc ctcaggcgaa    127500
     cgggtgtcga caaacccgag tggtcgacta ctccgcaacg ttagccttgt cagaagaatc    127560
     ccgtgcggcg ctcgcccatg ttccgcgcga caacgtgcag ggagttgaga tgcccgatcg    127620
     cagccccacc tcgaccccga tcgcgccgcc gaacgacgcc acgaaggcgc aactcgtcca    127680
     gtgggctctc gaccgcctca acgcccagga cgtcgacagc ctgcgtggta gtttttggac    127740
     cgccgactcc accgtgcact tcccgaccgg gacgtgtcgc gggagcgccg agatcgccgc    127800
     ctacttcgag caggtcttcg ccgccgtcac cgacttcacc ttcgagacgg tctcgatcgc    127860
     cgagtccggc gatgacgtct tggtccactg gcatttgacc ggacggcacg tcggcacctt    127920
     tgtcggcatc gccgccaccg ggcggcgaat cgatttcgag ggattcgacc acttcgtcgt    127980
     tcaggacggg aaggtcgtca cgaacacggt gcgctacgac caaatggagt tcgcccgcca    128040
     gatcaagctg ctaccgcccg acggatcaat tgcggatcgc gcgttgaagg ctgccttcaa    128100
     cgccacaacg cgtgtagtcg gcatcgttcg acgtcgttag ctcgcgatca caggtgacta    128160
     cccggctcgc aaattctcga cgtacggcag atcaccgttc gcagacactg caactcgcgt    128220
     cgaaaatcaa agtcggaaaa accctgggcc actactcaca gctatatcgg tggagcgggt    128280
     gtcctcgctc ggatacgggc gggcacgggg ccgccggcta ccatggtgaa cggcgtgacg    128340
     agtgggaagt cggcaccgag ggactcggtc tggactgttc ggaggatgcc ggccaaggcc    128400
     aatgtcgctt cgagcatggc gaaatgatcc ccgatacagg tgcgcggacc gcctccgaac    128460
     ggcaggtact gccacctggt gcgccccgcc gatcggtccg ggctgaaccg ctccgggtcg    128520
     aaccgaccag gggcgcccca cagggtggga tcgtgatgga gcgcatagat cccgacgatg    128580
     acgttcgtgc cggccggaat tcggtagccg tcgaccgcga catcgcgcat ggccctgcga    128640
     ccgaccgcgg ccgcgggtgg acaggcccgt agtgcttcat ggaccacctg gacggtgtag    128700
     gggatgcggg ccacgtcgtc cacgtgcagt gggcgatcgc cgagtgcggc gacctccgcc    128760
     gccactcgat cttggatcgc gcgatcgcgc cccagggccc agaggctgta ggccaaggtg    128820
     gtcgccgtgg tgtcgtgtcc ggcaaaaagg aacgcccaca gctcctggcg gatcgcccgg    128880
     tcggtgaatg gcttcccggt ctgggggtcg gtcgtatcga agaagagtct gatcagctcg    128940
     gcattccggc cgggttcatc gtgggccgaa gtgatcgctt catcgatcac ggtgtcgacg    129000
     acgtccttcg cggtacgaaa ccggtggcgc gggggtgtcg gcagccaggc tggtgcgcgg    129060
     acaggctgca gcgcgcgatg cgacacgaac cgggcggcac ggtcgagcgc cggtccgagt    129120
     acctcggcct gcgcgccgag gtcgctcccg aacagtgact gcccgagcac ccgcaaggtc    129180
     agtcgccggg tttccctgtc gaggtcgacc tggtccgagc gggcccactc cgcggccatg    129240
     gtctgcgcga cacccgccat gcagctggca tagatcgcga cgtgtttctt ggtgaacagc    129300
     ggctgtaagg ttcggcgtcg gctcagccac ggctcgtggg tgatgttgaa gaggttgtcg    129360
     ccggaccatt ttcgtgattc ggcatggacg gtcaattcct tgtcgaaggc gccgtcggaa    129420
     ccgccgagga cgtcgtgagc accttgcggc gaggtgacga cagcaaatgg cggcaccagt    129480
     cgcttcggtc cgagtgcgac gatcgtgacc ggtccgcccg cgtcccggat gtcctcgaga    129540
     ccggtgtgaa acttgttcag ggccttgacc cgtgcgaaca gcggcatcgg cgcgtcgggt    129600
     gctatcggat actcttgcgc ctcttcgctg gtccgggcca cgacgtcaag tctgacactc    129660
     ggcccggctc gaccgctaga ccaggggacg ccccccgttg aggactcgga caccacgccg    129720
     ctccggtgtt cgtccccgag tcgacatgcg agagctcggc aggaacgacc ccgtctgccg    129780
     aacgcggacc ggggcgttcc gaaaccggcc ccgtggccgg aagccggtga gctgcgcgtt    129840
     cccgtttccc cgtccgagaa aaccgactcg cggaactggg atcgaaaccg ctggcccact    129900
     gcgcatcgtt gttgcagaac tgatgggtga ggcggcagtt cgcccgggtg tgggggcctt    129960
     cgcggtcgat gtggtcgatc gacaggactt ccgggccgta cagggcatcg aagtccactg    130020
     gctccaggca gagttggcat atcccgccgt cgcgggcata gatgtccatt cgggtgaacc    130080
     gctcggcgat gatcttgccg tcgacgtcga ccggcggaat gaagctggcg cggtcgcggc    130140
     ggtggtcccg gaacagctcc cgctctcacc gcgcccggcg gcgcggcgac gcgacattgc    130200
     gtgggccggg tcagctgtcg cacgaccgca gcgctggcgt cgagcacgaa gtcggcgacg    130260
     tccgggccgt ggtacagcgt caggtttcgg tcggagtcgc tgggcaccac ggctccgccg    130320
     ggctagggaa tgccagcaaa ttggccgaat gggtgagatt gtctcggcga gcagtcctgc    130380
     gcgaatggct tcctcaacgg tggacagctg tccgcgaaca tccgcgagct ggggggtctg    130440
     gggcatgcaa cggatcgtgt cgtcgctgtt gacagcccaa attttgaggt ccatcattat    130500
     ggacatgaaa gtggggtcgc cgcgcccgta ccggatgacc gcccgggcgc aatcggcggc    130560
     acagaccacg gagcggatca tgggcgccac gctggagctg taccgggagt attggctgga    130620
     cgagatcacc ctcgagcggg tcgcgggccg ggccggggtg tcgatcaaga cggtgcagcg    130680
     caagttcggc aaccgggacg gactgctgac cgcgacgctg cggtggatcg gccgcgaggt    130740
     caccgcgcag cgcttcccgg tcgcggccgg tgacgtcgac gccgccgtcg agaacctgat    130800
     gacgcactac gagcagtggg ggccgctggg tttgcggcac gtgctgcagg cgcagcgctc    130860
     gccgctcatc gcgtcgatcg tcgcccgcgc gcagggcctc caccaccgct gggtggagca    130920
     ggtgttcgcc ccgtacctgg acccgctgcc ggcggcggat cgtgacctgt tgttcgctca    130980
     gctcgccgcc ggcaccgacg tgctggtctg gcacgtgttc cgcaatgatc tcggcatgtc    131040
     ggccgagcgt accgggcagg cgctgctcgg catgctgcgg gcgctgctcc cggacgcgcc    131100
     acccgaaccg acctgaaccg ggcccatccc gagacccagc ctcctggagg ccacgccatg    131160
     gcacacatcc tgttcgtcac ctgggacggc ggcggcaacg tgcccccgcc ctcggcatcg    131220
     cgaccgagct ccaccgccgc ggccacgagg tccggttcct cgggcatgaa cagcagcgcc    131280
     ggcagatcga gaacctgggt ttccggttca ccgcgttccg ccgtgcccgg ccctggcggt    131340
     cgaccaccgc acaccccgga atccgcggtc tgtacgcgta tctgtcggtg ttcaccgacc    131400
     ccggccccgg gatcgatctg ctcgacaccg tcgccgccga acccgccgac gtggtggtga    131460
     ccgactgcct gctctacggc gccctggccg cggccgagcg ggcccgcctg ccgcgggtga    131520
     cgctggtgca caccttctac gagttcatgg aagcgggcgc caggcgcggc ccggcaccgg    131580
     tgctggcccg cctgaaaggg caacggcccc tgcggttgtg gacctcctcg gacctggtgc    131640
     tggtgaccac cgagcgggaa ctcgacccgg ccgggcgccg gcgccgtgat ctgcccccgg    131700
     cggtccacta caccggggtg gtgccgcacc gcatgccgtc cgccctgacc tgggtcgggg    131760
     agcgggagcc gctgatcctg gtcagcctgt ccagcaccaa cttccgcggc cagcagcaga    131820
     ctctgcaacg cgtcctcgac gcgctgcgcg gggtcccggc acgcacggtg gtgaccaccg    131880
     gcacctccgt cgaccccacg acgctgaccg ccggcccgga cgccgagatc cacggccacc    131940
     tcgatcacga gacgatcctg ccggacgcca ccctcgtcat cgggcacggt ggacacgaca    132000
     ccaccatgcg cgccctggcc cacgacgtgc cgctgatcat cctgccgatg cacccgctgc    132060
     tcgatcagac gatgatcggc cgcaccctcg accaccgcgg tgcggcccgc tgcctgccca    132120
     agaaggcccc acccgaccgc atccgagctg cggtggacac tcttctcgcc gacggcccac    132180
     accgggcggc cgccgccggg ctcgggacga ggatccgctc ccacgacggc tcgatggccg    132240
     cagccgacct catcgaccac ctaccccacc gacaggtacg cagatgaatc tgactgctcc    132300
     gaccgtcggc tgaatccacc tccccacgca ccccgccatc cacacccacc aacacgaaca    132360
     cgacccagga gggcgccatg atcatcaccg aggaatccgt tgtcatcgaa cgccccatcg    132420
     aggaggtgtt cgccttcttc cacgaccctg ccaacgtcac ccggtacgcc aagaaacgtg    132480
     gcgtcctacc agcacgtgtc gggagactgc ggtgaaatgg gcgccgtcgt gcatcacgtc    132540
     gtcaaggtcg ccggccggcg gctcgacgtc accgaggaac tgaccggcgt cgagcaggac    132600
     acgtccctgc gtcgccgcgg cgtcgacact cccgcccccc ttcgagaccg aaatccgctt    132660
     cgccccggcc ggggcggaga gcacccgggt cacctggcac caggagtccg ggaagttcgg    132720
     tggcctcctc ggcaagatcc ccgatgggat cgtcgcgaca ctctatgccc gcaacgccca    132780
     ccgcaatctc gctaacgcga agaccgtgct cgaagcctga cacaccgtgc gggcaccacc    132840
     ctccacgggg cggttcgccc acccggtcac tctcatttcg ccgcgaccac ccgccgccgg    132900
     cacccgtgac atcgagtagc ccgcgaccac ccaattgcgt cgggtgatcc tgccaagaag    132960
     gcctgatctc atgactgaag acacgcgcac tactgccccc accgtcgccc cgtccggcac    133020
     gttcgccagc ctcgacccgc gctcgggcac cgtcctcgcc gaatacccga tcgccgactc    133080
     ggtcgccgtg gccgccgcgg tggatcgggc ccgcgccgcc gcccgctggt ggcacgacca    133140
     gggctttcgc gggcgtcgca ccatgctgct cgcgttcaag agggccgtcg cgtccgacgc    133200
     cgacgccctc gccacgctca tctccgccga gaccggcaaa ccccgcggcg acgccgccct    133260
     cgagatcatg ctggcgatcg agcatctgga ctgggccgcc cgacacgccc gaaaaatctt    133320
     gcggcgcaaa cgggttcggt ccggtctggc cgcgatcaac cagtccgcgt ccctcggcta    133380
     ccagccgctc ggggtgatcg gtgtcatcgg cccgtggaac ttcccgctct acaccccgat    133440
     gggcgcgatc tcctacgccc tcgccgccgg caacgcggtg gtgttcaaac cctccgagct    133500
     gaccccaggg gtcggcacct ggctggagca gaagtggaac tcgctcgatg gcacgcggcc    133560
     ggtgctgcag gtggtcaccg gtctcgggga gaccggcacc gcactcgccc gggccggggt    133620
     cgacaagatc gccttcaccg gctccggcac caccgcccgc aaagtgatga caacctgcgc    133680
     cgaaaccctc accccgctgg tggccgagtg cggcggcaag gacgcgatgg tggtcgccga    133740
     ggacgccgac ctggacaagg ccgccgaagc cgccgccgtc ggcgcgttcg gcaacgccgg    133800
     ccaggtctgc gccggtgtcg agcgcgtcta cgtcgtcgaa cccgtctacc accggttcct    133860
     cgacaaactc gcggccgcgg cgatccgggt gcgtcccggt ggcgacgaca ccgccaccta    133920
     cgggccgatg accctgcccc gccaggtcga catcgtgcgc gatcacatcg cggacgccct    133980
     cacccggggc ggcaccgcgg tcgtcggcgg tgtgggcgcg gtgcacgagc gctacatcga    134040
     cccggtgatc ctcaccgacg tcccggaaac ctctaccgcg gtgcgggagg agaccttcgg    134100
     ccccaccgtg gtggtcaaca aggtcgggga tctcgacgag gcggtcgagc gggccaacgc    134160
     caccgcctat gggctcgggg cgtcggtctt cacccggaag cgggcccgcg gcaccgcgct    134220
     cgcccaccgc ctgcgcagcg gggccgtgtc ggtcaactcg gtcttcagct acggcgccat    134280
     cccggcactg ccgttcggtg ggatcggtga atccggcttc ggccgcgtgc acggcgccga    134340
     cgggctgttc gagttcagcc gcgcccacgc cctgaccgtc gaaagatacc cagccccctt    134400
     gaaactgttc gcgctcgaac gcgcggaacg ggacatgagg atcgccacct ggatgttccg    134460
     gctccggcac gcacggtaac aacgtttcga actcactcac ccgaaatcca accttcaacg    134520
     gcaaggaggc ccgccgtgaa caccgaacaa ccgaccccgg ccaccacacc aacaagcccc    134580
     tcggacatca cgtccgtcgc cgtgcgctgc atggagatga tggccgacgg cgaccgcgcc    134640
     acgttcgagg aactggtgca ccccgacgcc atcaatcgcg agtctcggac cgaacccccg    134700
     gacaccagag tcatcggccc cgaagggttc tacgcgaccg cgctgtggtt acgaggcgca    134760
     tttgccgagt tgcaccacga cgtcctgcac gccgtggcag cggacgatct cgtcgtgctc    134820
     gataccgtca tgaccggccg ccaggtcggg ccgttcgtga cctacgacga acacggtcgg    134880
     gtcgaccagg ccttcgcgcc gaccggaaaa agcttctccg tccgccaaac acactggtta    134940
     cggttcgtcg acggcaggtt gatcgaacac tgggccgtcc gcgacgacct cggtatggca    135000
     caacaagccg ggtggatccc gccgaccccg gccattctga tccgaaacgc tttcgccaaa    135060
     cggcgagcac gcaagaccac tgccgccggg acagcgttcc actagggtgt gtctcccaat    135120
     gatttgtggt gttgtgctgc agactcttcg gtgtggcaga cgttgttgat cggtttgagg    135180
     tgttgacgga caagcagtgg gagttgctcg cgctgctgtt gcccagttcc gatgggctcc    135240
     gggggcggaa gttccggaac aatcgtgtgg tggtcgaggg gatgctgtat cgactgcgga    135300
     ccgggttgcc ctggcgagat ctcccgtcgc atttcgggcc gtggaagacg gtgtggaagc    135360
     gacatcgccg ctacgccgga gacggaacct gggatcgggt gctgacggct ctggtcgcga    135420
     tggccgacgc cggcgggaac ctggactggg cggtctctgt cgattccaca gtggtccggg    135480
     tccatcagca cggtgcgaac gccgcccgcc acacaggggg atctaccgaa ttacacgaac    135540
     ctcggtgacg agcctgccga tcacggcatc ggccggtcga ggggcggatt gaccagcaag    135600
     gcgcacctgg cgtgcgacgg tcacgggcgc ccgctgtcgg tgctggtcgg cccaggccaa    135660
     gccggtgaca gtccgatgtt cgcccacgtg ctggagggca tctgcgtgcc gcggctcgcg    135720
     ggcggagcgc accgcacgcg ccccgacgag gtccgggccg acaaggcgta ctcatcacgg    135780
     gcaaaccggg aactgctgcg cagcagaggc atcaaggcgg tgatccccga gaagaccgat    135840
     caggcagcga accgggtgaa caagggccgc gcgggcgggc ggccaccgaa cttcgacccg    135900
     gagtcctaca aggggcgcaa cgtggtcgaa cgggccttca acaaggcgaa acagtggcgt    135960
     gcggtggcca ctcgctacga caaactcgcc ctcacctacc gcgccggatt cctgctcgcc    136020
     ggcatcgtcg agtggctcaa gttattggga gacatgccct agtactgcaa cggcacttgc    136080
     ttgacaggta cgcgatactg attgtgtggt cctcgatctg gttgctgccg agttggaagc    136140
     gttgcatgag cggatctccg gtcggttcgc ccggtcggag ccgcggtccc gagtccgtga    136200
     atatgtgacg ggtttggttg cgggtctgga acgcaagaac gggtggaccc tcgccgagcg    136260
     ggccggcgag atcagcccgg acgggatgca acggttgctg cggcgcgcgg actgggacgt    136320
     cgacggcgtc cgcgacgacg tccgtgacta cgtggtcgaa cggctcggcg atccggccgg    136380
     tgtactgatc gtcgacgaca ccggattcct caagaagggc acccgctcgg ccggggtgca    136440
     acgccagtac tcgggcaccg ccgggcgggt ggaaaactgc cagatcggcg tcttcctcgc    136500
     ctacgccagc ggcgccggcc acgccttgat cgaccgggaa ctgtacctgc ccgaatcctg    136560
     gacctccgac cgcgaccggt gccgcgccgc cggcatcact gacgacatcg agttcgcgac    136620
     caaaccgaga ctggcgcaac acatgatcga acgcgccctc gacgcacagg tcccgttctc    136680
     ctgggtcacc gcggacgagg cctacgggca ggtgaagtac ctgcgggtct ggctcgagga    136740
     acgcgatatt tcctacgtcc tagccacgcg ctgcaacgac gacgtgttca ccccgcacgg    136800
     ccgctccggt cgcgccgacg agatgatcgc cgcggtcccg gcgaagcagt ggcgccggat    136860
     ctccgtcggc gatggcgcgc acggccggcg cgaatactcc tgggtgcgga tcccgatccg    136920
     gatcgcctgg gcacccgggc gcgggcactg gctgctcgcc cgccgatccc tctccgatcc    136980
     gaccgagatc gcgtactaca tctgcgccgg accccgccgc accacgctca ccgaactcgc    137040
     caccatcgcc ggctcccggt ggcgggtcga ggaatgcttc cagcaggcca agaacgaggc    137100
     cggcctcgac cagtaccagg tgcggaccta ccgggcctgg tacgcccaca tcaccttgtc    137160
     gatgctcgcc ctcacctggc tcgccgggtc gaaaaccgaa gcgataaaag gggaatcggg    137220
     atcgaaaatc agggcatgat cggctacacg ctacccgaga tccgccgcct gctcgtgcaa    137280
     ctgatcctgc gacacgccca ccccgacgag cacatctggt cctggtcgaa ctggcgacgg    137340
     cgccgacaac accaggcccg cacttcccac taccgacgtc gcggacacct cccataagtg    137400
     ccgttgcagt actagcgtcg aattcaggca gaccccgatg ggaaagtccc gatccgcgga    137460
     agtttcggcg gccggttgtc tccatcagga cagtcacgtc ctggccgatc agcctgtccc    137520
     gggtatggcg acggccctga tcacgggcgg gcagccgacg atccaccggc gccgatccgg    137580
     gcttggctcg atcggcacct gtggacaata cgcccaggcc tgttgtgtcc caatcactcc    137640
     tgaagtctga catcaggggc gtcctgttcg cccgcatctg cctggccgca tcgtgatgtc    137700
     ggctgcagaa atgccaggga attgagacat agggaggcgg ccatgccgtg agaccaacga    137760
     caaatcctca ggtcacagcc gtcccaaaat gccatcagta gcgagaccct acaagcttgt    137820
     agtgtctcga gaactgtggc cagatctcac gcaagatggc cactcggtgg ccagttggcc    137880
     gattggttga gattgtcgcg gcgtcgcccg cgtggtgtgg agtcgtggat caacagtgcg    137940
     accgctggcc gctccttctg cgaaagcggc gcggaccgga tcgcagcgtc ccggcggtga    138000
     gtacgcgtgc actgatccga cagtggtcgc gctcgttccg aaagcggatc gatgagagag    138060
     aactcggggt gagatcttcc accccgaggg gggaggtgcc atttcgctgt ctaccggaga    138120
     ctgggatcag cctcgcatct ccggtgcggg atcggagcgg gattcgaact cgcgttacat    138180
     cttctgggag cccgacatgt tcatcaagca gattgcagga ttcatcggtg gcggcgcact    138240
     ggtcgccgca tcagtcgccg cgctgattgc agcgccggcg aacgcagtgc cgggcgtcaa    138300
     tccgccggcg ccgcggttcg tgagcctctc ctattccctc gagtcgacct tcgcggggtc    138360
     ctcgaacgtg gtggacacgt acgccgagtc cgtgagccag gcgtactacc actgcgacaa    138420
     cctcagtggc gctaacgatt gccaggtcgt gatcacgagt gattggggct gcgttacgtt    138480
     ggtgcgcggt tggaccaagg agtcgtactt gggcagtccg caggggaagc ccatattcgg    138540
     cgtgggaaat gggccgacca gggaagaggc tgaacaggtg gccacgatcg atgtcgaggc    138600
     tcgactcgac gccaccccgt acgccgttgg ccacggagtc accaagtgcg tctactgaag    138660
     ttgcggacga atcccggact cacacgatcg gcccaacgtc cggtccgatc gatcaccccg    138720
     aacgtcgacc tcgccccgtc cgcaagcgga acgcagaccg gcacgtcccg aaagccgggc    138780
     gtagaccgga actcactgag ctgcgcgggt cccgatagcc ccgtccggtg atgattttgc    138840
     tttcggggcg gcggattctc actgtcgttg caacacaagt ctattgaaat ctgggtcgtc    138900
     ccagctcacg gattacgtta ccgcagtcgg catcgcgagt tccagcgcag tgcggcgccg    138960
     gtgagcggtg gcccgtcgct cggcgttgaa caccgtggcg ggagttgcgt actccaggtt    139020
     cttccgtggg cgagtgttga gctcacgcgt taccgaccgc acatgagcgt gactgtgcac    139080
     cgacaaatcg gtgcccttcg ggaaatactg tcgagcgagc ccgttgaaat tctcgttcgc    139140
     accccgctgc cacggactgg aacgttcggc gaagtagatc ttcagatcaa gggccgcgga    139200
     gatctctcgg tgcagacaaa tctccgttcc ctgatcccac gtcaacgttc tgcgcattcg    139260
     tttcggcagg ccagaaaatg ctttgatgac agcatttttc accgattcgg cggtgtgatc    139320
     gacggggaga ttgacgatga ttccgtattg cgtcgtccgt tcccgcaggg tcatcatcgc    139380
     cgatcggcag cgcaacccca ggatgtaggg gtcggaccgg ggcgcggtgc cgggattgct    139440
     cccggcccgt ttccccggcc cgccctccgc accggacgtg cgactctcat cgcatccggc    139500
     gctccacgga ctgccactgc taagcaggga ccaaggtctc tgctctgctg gtccacggtg    139560
     tggggatgtt gctcgcccgc caccggtacc gagtaatcgg gacggtggtg gtgtcgaaca    139620
     tgatgatccc gttctcttgc ggacgattgc cgggcctgcc ggtcaggaac cgtcggtaga    139680
     gatccgccca cgtgatccgt ttgtgccgtt tgagcagcca ttgggtgacc cgatgccagg    139740
     cgaaggcatc gaggtaaccg aacgtcgctt tcgacacacc gtgacggaaa tacgcacacc    139800
     atcctcggag caccggattg aggcgtccga gcagatcagc aaggccatga tgacgtgccc    139860
     tcttcgtcag cgcccgcacc ttcgccatga tcgaaagcaa cgctttcttc gacggatagg    139920
     tgtagacgct catcttgttc gtgcctttcc tgcggcgccg ctggatgcgg aacccgagaa    139980
     agtcgaaccc ctcgtccagg tgacataccc gggacttttc ggcggacaac cgcagcccca    140040
     gcggggctat cacgtccgcg acctcgtccc agagtgcgtc cgcatgcgcc ttggttccga    140100
     ccaccatgat gacgaaatcg tccgcgtagc gcacgattcg gtaggtggcc ccgccgcgtt    140160
     tgcggtgcac ctcgcgccga taggcactcc cgtgggaatc ccatttcgca cagaaatgtg    140220
     catccaacac cgacagagcg atgttggcga gcaacggtga gagtatgccg ccttatgaac    140280
     agtgctgggt tatgcgcagc gctggcgtgc aaggcctggt gacggcgatg tcagaggtcg    140340
     atcgctgcgc ataatccgcg gatcctctga tcaggcggcc cggtacggtg ccgggcctcc    140400
     atgatcggag gtcagttgtt atggcgactt tgtctgcgtt ggtgtcgggc ctggaggcgg    140460
     agctacagcg tttgggctac aaggattcga cgctcgtttg gtaccggggc tgttggcggc    140520
     ggatgcagaa gcacttcgct gcgcgtggtg tcgaggagtt ctccctggat gcggcgatgg    140580
     cgtgggtcga cgacgcgtgt ggtttcttcg acaaggagca ggccggcacc ctgaagcgaa    140640
     ccgatgtgta tttgttcaga gttgctcaga tgctggagga ttacgcggtc cacggggcgg    140700
     tgctgcgccg ctataaccgg tcggtgagca agctggacgt ggccggcgcc cagacggtcg    140760
     cccggttcca ggcgcacctg cgctcggctg ggcgctcggc ctcgactgtg cggacctacg    140820
     ggacgttggc cggggagttc gtcgcgttca ccgacacccg cggagggctg ggctgctgcg    140880
     acgccgccat gatcggggcg ttcgtcgcca cgctggccgg ataccagttc aagactgtcg    140940
     agcagaaact gtgcgcggtg cggtcgttgc tgcggtttgc ctccgccgcc ggcctggtcg    141000
     acggggcgtg cttggaggcg gtgccggcgg cacgctcggc caggcaggcc aggatcccgt    141060
     cggttgaggc tgcacccttt gagtggacac cccggacaat ggttctagga gagccaggag    141120
     ggatgtcgag gtgggacgcc agtctctgta cacggaggaa ttccggaaag acgcggtcgc    141180
     gttgtatcgc gcggccgacg gcaaacgcac gtacgcggcg gtggccgcgg atgtgggcgt    141240
     cagtggcgaa acgctacgga cgtgggtccg caaggacacc gcccgtaacg cgcgctcgca    141300
     ggaccgcagt accggcgccg acgggaccga ggcggacgag ctcgcgcggc tgcgcgcgga    141360
     gaatgcgcgg ctgcgcggtg cggaaaagga atggcagctc gaacgcgaga ttctgcgccg    141420
     ggcggccgcg tatttcgcaa aggaggtgaa gtgaagaccc gccgctggga cttcatctcc    141480
     gaccatcgcg ccgagttcgg cgtgcagcgg ctgtgccggg tgctcgggac ctcccgttcc    141540
     ggctactaca agcacctgat cacggagccg gcccgagtcg agcgccaggc cgaggaagcc    141600
     gcgacggtcg ccgagatccg cgccattcat gccgagcacc ggagcgccta cggtgccccg    141660
     cgggttcacg ccgaactccg ctcccgcgga cgcaagatca accgcaaacg ggtgacccgg    141720
     ctgatgcgaa tccaccacgt ggtgggcagg cacctgcgcc gcagcaagcg cacgaccgtc    141780
     gcggacaagt cggctccgtc ggtgccggat ctggtgatgc gagacttcac cgctacggct    141840
     gtcgatacca agtggtgtgg ggacataacc tacatcccgg tgggatcctc gtggttgttc    141900
     ttattagtta cgtggaatca cgccgggggt cggttgttcg tcccgcggtg tcaccacgag    141960
     ctgaggggcc ctgttgactg tgtcgatgat cttggaagag aagtggccgg tcctgtgccg    142020
     gcacgagcgg gcggccgagt ggttgcagat ctggaccgat ctggggcggg cgcctcgcac    142080
     gatcgatgcg tacgctcgcg gcctggccga gtacctgctc gtctgcgagc gtgaaggcgt    142140
     cgatccggtt gtcgcgaccc gggcccaaat cgccttgttt gtaagggact tgcggactcg    142200
     accgagtcgg cgcggtacca atgttgtcgc gttggactcg ggttcgggtc tggcgaacgc    142260
     gacgctgcag cagcgactgg ttccggtgcg gttgttctac gacttcctgg tcgaggaggg    142320
     ggtccgcgag tccaacccgg tcggtcgcgg gcgttacacg ccgggccggc acttcggtgg    142380
     gcagccccgg ccgctcgtcc cgcggatggt caagttgccg tggatccccg gcgaggccga    142440
     gtggttgcag ctgctcgacg ttttccggct cgagccgatc cgtaaccggc tgatgctggc    142500
     gctggcctac gactcggcgc tgcgccgtga agagctgtgc tcgctccgta ccgacgatct    142560
     cgatcccgcg caccgcatgc tgcgggtgcg gccggagacg accaagaccc gtcgagggcg    142620
     ggtggtgccg tactctgcgg cgaccggggt gctgctgtcg ggctacctcg cccaccgggc    142680
     cgggatcagc cgcgcccggg ggccgctgtt cttgtccgag tcacggcgca atttcggtga    142740
     gccgctgagc ttgtggagct ggtcgaaggt ggtgcggcga gtcgcgttgg ctgctgatgt    142800
     tccgcagttc tctacgcata ccacccgaca cctgtgtctg accgacctgg cgcgaatggg    142860
     ctgggagctg catgcgatcg caaccttcgc cgggcaccgt tccaccgagt cgacgctgac    142920
     ctatattcac ctgtcgggtc gggatcttgc ggagaagctg aatcgtgcaa tgacgcacct    142980
     gcatgcgcag cgcatcagca tgctcaccgc acccgacggg acgggtccgg cgtgaccgcc    143040
     gcggttcgtg ccgtcggcga ggcggatgcc acgtggccgg cgtcgacgtt tccggtgtcc    143100
     ctcgaacgct acgatcgccg ggaggagctg accgatgcgg agcgccgagc actgcgcgat    143160
     ttgagcccga aggcgttgcg ccgcaataga gcgcggggaa tcccacgccg gaccgcgacc    143220
     cactggacgg cgctggtgcg gctcgtcgag ccgctcgaca ccgcgcgggc cgggttgcat    143280
     catggcgatg acgcccggtt tcggcgggcc ggggcgcacg cggccgctat catcttgcag    143340
     aactgcgcgg acaccggccg gtcctactgg gcgtggacga gcgaggactg ggcgcagctg    143400
     tgtggttcga gcgccgaggc cttcgtcgcg gccagggaac tgcctaccga gaccaccgtg    143460
     cgtcccttcc tcgtcgctct ggcctatctg ctcggcagct tcgacgcctt ccaactattg    143520
     ggcacattca accggctgca cctggcccgc ctcgtcttcg gcgccgaggc gatcgaggag    143580
     tcgatgcgcc aggccagcgc ggtcctggac cagtgggggt accgcggcgt ctttatcggc    143640
     aaacaccgac tgcgcggggg gctcagccag gccctgctga tcaaccgcag ttccaggctc    143700
     gaggatctgg ataccgcggc attcgaccgg ctgcgcgtgc acccagccac caacgatcac    143760
     caaggcgaga tgctctacgc gctccaacgt gccgtcgccg cactcggaca ctgcgacccg    143820
     ccggtgcgca ccggagacaa cccctacgcc gtcatcgaag gcaccaccga cagctgggcc    143880
     aactgggtcg cccgttggca cgacacctcc acgctcaccc cgcgggtccg caggaccatc    143940
     cgcaccatcc tggccaaggc cgggcggtgg ctcgccgccg aacatcccga gatcaccgaa    144000
     cccgggcaat ggacccgcca gaccagcgcc gcctgggtcg cggccgtgga ccgcatgacc    144060
     gtcggcgact acgtccaacg ccgcgaccac ctccgcgccc gcaccggaga cccgatctcc    144120
     ccacgcacca aagcccacat tctcatggcc acccgcacct tcttccgcga ctgccaggag    144180
     tgggaatgga tcgatcgtcg cttcgacccg gcccgggcac tcgcactgcc ccgcagcgtg    144240
     tccgcactga tcggcaccaa cccgcgtgtc attgccgacg atgtgtgggc gaagctgctc    144300
     tgggccgggc tcaatctcga ctcgagtgac ctgcccggca attccgccca cacctactac    144360
     ccaatggagc tgatccgggc gatcacactg acctggctct tcggcggact gcgcagcgac    144420
     gagctatcgc ggctgcgagt tggctgcgtg cgttggcaac acgacggtca gcccattgct    144480
     gccgactcac ccgacgtgct cgctgaggac gccgtctgcc tgctggaggt ccccgtccac    144540
     aagaccggca ccgcgttcac gaaacccgtc gatccccttc tgggacaggc gctcgaggcc    144600
     tggcaagccc tgcgcccgcc tcagccgaag acactcgacc gcaagaccag cgaacaggtg    144660
     gacatgctct tcgccttccg cgcgcacccg gtcgcaaaga actacatcaa ccgcacgatc    144720
     attcccgcgc tctgcgccaa ggccggtgtt ccgagcagcg acgtccgcgg caacatcacc    144780
     agtcaccggg cccgctccac gatcgcgacc cagctctaca acgccaagga accgatgaca    144840
     ctgttcgagc tgcaggcctg gctcggccac cgcaccccga acaccaccca gcactacgcg    144900
     aaaatcaccc cgaacacgct gtccaaggcc tacaacgaag ccggctactt cgcccgcaac    144960
     gtacgcacca tcgaagtgct cgtcgaccgc gacgccgtca cctccggcgg cgccgccacc    145020
     ggccaaccct ggcagcacta cgacctcggc cacggctggt gcagctacac ctttttcgag    145080
     cagtgccagc accggatggc ctgcgcacgc tgcgacttct acacgccgaa agactccagc    145140
     aaagcccagc tactcgaggc cagcggcaac ctacaacgca tgctcaccag catcccgctc    145200
     accgacgacg aacgcgccgc cgtcgatgac ggacacaccg ccgtcgcggc gctgctcgag    145260
     cgcctcaccg acctccctac acccgccggg cccaccccac gagagatcgg tacgtccccg    145320
     accgtgaccc tgctgccgat cgtgcaagtc cgacacggag aaccctgatg aacttgacaa    145380
     tcctgattcc acataatggc cacggtgatc gacatcttct cacgccgggt ggtgggctgg    145440
     tcgatcgctg accacatgcg caccgatctc gtcacggacg cgatcgagat ggcggtgcgc    145500
     acccgcggtg gtgacgtcgg tggcgttatc ttccacagcg accgcggatc acagggcgga    145560
     ttcaaccggt cgtcgcaaca ccgtgccgtg aggacgagtg tacctgttcg gcaaacactt    145620
     ccgctggagt tctccaaccg tgcacttttc gggggcggtt gttgagcgca tcggcgaccg    145680
     cctgaagctc acggaacttg tatcgggaca gatcagttcc cttcggaaaa tattgtcgca    145740
     gcagcccatt ggtgttctca ttcgttccgc gctgccatgg actgtacgga tcacagaagt    145800
     agacacggat acccgtagat gccgtcagct cggcatgacg cgcgagttcc tttccgcgat    145860
     cccacgtcac ggatctgcgt agatgctcgg gcagcggtga cagcgtcgcg gccagagcat    145920
     cacgaacgga ctccgaacca tatccggaca gcgccggccc gttcttcacc atcgccgctg    145980
     ttccatagcc cttcagtcgc ggcaggtgta gtagagtcgt gtatctgctg gtgcgctcga    146040
     cgagcgtgcc gatcgcggac cgggtcagac cgatgatgag gtcgccctcc caatgccccg    146100
     gcgtcttccg gctctcgacc tcctccggac gggcgctgat ggtcacctcc tcggtgataa    146160
     atccggtgcg ctgcttccgt gctcgcgcac gaggctttcg cagcgcccgg ccggtgcgca    146220
     agcacgcgac gagctcccgc tccaggccgc cgcgaccctc gatgtagagc gattggtaga    146280
     tcgcctcagg tgaaatgcgc atcgtcgggt cctccggata gtcgatcggt aggcgattcg    146340
     agatctgctc cggactccac gccgtcgccc accgacgatc accgcgccga ggcttgtttc    146400
     ggccaatcca agcggcatcc ggaccggaca ccacggttcc atcgtcggca cgaatcacac    146460
     cagacagttt gtcctgcaca tattctcgta gccgatcgtg ttcggcgagc ttcgctggtt    146520
     ttgggcgcct cgcggcgagg tcggccttcc actgtgcggt cgacgctcgg tatgtgagct    146580
     tgccattgcg ggtggcggcg ttccgccgca actcccgcga gatcgtcgac ggtgaccgtc    146640
     cgatccggtc agcgatgtcg cgcatactca tacccttggc tcgcagcagc gcgatatcct    146700
     cacgctcggt gaacgacagg tacctccccg agaccggggt caactcgatc ggtggcatcc    146760
     caccagcctg gcggaaccac cgtgtcccca ccggccccga cacgccgcat gtggtcgctg    146820
     cgtcgtcgct cgtgagaccc tcggcgatcc gcgtccagaa tgcccgctct agatctcggc    146880
     gtatcggagg ccgtcccggt gaccgcatca ccgcacgccc cgtcaacgct gctgcccacc    146940
     cgggtggtcg tcccattccc acacctccgt tatcgaggtg ttgcttccac cggttgagcc    147000
     tggtcagtac accgcagcag ctttcgtcga tgtatgccgc cgtcatggga ttcagctaag    147060
     tcgaggacgg gtcggctcga gttacgataa tgctctcgcc gagtcgttct tccaaggact    147120
     caagagggag tggctgcacg gacggagttg gacgtcgaag tcgcaggcac ggctggacct    147180
     gttcgagtgg ctctcgtact tcaatcgacg tcgccgtcac tccgccctcg gatacctcac    147240
     cccagtggag ttcgaacaac gactcatcgc gtcgtctacg ctgtcagtcg ccgcatgaaa    147300
     tccggtgtcc actcccgagg ggcaacctca cgtgtaattt gccccgaaga ggtcaacgta    147360
     gttcaggtca ccgaggacgc gtcctgcgcc gagatcccaa ccgggaatct tcccgtcgtc    147420
     gaatcgaacc ggaatcagcc aggtcacgcc gggtgccatc tggcggaact cctcgacggc    147480
     gagagtgagt tcttcgttca tgacggtctt gggccgtgcg cgggagttgt cggagaaaca    147540
     cgcgaggaag atcagtgctc ctgatcgaat tgcatctcgg atttttgcct tccaattgtc    147600
     gccgggggcg agtgatgtcc ggtctctcca gtaggggatc tgggctgcgt caaggatttt    147660
     gcagagttgg tcgacctgct gttgatcctc tttgacgtag gagatgaaca cgtgtttgcc    147720
     ctcggctgat gtcacgccga gatcgtatcc ttccctgatc cggggcgatg gcatgtacct    147780
     gtgtggtgtc gtcgggggcg tccggcggtt taccggcgtc gggtgtgggg tggcggcccg    147840
     ccgggtcagg gcagctccgt gttgaggcac gcaatcatcc cgaacagctc acccggaact    147900
     gttctggtgc catggaagtc gcggagcgag cgtgctgccg aggagggcac tattacatcg    147960
     aggagtcagt ttgggtgaat ctgatgctgc cttgggacgt gagtgggtgg tgatcgatcc    148020
     cgccacagtc gacggaggtg ggtcggactt gggccccgac gacggtacac ccgcaactgc    148080
     tagtagaccg tcgcggctaa gtgttgggat ataggtggcg gagtttgatg cgggcgtcgt    148140
     cggtggtgaa gtgccactgg acctggcgtt gatcggcgtt ggtctgtcgt tgccaggcgg    148200
     cgagttcggc gttgaggatt ccgaggtcct cgatgtgccg gtccaggtac tggcgggtca    148260
     gcgcggagag ctcgatctcg gcgatgttga gccacgagcc gtgtttgggg gtgtggtgga    148320
     tcttgagccg ctgcgcgagc gcgaacgcct cggccggctc gaaggcctcg tagagcgatc    148380
     cgatgccgtg ggtgcctgag gttgtccatc accagcaaca ccgtctctgc gtcgggatag    148440
     tccacgcaca gcaggtcttt gacctgcccg gcccagtcga ccttggtgcg ccggggctgg    148500
     gaatcgacac gccgccagcc ggccaggggc tcgacccagc agaagatcga gcaggtcccg    148560
     tgccgcacgt actcggagtc ctccttcaga tcgcgtcccg ggcccgctgg gatcgggtca    148620
     tgcgcgtgag cgaggagctg gtagggattc tcgtccatgc acaccaccgg gcgtgaggga    148680
     tcgtgggggc gggcgtagac cgacaggatg tcttccatgc gggccgcgaa ctctgcgttg    148740
     gcccgcggcg ggatggtcca gcacttcttc aggtgaggac gaagtttcgt ttttttaaaa    148800
     cccggccgat ggtcgagtgg tccaggtcgg ggatgtcgtc gaccagggcg acgtgcttct    148860
     ccagcagtcg cagcgaccac cgcgaccgac cctcgggcgg cttcgagcag gccaacgcaa    148920
     tcaacctggc ctcgatctca ccagtgatct cccgacggca ccggtgggag gtcacgctgc    148980
     ttgcgaccga tcgtggcctc cacgtctcga ccggtctcag cgaaccgatt ggccaccagc    149040
     cgcaacgtct cacccgagac ctccaaccgt gccgcgatca cctccttctc atcaaccacc    149100
     ccgaccgagg tgtccagcgc cagcaacacc cgggcccgcc ggatcatcgg gcaggtgctg    149160
     acctggaccg tcgacgaagc accggaagcg gacggatggg agttcgcgca cctgtacccg    149220
     aacggcgctc gggcgcaccg caccgcactc ctgcctgacg gacatcgcaa ccgcggtgac    149280
     gactggcggg gaagcccgga tggggttgct gccatggcgg ctttgctgcg ggtcagagaa    149340
     tcgtgcggca ctctgtcgcg gcgtggaccg cggacggctc gaatgacagg atggccaggt    149400
     cacgacgccg gcgttggggg cggttcgggt ggtggcgcgg gcgcgcgtcg gggtgggtga    149460
     ggtcgcgtac tcgcacgtcg aggagttggg ctagggctat tgtctgatcc caggtcgggt    149520
     aggcctggcc ggcctcccat aggtcgacgg tgggttcttc tgcgtggcag gcgatgtcga    149580
     cggtgggccc ggagtgtcgg ccgttgtcga ggaggtggct gatgtaccag gggacgagct    149640
     tgccggcttg ccagaggtcg tgctcgtcgc tgtccggatc gacgaaggga ccactgacgg    149700
     cgaattcgct cgcgaatagc ctgaggcgcg cgaggtccgc cggcgatgct gattccacgc    149760
     tctgttcgac ccccggctga tcgcgggcgg ttgcggatct gcgacgaaag aacttgaaca    149820
     tgggtgctcc tgtcggtgtg agggcggacc gtgttagcgc tcacccagat gtcagcggcg    149880
     gatcgttcag gggtgtatgt cgttttgtcg tcgtatctta tgggcgtcac ggccgacgct    149940
     gccggcggtc gatggttccg tgacttggcc tgcgcgagcc tctgacgtgg gcagtgtcct    150000
     gtcttcgaca cgagaatgag ggcatggtcg tggagatgaa gcacgatggc ctgcggacgg    150060
     cggcatccgc cgccggcccc ctgtcgcccg tgaggctgcg gcacttgggt gacgatggcc    150120
     ggcatcaccg gcgccgtccg cggccggcac cgcattgtca ccacgagaag cgacgatacc    150180
     gcgccgcgtc acccggctct gatcggacga gcatggtcga caccgaccca cccggctcag    150240
     tggtgggtag ccgacttcac ctacacctgg acgttgtcgg gattctgcta caccgcgttc    150300
     tgcgtcgacg tcttctcccg ccggatcctc ggctggcgag tgatgaccag caaatctact    150360
     ccgctggtca catcggtgct cgaacaagta ttgttcaccc gacgtcgaca cgacttccac    150420
     ttcacagcaa ccggtttggt gcatcactcc gattaagccg aggttttcgt tagccgagga    150480
     attcagggtt agggctggtc agctgcttat gtcggtcgga tttttcggct taacgtttcc    150540
     gattcatcga aggtgcagaa ggatcgcagt gcgttttcgg tgaggtggtg ttcggcgggg    150600
     cgccggggtt gaggaggcgg cgttgacggc ggcgcgcgtc aggtcgatgg tggcgagtgt    150660
     gtagaagatg gtggtggttg gtacctttcg tggccgagga gacgcatgtc ggcgacaacg    150720
     acggcaccga tttggtgctc gtcttgtcca ttgcaacatc cttcccattg gggcaatgga    150780
     caccgacaaa cgtacgccag gcaatcaatc attaagccga agaattcctc agaaatctct    150840
     gcagcacaga aatacaggca cttcctcggc ttaacgaaaa cctcggctta atcggagtta    150900
     agccgaactc ggcttaactc cgatgcggga agccaataca cgtcgctggc cttcacccat    150960
     gtgctgcagg aagccggcat cgtcggatcg atcggcagcg tcggcgacgc cctcgacaac    151020
     ggactcatgg aatcggcgat cggcttgtac aagaccgagc tcctcggccg ccatccgata    151080
     ctgaaaggga gggccgaact cgaacgcgaa acggctgcgt gggtgcactg gtacaacaac    151140
     agccggcttt ccgcactcga ctacctgaca ccggtcgagt acgaagatcg ctaccatcaa    151200
     cagaccacct cgagtgaggt ggcgtaaacc gggagtctct accgaatcca ggacgcttca    151260
     gttatggcgg acggcgggtc ctgtggcagc aggcgttgcg tcacgcattc ccccacaaca    151320
     cgaatgatcc caatgggtac atcgtcgccg accggggcgg gcgtttgcac ggcctccgta    151380
     accgcgtctc gcacatggag cccctgctcg gcgtgaacat caccgcccgg cacaacgacg    151440
     cgctccgcat actcgccgcg atcagccccg aggtccggga ctgctgcgcg ggcatgagta    151500
     cggtcatcga gattcggcgg aagtgcccca tcaggctctg accagatcgt ctggccacga    151560
     gcaacggcgg gcgttaccgc atcaccagca gtgcaggggg ggcagcgccg ccggcagctt    151620
     ctacggttac agcggcttcg acggcggtgg aggatattcc gactgcggaa acggcggcgg    151680
     ttgcaactga acaaccacgg gcgtgagaac ttccattcca gcgccaccga actgagcgcg    151740
     gttccagaag aaacgccgat taccgatctt ggggagtcag aggtgagcgt cccgaatttc    151800
     gcggattttt ttggggttcc atagacgctg cggtcgatat gtcgtcgatg gaaggcccat    151860
     cgcctccggg ggaccgcagg cagagcctcg atgagatagg ccgccgccgt cttcggatac    151920
     gcgggcaacg ccgtgtcgtc gtgaccagtg caccagctct cgaagcgccg ccacgtcggc    151980
     gcaatggcac ggtgggcgcg cttccagcgg gatgtggaca ttagcgggat gtggacatta    152040
     ctgcccgaga ggggcagcga ccgcctccga catgccggcg attcgcaggt ccggacgtgg    152100
     cggtggaggt cggggttgac gatgtgtcgc gcgtctagat cgctcgttca gatcgttctt    152160
     gctcggctgc ttcgtccggc agcgaccgat cgggagttga gatagcttcc tgagtaggtc    152220
     atggagcctc accggggacg acgtcacccc aggccgcgcg cgaacctgac tcgccgattc    152280
     ggtagacctg cacgatggtg ctggccgcca cgacgatcgc gagaatcgcg acgatccatg    152340
     tgagcgggcg tgacggtccc gcctttcgtt cgcggaggtg taccgcggtg atggccagtg    152400
     cgatcagcag aagcgccgcg gagaagtaga tcatggtgtc gccgcgttcg gtgtgcgcat    152460
     ccacggcagc agtgtcagta acattctttt cgagccattg cccggcgtcg gtggtcagcg    152520
     gggtcaaagc agtggtgacg gccgcgagca ccagtgtcgg ccacaccagt cgatgccggg    152580
     cggtcggcca cacgctgcac aacatgacga gaaccgctgt catcggcgcg agtaccacca    152640
     tgaaatggac gagcagtaca tgtacgggta aaccgttgac agtggacatg ggccaattgt    152700
     tcagattcgt gctgagaaag cgctgaaggt cagctgtggc ggaggctgcg gtgtggtcac    152760
     agttctgacc gtgtgctgag gacggcgcgt aggcccttgt tgaacagatc ggtggaatac    152820
     accagtttgg cgtcgatacc gtctggtgca ccggtgccgt cgtgccgttc ggtgaaatag    152880
     aaatgcggat cgcatttcgc gatgtcgagc ggactgggcg tgatgtcgaa gtgagtccgt    152940
     cgacatcgcg ttcggcgggg gcgaagtttt cgagcgagat cgcgacctgg aagaacgggt    153000
     gcaacgacgg tgaccgtgcg ggatcgagga tctccaccag gcgctcgaac tgcacatccg    153060
     cgtgcgcgaa cgcccgcaac tcgatgtccc gagcaacggg ccaccaggtc gtcgaaggtc    153120
     gtggtcgact ccacctgtgt gcgcaggacg acggtgttga cgaacattcc cacgacgtcg    153180
     tccaggctcg ggtggccgtg tccggcgacg ggagcgccga tggcgatgtc ggtggcgccg    153240
     ctcagccggg caagtagtag cgtcaccgct gcgtgcagtg ccgtgaacag gccggtatgg    153300
     tgggtgcgcg ccgcctcgag cagtgcgcca tggacggccg gggcgatggc gaagggcagg    153360
     cgcgccgccc cgtaggacca cttctcgggt cgggggcgat cactcgggag cgagagcgct    153420
     ccggtcaatc ctggccagtt cctctgtcca atagtcgatt tgggcatacg cgagacttcc    153480
     ggggtcatcc tcgctgtccg aggacagccc gccgccagag ggtgtagtcc gcgtactgca    153540
     ccggaaggtc ctgccactgc ggcgccgagt cgtccgcccg cgcgctgtat gcgaggacga    153600
     ggtcgcgcgc caacggcgcc aacgaccacc cgtccacgcc gatgtggtgg aacgtgcagg    153660
     cgatcatgtg gtcgtcgggc ccgaattcga agacccgaat ccggaggggt ggatgagttc    153720
     ggacgtcgaa tccagctgta aggaccgccc tgatgtttct tcgtcggcgg gggtcgggga    153780
     cggcgtcggc gagcaggtgt tggtaggggc cggcgggagt gtcggggtag atggtccgca    153840
     gtggccggtg ccgttcgagc acatcggcga ccgcacgtcg aagagcggtg tggtcgaacg    153900
     cgccgcgaac acggagggtg aacggaatat tgtagtgggc gggcgcggtg acggttctgt    153960
     cgatgaaagt ctgtgccggg gaaagcggga gtcggtcggg caggggtatc gcgccgagcc    154020
     ggtggcgatc cgtatcgcgc gtcgattcgc cgatccgggt ggccagcgcg gcaaccgtgg    154080
     gcgcgtcgaa cacgtcccgc cccccgagat cggtacccca gcgatcattg atccgggaca    154140
     ccactcgggt cgcggacagc gagtcgccac cgaggtcgaa aaacgagctg tcggcaccga    154200
     ccgcggaggc accgaggacc tgcgaacacg tcggcgacgg cgtgttcggt cggtgtctcg    154260
     ggatctcgtc gagaccgtgc gccgtcctcg aaggtgggat agggcagcga cgcacggtcg    154320
     agcttgccgg tgggggacag gggtaccgag tccacgagca tgattgacgc ggggaccatg    154380
     taatcgggga ggaaccgccg gactcgtgca tggagctgct cgacgtcgaa cgtctcgggc    154440
     tcgcgcggca atacatacgc gacgagcacc ggattcccgg tggacccgcg atgcaccacg    154500
     gtgcggcaaa ggtgatgtcg ggatggtccg aaagagccgc gtcgatctcg ccgagctcga    154560
     tccgcagacc tcggatcttc acctgatcgt cggcccggcc gaggaactcg aattcgctgt    154620
     tcgtcgacca gcggatgtgg tctccgctgc ggaacatacg cgagcccggt tcgccgaagg    154680
     ggttcgcgac gaacgtggcg gcggtcaaac ccggacgtag gtggtagccg cgggcgagac    154740
     ccgctccgct cagatgcaat tcgccggtgg cgccggggga gcggacgcag attccgatcg    154800
     agcaccacgg cgcgcacccc gcgcatgagg ggccgatcgt gaccggtgac tacggatcca    154860
     tcgggtcggt caaggtgaca ctgcacgtgg tttcggtggg agaccgtatg catttcgcat    154920
     gtcacggcct tgggcccagc gtcggaccag cgggggcggg cacggttcgc cgccgaccag    154980
     caccaattgc aactcgtcga gacctgccgg gtcgacggtc gccagggagg aaggggtagc    155040
     cagcagatgg gtgatgtggt gttcccacag gaacttggcc agttcccgac ctccgaaggc    155100
     ggttgcgggg gccacgacca gggtggcgcc ggcattggcg gcggccagta tctcgaccag    155160
     ggcggtgtcg aacgtcggtg aagcgaggtg caggagacgg gacgctgtgg agataccgta    155220
     tttctcgcga atctcttgag cgaggttcgc cagtccggcg tgggtgacga cgcaccacct    155280
     tcggggtgcc ggtggaaccg gaggtgtaga tgacgtaggc ggggtggtcg cggcggaggg    155340
     agtgtgtgcg ttcgaggtcg tgtacgggtc cggatcgctg atcaccgcac agttcctcgg    155400
     agtcgagcgc aagccatttg agtgagtcgg gtagtcgatc acgtgcctgc gagacggcga    155460
     gtccgatcgc ggcgcccgag tccgccacgg tgtacgtgat gcgatcggca ggatggcagg    155520
     ggtcgatcgg aacgaacgcg gctccggact tgaccaccgc ccagaggcct accactgatt    155580
     cgatcgatct ggagtccgcc accgcgacaa gcgtttcggg gccggtgccc cgagagatca    155640
     gtgcccgggc cacccggctg gaccgccgat ccagttcgac ataggtcagc gcccgttcgt    155700
     ctgctcgcaa cgccaccgct tcgggatact gctcggtggg cagtccgcgg caccggatgc    155760
     gggcacgaaa ccggtgcgct cacccggaag gaagaggccg agatccgcga tcgcggtcga    155820
     ggagtccgcg gcggcgaacg tgtccaggaa cgcgatgaac catcgatggt gggcgccgag    155880
     cttgtcgtgg ctgtatgcgg tggagttgcc ttcgaagtcg atgcgcggca acgatccgat    155940
     cgatcccggg tacacgttga tcgccagttc cgaggtcggc ccggtggtca ggacctgcac    156000
     ctgtccggtc acaccgccga aggagatctg ctgtgtgaac atcatcaggt tgatgaccgg    156060
     tccgaacggc gccggatcgg atggggcaga cgcggctgcg cccgaatggc ggtcgcgtcc    156120
     gatgtcctcg cgtcgatacc gctggtggcg gagggcggcg gtcaacgccg cctgggtggg    156180
     tttcatcgcc tccccgaccg tggacgagcg gacccgccgt cgccgcaacg gcagcatatt    156240
     cgatactgat cctgcggaat tacgcagtag agcactagtt ctggccgaaa cgggcagtga    156300
     gagaaggatg ttctcggcgc cggtcatgag ggcgaggaag gcggcgaacg cggacacgat    156360
     caccgccgcc gaacggagcc gccgcggtcg acgagggcgt tgccccgggc ggagacggcg    156420
     ccgctgaccc ggtgtgccgc tgcgccgggt gtgctgctgc gcccgagagt cactgcgtcc    156480
     ggcaggtccg ctgtctcgcc aacccagaaa tcacgatcgc ggcgtctctg gtcggactgc    156540
     tggtagcgca ggtcctcgtc gagcagctgc ccggggtgca ccaccggatg ggcgggagct    156600
     tcccgctgtt cgagggcggc gacgtacagt tcggcggtcc ggccgatcag tgtcatcgcg    156660
     ccgtatccgt cgagggcgat gtggtgggcg cgcgaatacc agaagcagcg gctgtcggtg    156720
     agccgcagga tgtgtgagac cacgaggtgc tcgtcgtaca tgtcgaggga gatcttgcgg    156780
     tcccgtcgca tccatttcat gagctgcctc cagcggcgcg tcttcggcgc tgaggtcgac    156840
     gacggtgacc gatacgttcg cggccggtgc gacgacgacg gcgtgggggt gaccgtcgac    156900
     gtcgacgagc cgaacggatc cggcgccgag ttcgcggtgg gcccgctggt tggcggcggt    156960
     cagcaggtcg aggtcgacgg agccgcggag ttcggtgtac tgggcgatga cgaagggcac    157020
     ctcgggggag agatgctgtg cgaaccagat ggccttctac gccccggtga gcggaagggt    157080
     ctccggtcgc cccggcaggg cgcacaccga gggcggccca tcgatcgacg aggtcatgcc    157140
     gctgccctca cgacaacgat ctcctcggcc ctgtgcactg gagtgatcag accgcgtacc    157200
     tcgagcatct ggatgcgcga ggagagaacc ggaccgaacg ggacctcggc cctcgctgcg    157260
     atgtcgacgc gcagcccctg ttcttcgagg atgtttgtat catctcgatt ctccgctgag    157320
     tgaggactgg gcgatcagca gtaccccgtc cgcgtagagg acatccggtg cctcgataca    157380
     gatccggtcg agcagtgccc gtccgttccg tcccacgccc gctcgccccc gcggcttggc    157440
     agctcatcgt tgggggcggg aacgtaggga ggattggtga ccaccaggtc gaacctgtcg    157500
     gcgcggaccg gagcggtcag gtcgccgcgc gcacgacccg gatcgaccgg cgatgcatcg    157560
     cggcgttgag ccgcgtgttg agcctagcgc ggcgggagag gtccactgcc gtcacccggc    157620
     cggcgcccgc cgcgagggcc cccaggctca gtgcccccgt tccggtgcac aggtcgagga    157680
     cccgggaacg gggtccgagt ttctgcgatg cgagtacctg tgccagcaac caggtgtctg    157740
     cctgtggcgg atataccccg ggcaggcgca acagcaccgg tactcctcgc gattgcggca    157800
     gcggtcatca ccgactcgtg gacgatccgg agtggtggct acacacacgg ccttttcggt    157860
     cgtgcggtgc agcataagat ccgcggtcgt cgagtccacc aaaggatcga aacacggact    157920
     tgtcctctcg cactgtgtgc ttgcccgatc gttcccgccg gggctcggcc gctggggcca    157980
     gatgtcctag gccggcaggc ttccggtctc gaggaaaatg acccgccgcc gatctcagca    158040
     gtgtggtcac agaatcgttc gtagaagcgg ccgagcagag tgatgtcgac agcggcttgt    158100
     accccgtgag gccattgctc ggcttgggtg atcgtttact ctcggctatg tgcacggcga    158160
     gtccacccat gcgtcgtagg tcgccgacag cacgaggccg ccgaccatga cacgcagatc    158220
     atgcgcgacg ggcgcctgca gcgggagcag cgagaacgcc cgctgctccc aggtcgtggc    158280
     gtcattctcg agtgctccgc tcgcgtcgat gacacgctcg gccagagtga ggtccgcatc    158340
     cagcagcgcg ttcgtcgcat ccgacaccgc ggtgacggtc agcgcgcatg tcgcggccaa    158400
     gccaccggtc agcccgtcga tgctatccgc gaatcgtgtg cgcatccgct cacggtcagt    158460
     gggcactgtg cgagcgtcgt cgggcgtccc aacatcgttt accacctcca ctgcaccgcg    158520
     tgtgcatcac gcgcagcggc gggtgatgca ccagtgcctg ctgctttcgc gtgtatgtat    158580
     tgagatggat tgaatcgacg gtcgtcatcg ggcagccgtg ttcctctcgt cgcaacgagc    158640
     gtcgaacggg aacagcgcaa cgatcggtgg gctgcaggat atggataacg aggggactat    158700
     ccacgcatct cacgacccca ctcatggtct ccgtcaccgc cttgggcgat cagcacgatg    158760
     gccaggatcg tgtaaagaat caccgccaga aggagtagac cgccggcgat ccacagcgac    158820
     agttgcccga gccggcgcac ccggcgggag gcgtccacgg cgccttcgac gtcgccgctc    158880
     gcccaccgtg gatacacatc gaatgcatgg ttgaaggcgg agaaagccag cggccagaag    158940
     aacacgagcg atgccacggc ccaacccgca ttgctgctgg gtctcggttc ggcggggtcg    159000
     tcggcgccgc gcttggctgg gggttcgttc gcggcgcggc cggttcggca ggtgtggatt    159060
     ctggtgtcgg cgagaccatg atggactcaa tgtcggtcgg gatctgcctg acggtacggg    159120
     acctgtgttg agaattcgct gagaagccag ccgattccgt tctaatacca ttgccgtgca    159180
     acaacgttgc ggaggttagg acgtcctcgg aggccggtgt cctcatcggg gatgaggcgg    159240
     agacgagctg tcgatgctct cgggttcgaa cggaggccgt attccacacg tcgaggatgc    159300
     gtgagaaaat cgcccgcttg cctgctgcgg tggggtgcag gggccgcgtg aacggctggg    159360
     agatgagcca tcacgaccgt tcgtggaccg gttcgcggtc tgccacggtt tcttggtggc    159420
     ggatgtgggt gtagacgatg agcgccagca agatcacggc gagcactgcc gatgagccca    159480
     ccgtccccag cgccaatccg cctttgtcgt gcggcttgct gaacaggtcc ccgaccgtcg    159540
     caccgagcgg gcgggtcagc acgaacgcag cccagaaaag gacagtgccg gaggacgtgg    159600
     tgaagtagtg ggcgccgagg atcaacgcca tcacggtgcc gatcaggagg gcgccgccgg    159660
     cgaagccgag accggaactg tcggcgagga agtcgccgag cgaggtgccg agggtgttgg    159720
     agaacaagat ggcggtccaa tagagcaact cgcctcggaa ggtgcagatc cgttcgacat    159780
     cgaaggtatc gccgaaccga ctccagatgg cgaagacgca ggccaggcag gtgatgagaa    159840
     tgagtgcgcc cttggcgtag ccgagtccgg cggagcggtt gaggaagtcg gacatggtag    159900
     tgcctgcggt gctggtggcg acgatcactg tccaatacag ggcgggatga aacgtcttgg    159960
     ccttcagctg ggtgacgagg ctgacgagga acagtccgat gaacaacacc gaggctgcgg    160020
     cgtagccgat gttcagggtc tgggcgagga gatcaccacc ggtttcgccg agcgtggtgg    160080
     cggcgatctt catcacccag aagatggcgg tgatctgggg gagtttcttc atgattgctc    160140
     cagtcgctgt gcgcggcaac ggtcactggg acgctcgcac gatgcgtggt gcggcagcac    160200
     gagtgctggt cattcataca tctgcggtgc ccccacggtt ctgtgctggt cgggtggtgc    160260
     aggtcgaact ggtcgacgct ggggtgtcgg cggggctcgc cgacacgtcc gggatggttg    160320
     tgcgcggctg cgccgacgga gtcgcgacgt cgtcgggtgc gcaccgcatt gatcagcagc    160380
     ggcaccaagg agaccaccac gaccgcgatc aggatcacct cgatgtggtt gcgcacgatc    160440
     ggtatcccgc cgagaaggta tcccaggacg ggtacgcccg taccccacag cacacccccg    160500
     atgacgttgt aggtcacaaa ggtgcggtag cgcatgccgg aggctcccgc catcaccggg    160560
     gcgatggtcc gggcgaccgg tacaaatcgc gcgaggagga cggtgcgcgg cccgtagcgg    160620
     tcgaagaagc gccgcgactg ctcgagctgc ttcggtccca gcctcgtcgc gctgggactg    160680
     tcgaacaccg ccggtcccac gcgtcggccg atgaggtaac cgacctgatc gcccaggatc    160740
     gcagcgacag gtatggcgat caccggcacc cacaggggcg cgaagggctg aagttgggcg    160800
     gcgaacacgc cggcggtgaa caacagcgag tcgccgggca ggaagaagcc gacgagaagc    160860
     ccggattcga cgaacactgc gccgagaacg ccgagcagac cgagggcgcc cagcaacgtc    160920
     ggcacatcca ggatgccgat cccccagtgc catgctcatg ccgcggcccc gtcgtcatcg    160980
     cgtggttgct gacggccatt ccgggcgatg accggacagc cagcaggcac cggtctcggt    161040
     tgccgcgaac gccgacgcca actcccgtgt cctccaggac ttgcagtgtc gatgcgcccg    161100
     ggccccggcg acgctcgcgc gacgggctca gccatccgtc gcggcgaaca ccgctgtgcc    161160
     tgcgacgagc agggccagcg gtagcacggt cgtgctgcac ctcggtgagc aaggtcgtgg    161220
     gcgccgccgc gcagcctgcc gaaccgggcg agtcggcgtc gaaagcgcga cggtgtcagt    161280
     gcgtgtctca cgcctgcagt cttggcgcgg ggtgctgtgg tgacgctgag gaagccgcac    161340
     actctcagcc agtatcgggt gtgacctgga gtttcgttca tcggtgagcg gtttctcggc    161400
     gagtccacac tgggctgggg ccaccctcgc agtaatagcc ggcatgaggg caggagtggg    161460
     ccatgacgtc taccaaggac aggccggttc acccgccgac ctcgccgcca ccacgtcggc    161520
     gcgccggtcg gcggacagcg cgccggatcg tcggcgtggc cgtgaccacc atggtccttg    161580
     ccgccgcgat gtcgtatgcc caggcgttgc tggctcccgg ttacgcgacg tggcaggaca    161640
     aatcctcctc gtggctgcgc gaccacggcg ccgccccatt actgaacctg tacgagaact    161700
     ggctctacac gcggcatccg ccgtcgaacg cgcaacccga cctgagtcag ctcgccccct    161760
     cgttgcacgt tcccggtgtt cccggccggg acgcagcagc cgcgactggc cctgccgctg    161820
     ctgccgcacc cggcaaacac gccaccggtc atgtggtcac cgggtcgtgc cggcccggaa    161880
     ggcacgccct tgtcttatac cgcggtgttc caacccgatg ccgcgcaccg cggcgtggtc    161940
     gccggtgcgc ggcagacctc tgcgcgcggg gtgacgctca tctgatggag ggcaccgagc    162000
     agccttccag ttcgccaaac ccggcagacg ctcgggtgcc ggtgggtgat gccgtcgttg    162060
     gttgccgcgt tcaactcggg tttcaagctg aaagacattc gtggtggctt ccattggaac    162120
     gggatcctgg tgcggccact ggtcgacgga caagcatcgg tggtcatcga cgactgaggt    162180
     tgcccctcgg gagtggacac cggatttcat gcggcgactg acagcgtaga cgacgcgatg    162240
     agtcgttgtt cgaactccac tggggtgagg tatccgaggg cggagtgacg gcgacgtcga    162300
     ttgaagtacg agagccactc gaacaggtcc agccgtgcct gcgacttcga cgtccaactc    162360
     cgtccgtgca gccactccct cttgagtcct tggaagaacg actcggcgag agcattatcg    162420
     taactcgagc cgacccgtcc tcgacttagc tgaatcccat gacggcggca tacatcgacg    162480
     aaagctgctg cggtgtactg accaggctca accggtggaa gcaacacctc gataacggag    162540
     gtgtgggaat gggacgacca cccgggtggg cagcagcgtt gacggggcgt gcggtgatgc    162600
     ggtcaccggg acggcctccg atacgccgag atctagagcg ggcattctgg acgcggatcg    162660
     ccgagggtct cacgagcgac gacgcagcga ccacatgcgg cgtgtcgggg ccggtgggga    162720
     cacggtggtt ccgccaggct ggtgggatgc caccgatcga gttgaccccg gtctcgggga    162780
     ggtacctgtc gttcaccgag cgtgaggata tcgcgctgct gcgagccaag ggtatgagta    162840
     tgcgcgacat cgctgaccgg atcggacggt caccgtcgac gatctcgcgg gagttgcggc    162900
     ggaacgccgc cacccgcaat ggcaagctca cataccgagc gtcgaccgca cagtggaagg    162960
     ccgacctcgc cgcgaggcgc ccaaaaccag cgaagctcgc cgaacacgat cggctacgag    163020
     aatatgtgca ggacaaactg tctggtgtga ttcgtgccga cgatggaacc gtggtgtccg    163080
     gtccggatgc cgcttggatt ggccgaaaca agcctcggcg cggtgatcgt cggtgggcga    163140
     cggcgtggag tccggagcag atctcgaatc gcctaccgat cgactatccg gaggacccga    163200
     cgatgcgcat ttcacctgag gcgatctacc aatcgctcta catcgagggt cgcggcggcc    163260
     tggagcggga gctcgtcgcg tgcttgcgca ccggccgggc gctgcgaaag cctcgtgcgc    163320
     gagcacggaa gcagcgcacc ggatttatca ccgaggaggt gaccatcagc gcccgtccgg    163380
     aggaggtcga gagccggaag acgccggggc attgggaggg cgacctcatc atcggtctga    163440
     cccggtccgc gatcggcacg ctcgtcgagc gcaccagcag atacacgact ctactacacc    163500
     tgccgcgact gaagggctat ggaacagcgg cgatggtgaa gaacgggccg gcgctgtccg    163560
     gatatggttc ggagtccgtt cgtgatgctc tggccgcgac gctgtcaccg ctgcccgagc    163620
     atctacgcag atccgtgacg tgggatcgcg gaaaggaact cgcgcgtcat gccgagctga    163680
     cggcatctac gggtatccgt gtctacttct gtgatccgta cagtccatgg cagcgcggaa    163740
     cgaatgagaa caccaatggg ctgctgcgac aatattttcc gaagggaact gatctgtccc    163800
     gatacaagtt ccgtgagctt caggcggtcg ccgatgcgct caacaaccgc ccccgaaaag    163860
     tgcacggttg gagaactcca gcggaagtgt ttgccgaaca ggtacactcg tcctcacggc    163920
     acggtgttgc gacgaccggt tgaatccgcc ctgtgatccg cggtcgctgt ggaagataac    163980
     gccaccgacg tcaccaccgc gggtgcgcac cgacatctcg atcgcgtccg tgacgagatc    164040
     ggtgcgcatg tggtcagcga tcgaccagcc caccacccgg cgtgagaaga tgtcgatcac    164100
     cgtattagtt acgtggaatc acgccggggg tcggttgttc gtcccgcggt gtcaccacga    164160
     gctgaggggc cctgttgact gtgtcgatga tcttggaaga gaagtggccg gtcctgtgcc    164220
     ggcacgagcg ggcggccgag tggttgcaga tctggaccga tctggggcgg gcgcctcgca    164280
     cgatcgatgc gtacgctcgc ggcctggccg agtacctgct cgtctgcgag cgtgaaggcg    164340
     tcgatccggt tgtcgcgacc cgggcccaaa tcgccttgtt tgtaagggac ttgcggactc    164400
     gaccgagtcg gcgcggtacc aatgttgtcg cgttggactc gggttcgggt ctggcgaacg    164460
     cgacgctgca gcagcgactg gttccggtgc ggttgttcta cgacttcctg gtcgaggagg    164520
     gggtccgcga gtccaacccg gtcggtcgcg ggcgttacac gccgggccgg cacttcggtg    164580
     ggcagccccg gccgctcgtc ccgcggatgg tcaagttgcc gtggatcccc ggcgaggccg    164640
     agtggttgca gctgctcgac gttttccggc tcgagccgat ccgtaaccgg ctgatgctgg    164700
     cgctggccta cgactcggcg ctgcgccgtg aagagctgtg ctcgctccgt accgacgatc    164760
     tcgatcccgc gcaccgcatg ctgcgggtgc ggccggagac gaccaagacc cgtcgagggc    164820
     gggtggtgcc gtactctgcg gcgaccgggg tgctgctgtc gggctacctc gcccaccggg    164880
     ccgggatcag ccgcgcccgg gggccgctgt tcttgtccga gtcacggcgc aatttcggtg    164940
     agccgctgag cttgtggagc tggtcgaagg tggtgcggcg agtcgcgttg gctgctgatg    165000
     ttccgcagtt ctctacgcat accacccgac acctgtgtct gaccgacctg gcgcgaatgg    165060
     gctgggagct gcatgcgatc gcaaccttcg ccgggcaccg ttccaccgag tcgacgctga    165120
     cctatattca cctgtcgggt cgggatcttg cggagaagct gaatcgtgca atgacgcacc    165180
     tgcatgcgca gcgcatcagc atgctcaccg cacccgacgg gacgggtccg gcgtgaccgc    165240
     cgcggttcgt gccgtcggcg aggcggatgc cacgtggccg gcgtcgacgt ttccggtgtc    165300
     cctcgaacgc tacgatcgcc gggaggagct gaccgatgcg gagcgccgag cactgcgcga    165360
     tttgagcccg aaggcgttgc gccgcaatag agcgcgggga atcccacgcc ggaccgcgac    165420
     ccactggacg gcgctggtgc ggctcgtcga gccgctcgac accgcgcggg ccgggttgca    165480
     tcatggcgat gacgcccggt ttcggcgggc cggggcgcac gcggccgcta tcatcttgca    165540
     gaactgcgcg gacaccggcc ggtcctactg ggcgtggacg agcgaggact gggcgcagct    165600
     gtgtggttcg agcgccgagg ccttcgtcgc ggccagggaa ctgcctaccg agaccaccgt    165660
     gcgtcccttc ctcgtcgctc tggcctatct gctcggcagc ttcgacgcct tccaactatt    165720
     gggcacattc aaccggctgc acctggcccg cctcgtcttc ggcgccgagg cgatcgagga    165780
     gtcgatgcgc caggccagcg cggtcctgga ccagtggggg taccgcggcg tctttatcgg    165840
     caaacaccga ctgcgcgggg ggctcagcca ggccctgctg atcaaccgca gttccaggct    165900
     cgaggatctg gataccgcgg cattcgaccg gctgcgcgtg cacccagcca ccaacgatca    165960
     ccaaggcgag atgctctacg cgctccaacg tgccgtcgcc gcactcggac actgcgaccc    166020
     gccggtgcgc accggagaca acccctacgc cgtcatcgaa ggcaccaccg acagctgggc    166080
     caactgggtc gcccgttggc acgacacctc cacgctcacc ccgcgggtcc gcaggaccat    166140
     ccgcaccatc ctggccaagg ccgggcggtg gctcgccgcc gaacatcccg agatcaccga    166200
     acccgggcaa tggacccgcc agaccagcgc cgcctgggtc gcggccgtgg accgcatgac    166260
     cgtcggcgac tacgtccaac gccgcgacca cctccgcgcc cgcaccggag acccgatctc    166320
     cccacgcacc aaagcccaca ttctcatggc cacccgcacc ttcttccgcg actgccagga    166380
     gtgggaatgg atcgatcgtc gcttcgaccc ggcccgggca ctcgcactgc cccgcagcgt    166440
     gtccgcactg atcggcacca acccgcgtgt cattgccgac gatgtgtggg cgaagctgct    166500
     ctgggccggg ctcaatctcg actcgagtga cctgcccggc aattccgccc acacctacta    166560
     cccaatggag ctgatccggg cgatcacact gacctggctc ttcggcggac tgcgcagcga    166620
     cgagctatcg cggctgcgag ttggctgcgt gcgttggcaa cacgacggtc agcccattgc    166680
     tgccgactca cccgacgtgc tcgctgagga cgccgtctgc ctgctggagg tccccgtcca    166740
     caagaccggc accgcgttca cgaaacccgt cgatcccctt ctgggacagg cgctcgaggc    166800
     ctggcaagcc ctgcgcccgc ctcagccgaa gacactcgac cgcaagacca gcgaacaggt    166860
     ggacatgctc ttcgccttcc gcgcgcaccc ggtcgcaaag aactacatca accgcacgat    166920
     cattcccgcg ctctgcgcca aggccggtgt tccgagcagc gacgtccgcg gcaacatcac    166980
     cagtcaccgg gcccgctcca cgatcgcgac ccagctctac aacgccaagg aaccgatgac    167040
     actgttcgag ctgcaggcct ggctcggcca ccgcaccccg aacaccaccc agcactacgc    167100
     gaaaatcacc ccgaacacgc tgtccaaggc ctacaacgaa gccggctact tcgcccgcaa    167160
     cgtacgcacc atcgaagtgc tcgtcgaccg cgacgccgtc acctccggcg gcgccgccac    167220
     cggccaaccc tggcagcact acgacctcgg ccacggctgg tgcagctaca cctttttcga    167280
     gcagtgccag caccggatgg cctgcgcacg ctgcgacttc tacacgccga aagactccag    167340
     caaagcccag ctactcgagg ccagcggcaa cctacaacgc atgctcacca gcatcccgct    167400
     caccgacgac gaacgcgccg ccgtcgatga cggacacacc gccgtcgcgg cgctgctcga    167460
     gcgcctcacc gacctcccta cacccgccgg gcccacccca cgagagatcg gtacgtcccc    167520
     gaccgtgacc ctgctgccga tcgtgcaagt ccgacacgga gaaccctgat gaacttgaca    167580
     atcctgattc cacataatgg ccaagaacaa ccacgaggat cccaccggga tgtaggttat    167640
     gtccccacac cacttggtat cgacagccgt agcggtgaag tctcgcatca ccagatccgg    167700
     caccgacgga gccgacttgt ccgcgacggt cgtgcgcttg ctgcggcgca ggtgcctgcc    167760
     caccacgtgg tggattcgca tcagccgggt cacccgtttg cggttgatct tgcgtccgcg    167820
     ggagcggagt tcggcgtgaa cccgcggggc accgtaggcg ctccggtgct cggcatgaat    167880
     ggcgcggatc tcggcgaccg tcgcggcttc ctcggcctgg cgctcgactc gggccggctc    167940
     cgtgatcagg tgcttgtagt agccggaacg ggaggtcccg agcacccggc acagccgctg    168000
     cacgccgaac tcggcgcgat ggtcggagat gaagtcccag cggcgggtct tcacttcacc    168060
     tcctttgcga aatacgcggc cgcccggcgc agaatctcgc gttcgagctg ccattccttt    168120
     tccgcaccgc gcagccgcgc attctccgcg cgcagccgcg cgagctcgtc cgcctcggtc    168180
     ccgtcggcgc cggtactgcg gtcctgcgag cgcgcgttac gggcggtgtc cttgcggacc    168240
     cacgtccgta gcgtttcgcc actgacgccc acatccgcgg ccaccgccgc gtacgtgcgt    168300
     ttgccgtcgg ccgcgcgata caacgcgacc gcgtctttcc ggaattcctc cgtgtacaga    168360
     gactggcgtc ccacctcgac atccctcctg gctctcctag aaccattgtc cggggtgtcc    168420
     actcaaaggg tgcagcctca cgacggcggg cacatgacga tcggccaatg ggccgggatg    168480
     ccggcataaa cgaccacatg gtcgcggtcc ggcagaacct cgccctcata gtcgatctgg    168540
     tcgagggcct cgtggacggc gaagccgcgg ccgcggccgc ggccagtggc ggcggtggcg    168600
     tgcgagagca gagtgtcctt cgccgggctg cggaccgact tcccgacccg ttcggcgatg    168660
     accagagcac atgccacagg gcggcggcga tcccgaggaa agggacggcg atcacggtga    168720
     gcgcgtatcc ggcgatggtc cacgccgaag acttttgggt gcggtcgacc agcggcccgg    168780
     agaccagccg cagcattggc gcgcagcctc accgactccg gtgacgatac cgacgacgaa    168840
     cgcggtcgca cccaacgacg ccagcagggg gccggtgatc gacagggcac cctcgtatcc    168900
     gacgtccgtg agcaggctga tcgtgccgaa cgcgaacacg acccgcaaag cacccatcgg    168960
     ccggcgcacc ctcccggcaa tgcccaccgt tcggacgggt ttcgggaccg gcgcgtggga    169020
     cccgcgccgg gcgttggagg acctgtccgc gggctcggac ggcgtcattc acgctcctgg    169080
     cggtacgggg acgagcagga ctgggcggtg ggcgtggtgg accagttttg aggacactga    169140
     ttcaccgagg aaccgttcca tcagcgacat cgccccgccg cgggaggtgc cgatgatgat    169200
     catcagggcg tcgttcgctt cggcgatggt ggtcagcagc tgtgccgggt tgccctcgcg    169260
     ggagtaatag gcccagttgc cgggcagggc cgccagcatg gcgctcgcct cggtgcgctc    169320
     ttgctcgacg gcgtcggcga agcgctgctc ccagtcgtcg cggtccggtt cgatcgggat    169380
     gtcgtcgatg tcgacgatgt gcgcgacgtg cacgaacgcg gtcaggcggc cggcgaggtc    169440
     catcgcgtag gtcagggcgg cgtggctcgc cgggtgccgg tcgaagccga ccaccagatg    169500
     acacaccgcc ggggtgggcg ccggcgggcc gtcgacgcgc agcggggtcc gccagtcccg    169560
     cagcgtctct cggggggcgg ggtggttgtg gttgttttgg gtcattgtgt tctcctcaca    169620
     ccctcgcttc tagatcccgg ccaaggccag acccgccgcg ccggcggcga cggtcaccag    169680
     cagggtgccg accgcgttgg tgacaccggc tgcataccgt ccgcggtgga tcagccgcac    169740
     ggtctcgaaa cttgcggtgc tgaaggtggt gtacccaccg cagaacccga cacccacaat    169800
     caactgcacc tcgcgcggaa caccgtgaaa aaggaccagg ccaaccacga acccgagcag    169860
     caaagacccg gtcacgttga tcgccgccgt cgcccacgga aactcaacgc tgcggcggtg    169920
     tttgatcgcc ccatccacaa cgaaccgggc gatcgccccc acactgccgg cgcacgcgat    169980
     ccaccacacc atcaccgttg ctcctcccgc cgcgaccgca cctgctcccc gaccgcgatc    170040
     cccgcgatgg tggccaccat gcccgcgagc accgttccgg ccgcataact tcccgccgcc    170100
     caccactgat ggccgcgcag gagcaggtcg gcatccaccg cgagggtgct gtaggtggtg    170160
     aacgagccca gcaccccggt gcccacaccc aggcgcaccc gctgacgcca cgccgtgtcc    170220
     gggccgagcc gggtcaacgc ttcgagcacc agcccgagca ggaacgcacc ggccacgttg    170280
     atcacgaatg tggtcaccgg ccatccaccc gcggcctggg ggaaccacac accgagctga    170340
     tagcgaagcg gggccccgag caagccccca ccaccgaccg ccgcgatcgc cgccgggcga    170400
     acatgcaacg ggccgggggt acggggtgcg gtatcgggat cgaccggcaa agtgggattc    170460
     gggtcgcggc gaccgtccac gggcacactc cttccacgaa agggaaaagg agccatcagc    170520
     ctcgggtgag gcggttcaga cgacccctcg cagggtgtcg tggcggagat ccatcgccga    170580
     acaggatcat aaccgccgtc tggcatcgga cgtagacctc cgtcggtccg ctcaggagaa    170640
     ccaacacggg agagcctcac cacggcggcg gggcggcgag ctgccgggtc agggtgcgct    170700
     cgctcacgag gaactcgccg tgggcgttcg ctccgctacc gtggcgtcgt gacttccact    170760
     gtggacgtac tggcctacat tccgagtccg cctcaaggtg tctggtatgt cggaccggtg    170820
     gccctgcgcg cgtacgcgct gttcatcatc gtcgggatcg tcgtcgcgat cgtgtggggt    170880
     gaccgtcgct gggtcgcccg cggcggcgag aagggcacgg tcctcgacat cgccatctgg    170940
     gcggtgccgt tcggcctgat cggcggccgt ctctaccacg tgatgaccga ctggccgacg    171000
     tacttcgggg aaggcggcga ccccgtcgac gccctgaagg tgtggcaggg cggtctcggc    171060
     atctggggtg ccgtggcgct cggcggtgtc ggagcctgga tcggttgtcg tcgccgcggc    171120
     atcccgctgc ctgcgctcgg cgatgcggtc gcgcccgcga tcctgctggc gcaggcgatc    171180
     ggccggctcg gaaactactt caatcaggaa ctctacggtc gcgagaccga cgtgccgtgg    171240
     gggctcgaga tcttcgagcg gcgcaacgac ctgggccagg tgtcaccgca gctgatcgac    171300
     ggggtgtcca ccggcgaggt cgcgttcgtg gtgcatccga cgttcctgta cgaggcgctg    171360
     tggaacgtgc tgatcgtcct cctgctcgtg tgggtcgatc gccgcttccg tatcggtcac    171420
     ggccgcctgt tcgccctgta cgtggccggg tactgcgccg gccggttcgc ggtcgagttg    171480
     atgcgcagcg actatgcgag cctcatcgcg ggtatccggg tcaattcgtt cacctccggc    171540
     ctggtgttcg tcgcggccct ggtgtacttc ttcgccgcga cgaagggccg tgaggatccg    171600
     gcggagctgc agtcgacgca cggtgatgct gcgaatacgc ggcagcccga gtaggcggag    171660
     ccgacgaccg gcgagacgcc gaaatcggag gagaaggctc ccgagggggc gtcgggagac    171720
     aaggctgtga gtgcggacgc cgagtccgga gcgaagaccg acggcagcaa gacagacgga    171780
     tgacgcgact gactgaaccg gccgaccgcc gcgcttacct tactgacctc tggaccgata    171840
     actcgcagac cttgcggcac ttcggatacc gcaagctcga ggcatcaaca gggcgacagc    171900
     gacgattcgc ccattctgtc cagatcgacc gtctcggtgt cgttcgtacg tgtgctcggc    171960
     cttgcctttg ccgatgctta cccacgggac ggtccgcgat tgcactccca ccgtgtccgt    172020
     cttgcgcggt gacgatgacc gtgacccgca tcgttctgtc aacttgtcag cgcaggggtt    172080
     cacgtcggac ggctccatcc gggcagaaag cgaggctgtt agggcgtgtg gtcaatgcgc    172140
     gagtggggtc gtcggctgac cgacacggtt tgtaattggg tgcccgagca gtcaatcggt    172200
     gtatccgggc tccggcagtt cgggcttttt cgtgctgtgc ggggtcgtgc ctcggaccgg    172260
     aaggtggacg atggcggtgg cgccgccgtc ggggttggtg tcgatgtgca cagtgccgtg    172320
     gtgtgcggtg acgatctcgg cgacgatggc caggcccagt ccggagcctc cgctgccgcg    172380
     ggcgcggtcg cgttgcaggc ggaagaatcg ctcgaatacc cggtctcttt cggtctcggg    172440
     tattccgggg ccgtcgtcgg agacctcgat tcgggcggtc acactatcgg atgacacccg    172500
     cacacggacg gtggtggtcg cgtagcgggc ggcgttgtcg acgaggttgc gcaccacccg    172560
     ggaaatctgg gtggcatcac ctcgcacctg gaccggttcg aggacgcagg agaacgttgc    172620
     accgccctcg gcgcgtttgc ggtgcacctc cgaggcgacg acgtcgtcga tgtcgacgtc    172680
     gacgatgcgc aggggcagtc cgtgctcgtc ggctcgtgcg aggagcagca ggtcgtcgat    172740
     gaggtggtgc atcctggcgg cctcggggag cagggtgtgt tcgacgagcg cggtgtcgag    172800
     cagttccggt cgatcgcgtc cgatctcgag cgctgtggtc accgtcgaga gtgggctgcg    172860
     cagctcgtgg gaggcgtcgg cgacaaagcg gcgttgcgcg tgctggccgg attcgatccg    172920
     ggagagcatc gcgttcatgg tttcggccag ggcggcgatc tcgtcgtgct gggtcggtac    172980
     cgggacgcgt tcggcgagat cggaactcga gatcgcggcg acccgggtac ggattttctc    173040
     caccgaccgc agcgaacgtc cgatgagggc gtaggtggcg agggcggcga cggccacgat    173100
     gaacggggcc cccaatgcca ccagaacggc aacggttttg atggtgttct cgatgttttc    173160
     cacactggtc gcgaccacga cggtgtaccg gccaccgacc ccggtggtgg tgtacgcact    173220
     cactcgtaac ccgtcggtgc ggggggcggg ccgcgcgcca tgaacgagcg caccctcggg    173280
     cggtcgcacc gcggtgaccg gttcggtggg gccggcggcg gaggaccgca ccacccggcc    173340
     ttgggggtcg atgacctgca ccaacgtcac ccgtgggttg acggacacgg tggcggcgtc    173400
     gagttcgtcc ggggtatcga gccgcagctg ggcactgact tcctggatcc gggcggcggc    173460
     agcatcgtcg gatgccgaga tcatcgaccg gtacagcacc agcgtcagcg cgatcgcagc    173520
     gaatcccacg gcaacggcca cgacgacgcc ggcgatgatc gcggatcgga tgcgcagccc    173580
     ccacctccgc ggatgcagca ggggccagat cccgtccatg ggctccatct tcgatcatcg    173640
     cggtgtcggc cgtgggcggg cgggaagatc cgcccgccca cggcgggttc taccggccgg    173700
     gggtgtgcat cccgggggca tcgggtacct ccgggccggt ctgatcgccc tgctgaatgt    173760
     tgtcgttgtc gacggcgccg ggggtatcgc attccggtgt atcgggtacc tccgggccgg    173820
     tctgatctcc ttcctgaatg ttgtcgttgt cgaccgttcc gcaggcgtcg gggacgtcac    173880
     cgggttccgg cgtgtccacc accgacggcg gattcggcgg cggctgggcg gtgttggccg    173940
     cggcgatgcc tccgccgatc gcggcggcgg cggagaccgc cgcggccgtc gcgatgagtt    174000
     tgcccttgag gttcatggtg tcgtccttcc cgtactttca gccgatctga ctgttacgac    174060
     caggctgccc aaccggtgct gagaggtcgc tgtgggtggc tgagagaccg ccgagaggcg    174120
     catccgaacg ccgtttctca gagctcgcgt agcacggtca gcggtgagcg gcgcgcgatg    174180
     cgactggtgg tggtggccac gaccgcggtc acgacgacga ccgtggcggt gaccgcgccc    174240
     agataccccc atgggacggt gagggattcg gggggtgggt cgaagacgcc ggtgagtatc    174300
     ttcaccagca tctgcgacaa caccgcgccg agcagcccac cggcggccag cccgccgacg    174360
     accaggacgg ccgcttcggc gaccacgaac gcgcgcaggt gccggggttg ggcgcccagg    174420
     gcgctcgcga tggcgaaacc ccgtcgccgc tccgccaacc ccagcgcgag caccagcgcc    174480
     ccggcggcgg ccgctacgac gacaccgtag ccgagttcga tgcgggtcag accggcgaga    174540
     ttcacggagg tcaggctcga gcccaccgtg gcgcgggtgg tggtgatgtc ggtgaccgtc    174600
     gcgctcgtgc cgaccacggc gcggatgcgg tcggcgaccg cggtggtctc ccgcccggcg    174660
     gtgtcgacga ggaacgcgcc cacactgtta tttccggtct gctgggcgat gtaatcgccg    174720
     ttggcgacga agaagctgtc cttgggtgcg gtggggaatt cggtgaccac tccgacgtag    174780
     aggaacggca ccgggaccag ctggtgggtg cggctgtcgg gcaggcgcag gttgagcgtg    174840
     tcacccgggg cgagttggaa atccttgacc gtttcggcgc tgaccaggac ggagtccggg    174900
     tgcacggcaa gctgattcat cagctcggcc gcggtgccgc cctgaaagta gctgttctgc    174960
     aacgcggtga ccgtggtgat cgtgctcggg ttcaccccgt agaggtcctg gaggtcggcg    175020
     ccgatgtagg cgaagcggtg ctggatcggt tcgaccgcgc ggacaccggg caccgccgag    175080
     agggcggtcg ccgcgtccgg cggcaccggg ttcccgggtg attcggtcac ggtgacgtcg    175140
     gccccgttgg tcaggtgtgc gtccacctcg gcctgggcgc ggtaggtggc gttgaaggtg    175200
     gcggtggaga tcgcgaaggc cagcgcgagc gccagcagca cgatgccgcg ggccagggaa    175260
     tgtcgctgcc gcgagatcga gttcgcgacg gtcggcgcca agggtccggc cagcggccgc    175320
     agcgcggtac cgacgatccg tcggccaccg ccgaggatca gatcggccag ccgccagatc    175380
     agcagggcgg cgccgaccca cagcagggcg ggggcggtga acgcccagta cgacacggag    175440
     atcgtgggca ccccctcggg ggcgaggacg agttggtagt tgttgcggct ggtcgaccag    175500
     aacagcacac ccgcggcggc gaggagtccg atgtccagcc cggcgcgggc ccagcgcggg    175560
     ctgcgcccgg cggtcaatgt ggcgcgtccc gcggtgacgg tgagggcgcg cagatcccgc    175620
     cgcgccggca tgaggatcgc ggcggcggcg accgccagtc cggtggccac cgccgcaccc    175680
     gaccaggcga gcgctgaggt ggcggtggca ccgaaccgcg ccgaaccgaa cagcatcacg    175740
     ccgaccgccg cggcggcggc cagacctacc gcgctgcccc cgaccccgac ggtgaccgcc    175800
     tcgacggcgg ccaggcgcag aagttgcctg cgcgaggccc cgcgggcgcg cagcaacgcc    175860
     tgctcctggc ggcgtcgccc ccgcccggcg tcgacgaccc ggcggtgaac aggccggcga    175920
     ggatcgcggc gggcaggccg aggaacagaa acagcacctg cgcgtaggcg gcatcggacc    175980
     gtgcggcgcc caggctcgcc ccgaggttgt ccccgaccag ggcgccgccg acgctgcggg    176040
     cctcgagatt gtgcgccgcc gcggtcacct cccgataggc ggaggccgga tccgcgggca    176100
     gggcgtggtc gaggacggca tggatctggg tgcccaccag gtccggccgc agagcagcaa    176160
     gcggatcgaa caggacgtgc caccgcgcct ggtcgagcag gagcacgtta tcgggcgggg    176220
     cgaccggttg cgcgccgggc ggggcgccga ccttctgaaa cagcgagtcg gcctgcggca    176280
     gatcgaccac gccgtcgacc accaccggga ccgtcggcag cccggcccga cccacctcga    176340
     cggtatctcc cggtttcacg tgcagattcg ccgccgtctg ctgcgccacc agcaccccgc    176400
     cgcccgcccc ggccagggtg cgcaccgccc cggggaagtc ggtgcggtac ccctcgggca    176460
     ggcccaggac catgcccggt ccggtggttt gggtgcttcc gccgccggtc gcggtgaacc    176520
     cgttggtttg ggcgaatccg accgggaccg cggcggtgac cccactggtg gcgcggacca    176580
     ggtcgagcac cgcgctcggg gtggtggccg accggacctc gacctgccag tcgacggcga    176640
     cggtgccggc ggcgcggacg gtcatcgaac cctgcgcggt ggtgaggaag atcccgatgc    176700
     cggccagcag ggcgaccgcc gccccgatcc cgcccaccgt cgcggccaac cgggcgcgcc    176760
     gccgccgcag cagaccccga acccagatcc cgatcatctc gcgcccccgc cggtctctgg    176820
     tggcccgagg cccggtggtt cggtcccgga ccgcgcaccg gtgtcgagtc gcccgtcccg    176880
     catcgtccac cgcccggtga gtaggcccgc gacaaccggg tcgtgggtgg agacgagtac    176940
     cgcggcatca atggcctcgg cggtgtcgag gagcaccgag agggtggtgc gtgcggtgtc    177000
     gtggtcgagt tgcccggtcg gttcgtcggc gaggatcagg gcggggcggg cggcgagcac    177060
     ccgcgcgatc gccacccgct gcgcctgccc gccggacagc tcgtccggca ccttgtcggc    177120
     caaatccccg atcgacagca cctcgagcgc gcggcgggca cgggccctcg cccggtccgc    177180
     cgactgcccg gcgaacagca acggcaacgc cacattctcg atcacattca aggcaggcag    177240
     caggctcggg ccctgaaaca ccacgcccac cgaagcggcc cggccacggc gcaggtcggg    177300
     cagcgccggc catcgcaggc tgccggtggt gggggtgtcg agtccggcga tcagatgcag    177360
     cagcgtggtc tttcccgatc cggagggccc catcaacgcg atgcgtgcgg atccgggcag    177420
     ctcgaagctc gcctcccgaa gggcgatcac cgcgttcggg ccggcgccgt aggttcggcc    177480
     gagggcggtg ccctcgacca ccacccgcgg cgcgggggct tctcccgcag cgcgggtgcc    177540
     gttgccggtc atcggcgcac ccgcccgtcc tcgagggtga tcacccgggc cgccgcgacc    177600
     gccaccgccg ggctgtggct ggccacgacg atcgcggtgc cgccctccgc ggcggcggcg    177660
     agcaggtcga gcacccccga ctcggtgaca ctgtcgagtt ctccggtggg ctcgtccgcg    177720
     atgaggacgg tcggctcgtt ggccagggcg atcgcgagtc cggcgcgggc cagctcgccc    177780
     ccggagagct ggctcgggta ggcgggggcg cggtggccca ctgccagcga atccagcagt    177840
     gccgctccgc tggtgcgggt ccgccggcgg gcgaggcccc gcacgagagt caggttctcg    177900
     gccaccgtga ggtgttcgag caggttcgcg ttctggaaca gcatgccgac gtgccgggcc    177960
     cggatgcggg cccggaccgg ttcgggctgg tgactgatgc ggcggccgtc gatgtgcaca    178020
     ctgccgccgt ccgggtcgtc catcccggcc aggcaggcga gcaaggtgga ttttccggat    178080
     ccggacgggc ccacgaccgc cacgaactcg ccgcgaccca cggtgaggga gactccctgc    178140
     agggcaaggg tttcctcctc accggcgcga tagaaccgat acagcgtccg cgcccgtagg    178200
     gcgggcggcc cggacggcga cccggtgctc atcacatcac ggccattgca gcgaatcggt    178260
     gatcgtgcgc cacgggtcga cattgtcggt gccctgcggc ccggacaagg tcacaaccac    178320
     ttcggttccg ttgtgccaga actgataccg ctcgaccgct tcggtgacgg acttcccggt    178380
     caccgggttc ggcgccgacg ccgcctgata agtgatcagg acggcctggc cggcccgccg    178440
     ttggacggca gtcaccgtgc ccgcacggta gccgggggtg cccgccgcga tgccgggcaa    178500
     ctcctgggag atgaccgact cgacggtcgg cgcggcggcg cggtcgccgg cctggacccg    178560
     gacggtgttg tacttgtccg tgaagacggt ctcggtgccc gcggtgctgc gcgaccagcc    178620
     ctcggggacg gagatggtga accggtcgcc ggccggggtg aacggcacat acacctggtt    178680
     gtcggggatg tcaccggccg gattggactc gggggcggtg gcattcggtg cggtgctctg    178740
     gcccggggag atgggtggcg gattctgtga gcagctcacg gtcaccatca ccaacaccac    178800
     ggccaggaga ccggttctca gggcggtgcc ggcgcggttg ccgatgtgct tcatgatggt    178860
     ctcccgaaca ccctcggagt acgggtgctg tggtggcggt tggtgttgtt gatcgatgcg    178920
     cggggtgcac cggaagatgt cgagaccgcg cggaccgctc gattcgggat catcgtggtg    178980
     ttgcctggtt ctgcgctgtg cggagagagg tcgagatgct gtgcgcggat caccacggcg    179040
     gaccgtgatt gtcggccggc gcggcgcgcc gcggagccgg atccggcggt cgctgagctg    179100
     gtcctcgatg ctggcatgcg atcacccggt cgatatcggt cggtgctcgt cagcgacagg    179160
     atgtggcatc ggtggtgtgt ccgagggccg accgtcctcg atccccgaga tctgcacggc    179220
     tgaaatcggc acggctgggg cgccggtcac ctctgcggcc cgcccgggtg ggcggcgggc    179280
     cgcgagggcg gtgacggcgc aggatccggc ggccacgacc gcgcccccga gcagggctcc    179340
     accgagcacg tcggtcagcc aatgcacccc gaggtacagc ctggtcgccg cgaccacgac    179400
     cacgaccaac accgccagag tcccggccag ggcgccacgg gcccggccgg gcagccccgc    179460
     gccggtcacg atcagcaggg cgccggcgag ggccacgatg ccggtcacat gccccgacgg    179520
     aaacgaccag tccgtctcgg tgacgagttg ggaggcagtg ggaggtcgtg agcgggcgac    179580
     gatcatcttc acgatcgtgc tggccgccgc ggcgaccgcg acgataccca ccaccagcac    179640
     tcccggctcc catgatcgcc ggcgccagga caccagggcg gcggtgacca cggccacgag    179700
     cgcgaccccc accgggctgg ccgcgtcggt gattaccacc gccgccgcgg ttaccccggg    179760
     ggagcgatgc gcgacgaacc agtcgagtgt cgcggtgtcg gcgccggtca cccaaccgga    179820
     gaggcgaacc tggaccgcca ggagggtgaa catcagcagc agcgccgcga cccgcaccgc    179880
     gccccaccca cagaccgtcg tgaccgtgga atcgccgcgg cgccgattcc accgctcggc    179940
     ccccagcgcc accgtatagg ccagcacgcc caccgtgagc atccagatcg cgatctcggc    180000
     ggtggccgct tcggtacgaa cctcgttgat caccaggtca attgcgtcgc gcattccggg    180060
     catgcttcca gtgtcgtgtt cggccgctgt gagaacactg agagcgtgcc ctggtccgtc    180120
     cggaattggg ctctaatgga agaaacaccc gaggacggtg cgcgatgcga atcctcttgg    180180
     tcgaggacga ggcccgactg gccgagaccg tgcggcgtgg actgacggcc gagggcttcg    180240
     tcgtcgatgt cgcgcgcgag ggatgcgacg ggctcgaaca ggccgtgacc ggagatttcg    180300
     acgtggtcgt gctcgacatc atgctgcccg gcatgcacgg ctaccagatc ctgcgggagc    180360
     tgcgcgcacg ccaggtgtgg actccggtgc tcatgctctc ggccaaggac ggcgaatacg    180420
     accaggcgga cgccttcgac ctcggcgccg acgactacct gaccaagccg ttctcgttcg    180480
     tgatcctggt ggcgcggttg cgcgccctgc tgcggcgcgg ggcccccgag cggccggcga    180540
     tcctcaccgc gggcaacctg gcactcgacc cggcccgccg gcgcgtgagc cggggggagg    180600
     acgtactcgc cctgacaccc cgcgagtacg gggtgctcga attcttgctg cggaacaagg    180660
     gggacgtcgt cagcaaggcg gagatcctgc gctcggtgtg ggacagcaac tacgacggcg    180720
     acgacaacgt cgtcgaggta tacatcggct acctgcggcg aaagatcgac gcaccgttcg    180780
     gcatggccac catcgaaacg gtgcgcggcg tcggctaccg gctactcgac gcccaatgac    180840
     cgaatctcac acccgctgga tcagccgcgc gaacgcccgc aggacggcct cccaaaaatc    180900
     gaggccgatc accaccaggg caccggtcgc ggcggccgac agcacaacat ggaccgaacg    180960
     acgtcccgcc cgctcccagt acacgtcacg aagattcagc cacaaggcga actcgtccag    181020
     cgtgagcgcg gcaccgacac cgaacagcgc ggcaacgacc ggatggtcgc cgtaaccgaa    181080
     ggcgaacgcg agatatccgg tcaccagcag cagcacgatc ccgggcacca gatgatgaac    181140
     atgggtgccc cccacccgca cattccgcac gaaccggctg ccccgccgaa ccgcgtgcgt    181200
     gatcacccgc acccccacga agctgaccag gaacgacgcc agcaccacga atgcccccaa    181260
     cttgccctcg tccacgatcc gcgagtggaa cacttccacg acttcctcga cgaagcgggc    181320
     gatatggttc acaccatctg ctcctcaccc cgccggtcgc cgcccgggtc attttgctgg    181380
     tcatgcggca cacagcggcc caacctagag ggtaaacgtt cgccgagccg attcacggcc    181440
     ttcgcggtgt cctccggacc gattcccgcc ggactgacca gtaggcgcgc cctcgccagt    181500
     cggcgccgac cgcgaccacc gaagaacagc gcggagaccg cgtaccccaa ctggagccgc    181560
     tctcccgcaa gttcaccggc cgcggtgccg agagtgaatg tgaactggat cgccaatcag    181620
     tagaaccctt cgcggccagt ggtgtcgatg ctatggatgg acagggtgcg ctcgctcgcg    181680
     tacccgagca cgaaggccgc tatcagtgcg ataccgaaga tcatggtggt ggcctcgaga    181740
     gaccggtcag ggttgtccgg gatgagtgtc ccgaccacgc tcagcagaat cactgcacca    181800
     atacagcgcc ggaatggact ctgtgccctt ctgcggtccg atgcggcggg cggccgccgc    181860
     atcggtggga cgccggtccg tgcctttgca cgattgcctt accgaagcgc ggtcaacagt    181920
     gcggtgaggg tctgggtctc ggtcgcggtg tcgggtttgc tggcgcgtag tgcgtgcagg    181980
     acgctgtcga tctggccgtc gaggacggtc caggtggttt cgtcgagtgg gcgcagcgtc    182040
     gtctcgtcgt cgtcccacgc cgtttcgagg tccttgatcc gggctgtcgc gtctgcctgg    182100
     tcgccggcct ggactttccc gagggtgtcc tccgcgatgg tgcggaactg cgctatctct    182160
     gtcggcggga aatgcgctga cacctgaccc ggggtgagcg ttgtgatcac gggtgtggtg    182220
     ccggtttcct cgtcgctcgc cgcggtcgcg tgtggctgcc cggccgccca gatgagcagc    182280
     gcgccggtgg cgacggcgac ggcgacgtag tacccgagca tgatccgctc gcgcgtcgga    182340
     tgcgtggtga tggtcgttgt gtgggtttgt tcgtgctctt cgatgacgtc gctgcgggtg    182400
     agcgtgaggt acacgaccgt cgcgaggatg gcggtgagga agatggcgct ggtgagggcg    182460
     gtacccaggc cgagtccgtg atcggtcgac ggggatgcga gccagtcgcc gaggttcgcg    182520
     ccgagtgggc gggtcaggat gtaggcgagc cagaaggaga gcacagcgtt cgcgcccaga    182580
     cgccagccga tcacgatcaa cacgatcagg ccggccggca ggagcaccga tacaccgggt    182640
     ccccagccgg tgaggtcgag tgtccagtcg ccggccgcgg tacccagggc gaaggtgata    182700
     agtactgcga gccaatagaa taactctctg ggcaccgtga cgatgctgtg gatcgacaac    182760
     gtccgctcgc gaacaaacca cacggcgaag acgatggtca gggccgccgc gaagacgctc    182820
     gtgctcaggg cgagcggaat gccgagaaca tcggtcagga tgtcggtgta gagcgtgccg    182880
     gtcacgctga gcacgacgac cgtcagccag tagacgaatg gctcataacg ggaaaggcgc    182940
     aactgccacc ccagaactgc ggcaaggatg accgtgaagg tgagggcggt ggtgttcaga    183000
     ccgaaaccca aggtcatgtt gatccagtcg gcgaagctct cgcccacggt ggtgcagagg    183060
     atcttgatga cccagaacca gacggtgatc tcgggcacct tactcagcat cgcgcgctgg    183120
     gctttgatcg tctcggatct cgttgcctcg tccacaacgt ccgaccgtaa cgccacgtgg    183180
     ctgaacattc gctgagggtt cggtcaacgc ctgccccgcc ctccccatgt cacgagtgat    183240
     ctgtcgtccg gttcgctcta ctgcctatgt cagttttcgc cggccggcgc aatgaggacc    183300
     ggcggatctg gctcgcgagg aggggttgcc tcgccctgac tgggtatccc gagcggcatg    183360
     atggttcatc ggaatcgatg tacgcaagcg ccccacgaat gtcgacgaaa ccactggggc    183420
     cccagcaaac tgccacccat caccgctgcg ctgggggtgc ggggtgagaa tcagtgatcg    183480
     atccgtgtcc atcgctgtgg agatgacccc acgagtctgc gctcgaggat gcgaagtact    183540
     tccgtcccac cgtcgccgct ggccttgcgg caagcactga accgcgccat tgatctgacg    183600
     gtttccattg tacgagagac gataccaagc gcgatcgatg acccattcgg gaaggtcgcg    183660
     gtcccggtgt gccgaacaca acggttcttg gatggaatcg gtcgacatat tgtcgggtcg    183720
     gcggcaggcg ctgcgcaagt tgtccgcgcg gcgctttgtc cccgcggcgc tgcatgctct    183780
     gacgacctcg gatacgccgt cacccctcgc ccggtcacct gacccgcaca acaccaccgc    183840
     gatctgctcg gctccgctgc gctccgccgg gagaatgtac ccgtcggcac caggcgcaag    183900
     atcacctcac tatcggggtt attcgcgcat gtggtcgtgc cactcgcccc cgtcgccgcc    183960
     gtttgcaatc agaacaatcg ccgcgatcgc atagaggacg atcgcgagca gcagtaagcc    184020
     accgaagatc catagtgaca gttgcccgag cttacgcacc cgccgagagg cgtactcggc    184080
     gccgtcaaga tcgccctctg cccacctggg atagacctca aacgcgtggt gaaatgccga    184140
     gaacgccagt ggccagaaga agagcaccga caccaccgcc cagccggcgt tgctgctggg    184200
     tctcgccctg accgactggc cgtcggttgg gtcgcgggcg ggctcggtcc gagtgggccg    184260
     ctcatcaggc gcgggttccg atgatggatt gaccatcgcg acctccatat ctgtagagac    184320
     cgttccgcat cgacgatacg tgccttacgc tgaggattcg ctgagtgctc catgatcgat    184380
     ttcgggtgtg gtcgccgtgt tcgctgtcgt ggcgcggcgc ctctcgatca ccgcgccgcg    184440
     cgagtagcga gaccactggg taggtccgcc gtccctcaga gtgctctcgg cgaatccggt    184500
     cactccggat gtgcatgcca tcccggacga tgtcgaccac ggttcccgag gtcacctctc    184560
     cttggagggg ttcgatcgcg cagatgccga cacgcagtga tccattcttc ggacgcggta    184620
     acgacatccg ggtgggcctg ccatgtattg gtcaagtcgc gcaagaggta tgggcgcaca    184680
     acgagaaccc ctctcagcgg acccacagca ttggatggcc atagtgggtg ccggggtgaa    184740
     tgtgattgcc gaccacggag aagagaggag atcgacctat gtcatcggtt gcgcccggat    184800
     cgcatggacc cgatcatccg tcacggtatg tgatgcgcaa acttcctcac atcaccctga    184860
     ctttttggat gttgaagatc gtcgcgacca ctttcgggga aaccggtggc gacctgctcg    184920
     cgcagacctt ggaggtcggc tacctggtga gcacgctcgt cttcttcgcg atgttccttg    184980
     tcgctgtcgt ggtgcagctg cgggctcgga agttccatcc cgccatctac tggacggtca    185040
     tcgcgctcac cagtaccgcc ggcaccaccc tgtcggactt gatgaaccgt accggaggaa    185100
     tcggttacac gaaaggcgcg atcctgctca ccagctgtct cgccgtcgtg ttcgtagtct    185160
     ggtggcgcag cgggcaaacc ctcgacgtcg aaaatgtcgc gagcttcaaa ggtgaagtgt    185220
     tgtattggat cgcgatcctt ttctccaaca gtctcggcac ctccagtggg gacttcctag    185280
     ctgacgacct cggcatcggt ttccgggata gtgcggtggt cctgtccgcg gtcatgttgc    185340
     tgctgttggc cgcacactac ttcacccgga tcaacgccat gttgttgttc tggatcgcat    185400
     tcgtcctcac ccgtcccctc ggcgccaccg caggcgactc cttgagtaaa ccgatcgaaa    185460
     agggcggatt gaactggggc accatgtgga catcggcggc gctgctcgcc gcaatggtcg    185520
     ggttgatcat ctaccaggcc atacacctgc gtcatcaccc tctcgatcct ctgccagctc    185580
     cgatcgaccg gcgcacaggt gatcggcaga agcccaacgg cgccctggtc cccgaagacc    185640
     gcgcggagcg ggtcactgcc gagggatccg cttgacccgc cgtggccgat acatgcccgg    185700
     cgctgcgcgt aggtgcgacc cggcgagcta ttgccggtca ccgggttgtg cgtcggtgtc    185760
     gtcgccggcg caggtttgtc ggaggaacgc cgatgaggcc gaacgtgttt cgtgctcatc    185820
     tgaatccagc gggagaggtc tcgcgcctcg gcccctggtc gcctcctgcc acgggacctc    185880
     caccgccgac agggaaagga accaccgaag cgggtccatc ccataggaac gctgcgtgcc    185940
     gtcgaccggc ccaggtcgga cagatacgcc gtcacagcgg cttcgagcgc ttggtctata    186000
     gcaagaccgc ggccgccgca ccggaggttc cgggctgggg ctggccatcg acgccgcaca    186060
     caacggggcc gtccggctcg cagacggccc ggacggcggc gttcgcgtca tcgtcgaact    186120
     tgccgtacgt ggacctgacc acccccggcc gatctcgccg aatagccagc gccagtagta    186180
     ccccggtccc ggaaggtctg tgcggtggcc cacgatgcct cgagcacggt gatgtgcgcc    186240
     ggttcagggt gtgatcgcga gtcgtcgacc caaccagggg agttccttct ccagaccggc    186300
     cgaccacacc tcgaaggtgt gaccgccggg gagctcggag tagtgaacat ccataccggc    186360
     atcccgggcg gcgatggcga gcagttgcag cgcctgctga gcctcgggat cggcggagcc    186420
     ggcgacgaat gcgccggcgc tgtccgggta ccggtgggtg tggagcaggt cgagggggtt    186480
     gatgcggcga aaggcctgct cgtcgccggc gaacacgtcg gtgacggtgc ggcggtggtc    186540
     accgaggcct ggttcgatct gcccggacag gtcgaggaag gtcgggtaga tgtcggggtg    186600
     cgcggtggcc agttggaggc tgcaggttcc gccgtaggag agccctccga ttgcccagcc    186660
     ttgcgggtcc ggatcgatct ggaaggtgct cttgacccag ttcgggacgt cggtaccgag    186720
     gtaggtgtcg acattgccga ggtgcgagtc cacgcacgcc gggttgccga attgagtgcc    186780
     cgtcgcgtcg gcgacgacga caacgggcgc caggccggcg tgctgtgcgg aaaaggagtc    186840
     catggtctcg accagtcgtc cgccggccag ccagtcctcg gggccgccgg gtaccccggc    186900
     cagcagcacc agtaccggca gaagggggcg tggctcggcg aagtatgccg gtgggaggta    186960
     gacgatggcg ggtcgtgcct cgaatcgaga caccgtcggt ggaatggtcc cggtagtgac    187020
     cgctccggtc gcgggcatgg ctgccggcgc ttcccacacc ggggaaagcg gatcccgatc    187080
     gacggcggtc cggtcggtgc ccctgatctg gtcgagggcg agtgtgcggt agtcgggaat    187140
     gcccaggatc gacccgagtg tcgggtaggc agcgaacagg acattgatct ggccagccgc    187200
     ggcgatgacg acgacaaccg aggaaagggc gatcgcggtc gctgtcaccg ggtagcggcg    187260
     gtcgcggcat cggaagaacg cccgcaacgt cgccaacagg acggccagca ccgcgacgcc    187320
     accccagaag tagactcgcc ggtcgagtat gtcgggaaac ggcttccaga ccctttcgac    187380
     gatccacacc gatcccaccg ccagcgccac ggcaccacaa ccggcgaggg ggacaccgac    187440
     gagcagccat cggcggccgc ggcggaggag tagaacaccg agaccgatga ccacggcgac    187500
     cgtcagtgcg gcccggatcg gtccggacag caatgaccac ccggtcagtt cgctgagcat    187560
     cggatcggcg cacccttcct cccgacgggg cccggactgt gctgttgacg ccggtaccac    187620
     cgccgcgctc cccacccaag cggctcttcc cagttggcag tggcattgat gtcggccggg    187680
     cgcgcgccgc catgatcggc aggcgaaggc caaccgtacc cgtccgcaga taatgcggcc    187740
     acaactcgat tgttgccaca cgtggcgttg acggagacga cggcagcggt gtcggtgtgt    187800
     ggatcgaccc gcaacggtgc ctcccggcgc cagtcgaggg tcagcaaatg cgttcctcgg    187860
     gagagccgct ggacgaagcc gtatccggcc aactctcctt ccgggacttg ccagccgatg    187920
     tgttcggttt gtcgacgacc tcccgaacac cggaccgcgg gtgaccagct gctcgaacac    187980
     cgccggcaac tcggtctccg gcgttcggca aggatttgtc gtaccggcga ccgccgtcga    188040
     tgctcatccg agtgcgttcc gccatcgatc gatggcaacc attgtttagt cacagtgaac    188100
     ctggttgggg ctcagcaggt tcgggctgat ccgcaggacc ggatcggtga ccacgcagag    188160
     ggcgtagcgc ggccgcggaa gtcggtagtc tcgccgcggc gaggcggtca cagacatccg    188220
     ccgggtgtac caggaggatt acgcctacgc cgcagccgtg gcgctgatcg cctcggtgga    188280
     ctcggactcg gactcgacgg aggcgctgtt cgtgcctagc tcgaagcgca cctaacctct    188340
     ccgcgaagga caagcggatc gcgtccttcc ggggtttccg atgaaggcgc tcatcgccgt    188400
     gaagcatgcg atgctcgtcg tctggaacat tctcgccacg gcgacctctg ccccgatccc    188460
     ggggccgtcg acttcatccg gcgtggcccc gccacgacca ggggcccgcg cagtcggcga    188520
     gctcgaggca ctcggctacc gcgtcacccc ccacccgtcc tcacctgcgg tggtcaccta    188580
     gtttcgtaag agagacgtga gagacatggt gtctctgacg agccgggcga gggagggaat    188640
     gtgatggtcc gtcttgcccg aatggcgatc acccgtggca tcgccagtgc aggcgccacc    188700
     ggcggcggca cctgtcagcg gctggtgagt tcgtcggtgt ccacatgcac cccgacgtgg    188760
     actccaactt tgctgccgag gttgaccagg gcgtcgagtg agaacttgct cagctttccg    188820
     cggtacaggt ccgacagccg cggttgagtg acgccgaggt tctgcgctgc cgtgacctgg    188880
     gaccacccga agcggtcgat ctgtccgcgg atcgcggtca tcagatcagc gcggagctga    188940
     cggttgtatg cttcgcccgg ggcgtcgctg atcgcctccc aaacggaagc ggtctcgacg    189000
     atgtcgttgt cgctcatcat ttctccttcg catgtgcgtc cgccgccttg tagcggcgac    189060
     ggccgaggtc gatgtcggac ttcgaggttt tctgcgtctt cttctggaaa cagtgcagga    189120
     cgtagaccac ctcgccgaac cgagcaacgt agaacgttcg aaacgctcca tcgggagtgc    189180
     ggacccggat ctctcgacag ccggccccaa cctccttcat cgccttccag tcatccggat    189240
     ccagcccctg ctgcactcga tcgagctggt agccgagatc tgtctgtgca tctccgggca    189300
     gatcacgcag gtcatcgagc gcactgccaa cccatcgaat cggtttttcg ttacctcgca    189360
     ccacttacac agtatatcaa tacggatata cacgagaccg ggaagtatat tcgatcgttt    189420
     catggtcgag catgacctgc agccgcgtcg tcgggagttg aggacacgga ggacgacgtc    189480
     gatggcgaga tggttgacga ccaccatcag cacgaacgat gttccggttc cggaggtgta    189540
     catgtcgcag gcagagcgcg cgcgggggcg cggcagccac tatatcgagg aatcggtctg    189600
     ggtgtacctg atgcgtgact gggacggtgc cgatcggtgg gtgctcgacc cggtgacggt    189660
     ggacgggtac gggctggact cgggcctcga gaacggtgtc cgcaacagtg agtgcgtgtg    189720
     cgaggaccag gccgagtgcg acgtgtccgg gatcggatgg accgggccgc cgttgtgtgg    189780
     tggagccgga ggggctgggc ggtcaaggtt ccggtgctcg cgcagtttcc tgcggatatc    189840
     gagaccatga ccgggctcga ccccgagggg cgcccggtga tggcgcagcg gattggtacg    189900
     gtcgtgggtg tagacgaacg gcgcgttgcc gaataattca tcgcggatga tgcggttgtc    189960
     tcacgctctt gatcgcacgg ctcgatcacg aggtttgtca ccgacgtttg agccagatcg    190020
     cgaactgcgg cggccaacgt gacgtcgcgg cctgccgctc gttcaccttc ttcgaactca    190080
     tgagatggat acggctggac gcctcgagtc gcgcgacttc ggagacaatc ttcggtgcca    190140
     gcttcgtgcc aacaccggtc atgtgaatcc gtgtgtgtcc aggcgggcgg agcgcgttca    190200
     tctgcttacg gagaccggtg agatcgccgg cagcgaccgg cacggcggac agagggcata    190260
     ctcgcccctt ttggattcgt cgatgaacgc atgcattgcg gcggaacgat ctgaacagtc    190320
     ccgggctgcg ggcaccgcac gctcatcact gctggttcac ggcacgcaat ttgtcggttg    190380
     agcggtgcgc ggtaaccgga tgcctgctgt cgatgtcgat gagacgacgg tggaagcgtt    190440
     tcatcgtagt tgggctgagc gggcagagcg accgcgggcg gggtgtgctg gtgtctaccg    190500
     cctctgacgg cagacaccag tgtgcgtttg acctgccgcc catatgggct gtatgggtca    190560
     tatgcagtga gagtgcgctg agctgaggtg ctggtggcac gtcccacccc acccgccgat    190620
     gccgcggctg tagctaggca gagtgctttg gatgtagtcc tcgacggcct cacgcatgag    190680
     ttcgctgggc ttgtggtgct tgtggtgctt ggcgttcgtc gagcttgttg ctcaacggtt    190740
     ggggctgatc aggcgcaagg acccgaccgc cagccacccg cgccgggcga ggcgggcatc    190800
     gatggccttg accgcggggt gcgtcagccg cgctcgtacc gcggtgcgcc cgagcgcgcg    190860
     caccagcagc agcgccagca cggcgctgac cgtcgtggcg gcgatcgcga cggcgacccc    190920
     ggggccgggc ccgaaccgca gtccggcgct gagggtgaac accgttcgcg gcaccggggc    190980
     gatcgtcagt accgcctggg ccaggaagaa caccagcacg aacgccggtc ccatcgactc    191040
     cgcccactcc tgcacctggg agatcgacgg gcgaggggcg agggcggcgg ccacggccag    191100
     tgaggccagt accgccaggg tggcgaggac tcggcggtcg cgcaggatca gcggcacccg    191160
     ccgaggaccg cgacgtgggg atctggggga tagttggtcg gcggaggcgc tcgggcgggc    191220
     atcacctggc cgcgagtgct caccgactga gtcggcctcc gcggcggcgt ggacggtgta    191280
     ggttcgcggc ctccacgttg gagggatcac gccagcgcgc ttccggccag ccactgatcc    191340
     cacggcacgg accagtcccc gttctgccac tgcgcgagcg gctccccgcc ggtgttgcgg    191400
     acctcgacga tgtcgccggg gacggagaag tcgtagaacc agcgggcgtt gtccgggctg    191460
     aggttcaggc agccgtggga aacgttggtg ttgccctgcg cccagatggt gtcggcgagt    191520
     tcgtggagat agatgccgtc gttgctgatg cgggtggcgt agttgatcgt ttccttgtac    191580
     cccaggcggg aattgaccgg gagcccatag gtcgaggaat ccatgatcac ggggttggcc    191640
     ttgtccagaa cggtgtagat gccgcgctgg gtccagaacg tcagggtttg cccgttgatg    191700
     gtttcgctgc cgcccatccc catcgaggtg ggcatggtcc gcacgacttc accgttgttg    191760
     ctgaccgtga tctgtttggt ggtgtcgtcg gcgatggcga tgtgcgcgtc gccgatgatg    191820
     aacgaggtgg tcgcgtcctc ctgaccgaac agtccaccac cgaggtcgac gccgtagacg    191880
     ttcgcgcggg cggtgacttt cgtgccgggt gtgtagtagt tctgcggtcg ccagtgcacg    191940
     ttctgctcgt ccgcccagta ccaggatccc ggcaccgggg gtgtggtctc gacggtcaac    192000
     gccctctcgg cagcggcgcg gtcggtgatc ggctcgtcga agtgggtgac gacgacgatt    192060
     ccgatgccga aggtgccgcc gtcggtgagg agattgccac cggaggtgac gaacgtcggt    192120
     ttggtcaggt tgcccggttt gacggtggag aaggtgctgg tccgctcggt gcgggtgccg    192180
     tcgtcgtgga ttgcggtggc cgcgatggtg taggtcctgc cgtatcccag cgcggcaccg    192240
     ggtttccagg cgatgcggtc gggggtgaag atgccctcga tgaccttgcc ttcgttgttg    192300
     gtcatggtga ccgattcgag ggtgccaccg gtggtttcca ctgacaccgg gtccgcgggg    192360
     ttgaccgtgt cggctccgtc ggcgggggtc accgtgatcg tggggtcggg gtcggcgggg    192420
     gtggaagggt tcgcgccgcc gcccggcgag gatccggtgc cggatggggc gcaggcggcc    192480
     agcagcgcga gcaggatcgc cagggcgatc aggatcggag tacggcgggg tgggtgtgtg    192540
     tgcatgagtt cctcaatacc gacgaggcgg cagcgagctg gtggcagaga agaagtgggg    192600
     tgcacgccat gtccgtggcg gcgggggaag agggtgggac cgggaggggg cacggtccca    192660
     ccctcgtggg gtcagccctg ttgcagctgc ccctgcatgg tggtgatttc ggcttgctgg    192720
     gcgccgacga tggcggtggc cagttgcttg gcgtcggcgt tctctccgtc ggagagttcg    192780
     gtctgagcca tctcgatggc accggtgtgg tgttcgatca tcatgttcag ccaggcggtg    192840
     tcgaagtcgg cgccgctctt gccggccagg tcgctcatct gctccggtgt catcattccg    192900
     ctcatgccac cgccgtcggc catcccgctc gttccgccgt gcttcatccc gctcatgccg    192960
     ccgccggcat cggtcgaggg aacactcatg ccccgctgtg ccagcagtgc ggtcatctgt    193020
     tccatttccg gtccctgggc tgcggcaatg tttttggcca ggtcgagtat ctgtgggttg    193080
     gtggtgcggc cctcgaccat gttggccatc tcgacggcct gggcgtggtg ggggtacatc    193140
     gtctgcagga acgtcacgtc ggcgttgttg aatgcggtcg tctccaccgc tgcggtggtg    193200
     gggctgctcg acgtggtgcc cgaggtgtta ttcgacatct gggacatgtc gtgtccgccg    193260
     ccgctgttgt cgctacagcc ggcgagaacc agcactccgg acaccgccgc ggcggacagg    193320
     acgaacgtgg cacgggggga acgcaaagac cacatggata ggactcctcg aaaggtcggt    193380
     gtgtgaaagg tgaagcaggc gtgcccgaga cacgtccgcg taggtgaccc acttgacgtg    193440
     ggtcacctgt cacacccgca ataccgacag ttgcgcgagg gtcggagtgg tccacggcgg    193500
     cgcccggcca gcgcggtggc gcagcagggc ccgcaggctg tgtaccgcgg tctcgccggt    193560
     ggtggcggtg gcgtaccacc gggcgaggac caacgccgcg gcgatcgtca tcacggccat    193620
     gcacagatgc aggccggaat ggtcggtgca gtcgccgccc tcgcagcccg tcccggccag    193680
     tgcgacggga aaatcctcga gcggcatcgg catcggcgcc gcggccgcgt cgtgggagtg    193740
     cgcgtgcaca ccggaatcat gccccgatga ggtggggtgc ccgccggtgt ggtcgagcag    193800
     gggagaggaa tgcatgagga ggacaccgaa cagcaccgcc acgacagcgg ccacccgcag    193860
     caggtgctgc atcggcggcg tcgtacccag cgctttcaca gtcatgatgg tactggccgg    193920
     gctcggggtc gccgcggtga agggcgcgac cgggtgattg tgtcgctgag tgcggcgcca    193980
     ccggtcggct gtccgcactg ggtaaccccg gagacgatgc gatcgcccgc cgtcccgccg    194040
     ccccgccgcc ccgtcatcgt tcaccgggct ctgggtagag gaatctgcgg gtgacgagat    194100
     gtttgctgtc ggtgagggtt tcctcgctga tccgtccggc gtcgtcgagg gtgagcaaca    194160
     cgttcattcc ggcggccggg tagccgagca ccaaccgcac ggccccgtcc gcgtgcggca    194220
     accggacggc gatcggggcg gttccgtcgg cgtacggttc ctgcgccagg aagaagtcgg    194280
     cggacaggtc gagtcgctgc ggctcgggca ccgggccgct ggtgtcgctg gtgacgctct    194340
     cgtagacagt caggtcccgt gggcgtgggt ggcggcgacg gcgcgggcga ggtcgtcgcc    194400
     gccgggaccg gtgggccagg gcgcgagcag gctgaccgtg ccgccctgcc agccctgcgc    194460
     cgccgcgccg agggtgagca cgttgtcgcc gccctgccag ctggcgggtg cgacgaagca    194520
     gcccgggccg catccccgca ggtcgagtgg agcgccgtcg gttcctgcgg cgtcgatccg    194580
     cccggtcagg gaaaagtcct ggcccggttc gggggcgtag tagtcgccgc ggcgtggggt    194640
     ggacagccgt accaccagtt gcccgtcgct ggcggcgacg gagagtccga tctgcccggc    194700
     gagggcgccc aggggcagga ccggacccgt cggcgccggg gggcccggct gcggggaggt    194760
     gccggccggg gtggtggaga ccagggtggc gctgaccgcc agcaccgcga tcaacacgat    194820
     gctctcggcc cgaatcgtac gccgcatcag ggctgttcgc tccggggcgt gcagcgattg    194880
     ccgcgccgcg agcgctaacc cggcggcggc ggcggcgacc agcaccagct tgaccaccag    194940
     cacctgaccg taggtggtgg acagcagggc ggagaacgga atcagcagca gggcggagac    195000
     ggtgccggtg gccaccacga ccaggaaggt ccccaccgcc agccgggtgt atcccgccag    195060
     cacccaccgc acggcggcgc gctcgcccca ccaggcacgc accgcgcgga ccgtgtgcac    195120
     gagcgcgccc acccagatcg cggcggccgc caggtgcacc gcggtcagga ggccacccca    195180
     gccgggggcg gcgacgttgg cgtgcgagcg caggccctcc gcggcgacga ccagcaccag    195240
     cggtgcgagt gtccacttcc ggcggtcggc ggcggccacc acgatcgccc cggccaatcc    195300
     ggcggcctcg gtgagcaaga cgagaccggg ccggctctgc caccacatat tcacctcgcc    195360
     ggcgacgcgg cgagggcagc gccgaggccg aggacaccga caagtccgat cagggcgccg    195420
     gccaccaacg gggaccgcag caccggcagg gacggattct ctcgtcgggc ggtggtggtg    195480
     acgcgttcgg cgatcagacc gccgagtgcg acggcgagcc cgaggagcag cagccaccgc    195540
     agggcggtat cggtccagga cgtcgacggg ccgtcggccg cgctgccgtc accggtcagg    195600
     gcgaggccga cggcgaatcg gaagtcctgc tcgaccaggt ctccgtcggc gccggtcacc    195660
     tgccagcgca cggtgtaggt ccccgctgcc aaggtgtcgg ccgggcgggc ggtgaggaca    195720
     cgcccgtccc gggcggtttc ggcggcgccc atcgggattt cgcggccggc gccctcgtgc    195780
     aggacgatcg cgggcgcccc gggggtgacc ggttcgttga acatcaacgt gatcgactgc    195840
     ggtgggtcgg agaccgcggt gtcggagccg gggtcggtga acagcagggt gggacgggcg    195900
     ccggccaccc ccgccccggc acccgcggcc gcggtcaggg ccagcagcag gagcaggcca    195960
     cggaacaggt ggcgggcgag ggcgggcaca gtcgtcagtt cagggtgtag agcgcctggg    196020
     aggtggcggc gtaggcggtg tcgtagttgg ctgcggtcat cgcttcgacg gtgccgaccc    196080
     gggagcgttt ctgccagtcc cgcccatccc tgctgcgcca ggcgtacccg tcctcgtcga    196140
     ttccccacag cgcatccccg gcgccggaga ccatcaccag tcgtggggcg ttcggcacgg    196200
     gcgagaacgt gcgggcgccg gtggtgctgt gttccagacc cgccggggtc accgcccaca    196260
     ccccgctgcc gttgaccgcc agtgcgccgg cgaccagaga cgcgcccggt gtccaggtgg    196320
     tgccgccgtc ggtcgacacg agcagcccgt ccttgccgtc gaaaccgacc agcagccgtc    196380
     cgtccgtgct caggacatgg aagtcgacct gcccggccag ggaccggtcc acccagctgg    196440
     tgccgccgtc ggtgctgctg cgcagcccaa gcgggttggc ggccgaactg gacgcaccgg    196500
     ggtgcccgga cgcgaagacg gtgtcggtgt tcggtacgcc ggtcagtccc atgaagtcgt    196560
     cgtcggaggc gccgacgcgg gacgtcgtac cggaggtgtc gatggcgaac agccccgtgt    196620
     gggtgccggc caggacggcg ccgtcggcgc ccacgtgcag tccgtgcagg tgggtcagtt    196680
     cggagctcaa ctccaccgtc ggcacggcgg cgtccggtgt cgtcgtgtcg tcggcttgcg    196740
     aagagcagcc ggcgagcacg agcagggcgg cgatcccggt gggaaatacg gtgcgggcga    196800
     tccgattggc aggcatgggg tctcgttctg tgctcggcgg gatgaaaaaa gggggggcac    196860
     ccgtagcgaa gccgccgcgg gtgctgggtc cgatggtgtt gcggcggtgg ttattcggtg    196920
     taggacaggg tggtcatcat cccggcctca ccgtggtaga ggttgtggca gtgcaccagc    196980
     cactggccgg ggttgtccgc gtccaggtcc acctcgaccg tctgattcgg cagcaccagg    197040
     gtggtgtcct tgcggggacc ggtgccgtgg ccgtcgacga cctggaaggt gtgcccgtgc    197100
     aggtgcatgg ggtgaaacat catggtctgg ttgacgaacc gcagccgcac ccgctgcccc    197160
     tgggcgatcg cgagcggggt gtgctcgtcg taggtggcgc cgttgatcgt ccaccggtac    197220
     ccggacatgt ccatgcccag catcagatcg tggacccgat cggggttgcg taggccgagc    197280
     cggacgtcct cgcgggaccg cagcgccagg ccggtgatcg ggggtgcgtc gagctcggca    197340
     ggccggatgg ccggatcgag tcgtccgcct gccccggtgc ggatcacggc gaaaccctgc    197400
     ccctgtttgc cctcggcggc cgcgacgatc gggaagaccc cgtcaccgag cgtgacgatc    197460
     gcatcgaaac gctcccccat gccgatcagc accgaggatc ctgtgaccgg ctgcatcgga    197520
     tagccgtcgc tgtgggtgac ggtcagctga tggccgccca cggcgaggcg gaacgcggtg    197580
     tccgccccgg cgttgatgat ccgcagccgc acccgctgac cggggcgggc ccgcaccgag    197640
     aaggggtcgg tcccgagggt gccgttgatc aggtagtagg ggtagtccac gtccccggtg    197700
     tcggcgccca gcgggttcgc cggatcgatc gtggtcccta tgtccatccc ggacatgccg    197760
     ccgtggtcca tgcccatgcc gctcatcatc ggcatcccgc cctggcgcag ttcatcgagt    197820
     tgctggtccg gggtccggcc gcccaccccg tcgagccagt cgtcgaggac caggacggcc    197880
     tcgaggtcgt agtcgccgcc ctcggccggg tcttcgacga tgaccggggc gtacaggccc    197940
     cggtcgaact gcatcccgac atgggggtgg agccagtggg tgccggcgtc gggggcgagg    198000
     aactcgtagg tgaacgggct ggtgggggcg atggcggact gggtcagccc gggcaccccg    198060
     tccatgtcgt tgcgcagcgc gatgccgtgc cagtggatgg tcgactcggc cggcagatcg    198120
     ttggtcagct cggcgcgcag cagatccccg cggcgcagcc ggacttcccg gccgggaatc    198180
     cggtcgttgt aggcccaggt atcgacctgg acaccgccca ggtcgatccg ggtcgggccg    198240
     gctttcaggg aggcggtgac cgtgttcccg gtcccgatag tggctcgccg gacctgctcg    198300
     gccgtcctca cggctgccga atcgggaccg acggcggtgg gcgccggtcc ggggccacca    198360
     cccctgctgc acgcgcccgc agccgccacg gcccccaggc cggccagcgc cagaaagttc    198420
     cgacgcgaca ggcgggcggc accgggaaac tgttcgatca tgcacaactc ctgttcgagc    198480
     gcggagggcg gcgcgggact ccggccgtga accccacccc aatctacgta gttgcatagt    198540
     agatggggtg gggtgggggt ctgaccaggg cgttgccttc ggcgacctag cgggcggccg    198600
     gtacctcgtc gccctcgggt gcgggggtct gcgccggcgg cggggcgagc tgggcggacc    198660
     ggtcgagcag atacagggca cccacacaca ccgccccgac gacggtcagc gccacccaga    198720
     tcagcgcacc cagatcggcg tcgcgcagga tcccgaagac ggcgccggtg cccaggttgc    198780
     cgagcaggat gccgatcccg acgacggtgt tgtagaagcc gtagtgggtg gcgacgagct    198840
     tgccgccgga tagggcgacg acggtgtcca tctcgaacgg aaataccgcg gcggtgccga    198900
     cggccaacag cgccgcggtc agcaccaggg caccggcggc ggcccacccg ccgagggcgg    198960
     ccggactggg cagcaggatc agcggaagga aggccagcgc catgatggcc atcccgacga    199020
     ccaggctgcg tcccgaaccc caccggcggg agaaccagga ggtgatcctc agctgcccgg    199080
     cgatcgccac taccccggac accacgaaca gcgaggtcac cagggcggtg tcggaccgct    199140
     cgtccccggc caccacggcc gcctgcaggg gcagcgccag atagatctgg aacgagagca    199200
     cgtaggaccc gatcatcgcc actgcgaaca ggacgaaggg ccggttggcg accactacac    199260
     gccagtcctc gagcaccgag gtcttggccg cggccgtctc ggcccgatgc gcgggcagcg    199320
     cccagatctg cacgatcgtc agcacggcga agaccgcggc cgccgccagc gaggtgaccc    199380
     ggaaatcgag ggtggtcagg gcgagcccga tcagggggcc cagcagaatg ccggcctggt    199440
     agaagacgtt gaaggtggcg aacgcctcga cccgacgggg gccggcgtcg gcggccagat    199500
     aggcccgcac ggccgggttg aacagcgctc cggcgaaccc ggtcgcgacc gaggcgagca    199560
     ggatcgccgg cagtgattcc acggcggcga gcaggacgaa cccggcgacc cgcagcaggc    199620
     agccggcgac gatcaggggt ttgtagccga ggcggtcggc gagggtgccg ccgaggagga    199680
     acatcccctg ctgggagaag ttccgcatgc ccaggaccag cccgaccgcc cacgccgcca    199740
     gtcccagggg gccggccagg tagccggcca gatacggcat cagcatgtag aagcccacgt    199800
     tgatggagaa ctggttgacc atcagcactt ggctgggccg gtcgaagctg cggaactggg    199860
     tcagaaggtt cttcatgaaa cgctctcggt ggggtcgacc acggtggcgc accgggtcca    199920
     ggactggacg acgtggtcgg tcgggtggtc gatggtcgcc ggttcggtgg gcgggttggc    199980
     gtcgagcagg ccgtgctcgg cgcagtagtc gtcgttgtag atggtgtcga agtagcgctg    200040
     cgggccgtcg gggaagatgg ccgcgacccg ggtctccggt gggctggtgc gggcgatcca    200100
     accggcggtc agggcgacgg caccgacgct ccagccgccg ctggcgtggt gggtggccgc    200160
     cagggttcgg caggaccaga ccgcttcgtg gggggccacc cagtgcactt cgtcgaaggc    200220
     ggggtagtcg atgttgtcgg ggtagatgct cgagcccagc ccgcgcatga gccgggtacc    200280
     ggcgggttgc ccgaagatgg tcgatccgac ggtgtcgacg ccgaccagtt tcaggtcggg    200340
     gcagaaccgg cgcagcacgc gggcgacgcc ggcggagtgt ccgccggtgc ccaccgagca    200400
     caccagggtg tcgacgcggc cgagctgggc gatcagttcg agggcgagtg actcgtacgc    200460
     gtcgacgttg tcggggttgg tgtactgatc cgggcaccag gaccctggat gggcgctcag    200520
     gagttcgcgg accttctcgc gccgggcctg ttgccagccg ccggtggggt gcggtgtggt    200580
     gaccaactcg acgtgggcgc cgtaggcggc gagcatgttg tgcacgatcg gctccaggcc    200640
     ggggtcggtg accagggtga cgggatggtg atgggtgatc ccggccaggg ccagacccaa    200700
     cccgagggtt ccgctggtgg attcgatgat catcgccccg ggtgcgaggt cgccgcgcgc    200760
     cttggccttc tcgaccatgt gcagggcggg gcggtccttc atccccccgg ggttggagcc    200820
     ttcgagcttc gcccagaagc cccggcctgt gtcggcgaac ggttctccga tccacaggac    200880
     gggagtgttg ccgaccatgg tgctcggttg cgggcaacgg ccggcggtgc tcggcaggtg    200940
     gctggcggac ggtggaacga gggtggaggg aacagcactg ttcatgatga gtagtccctg    201000
     tatcgactgc gacgacggca gtaagtgagt gatgggcagc acgagctggg ccacgaggac    201060
     caaaagtcct cagatggcct gcgggctgct gatcagcacc tgttgataca gagttcgttc    201120
     agaacggtcc ggccgtgccg gatgggaatg ggtagatccg gcggcgcccg cggggtcagc    201180
     ggcaccgaca tcagcaccag caccacggcc agggcgatcg cgacgaccgc ggcgacggtc    201240
     agcgggcgga gcggattgtc ggagcggggc attgcgacga cggtgtgcgt ctcgtgcgac    201300
     aggtgggtcg atccgtcatc gatgtgcgcg tgcccgggag cggattcctc ggctggcatg    201360
     gatgttgtgg acgaggagac gtgcacgtcc tcgccctggt gatcgtgcgc cagaaagatc    201420
     ccgcactggg cgatcgtgtg ggcgagtaaa tagagggcag cggcgaccgc aacaaccgtc    201480
     cgcatacgcg gggggcgtat cgcaaaggcc gtcacaattt cccgactcta gcagcgcgta    201540
     cctgggcgcc ggtccagttg atcggcggac accagggcct cccgggcgcg atatccactg    201600
     gtcaggaagc catcggcagg caccacatgg ttccggtcac ctcgaggaca gccaacgcga    201660
     gcggggcggc ggtcaccatc gcgaccacgg cggccgacag caggcacacc cgcacctttg    201720
     cggtccgccg cggcggtgac gccagtcgtc cggcccggtc cagcagggcg atattgccgg    201780
     cgccgagggc cccgtcggga acctgggccg gagcgcacaa cgcgagcagc cccgagagca    201840
     gggcccgcga gccgtgcgcg cgcgccgccg agtcgtccgc gcacatctcc agcaggcggc    201900
     cgacctccac cgcaccggcg gtgaacaggg tcatgccggg caacgaggcg gcgagcaccc    201960
     gcagaacggc caggatctga gcgtggtgcc cggccagatg ggcgcgctcg tgggccagga    202020
     ccgcctggac ctgccggtca tcgagtgcgg cgagggcggc ggtggtgatc accacggcgt    202080
     gcggtcgccc ggcggcgcag taggcggcgc gctcggcatt gtcgatgacc acggcgtcga    202140
     caccgcgcac ctggtggccg atgaggcggg cccggcgggc atgaccgtgg gtgcggatcc    202200
     gcagccgcat cagcccgaca gcgagtcggc cggtgatcca cacggtgatc gacaccactg    202260
     ccgtggccgc cgcgactccg gccacctcga atgcggtgtc ggcaccgccg aggctctcct    202320
     gcaggcgggc aaggcaggcc ccgagcagcg actcgccggg acgagcccga taccggagaa    202380
     ggtcgagaac aagcagcagt gcggccatcg cccacgagag caccacactg gcgatggccg    202440
     ccgaccaggc gatcaccccc agacgcgggg cgaggccgcc atgggtgatg cggcgcaaca    202500
     ccggcggacc gaggacggcg acgagcccgc tgaacagggg gaagcaggcc gctgcgctca    202560
     tcatggggcg gcgtcctcgt cggtggccat gcgttgcaac gccatccgaa gtccggcggc    202620
     ctcctcctca ctcatctgct cgaagaagtg ggtcaagacc acatcggacc tgccgccgga    202680
     ttcgaacgcc tcacgcatca gccgggcact gtgctcctcc cgggttaggg tgggccagta    202740
     ccggaatgcc ttgccgctgc gctcacgctc gagccatccc ttgcggtgca ggttgtccat    202800
     cgtcgacatc acggtggtgt aggcgatctc gcggccccgg gccatgtcgt cgaacacctc    202860
     acggaccgtg gtcgatccct ctcgatccca cagccgttcc atcactaccg cttcgagttc    202920
     tccgaacccg cgcacccgca tcgcgccctc ccaccgtctt cgccgtccca gcgtacgacg    202980
     tcccggcccg gttcctgcgc ctcggtcgtg cgcccacctg cggcgacgtc acagaacacc    203040
     actatctact atctacgtac gtagtacgta tattgagttc ggaagctgat gtgaatcgac    203100
     gaggaggcgt ggaaacgatg ctggacatgg tgagcaatct gcaggcgtgg tgggactgtc    203160
     agatgatgat gagcggccag atgtgtcaga tgtgtgacat gtgctcgatg atgatgccct    203220
     cgtaatcgat tgagagtctt tcggattcag agaaccacgg tatgagtcgg cccctgccgg    203280
     tcggagtccg ctggcttgtg ccggttctgg cggtgatcgt tgtgttggtc gtcgcgctct    203340
     ggccacgaca aaagcgatga cgacccctcc accgggccgc ccaccgcaat cgcgacgggc    203400
     cgcggaagcg accaggccga acggggccga ctcgccgccg cagcagcgct acagccgtgt    203460
     ccgaccgcaa aggcggagac cgtcgacgcc ggagcgctgg gaggaatcac cgcccgctgc    203520
     ctcggatcga ccaccgaggt cgatctcggt gccgccctga gcggtgagcc gaccctgatc    203580
     aacgtgtggg cctcctggtg cgggccgtgc cgggaggaga tccccgtcct cgaggaatac    203640
     gcgcacaccc ccgatgccat ccgcgtcgtc ggcgtcgatg tcgacgacag ttccaccgcc    203700
     gcgctcgccc tgctcaccga attgggcgcg cactatccgt ccttcggtga caccgatgcc    203760
     ggcgccctgc gcggcgccct cggggcgccg ccggtgctgc cgctgagctt cctcctacgt    203820
     tcggacggct cgattgcgcg catcaccgag cctgcggttt tcgccgaacc cgcccaaatc    203880
     caccgagctg tcagcgaact gacctcatga ccacaccgac gcctcagcga cttctccgcc    203940
     gcagagtagt cctcgccgcc gtgtgcgcgg ccctgctcac cgcgccggcg tgtgccaccg    204000
     gtgcggacgc cgtcgcccag ggcggcacgt tcgacttcgt cgccccgggc gggcagaccg    204060
     acatcttcta cgacccaccc caggcccggg gcagcatcgg cgccctcacc ggaccggacc    204120
     tgatgaccga ccgaccggtg tcgctggccg actacgccgg gcatgtggtg gtgatcaacc    204180
     tgtggggcca atggtgcgcc ccctgccgca gcgaggccga cgacctcgaa cgcgcctaca    204240
     ccgccaccgc ggaccggggg gtgaggttcc tcggcatcaa cgtccgcgac ccggggcgcg    204300
     acaaggcgca ggacttcgtc gtcgacaacg ccgtcaccta cccctcgatc tacgacccac    204360
     ccatgcgcac cctgctggcc ctcggcggca gctacccgac cagcgtcatc ccctccaccc    204420
     tcgtcctcga ccgccagcac cgggtggccg cggtgttcct gcgcgccctg ctcaccgagg    204480
     acctgcaacc ggtcatcgaa cgggtggcgg ccgagccggg agatccgaga tgaccgtgct    204540
     cgcccaggaa ctcgggtcga gcttccagac cgccgccgcc accggaccga tgctgctggc    204600
     cctcggtgcc gcggcgctgg ccgggctgat ctcgttcgcc tccccgtgct gcatccccct    204660
     cgtccccggc tatctgtcgt atctggccgg gatcaccggc gcggagaccg agtccgcccc    204720
     cggtggtgcg atcggggtgc gcacggccac ccgctggcgg gtcaccggcg ccgcggtcct    204780
     gttcgtcgcg ggattcaccg tcgtgttcgt tctcgccacc gcgtcggtgt tcggggcgat    204840
     cagcgtgctg caactgaacc gggaactgct cgggcggatc ggcggcgtgg tcaccatcgt    204900
     gatggggctg gccttcctcg gcgcgattcc ggccctgcag aaggacaccc gcccgcatcc    204960
     gcggcggatc tcccacctcg ccggcgcccc actgctcggg gccgtgttcg ggctcgggtg    205020
     gaccccctgc ctgggtccca ccctcgccgg ggtgctgtcg gtggccgccg gcaccgaggg    205080
     cgccaccgcc gcccgggggg tcaccctgat cgttgcctac tgcctgggcc tgggcctgcc    205140
     gttcatcctg ctcggcttcg gctccaccgc ggccgtccgc ggtgtcggct ggctgcggcg    205200
     gcactcgcgc accctccaga tcctgggggg cctgaccctc gtcgtggtcg ggctcgccct    205260
     gctcgccggc gcctgggatg tgttcgtcgc ctggattcgg gacgagttcg tcaccgccgt    205320
     cgtcctcccc atctgacccc ggtgggaacc gtgggaaaca agtgaatagc ggcacagaag    205380
     tgaagaaagt gtattagcgt tacggcgtgt cgtcttgact ttgtcgcgcc ggtccatgtg    205440
     tttgctgcac cgccgaaacc ccggcgtgac tgctcagaag ggacctgcga tgcgcggtat    205500
     cacctcctcg gcgctgaccg cctgcacgag aagactgccc accctgtgcc tgggtgcctc    205560
     cacggcggcg gcgatggtgg tcctcacggc cccgcccgcc tcggccgccc atcccggcca    205620
     cgcggattcg tcgtccgcgc tcgccgcggc gctggccgac gcggtcacca tggtcgccga    205680
     cgcggcgcag ccggacgtgg tggtggtcga tcccagtcgt tggcagaccg tcgcgaacat    205740
     cgcggccgcc agcctgcgga atgccgaggc gaatggctcg ctcgccgatg cgttcgaggc    205800
     ccagcacctg ctcgccggat gcctgagcgg tttcgccgcc gggtccgccg ccgccgaggt    205860
     gctcggtgcc tgcgccgacg agctcggcgc cgtcgacggc ggcatcgcgc cgaggttgct    205920
     cgccgcactc gaactcggcg acgtctccga atcctccggt ccaggcatct tcgaccacac    205980
     cgacccggcc gaggctgcgg cggcacccga ctcggcgctc gccgaggcca ccgtcccgaa    206040
     cccggacgag gagcagaccg ccggcaccgg tgccgaaacc ggtgaggccg aggccgacgc    206100
     cgatccccag agcgagcatc ccggccccga gggcgccgag gacatcgagg ccccctcacc    206160
     cgaggcggac accggcggcg acgccgacgg atcccacacc cacgacggcg ccgacgccga    206220
     gggggccgcc gacgacgcga ccggtgacga gaccggcgcc gtgaccggtg ctgacgagac    206280
     cggtgctgac gagaccgagg acggcgcggc ggctccgcag cagccccgca cctggaatcg    206340
     ccccggcacc aaggaattcg tggcacccag cgcgggcacc gtcacctcca ccatggggga    206400
     tgggcgcggc cacgaaggca tcgacatcgc caacacactg ggtgccccga tcgttgccgt    206460
     cgcggacggt gaagtcatcg acgccggccc ggcccaaggg ttcgggttgt gggtgcggat    206520
     ccggcatgac gacggcacca tcaccaccta cgggcacaac aacgacaacc tggtcgaggt    206580
     gggggagcgg gtcaaggccg gacagcagat cgccaccgtc ggcaaccgcg gcaattccac    206640
     cggcccacac ctgcacttcg aaatcgaaga cccggacggg gagatcgtgg accccgtcaa    206700
     atggctggcc aagcgtggcg cctccatcgt cggactcgac tgagctgcaa ccgctgtttc    206760
     tccgtctccg caatcgggtc ggacagtcgg cggcagagct cgtgcagcgg cacagcggcg    206820
     gtggaagggg acggtggttg ccgatgatcg acgtcgagga cagcatcgtc atcgattgcc    206880
     ccatcggcga ggtcttcgac ttcgtcgcag atcagaccaa cgcaccccgc tggcagaacg    206940
     gactcgagca ggtccgccgg atcaccgacg gacccccggg gtgggaacca aacatgttgt    207000
     cgtccgcaag tttctgggtc ggagactgga cttgatcaac gaatacgccc acttcgagcc    207060
     gaacgcggag atcaccttca ccggtgcgtc cggaccgagc cgcttcgagg tgacgtaccg    207120
     gaccgaggag accgccgagg gaacccggct cagctgccac atgcggatgg agcagaaggg    207180
     actgttcgcc ctcggtgacc gggtggtggc cgagggtctg cgcagagact tcgccgccaa    207240
     cctacgaaac ctcaaggcat tactcgaaac ccgcgcagaa tagccgcaac cgatccggcc    207300
     gcgactttat ctcgacagac tgggcgccgc ccggttccgc agcgctttcc ggtgcccgta    207360
     tgcggtcacc ccgcgcggct tgtacaccgc cagcaccagc gcggcgagta ccacgatcag    207420
     ggcggcggtg gcatgcacca gatgggtggg gtcctgcaag acggctcggt cggcctgcga    207480
     ccagctcggc tgcgccgcga cggtcgcggc gtactcgatc gagcgggtgt agagcaccag    207540
     caccacggtg gcgaccagat tcagcagcaa cttcagcagc acccagtagt ggcgaaacaa    207600
     gccccacgcg gtgccgagcg agcagatcaa cccggtgacc agcgaggcca gcgccaacgg    207660
     cagcagcacc gcgtcggcga gcatcgccat cacctgatag cccccgcgca cctgtgccgg    207720
     atcggcgccg atcagcgtgg ccgcggccac caccaggtac gtgacgatgg caccgagcca    207780
     ccccgccgag gcaccgatgt gcacggtcag cgcgagcgtg cgcaccggcg gcgacatcgt    207840
     cacagtgtga tcggcccggt cagcgcctgc ggcagggcgc ggtcggcgtc gaagccggtc    207900
     accgggtgca cgaccgtggc gggggcggac atgtgccgtc ccggaccgtg gttgccgcca    207960
     ccgaacagca tcacggcgat gaccagcacg agcaggaggc cgacgacgac ggcgaccacc    208020
     ttcacccagc gtggcgtccg gtgctcggag ctgccgccgg ctgaacgggg cggcggcggt    208080
     ggggtgggtg tggggtcggt catcggcggt agctccctca tccacgaaga caacttttgc    208140
     gatacacact gtcacatgcc aagtcatgtt gtcgatagtg cggcgttgcg tatacttcga    208200
     gggtgccgaa gctgtggaac gagacgatcg aatcgcatcg ccaggcggtg cgggaggcga    208260
     cgatggacgc cgccgcggcc gtggtggccg agtccgggct cgcggcggtg accatgtcga    208320
     agatcgccga gcgcagcggg atcgggcggg ccacgctgta caagtacttc cccgacgtcg    208380
     acgccattct caccgcctgg cacgagcgcc agatcgcagg ccacctgcac catctcgccg    208440
     aggtccgcga ccacaccgac ggccccggcg cccgcctggc ggcggtgctc gaggcgtacg    208500
     cgcagatcct cgcgcatcat cacaccggtg cgatcgcggc ggggctgcac cgcggcgacc    208560
     acgtggcgcg cgcacagcaa catttgcacg agttcgtccg cgacctgctc accgacgccg    208620
     cggagacggg cgagggcgag gtccgcgccg acgccacaac tgatgagctg acctggtacg    208680
     tgctgcacgc ggtcgccgcg gctgaaggac tcgactcacc cgccgccgtg caccggctcg    208740
     tcacgatcat cctggccgga ctgcggccgc agcgctgacc gcgatctctg caccccgccg    208800
     ccggtggggg tgtgatctca gggccgcgcg gcgtgcgcga gaaacaccgg aatcgccacg    208860
     aaacctcggt ccgcctgccc gcggcgagtc tggtcaccga tccagtcctc ggactcctcg    208920
     gacgtgatcg cgccgacggc ggctgcggcg tgggcgatgc cggtgagcat cggcagcagc    208980
     gtgtggtcgg tgaacacccc ggtgtgaact tcgatctggg cgtcggtgaa gccggtgtcg    209040
     agcaggaggt tgcggtaacg gcgggcagcg cggggcgcgg cgacggtgtc ggcgcgggcg    209100
     tggacgatga ttcgggtgag ctcggggtga tcggagtcga tgaagaatcc gtcccagtcc    209160
     tgcccaatca ggacgatgcg cccgcccgga gcgagcaccc ggcgcgcctc ggtgagcgcc    209220
     gcagtgggat cggcgaggtc gtgaaagacc ttctccgccc ggtatccctg caccgagtga    209280
     tcggccagcg gaagctcggc tgcatccgct ttctcgaatc ggcagtgcgg ccaccgcctg    209340
     cgggcgatgg tcagcatgtg ctcgtccagg tcgatcccga gaccatccca tccctgctcg    209400
     gtcatctcgg cgacggcgcg accggcgccg cagcccacgt ccacaatcac cgctccaggt    209460
     ggggcggcca gtagttcgat cgatcgtgcc cgtagtgccg cggcaccggg gtagttgtcg    209520
     atgacgtcga ggagcgcgac gagggcctcg gtgtcagggg agatgttggt ggttgacatg    209580
     acagccagga tgcgacttca tgttgacatg aagtcaagcg acgacagccg ctcctggagc    209640
     atcggtgagg tcgccgagcg gttcgggatc gccacgcacg tactgcgcca ctgggaaacg    209700
     gtggggttgc tgcacccgtc gagagaaggt ggctcgcgcc gccgatacga gaagtcggat    209760
     gtgtacgcgg tggcgatgat cttgcgcgcg aaggaggccg gtttcggtct cgacgacatc    209820
     cgggagatgt tcgacaccga cgacccggtg aggcgcacag ccattctcgg gcgacaccgc    209880
     gacgctttgg cccggcggat cgcccgcgcg caggcctcgc tcgccctgat cgactgtgcg    209940
     ctcgactgcg atcacgacga catcgcgtcc tgtccgcact ttcacgcggc gatcgacgcc    210000
     cgcatcggcg cgctcgcgcc gttgtcactt ccgtgagcgg ccaagggact gccggtggac    210060
     ccactaccgt gatggccgga cttatgggga tgcgggccgt gccgctcgga cgtagtgcag    210120
     cagcgggcgg cggtcgccgc ttccggtgat ctcgaatccg gcgccgctga tcagaccgtc    210180
     gagttcgtgg atcgggttgt gttgcatggc gtgcccgctg agagttccta cgaggtggtt    210240
     cgcgatgcgg ttgcgcggtg gccggaagtc ggcgatgaac agccggccac ccggccggag    210300
     cacccggaac gcctcccgca gcgcggtggc cctcagctcg ggtggaatgt ggtgcacggc    210360
     caggctggag atcaccagat ccatcgacgc gtcatacagc ggcagggctt cggcgcccgc    210420
     gagccggaat gtgcagtgcg gtggtgagac gcgccgggcg taatcgatca ccggcggcga    210480
     cgggtcgatc cccaccacgc gcccgcccgg cagcacggcg cgggccgccc ggcgggagaa    210540
     gtagccggtg ccacacccga tgtcgagcac ctcgtcgccg ggatgcgccc cggcgagtgc    210600
     caccagcccg tcgaaaaccc ggcggcggaa accaccgaat cccaccgcgg agaaacactc    210660
     gtacagtcgc gcccgccgaa tcagtcctcc gctcccgtcg tcggcatgac catcggggcc    210720
     gcccagcagc ttccgaccga gtcccatgtg aaagtcctcc ctatggtgat cggtcagcgc    210780
     cctgcagggt gtgctgctcg aggtacggat atcagtgggt gacaagccgt gcggggtcga    210840
     ggtcgagtcg acggagaagc tgcgcattga gcgccacgac gatcgtcgag accgacatgg    210900
     ccgcagcccc ctccgcgggc ctgacccggt tatgcgtcgg ttcgttgacg agtgtcggcg    210960
     gcgaaccccc gcaaatcggt gagggttttg tgaagattcg ttgaagaaga gggccggtcg    211020
     agtgcgcctg gcgctggcac ggtattgagt tgaggaatcg gcgggtcacg acccgaggag    211080
     agtgtgcacc gatctggcgg cactcgttcg ggttgctgtg tgcgggggaa aggggtggca    211140
     cctcgacctg cacatcacgg cgtctgattc gacaccctca ctgccgtgcc ggccgccggt    211200
     ggtgcgcaca cgcctgacgc agcggcgctg acgtcccgat gaccaccgca agtgttccga    211260
     ggagagagat ggacagttcg gggtccgcgg agtcggcgcc ggtgaacgcg gtgctgaccg    211320
     catcgagaag agctttcggc agggatggtg gccggcccgc cgcgattccc cggtactgcg    211380
     gggcgtggat ctggtgctgc agccgggcga ggtggtcggg ctgaccgggg agaacgggtc    211440
     ggggaagtcg acgttgatga agatcctcgt cggcgagtac cggccggacg ccgggaccgt    211500
     gacccggtcg gggcggctgg gctactgccc gcagcagccg gtggtgtacg aaaggttgac    211560
     ctgcgacgaa cacttcgagc tgttcggttg cgcctaccgg atgaccccga acgaggagcg    211620
     acggtcccgc cggggactgt atgcggcgct cggcttcgag cgctacgcgg gcacccgcgc    211680
     cgaccggctg tccggcggta ccctcgcgaa gctgaacctc gggttggcga tgctcgccga    211740
     cccggaggtg ctgctgctcg acgagccgta ctccggtttc gactgggaca cctacctgcg    211800
     gttctgggaa ctggtggcgc accgccgcca cacgggcact cggtgctgat catcagtcac    211860
     ttcgtcaccg acgagcaccg attcgaccgc atcgtcgacc cgcgcaacgg gctggcggcg    211920
     gcgagatgag aagcgataat cacctggcgg ggccgggcga ggtcgtgtta ctcatccacc    211980
     gattcctggt cgactacgcc cgcaacccgg tcaacatgct ggtgctggtg ctggtcccgg    212040
     tggtgttcgt gattgttgcg gccgggtcga tggccgatgc cgcgaagctg ctcggcggcg    212100
     cgggcgggcc cgcggtggaa accgcgaccg ccggctgggc ggcgggattc ctcgccggta    212160
     tcgccaggtt cttccagatc ggcggagccc gtgccgccga tcggcggatg gtgtcggcgg    212220
     gccgtgcgcc gatgcggttg gtcgctgccc ggctcgggac cggaggggtg ctgggggtgt    212280
     tggtcgcggc ggccctgctc gcctttggcc gcgcgtaccg gcatcggtga cctcggccgg    212340
     gcgatcgccg gcacgctgat gttcgcggtg atctatctgg cgatcggcgc gctggtgggg    212400
     gcggtggtgc gcaacccggt caacggcacg tcctcatctt gttcgtctgg attctggacg    212460
     tgttcttcgg ccccgccgtg ggatcccccg atcgcatcga aacccggtgg ttcccgacgc    212520
     atttcgtgac gttgtggatg gtggatattc tgtcccggca cggtggccgg atgagggact    212580
     tgggctgggc gctggtgtgg atgttcgcgg cactgatcgt cagcaccgct gtcatcgccg    212640
     ccaccgtcgg tgtgtcccgg cggtcgcgtc ggcgccctcc agttggatcc gggtggggtc    212700
     agttctcgac cggactgcgg atgggtctgc gggattaccg ccgcaacccg gtgctgtggg    212760
     tgctgctggt ggtggtgccg atcgtgttca tcgtgttggc caaggcgatg accgcgagcg    212820
     agtccggcgt gttctccctg gtcgagaggg gcagtacagt gatgcaggtg ttctggttgc    212880
     cggatgtgca tgccgggacg atgaccccga tcgcggtctc ctcgcttgcg gcgttggcgg    212940
     ggctgttcgt cgggctcgat gcgcgcggag gcgatcggcg actgaccttg gccggcttcc    213000
     ctttccccct cctgctcgcg gtgcggttga cgatgatcgg gttcgccgcg ggtctggtca    213060
     ccgtctcgtc gctgatgatc atcgcgacgg tgttcgatgc tcggcagtgg ggtgtctacg    213120
     gcggcgggaa cctgctcatg gccgtgacct acgggctgct cgggttcagc ctggggccga    213180
     gcttcgggtg cgtgggtggg gtgttcatcg cgtttctggt gccctttctc gacctcggga    213240
     tcggccagag tccgatgctg cgcccagaac ctgcgacctg ggcacacggc ctaccgggat    213300
     acggggcgat gcgggtgttg ctcgacggcg ggttgaccgc acggttcgac gaggtcggcc    213360
     cactgctcgg agcgttggtg tggctgctcg cgctcagtgc gctggcgggg cggttgttcc    213420
     accgcgccca cccccgtgcg tccccgcttg ggctcgtgat ccggtaacga tgtgcccggg    213480
     gtgcacatga cgacccacat gaccgagtct ggtgatcgag aacatgatct cgagttgtcg    213540
     accacgctcc ggtgagcacg aaccatatac ccatagaggg tagtggtaat ggttcttgtc    213600
     tcgtcggctg cgaaaaagcg aggtcagtca ggctgaaggg gttcaccgcc agccttcttc    213660
     atcgaatctt catcaaatca ctaaccaagg catacccggt gggggcactc tcggacatga    213720
     ccgggcaggg agcggcgagc acggcgaaac cggttgcggc agaagcgagg gagcagccgc    213780
     tgtatcagag gctgggctat gtcccggctt cgtcgaaggg cggaacatca tgacgaacga    213840
     ggatgggcgg gcgccgtacg tcggcaacga cggagaccgt ggggttggtg aggaaccgca    213900
     gggagtcggt ggtcgcagtc gtcaccggtg gatgatggcc tgctgcattc cgatgctgat    213960
     tgtcgctgtc gcgctgatcg ccagcggaac ggtgggaatc gggagcctgg tgttcgcgct    214020
     ggcgtgcctc gggatgatgg cggtgatgat gttttcgatg gggggacaac ggcattgact    214080
     cccgcgccgt ggacgacggt catgggggcg ccgggtcgcg tgcgtaccga cagaagtcag    214140
     cctaccgagc gggacgccgg cttcggcgcc gccacaacga agaggtgcca gcgcgaatga    214200
     acacaaccgt cctcgaggtc agtggggtgc actgggcgag ttcgacggcg accgtcgagg    214260
     ccaccctgcg ccgccgaccg ggtgtcacct ccgtggaggc gaatgcggtc aaccagaccg    214320
     ccaccgtcac ctacgatccc ggcctcacgt cggtggtcga actgtcgaag tgggtgcgtg    214380
     actgcggcta tcactgcgcc gggcgttcgg tgcccgatca cgtctgcgac ccgatgtccg    214440
     aaccggccgc cgtgcgcggc gaggcaggac acgctcaccc cgccccggaa gctgcggcac    214500
     ccgctgagcc agccgctcac gaaatgcccg ccgggcatgc gcctgcgggg cggttaccgc    214560
     aggagatgat gggacacggc ggcggtcacg ccgggatgtc gatggacgcc atgatccgcg    214620
     acatgcgcaa ccgtttcctg gtggcgctgg tgctgtcggt cccgatcatg ttgtggtccc    214680
     cgatgggccg agacatgttc gggttcatgg tgccggcacc gttcggcctg cgcgacgacg    214740
     tcttcaccct gctgctgagc ctgccggtgg tgttctactc ggcgtggatc ttcttcgacg    214800
     gcgcctaccg ggcgctgagg gcgcggaccc tggacatgat ggtgctcgtc gccgtcgcgg    214860
     tcggggccgg ctggctctac agcgtcgggg tgaccctgac cggcggcggg gacgtgttct    214920
     acgaggccgc cacgatgctg accaccttcg tgctgctcgg gcactggttc gagatgcggg    214980
     cccgcggcgg cgcgaacgac gcgatccgca ccttgctcga gctcgctccg ccgcgggcgg    215040
     tggtgctgcg cggcggcgaa ccggtcgaga tccccaccgc cgaggtcacc gccggggacc    215100
     tgctgctcat acgcccgggc gcgaagatcc cggtcgacgg caccgtcgag gacggccact    215160
     ccgaggtcga cgagtccatg gtcaccgggg aaagcctgcc cgtgaccaaa ccgcccggct    215220
     ccgaggtgat cggtgcatcg atcaacacca ccggcaccct gcgggtgcgg gccaccaagg    215280
     tgggctccga caccgtgctc gcgcagatcg tcgccctggt ccaggaagcc cagaactcca    215340
     aggcccccgg gcaacgcctg gccgatcggg ccgcgttctg gctggtgctg gtcgcgctga    215400
     tcggcggcat cggcaccttc ctggtgtggg tgctggtcgg ggagagtgtg cagacggcgc    215460
     tgctgttcgc gatcaccgtc gtggtcatca cctgccccga cgccctgggt ttggccaccc    215520
     cgaccgcgat catggtcggc accggcctcg gcgcccaacg cggggtgttg ttcaagaacg    215580
     ccaccgcgct cgagacgtcg gcgcggatcg acaccgtggt gatggacaag accggcaccc    215640
     tgaccaaagg cgaaccggag gtcaccgacg tgatcaccga cggcatcatc gaggacgagt    215700
     tcctcgcgct cgtcgcctcg gtcgaacgcg aatccgagca cccgctggcc ggtgcgatcg    215760
     tccgctacgc caccgaccgc ggcatcccgc agttgccgct gaccgggttc gagaacgtgc    215820
     ccggacacgg ggccaccgcc caggtgca