(data stored in ACNUC7421 zone)

EMBL: AP011177

ID   AP011177; SV 1; circular; genomic DNA; STD; PRO; 4962103 BP.
XX
AC   AP011177;
XX
PR   Project:PRJDA34739;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
DE   Shewanella violacea DSS12 DNA, complete genome.
XX
KW   .
XX
OS   Shewanella violacea DSS12
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4962103
RA   Mori H.;
RT   ;
RL   Submitted (27-APR-2009) to the INSDC.
RL   Contact:Hirotada Mori Nara Institute of Science and Technology, Graduate
RL   School of Biological Sciences; 8916-5 Takayama, Ikoma, Nara 630-0101, Japan
XX
RN   [2]
RA   Mori H.;
RT   "Shewanella violocea DSS2 complete genome";
RL   Unpublished.
XX
DR   MD5; c742e20f5cb73ecf8f4e6a5bf91c4bfc.
DR   BioSample; SAMD00060963.
DR   EnsemblGenomes-Gn; EBG00001099650.
DR   EnsemblGenomes-Gn; EBG00001099651.
DR   EnsemblGenomes-Gn; EBG00001099652.
DR   EnsemblGenomes-Gn; EBG00001099653.
DR   EnsemblGenomes-Gn; EBG00001099654.
DR   EnsemblGenomes-Gn; EBG00001099655.
DR   EnsemblGenomes-Gn; EBG00001099656.
DR   EnsemblGenomes-Gn; EBG00001099657.
DR   EnsemblGenomes-Gn; EBG00001099658.
DR   EnsemblGenomes-Gn; EBG00001099659.
DR   EnsemblGenomes-Gn; EBG00001099660.
DR   EnsemblGenomes-Gn; EBG00001099661.
DR   EnsemblGenomes-Gn; EBG00001099662.
DR   EnsemblGenomes-Gn; EBG00001099663.
DR   EnsemblGenomes-Gn; EBG00001099664.
DR   EnsemblGenomes-Gn; EBG00001099665.
DR   EnsemblGenomes-Gn; EBG00001099666.
DR   EnsemblGenomes-Gn; EBG00001099667.
DR   EnsemblGenomes-Gn; EBG00001099668.
DR   EnsemblGenomes-Gn; EBG00001099669.
DR   EnsemblGenomes-Gn; EBG00001099670.
DR   EnsemblGenomes-Gn; EBG00001099671.
DR   EnsemblGenomes-Gn; EBG00001099672.
DR   EnsemblGenomes-Gn; EBG00001099673.
DR   EnsemblGenomes-Gn; EBG00001099674.
DR   EnsemblGenomes-Gn; EBG00001099675.
DR   EnsemblGenomes-Gn; EBG00001099676.
DR   EnsemblGenomes-Gn; EBG00001099677.
DR   EnsemblGenomes-Gn; EBG00001099678.
DR   EnsemblGenomes-Gn; EBG00001099679.
DR   EnsemblGenomes-Gn; EBG00001099680.
DR   EnsemblGenomes-Gn; EBG00001099681.
DR   EnsemblGenomes-Gn; EBG00001099682.
DR   EnsemblGenomes-Gn; EBG00001099683.
DR   EnsemblGenomes-Gn; EBG00001099684.
DR   EnsemblGenomes-Gn; EBG00001099685.
DR   EnsemblGenomes-Gn; EBG00001099686.
DR   EnsemblGenomes-Gn; EBG00001099687.
DR   EnsemblGenomes-Gn; EBG00001099688.
DR   EnsemblGenomes-Gn; EBG00001099689.
DR   EnsemblGenomes-Gn; EBG00001099690.
DR   EnsemblGenomes-Gn; EBG00001099691.
DR   EnsemblGenomes-Gn; EBG00001099692.
DR   EnsemblGenomes-Gn; EBG00001099693.
DR   EnsemblGenomes-Gn; EBG00001099694.
DR   EnsemblGenomes-Gn; EBG00001099695.
DR   EnsemblGenomes-Gn; EBG00001099696.
DR   EnsemblGenomes-Gn; EBG00001099697.
DR   EnsemblGenomes-Gn; EBG00001099698.
DR   EnsemblGenomes-Gn; EBG00001099699.
DR   EnsemblGenomes-Gn; EBG00001099700.
DR   EnsemblGenomes-Gn; EBG00001099701.
DR   EnsemblGenomes-Gn; EBG00001099702.
DR   EnsemblGenomes-Gn; EBG00001099703.
DR   EnsemblGenomes-Gn; EBG00001099704.
DR   EnsemblGenomes-Gn; EBG00001099705.
DR   EnsemblGenomes-Gn; EBG00001099706.
DR   EnsemblGenomes-Gn; EBG00001099707.
DR   EnsemblGenomes-Gn; EBG00001099708.
DR   EnsemblGenomes-Gn; EBG00001099709.
DR   EnsemblGenomes-Gn; EBG00001099710.
DR   EnsemblGenomes-Gn; EBG00001099711.
DR   EnsemblGenomes-Gn; EBG00001099712.
DR   EnsemblGenomes-Gn; EBG00001099713.
DR   EnsemblGenomes-Gn; EBG00001099714.
DR   EnsemblGenomes-Gn; EBG00001099715.
DR   EnsemblGenomes-Gn; EBG00001099716.
DR   EnsemblGenomes-Gn; EBG00001099717.
DR   EnsemblGenomes-Gn; EBG00001099718.
DR   EnsemblGenomes-Gn; EBG00001099719.
DR   EnsemblGenomes-Gn; EBG00001099720.
DR   EnsemblGenomes-Gn; EBG00001099721.
DR   EnsemblGenomes-Gn; EBG00001099722.
DR   EnsemblGenomes-Gn; EBG00001099723.
DR   EnsemblGenomes-Gn; EBG00001099724.
DR   EnsemblGenomes-Gn; EBG00001099725.
DR   EnsemblGenomes-Gn; EBG00001099726.
DR   EnsemblGenomes-Gn; EBG00001099727.
DR   EnsemblGenomes-Gn; EBG00001099728.
DR   EnsemblGenomes-Gn; EBG00001099729.
DR   EnsemblGenomes-Gn; EBG00001099730.
DR   EnsemblGenomes-Gn; EBG00001099731.
DR   EnsemblGenomes-Gn; EBG00001099732.
DR   EnsemblGenomes-Gn; EBG00001099733.
DR   EnsemblGenomes-Gn; EBG00001099734.
DR   EnsemblGenomes-Gn; EBG00001099735.
DR   EnsemblGenomes-Gn; EBG00001099736.
DR   EnsemblGenomes-Gn; EBG00001099737.
DR   EnsemblGenomes-Gn; EBG00001099738.
DR   EnsemblGenomes-Gn; EBG00001099739.
DR   EnsemblGenomes-Gn; EBG00001099740.
DR   EnsemblGenomes-Gn; EBG00001099741.
DR   EnsemblGenomes-Gn; EBG00001099742.
DR   EnsemblGenomes-Gn; EBG00001099743.
DR   EnsemblGenomes-Gn; EBG00001099744.
DR   EnsemblGenomes-Gn; EBG00001099745.
DR   EnsemblGenomes-Gn; EBG00001099746.
DR   EnsemblGenomes-Gn; EBG00001099747.
DR   EnsemblGenomes-Gn; EBG00001099748.
DR   EnsemblGenomes-Gn; EBG00001099749.
DR   EnsemblGenomes-Gn; EBG00001099750.
DR   EnsemblGenomes-Gn; EBG00001099751.
DR   EnsemblGenomes-Gn; EBG00001099752.
DR   EnsemblGenomes-Gn; EBG00001099753.
DR   EnsemblGenomes-Gn; EBG00001099754.
DR   EnsemblGenomes-Gn; EBG00001099755.
DR   EnsemblGenomes-Gn; EBG00001099756.
DR   EnsemblGenomes-Gn; EBG00001099757.
DR   EnsemblGenomes-Gn; EBG00001099758.
DR   EnsemblGenomes-Gn; EBG00001099759.
DR   EnsemblGenomes-Gn; EBG00001099760.
DR   EnsemblGenomes-Gn; EBG00001099761.
DR   EnsemblGenomes-Gn; EBG00001099762.
DR   EnsemblGenomes-Gn; EBG00001099763.
DR   EnsemblGenomes-Gn; EBG00001099764.
DR   EnsemblGenomes-Gn; EBG00001099765.
DR   EnsemblGenomes-Gn; EBG00001099766.
DR   EnsemblGenomes-Gn; EBG00001099767.
DR   EnsemblGenomes-Gn; EBG00001099768.
DR   EnsemblGenomes-Gn; EBG00001099769.
DR   EnsemblGenomes-Gn; EBG00001099770.
DR   EnsemblGenomes-Gn; EBG00001099771.
DR   EnsemblGenomes-Gn; EBG00001099772.
DR   EnsemblGenomes-Gn; EBG00001099773.
DR   EnsemblGenomes-Gn; EBG00001099774.
DR   EnsemblGenomes-Gn; EBG00001099775.
DR   EnsemblGenomes-Gn; EBG00001099776.
DR   EnsemblGenomes-Gn; EBG00001099777.
DR   EnsemblGenomes-Gn; EBG00001099778.
DR   EnsemblGenomes-Gn; EBG00001099779.
DR   EnsemblGenomes-Gn; EBG00001099780.
DR   EnsemblGenomes-Gn; EBG00001099781.
DR   EnsemblGenomes-Gn; EBG00001099782.
DR   EnsemblGenomes-Gn; EBG00001099783.
DR   EnsemblGenomes-Gn; EBG00001099784.
DR   EnsemblGenomes-Gn; EBG00001099785.
DR   EnsemblGenomes-Gn; EBG00001099786.
DR   EnsemblGenomes-Gn; EBG00001099787.
DR   EnsemblGenomes-Gn; EBG00001099788.
DR   EnsemblGenomes-Gn; EBG00001099789.
DR   EnsemblGenomes-Gn; EBG00001099790.
DR   EnsemblGenomes-Gn; EBG00001099791.
DR   EnsemblGenomes-Gn; EBG00001099792.
DR   EnsemblGenomes-Gn; EBG00001099793.
DR   EnsemblGenomes-Gn; EBG00001099794.
DR   EnsemblGenomes-Gn; EBG00001099795.
DR   EnsemblGenomes-Gn; EBG00001099796.
DR   EnsemblGenomes-Gn; EBG00001099797.
DR   EnsemblGenomes-Gn; EBG00001099798.
DR   EnsemblGenomes-Gn; EBG00001099799.
DR   EnsemblGenomes-Gn; EBG00001099800.
DR   EnsemblGenomes-Gn; EBG00001099801.
DR   EnsemblGenomes-Gn; EBG00001099802.
DR   EnsemblGenomes-Gn; EBG00001099803.
DR   EnsemblGenomes-Gn; EBG00001099804.
DR   EnsemblGenomes-Gn; EBG00001099805.
DR   EnsemblGenomes-Gn; EBG00001099806.
DR   EnsemblGenomes-Gn; EBG00001099807.
DR   EnsemblGenomes-Gn; EBG00001099808.
DR   EnsemblGenomes-Gn; EBG00001099809.
DR   EnsemblGenomes-Gn; EBG00001099810.
DR   EnsemblGenomes-Gn; EBG00001099811.
DR   EnsemblGenomes-Gn; EBG00001099812.
DR   EnsemblGenomes-Gn; EBG00001099813.
DR   EnsemblGenomes-Gn; EBG00001099814.
DR   EnsemblGenomes-Gn; EBG00001099815.
DR   EnsemblGenomes-Gn; EBG00001099816.
DR   EnsemblGenomes-Gn; EBG00001099817.
DR   EnsemblGenomes-Gn; EBG00001099818.
DR   EnsemblGenomes-Gn; EBG00001099819.
DR   EnsemblGenomes-Gn; EBG00001099820.
DR   EnsemblGenomes-Gn; EBG00001099821.
DR   EnsemblGenomes-Gn; EBG00001099822.
DR   EnsemblGenomes-Gn; EBG00001099823.
DR   EnsemblGenomes-Gn; EBG00001099824.
DR   EnsemblGenomes-Gn; EBG00001099825.
DR   EnsemblGenomes-Gn; EBG00001099826.
DR   EnsemblGenomes-Gn; EBG00001099827.
DR   EnsemblGenomes-Gn; EBG00001099828.
DR   EnsemblGenomes-Gn; EBG00001099829.
DR   EnsemblGenomes-Gn; EBG00001099830.
DR   EnsemblGenomes-Gn; EBG00001099831.
DR   EnsemblGenomes-Gn; EBG00001099832.
DR   EnsemblGenomes-Gn; EBG00001099833.
DR   EnsemblGenomes-Gn; EBG00001099834.
DR   EnsemblGenomes-Gn; EBG00001099835.
DR   EnsemblGenomes-Gn; EBG00001099836.
DR   EnsemblGenomes-Gn; EBG00001099837.
DR   EnsemblGenomes-Gn; EBG00001099838.
DR   EnsemblGenomes-Gn; EBG00001099839.
DR   EnsemblGenomes-Gn; EBG00001099840.
DR   EnsemblGenomes-Gn; EBG00001099841.
DR   EnsemblGenomes-Gn; EBG00001099842.
DR   EnsemblGenomes-Gn; EBG00001099843.
DR   EnsemblGenomes-Gn; EBG00001099844.
DR   EnsemblGenomes-Gn; EBG00001099845.
DR   EnsemblGenomes-Gn; EBG00001099846.
DR   EnsemblGenomes-Gn; EBG00001099847.
DR   EnsemblGenomes-Gn; EBG00001099848.
DR   EnsemblGenomes-Gn; EBG00001099849.
DR   EnsemblGenomes-Gn; EBG00001099850.
DR   EnsemblGenomes-Gn; EBG00001099851.
DR   EnsemblGenomes-Gn; EBG00001099852.
DR   EnsemblGenomes-Gn; EBG00001099853.
DR   EnsemblGenomes-Gn; EBG00001099854.
DR   EnsemblGenomes-Gn; EBG00001099855.
DR   EnsemblGenomes-Gn; EBG00001099856.
DR   EnsemblGenomes-Gn; EBG00001099857.
DR   EnsemblGenomes-Gn; EBG00001099858.
DR   EnsemblGenomes-Gn; EBG00001099859.
DR   EnsemblGenomes-Gn; EBG00001099860.
DR   EnsemblGenomes-Gn; EBG00001099861.
DR   EnsemblGenomes-Gn; EBG00001099862.
DR   EnsemblGenomes-Gn; EBG00001099863.
DR   EnsemblGenomes-Gn; EBG00001099864.
DR   EnsemblGenomes-Gn; SVI_r001.
DR   EnsemblGenomes-Gn; SVI_r002.
DR   EnsemblGenomes-Gn; SVI_r003.
DR   EnsemblGenomes-Gn; SVI_r004.
DR   EnsemblGenomes-Gn; SVI_r005.
DR   EnsemblGenomes-Gn; SVI_r006.
DR   EnsemblGenomes-Gn; SVI_r007.
DR   EnsemblGenomes-Gn; SVI_r008.
DR   EnsemblGenomes-Gn; SVI_r009.
DR   EnsemblGenomes-Gn; SVI_r010.
DR   EnsemblGenomes-Gn; SVI_r011.
DR   EnsemblGenomes-Gn; SVI_r012.
DR   EnsemblGenomes-Gn; SVI_r013.
DR   EnsemblGenomes-Gn; SVI_r014.
DR   EnsemblGenomes-Gn; SVI_r015.
DR   EnsemblGenomes-Gn; SVI_r016.
DR   EnsemblGenomes-Gn; SVI_r017.
DR   EnsemblGenomes-Gn; SVI_r018.
DR   EnsemblGenomes-Gn; SVI_r019.
DR   EnsemblGenomes-Gn; SVI_r020.
DR   EnsemblGenomes-Gn; SVI_r021.
DR   EnsemblGenomes-Gn; SVI_r022.
DR   EnsemblGenomes-Gn; SVI_r023.
DR   EnsemblGenomes-Gn; SVI_r024.
DR   EnsemblGenomes-Gn; SVI_r025.
DR   EnsemblGenomes-Gn; SVI_r026.
DR   EnsemblGenomes-Gn; SVI_r027.
DR   EnsemblGenomes-Gn; SVI_r028.
DR   EnsemblGenomes-Gn; SVI_r029.
DR   EnsemblGenomes-Gn; SVI_r030.
DR   EnsemblGenomes-Gn; SVI_r031.
DR   EnsemblGenomes-Gn; SVI_r032.
DR   EnsemblGenomes-Gn; SVI_r033.
DR   EnsemblGenomes-Gn; SVI_r034.
DR   EnsemblGenomes-Gn; SVI_r035.
DR   EnsemblGenomes-Gn; SVI_r036.
DR   EnsemblGenomes-Gn; SVI_r037.
DR   EnsemblGenomes-Gn; SVI_r038.
DR   EnsemblGenomes-Gn; SVI_r039.
DR   EnsemblGenomes-Gn; SVI_r040.
DR   EnsemblGenomes-Gn; SVI_r041.
DR   EnsemblGenomes-Gn; SVI_r042.
DR   EnsemblGenomes-Gn; SVI_r043.
DR   EnsemblGenomes-Gn; SVI_t001.
DR   EnsemblGenomes-Gn; SVI_t002.
DR   EnsemblGenomes-Gn; SVI_t003.
DR   EnsemblGenomes-Gn; SVI_t004.
DR   EnsemblGenomes-Gn; SVI_t005.
DR   EnsemblGenomes-Gn; SVI_t006.
DR   EnsemblGenomes-Gn; SVI_t007.
DR   EnsemblGenomes-Gn; SVI_t008.
DR   EnsemblGenomes-Gn; SVI_t009.
DR   EnsemblGenomes-Gn; SVI_t010.
DR   EnsemblGenomes-Gn; SVI_t011.
DR   EnsemblGenomes-Gn; SVI_t012.
DR   EnsemblGenomes-Gn; SVI_t013.
DR   EnsemblGenomes-Gn; SVI_t014.
DR   EnsemblGenomes-Gn; SVI_t015.
DR   EnsemblGenomes-Gn; SVI_t016.
DR   EnsemblGenomes-Gn; SVI_t017.
DR   EnsemblGenomes-Gn; SVI_t018.
DR   EnsemblGenomes-Gn; SVI_t019.
DR   EnsemblGenomes-Gn; SVI_t020.
DR   EnsemblGenomes-Gn; SVI_t021.
DR   EnsemblGenomes-Gn; SVI_t022.
DR   EnsemblGenomes-Gn; SVI_t023.
DR   EnsemblGenomes-Gn; SVI_t024.
DR   EnsemblGenomes-Gn; SVI_t025.
DR   EnsemblGenomes-Gn; SVI_t026.
DR   EnsemblGenomes-Gn; SVI_t027.
DR   EnsemblGenomes-Gn; SVI_t028.
DR   EnsemblGenomes-Gn; SVI_t029.
DR   EnsemblGenomes-Gn; SVI_t030.
DR   EnsemblGenomes-Gn; SVI_t031.
DR   EnsemblGenomes-Gn; SVI_t032.
DR   EnsemblGenomes-Gn; SVI_t033.
DR   EnsemblGenomes-Gn; SVI_t034.
DR   EnsemblGenomes-Gn; SVI_t035.
DR   EnsemblGenomes-Gn; SVI_t036.
DR   EnsemblGenomes-Gn; SVI_t037.
DR   EnsemblGenomes-Gn; SVI_t038.
DR   EnsemblGenomes-Gn; SVI_t039.
DR   EnsemblGenomes-Gn; SVI_t040.
DR   EnsemblGenomes-Gn; SVI_t041.
DR   EnsemblGenomes-Gn; SVI_t042.
DR   EnsemblGenomes-Gn; SVI_t043.
DR   EnsemblGenomes-Gn; SVI_t044.
DR   EnsemblGenomes-Gn; SVI_t045.
DR   EnsemblGenomes-Gn; SVI_t046.
DR   EnsemblGenomes-Gn; SVI_t047.
DR   EnsemblGenomes-Gn; SVI_t048.
DR   EnsemblGenomes-Gn; SVI_t049.
DR   EnsemblGenomes-Gn; SVI_t050.
DR   EnsemblGenomes-Gn; SVI_t051.
DR   EnsemblGenomes-Gn; SVI_t052.
DR   EnsemblGenomes-Gn; SVI_t053.
DR   EnsemblGenomes-Gn; SVI_t054.
DR   EnsemblGenomes-Gn; SVI_t055.
DR   EnsemblGenomes-Gn; SVI_t056.
DR   EnsemblGenomes-Gn; SVI_t057.
DR   EnsemblGenomes-Gn; SVI_t058.
DR   EnsemblGenomes-Gn; SVI_t059.
DR   EnsemblGenomes-Gn; SVI_t060.
DR   EnsemblGenomes-Gn; SVI_t061.
DR   EnsemblGenomes-Gn; SVI_t062.
DR   EnsemblGenomes-Gn; SVI_t063.
DR   EnsemblGenomes-Gn; SVI_t064.
DR   EnsemblGenomes-Gn; SVI_t065.
DR   EnsemblGenomes-Gn; SVI_t066.
DR   EnsemblGenomes-Gn; SVI_t067.
DR   EnsemblGenomes-Gn; SVI_t068.
DR   EnsemblGenomes-Gn; SVI_t069.
DR   EnsemblGenomes-Gn; SVI_t070.
DR   EnsemblGenomes-Gn; SVI_t071.
DR   EnsemblGenomes-Gn; SVI_t072.
DR   EnsemblGenomes-Gn; SVI_t073.
DR   EnsemblGenomes-Gn; SVI_t074.
DR   EnsemblGenomes-Gn; SVI_t075.
DR   EnsemblGenomes-Gn; SVI_t076.
DR   EnsemblGenomes-Gn; SVI_t077.
DR   EnsemblGenomes-Gn; SVI_t078.
DR   EnsemblGenomes-Gn; SVI_t079.
DR   EnsemblGenomes-Gn; SVI_t080.
DR   EnsemblGenomes-Gn; SVI_t081.
DR   EnsemblGenomes-Gn; SVI_t082.
DR   EnsemblGenomes-Gn; SVI_t083.
DR   EnsemblGenomes-Gn; SVI_t084.
DR   EnsemblGenomes-Gn; SVI_t085.
DR   EnsemblGenomes-Gn; SVI_t086.
DR   EnsemblGenomes-Gn; SVI_t087.
DR   EnsemblGenomes-Gn; SVI_t088.
DR   EnsemblGenomes-Gn; SVI_t089.
DR   EnsemblGenomes-Gn; SVI_t090.
DR   EnsemblGenomes-Gn; SVI_t091.
DR   EnsemblGenomes-Gn; SVI_t092.
DR   EnsemblGenomes-Gn; SVI_t093.
DR   EnsemblGenomes-Gn; SVI_t094.
DR   EnsemblGenomes-Gn; SVI_t095.
DR   EnsemblGenomes-Gn; SVI_t096.
DR   EnsemblGenomes-Gn; SVI_t097.
DR   EnsemblGenomes-Gn; SVI_t098.
DR   EnsemblGenomes-Gn; SVI_t099.
DR   EnsemblGenomes-Gn; SVI_t100.
DR   EnsemblGenomes-Gn; SVI_t101.
DR   EnsemblGenomes-Gn; SVI_t102.
DR   EnsemblGenomes-Gn; SVI_t103.
DR   EnsemblGenomes-Gn; SVI_t104.
DR   EnsemblGenomes-Gn; SVI_t105.
DR   EnsemblGenomes-Gn; SVI_t106.
DR   EnsemblGenomes-Gn; SVI_t107.
DR   EnsemblGenomes-Gn; SVI_t108.
DR   EnsemblGenomes-Gn; SVI_t109.
DR   EnsemblGenomes-Gn; SVI_t110.
DR   EnsemblGenomes-Gn; SVI_t111.
DR   EnsemblGenomes-Gn; SVI_t112.
DR   EnsemblGenomes-Gn; SVI_t113.
DR   EnsemblGenomes-Gn; SVI_t114.
DR   EnsemblGenomes-Gn; SVI_t115.
DR   EnsemblGenomes-Gn; SVI_t116.
DR   EnsemblGenomes-Gn; SVI_t117.
DR   EnsemblGenomes-Gn; SVI_t118.
DR   EnsemblGenomes-Gn; SVI_t119.
DR   EnsemblGenomes-Gn; SVI_t120.
DR   EnsemblGenomes-Gn; SVI_t121.
DR   EnsemblGenomes-Gn; SVI_t122.
DR   EnsemblGenomes-Gn; SVI_t123.
DR   EnsemblGenomes-Gn; SVI_t124.
DR   EnsemblGenomes-Gn; SVI_t125.
DR   EnsemblGenomes-Gn; SVI_t126.
DR   EnsemblGenomes-Tr; EBT00001554709.
DR   EnsemblGenomes-Tr; EBT00001554711.
DR   EnsemblGenomes-Tr; EBT00001554713.
DR   EnsemblGenomes-Tr; EBT00001554714.
DR   EnsemblGenomes-Tr; EBT00001554717.
DR   EnsemblGenomes-Tr; EBT00001554720.
DR   EnsemblGenomes-Tr; EBT00001554721.
DR   EnsemblGenomes-Tr; EBT00001554724.
DR   EnsemblGenomes-Tr; EBT00001554726.
DR   EnsemblGenomes-Tr; EBT00001554728.
DR   EnsemblGenomes-Tr; EBT00001554729.
DR   EnsemblGenomes-Tr; EBT00001554731.
DR   EnsemblGenomes-Tr; EBT00001554733.
DR   EnsemblGenomes-Tr; EBT00001554735.
DR   EnsemblGenomes-Tr; EBT00001554737.
DR   EnsemblGenomes-Tr; EBT00001554739.
DR   EnsemblGenomes-Tr; EBT00001554742.
DR   EnsemblGenomes-Tr; EBT00001554744.
DR   EnsemblGenomes-Tr; EBT00001554746.
DR   EnsemblGenomes-Tr; EBT00001554748.
DR   EnsemblGenomes-Tr; EBT00001554750.
DR   EnsemblGenomes-Tr; EBT00001554752.
DR   EnsemblGenomes-Tr; EBT00001554754.
DR   EnsemblGenomes-Tr; EBT00001554756.
DR   EnsemblGenomes-Tr; EBT00001554758.
DR   EnsemblGenomes-Tr; EBT00001554760.
DR   EnsemblGenomes-Tr; EBT00001554762.
DR   EnsemblGenomes-Tr; EBT00001554764.
DR   EnsemblGenomes-Tr; EBT00001554767.
DR   EnsemblGenomes-Tr; EBT00001554769.
DR   EnsemblGenomes-Tr; EBT00001554771.
DR   EnsemblGenomes-Tr; EBT00001554773.
DR   EnsemblGenomes-Tr; EBT00001554774.
DR   EnsemblGenomes-Tr; EBT00001554775.
DR   EnsemblGenomes-Tr; EBT00001554777.
DR   EnsemblGenomes-Tr; EBT00001554779.
DR   EnsemblGenomes-Tr; EBT00001554781.
DR   EnsemblGenomes-Tr; EBT00001554783.
DR   EnsemblGenomes-Tr; EBT00001554785.
DR   EnsemblGenomes-Tr; EBT00001554787.
DR   EnsemblGenomes-Tr; EBT00001554789.
DR   EnsemblGenomes-Tr; EBT00001554791.
DR   EnsemblGenomes-Tr; EBT00001554792.
DR   EnsemblGenomes-Tr; EBT00001554794.
DR   EnsemblGenomes-Tr; EBT00001554796.
DR   EnsemblGenomes-Tr; EBT00001554799.
DR   EnsemblGenomes-Tr; EBT00001554800.
DR   EnsemblGenomes-Tr; EBT00001554802.
DR   EnsemblGenomes-Tr; EBT00001554804.
DR   EnsemblGenomes-Tr; EBT00001554805.
DR   EnsemblGenomes-Tr; EBT00001554807.
DR   EnsemblGenomes-Tr; EBT00001554809.
DR   EnsemblGenomes-Tr; EBT00001554811.
DR   EnsemblGenomes-Tr; EBT00001554813.
DR   EnsemblGenomes-Tr; EBT00001554814.
DR   EnsemblGenomes-Tr; EBT00001554815.
DR   EnsemblGenomes-Tr; EBT00001554816.
DR   EnsemblGenomes-Tr; EBT00001554817.
DR   EnsemblGenomes-Tr; EBT00001554818.
DR   EnsemblGenomes-Tr; EBT00001554819.
DR   EnsemblGenomes-Tr; EBT00001554820.
DR   EnsemblGenomes-Tr; EBT00001554821.
DR   EnsemblGenomes-Tr; EBT00001554823.
DR   EnsemblGenomes-Tr; EBT00001554824.
DR   EnsemblGenomes-Tr; EBT00001554825.
DR   EnsemblGenomes-Tr; EBT00001554826.
DR   EnsemblGenomes-Tr; EBT00001554827.
DR   EnsemblGenomes-Tr; EBT00001554828.
DR   EnsemblGenomes-Tr; EBT00001554829.
DR   EnsemblGenomes-Tr; EBT00001554830.
DR   EnsemblGenomes-Tr; EBT00001554831.
DR   EnsemblGenomes-Tr; EBT00001554832.
DR   EnsemblGenomes-Tr; EBT00001554833.
DR   EnsemblGenomes-Tr; EBT00001554834.
DR   EnsemblGenomes-Tr; EBT00001554835.
DR   EnsemblGenomes-Tr; EBT00001554836.
DR   EnsemblGenomes-Tr; EBT00001554837.
DR   EnsemblGenomes-Tr; EBT00001554838.
DR   EnsemblGenomes-Tr; EBT00001554839.
DR   EnsemblGenomes-Tr; EBT00001554840.
DR   EnsemblGenomes-Tr; EBT00001554841.
DR   EnsemblGenomes-Tr; EBT00001554843.
DR   EnsemblGenomes-Tr; EBT00001554844.
DR   EnsemblGenomes-Tr; EBT00001554845.
DR   EnsemblGenomes-Tr; EBT00001554846.
DR   EnsemblGenomes-Tr; EBT00001554847.
DR   EnsemblGenomes-Tr; EBT00001554848.
DR   EnsemblGenomes-Tr; EBT00001554849.
DR   EnsemblGenomes-Tr; EBT00001554850.
DR   EnsemblGenomes-Tr; EBT00001554851.
DR   EnsemblGenomes-Tr; EBT00001554852.
DR   EnsemblGenomes-Tr; EBT00001554853.
DR   EnsemblGenomes-Tr; EBT00001554854.
DR   EnsemblGenomes-Tr; EBT00001554855.
DR   EnsemblGenomes-Tr; EBT00001554856.
DR   EnsemblGenomes-Tr; EBT00001554857.
DR   EnsemblGenomes-Tr; EBT00001554858.
DR   EnsemblGenomes-Tr; EBT00001554859.
DR   EnsemblGenomes-Tr; EBT00001554860.
DR   EnsemblGenomes-Tr; EBT00001554861.
DR   EnsemblGenomes-Tr; EBT00001554862.
DR   EnsemblGenomes-Tr; EBT00001554863.
DR   EnsemblGenomes-Tr; EBT00001554864.
DR   EnsemblGenomes-Tr; EBT00001554865.
DR   EnsemblGenomes-Tr; EBT00001554866.
DR   EnsemblGenomes-Tr; EBT00001554867.
DR   EnsemblGenomes-Tr; EBT00001554868.
DR   EnsemblGenomes-Tr; EBT00001554869.
DR   EnsemblGenomes-Tr; EBT00001554870.
DR   EnsemblGenomes-Tr; EBT00001554871.
DR   EnsemblGenomes-Tr; EBT00001554872.
DR   EnsemblGenomes-Tr; EBT00001554873.
DR   EnsemblGenomes-Tr; EBT00001554874.
DR   EnsemblGenomes-Tr; EBT00001554875.
DR   EnsemblGenomes-Tr; EBT00001554876.
DR   EnsemblGenomes-Tr; EBT00001554877.
DR   EnsemblGenomes-Tr; EBT00001554878.
DR   EnsemblGenomes-Tr; EBT00001554879.
DR   EnsemblGenomes-Tr; EBT00001554880.
DR   EnsemblGenomes-Tr; EBT00001554881.
DR   EnsemblGenomes-Tr; EBT00001554882.
DR   EnsemblGenomes-Tr; EBT00001554883.
DR   EnsemblGenomes-Tr; EBT00001554884.
DR   EnsemblGenomes-Tr; EBT00001554885.
DR   EnsemblGenomes-Tr; EBT00001554886.
DR   EnsemblGenomes-Tr; EBT00001554887.
DR   EnsemblGenomes-Tr; EBT00001554888.
DR   EnsemblGenomes-Tr; EBT00001554889.
DR   EnsemblGenomes-Tr; EBT00001554890.
DR   EnsemblGenomes-Tr; EBT00001554891.
DR   EnsemblGenomes-Tr; EBT00001554892.
DR   EnsemblGenomes-Tr; EBT00001554893.
DR   EnsemblGenomes-Tr; EBT00001554894.
DR   EnsemblGenomes-Tr; EBT00001554895.
DR   EnsemblGenomes-Tr; EBT00001554896.
DR   EnsemblGenomes-Tr; EBT00001554897.
DR   EnsemblGenomes-Tr; EBT00001554898.
DR   EnsemblGenomes-Tr; EBT00001554899.
DR   EnsemblGenomes-Tr; EBT00001554900.
DR   EnsemblGenomes-Tr; EBT00001554901.
DR   EnsemblGenomes-Tr; EBT00001554902.
DR   EnsemblGenomes-Tr; EBT00001554903.
DR   EnsemblGenomes-Tr; EBT00001554904.
DR   EnsemblGenomes-Tr; EBT00001554905.
DR   EnsemblGenomes-Tr; EBT00001554906.
DR   EnsemblGenomes-Tr; EBT00001554907.
DR   EnsemblGenomes-Tr; EBT00001554908.
DR   EnsemblGenomes-Tr; EBT00001554909.
DR   EnsemblGenomes-Tr; EBT00001554910.
DR   EnsemblGenomes-Tr; EBT00001554911.
DR   EnsemblGenomes-Tr; EBT00001554912.
DR   EnsemblGenomes-Tr; EBT00001554913.
DR   EnsemblGenomes-Tr; EBT00001554914.
DR   EnsemblGenomes-Tr; EBT00001554915.
DR   EnsemblGenomes-Tr; EBT00001554916.
DR   EnsemblGenomes-Tr; EBT00001554917.
DR   EnsemblGenomes-Tr; EBT00001554918.
DR   EnsemblGenomes-Tr; EBT00001554919.
DR   EnsemblGenomes-Tr; EBT00001554920.
DR   EnsemblGenomes-Tr; EBT00001554921.
DR   EnsemblGenomes-Tr; EBT00001554922.
DR   EnsemblGenomes-Tr; EBT00001554923.
DR   EnsemblGenomes-Tr; EBT00001554924.
DR   EnsemblGenomes-Tr; EBT00001554925.
DR   EnsemblGenomes-Tr; EBT00001554926.
DR   EnsemblGenomes-Tr; EBT00001554927.
DR   EnsemblGenomes-Tr; EBT00001554928.
DR   EnsemblGenomes-Tr; EBT00001554929.
DR   EnsemblGenomes-Tr; EBT00001554930.
DR   EnsemblGenomes-Tr; EBT00001554931.
DR   EnsemblGenomes-Tr; EBT00001554932.
DR   EnsemblGenomes-Tr; EBT00001554933.
DR   EnsemblGenomes-Tr; EBT00001554934.
DR   EnsemblGenomes-Tr; EBT00001554935.
DR   EnsemblGenomes-Tr; EBT00001554936.
DR   EnsemblGenomes-Tr; EBT00001554937.
DR   EnsemblGenomes-Tr; EBT00001554938.
DR   EnsemblGenomes-Tr; EBT00001554939.
DR   EnsemblGenomes-Tr; EBT00001554940.
DR   EnsemblGenomes-Tr; EBT00001554941.
DR   EnsemblGenomes-Tr; EBT00001554942.
DR   EnsemblGenomes-Tr; EBT00001554943.
DR   EnsemblGenomes-Tr; EBT00001554944.
DR   EnsemblGenomes-Tr; EBT00001554945.
DR   EnsemblGenomes-Tr; EBT00001554946.
DR   EnsemblGenomes-Tr; EBT00001554947.
DR   EnsemblGenomes-Tr; EBT00001554948.
DR   EnsemblGenomes-Tr; EBT00001554949.
DR   EnsemblGenomes-Tr; EBT00001554950.
DR   EnsemblGenomes-Tr; EBT00001554951.
DR   EnsemblGenomes-Tr; EBT00001554952.
DR   EnsemblGenomes-Tr; EBT00001554953.
DR   EnsemblGenomes-Tr; EBT00001554954.
DR   EnsemblGenomes-Tr; EBT00001554955.
DR   EnsemblGenomes-Tr; EBT00001554956.
DR   EnsemblGenomes-Tr; EBT00001554957.
DR   EnsemblGenomes-Tr; EBT00001554958.
DR   EnsemblGenomes-Tr; EBT00001554959.
DR   EnsemblGenomes-Tr; EBT00001554960.
DR   EnsemblGenomes-Tr; EBT00001554961.
DR   EnsemblGenomes-Tr; EBT00001554962.
DR   EnsemblGenomes-Tr; EBT00001554963.
DR   EnsemblGenomes-Tr; EBT00001554964.
DR   EnsemblGenomes-Tr; EBT00001554965.
DR   EnsemblGenomes-Tr; EBT00001554966.
DR   EnsemblGenomes-Tr; EBT00001554967.
DR   EnsemblGenomes-Tr; EBT00001554968.
DR   EnsemblGenomes-Tr; EBT00001554969.
DR   EnsemblGenomes-Tr; EBT00001554970.
DR   EnsemblGenomes-Tr; EBT00001554971.
DR   EnsemblGenomes-Tr; EBT00001554972.
DR   EnsemblGenomes-Tr; EBT00001554973.
DR   EnsemblGenomes-Tr; EBT00001554974.
DR   EnsemblGenomes-Tr; EBT00001554975.
DR   EnsemblGenomes-Tr; EBT00001554976.
DR   EnsemblGenomes-Tr; SVI_r001-1.
DR   EnsemblGenomes-Tr; SVI_r002-1.
DR   EnsemblGenomes-Tr; SVI_r003-1.
DR   EnsemblGenomes-Tr; SVI_r004-1.
DR   EnsemblGenomes-Tr; SVI_r005-1.
DR   EnsemblGenomes-Tr; SVI_r006-1.
DR   EnsemblGenomes-Tr; SVI_r007-1.
DR   EnsemblGenomes-Tr; SVI_r008-1.
DR   EnsemblGenomes-Tr; SVI_r009-1.
DR   EnsemblGenomes-Tr; SVI_r010-1.
DR   EnsemblGenomes-Tr; SVI_r011-1.
DR   EnsemblGenomes-Tr; SVI_r012-1.
DR   EnsemblGenomes-Tr; SVI_r013-1.
DR   EnsemblGenomes-Tr; SVI_r014-1.
DR   EnsemblGenomes-Tr; SVI_r015-1.
DR   EnsemblGenomes-Tr; SVI_r016-1.
DR   EnsemblGenomes-Tr; SVI_r017-1.
DR   EnsemblGenomes-Tr; SVI_r018-1.
DR   EnsemblGenomes-Tr; SVI_r019-1.
DR   EnsemblGenomes-Tr; SVI_r020-1.
DR   EnsemblGenomes-Tr; SVI_r021-1.
DR   EnsemblGenomes-Tr; SVI_r022-1.
DR   EnsemblGenomes-Tr; SVI_r023-1.
DR   EnsemblGenomes-Tr; SVI_r024-1.
DR   EnsemblGenomes-Tr; SVI_r025-1.
DR   EnsemblGenomes-Tr; SVI_r026-1.
DR   EnsemblGenomes-Tr; SVI_r027-1.
DR   EnsemblGenomes-Tr; SVI_r028-1.
DR   EnsemblGenomes-Tr; SVI_r029-1.
DR   EnsemblGenomes-Tr; SVI_r030-1.
DR   EnsemblGenomes-Tr; SVI_r031-1.
DR   EnsemblGenomes-Tr; SVI_r032-1.
DR   EnsemblGenomes-Tr; SVI_r033-1.
DR   EnsemblGenomes-Tr; SVI_r034-1.
DR   EnsemblGenomes-Tr; SVI_r035-1.
DR   EnsemblGenomes-Tr; SVI_r036-1.
DR   EnsemblGenomes-Tr; SVI_r037-1.
DR   EnsemblGenomes-Tr; SVI_r038-1.
DR   EnsemblGenomes-Tr; SVI_r039-1.
DR   EnsemblGenomes-Tr; SVI_r040-1.
DR   EnsemblGenomes-Tr; SVI_r041-1.
DR   EnsemblGenomes-Tr; SVI_r042-1.
DR   EnsemblGenomes-Tr; SVI_r043-1.
DR   EnsemblGenomes-Tr; SVI_t001-1.
DR   EnsemblGenomes-Tr; SVI_t002-1.
DR   EnsemblGenomes-Tr; SVI_t003-1.
DR   EnsemblGenomes-Tr; SVI_t004-1.
DR   EnsemblGenomes-Tr; SVI_t005-1.
DR   EnsemblGenomes-Tr; SVI_t006-1.
DR   EnsemblGenomes-Tr; SVI_t007-1.
DR   EnsemblGenomes-Tr; SVI_t008-1.
DR   EnsemblGenomes-Tr; SVI_t009-1.
DR   EnsemblGenomes-Tr; SVI_t010-1.
DR   EnsemblGenomes-Tr; SVI_t011-1.
DR   EnsemblGenomes-Tr; SVI_t012-1.
DR   EnsemblGenomes-Tr; SVI_t013-1.
DR   EnsemblGenomes-Tr; SVI_t014-1.
DR   EnsemblGenomes-Tr; SVI_t015-1.
DR   EnsemblGenomes-Tr; SVI_t016-1.
DR   EnsemblGenomes-Tr; SVI_t017-1.
DR   EnsemblGenomes-Tr; SVI_t018-1.
DR   EnsemblGenomes-Tr; SVI_t019-1.
DR   EnsemblGenomes-Tr; SVI_t020-1.
DR   EnsemblGenomes-Tr; SVI_t021-1.
DR   EnsemblGenomes-Tr; SVI_t022-1.
DR   EnsemblGenomes-Tr; SVI_t023-1.
DR   EnsemblGenomes-Tr; SVI_t024-1.
DR   EnsemblGenomes-Tr; SVI_t025-1.
DR   EnsemblGenomes-Tr; SVI_t026-1.
DR   EnsemblGenomes-Tr; SVI_t027-1.
DR   EnsemblGenomes-Tr; SVI_t028-1.
DR   EnsemblGenomes-Tr; SVI_t029-1.
DR   EnsemblGenomes-Tr; SVI_t030-1.
DR   EnsemblGenomes-Tr; SVI_t031-1.
DR   EnsemblGenomes-Tr; SVI_t032-1.
DR   EnsemblGenomes-Tr; SVI_t033-1.
DR   EnsemblGenomes-Tr; SVI_t034-1.
DR   EnsemblGenomes-Tr; SVI_t035-1.
DR   EnsemblGenomes-Tr; SVI_t036-1.
DR   EnsemblGenomes-Tr; SVI_t037-1.
DR   EnsemblGenomes-Tr; SVI_t038-1.
DR   EnsemblGenomes-Tr; SVI_t039-1.
DR   EnsemblGenomes-Tr; SVI_t040-1.
DR   EnsemblGenomes-Tr; SVI_t041-1.
DR   EnsemblGenomes-Tr; SVI_t042-1.
DR   EnsemblGenomes-Tr; SVI_t043-1.
DR   EnsemblGenomes-Tr; SVI_t044-1.
DR   EnsemblGenomes-Tr; SVI_t045-1.
DR   EnsemblGenomes-Tr; SVI_t046-1.
DR   EnsemblGenomes-Tr; SVI_t047-1.
DR   EnsemblGenomes-Tr; SVI_t048-1.
DR   EnsemblGenomes-Tr; SVI_t049-1.
DR   EnsemblGenomes-Tr; SVI_t050-1.
DR   EnsemblGenomes-Tr; SVI_t051-1.
DR   EnsemblGenomes-Tr; SVI_t052-1.
DR   EnsemblGenomes-Tr; SVI_t053-1.
DR   EnsemblGenomes-Tr; SVI_t054-1.
DR   EnsemblGenomes-Tr; SVI_t055-1.
DR   EnsemblGenomes-Tr; SVI_t056-1.
DR   EnsemblGenomes-Tr; SVI_t057-1.
DR   EnsemblGenomes-Tr; SVI_t058-1.
DR   EnsemblGenomes-Tr; SVI_t059-1.
DR   EnsemblGenomes-Tr; SVI_t060-1.
DR   EnsemblGenomes-Tr; SVI_t061-1.
DR   EnsemblGenomes-Tr; SVI_t062-1.
DR   EnsemblGenomes-Tr; SVI_t063-1.
DR   EnsemblGenomes-Tr; SVI_t064-1.
DR   EnsemblGenomes-Tr; SVI_t065-1.
DR   EnsemblGenomes-Tr; SVI_t066-1.
DR   EnsemblGenomes-Tr; SVI_t067-1.
DR   EnsemblGenomes-Tr; SVI_t068-1.
DR   EnsemblGenomes-Tr; SVI_t069-1.
DR   EnsemblGenomes-Tr; SVI_t070-1.
DR   EnsemblGenomes-Tr; SVI_t071-1.
DR   EnsemblGenomes-Tr; SVI_t072-1.
DR   EnsemblGenomes-Tr; SVI_t073-1.
DR   EnsemblGenomes-Tr; SVI_t074-1.
DR   EnsemblGenomes-Tr; SVI_t075-1.
DR   EnsemblGenomes-Tr; SVI_t076-1.
DR   EnsemblGenomes-Tr; SVI_t077-1.
DR   EnsemblGenomes-Tr; SVI_t078-1.
DR   EnsemblGenomes-Tr; SVI_t079-1.
DR   EnsemblGenomes-Tr; SVI_t080-1.
DR   EnsemblGenomes-Tr; SVI_t081-1.
DR   EnsemblGenomes-Tr; SVI_t082-1.
DR   EnsemblGenomes-Tr; SVI_t083-1.
DR   EnsemblGenomes-Tr; SVI_t084-1.
DR   EnsemblGenomes-Tr; SVI_t085-1.
DR   EnsemblGenomes-Tr; SVI_t086-1.
DR   EnsemblGenomes-Tr; SVI_t087-1.
DR   EnsemblGenomes-Tr; SVI_t088-1.
DR   EnsemblGenomes-Tr; SVI_t089-1.
DR   EnsemblGenomes-Tr; SVI_t090-1.
DR   EnsemblGenomes-Tr; SVI_t091-1.
DR   EnsemblGenomes-Tr; SVI_t092-1.
DR   EnsemblGenomes-Tr; SVI_t093-1.
DR   EnsemblGenomes-Tr; SVI_t094-1.
DR   EnsemblGenomes-Tr; SVI_t095-1.
DR   EnsemblGenomes-Tr; SVI_t096-1.
DR   EnsemblGenomes-Tr; SVI_t097-1.
DR   EnsemblGenomes-Tr; SVI_t098-1.
DR   EnsemblGenomes-Tr; SVI_t099-1.
DR   EnsemblGenomes-Tr; SVI_t100-1.
DR   EnsemblGenomes-Tr; SVI_t101-1.
DR   EnsemblGenomes-Tr; SVI_t102-1.
DR   EnsemblGenomes-Tr; SVI_t103-1.
DR   EnsemblGenomes-Tr; SVI_t104-1.
DR   EnsemblGenomes-Tr; SVI_t105-1.
DR   EnsemblGenomes-Tr; SVI_t106-1.
DR   EnsemblGenomes-Tr; SVI_t107-1.
DR   EnsemblGenomes-Tr; SVI_t108-1.
DR   EnsemblGenomes-Tr; SVI_t109-1.
DR   EnsemblGenomes-Tr; SVI_t110-1.
DR   EnsemblGenomes-Tr; SVI_t111-1.
DR   EnsemblGenomes-Tr; SVI_t112-1.
DR   EnsemblGenomes-Tr; SVI_t113-1.
DR   EnsemblGenomes-Tr; SVI_t114-1.
DR   EnsemblGenomes-Tr; SVI_t115-1.
DR   EnsemblGenomes-Tr; SVI_t116-1.
DR   EnsemblGenomes-Tr; SVI_t117-1.
DR   EnsemblGenomes-Tr; SVI_t118-1.
DR   EnsemblGenomes-Tr; SVI_t119-1.
DR   EnsemblGenomes-Tr; SVI_t120-1.
DR   EnsemblGenomes-Tr; SVI_t121-1.
DR   EnsemblGenomes-Tr; SVI_t122-1.
DR   EnsemblGenomes-Tr; SVI_t123-1.
DR   EnsemblGenomes-Tr; SVI_t124-1.
DR   EnsemblGenomes-Tr; SVI_t125-1.
DR   EnsemblGenomes-Tr; SVI_t126-1.
DR   EuropePMC; PMC3638456; 23479745.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; AP011177.
DR   SILVA-SSU; AP011177.
DR   StrainInfo; 303792; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4962103
FT                   /organism="Shewanella violacea DSS12"
FT                   /strain="DSS12"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:637905"
FT   CDS_pept        complement(334..774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mioC"
FT                   /locus_tag="SVI_0001"
FT                   /product="mioC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99971"
FT                   /db_xref="GOA:D4ZD50"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD50"
FT                   /protein_id="BAI99971.1"
FT                   /translation="MAKIDILVGTTLGNAEYVADEFAAVLSKLGHENVIHMTPKITDLD
FT                   PRSLWLIVSSTHGAGDLPDNIMPFLEEILSQKPDLKGTKYAICAIGDSSYDTFCLGPEK
FT                   LAQALESCGAQVYVDKIQIDVQYDHVPEDPALAWLEQWQDRL"
FT   CDS_pept        1149..1331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99972"
FT                   /db_xref="GOA:D4ZD51"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD51"
FT                   /protein_id="BAI99972.1"
FT                   /translation="MAKGSLAISGPNYDWKLIYLYLTQYNFINIAIISIIPSIPLAINV
FT                   LSQLAIRSISQIIES"
FT   CDS_pept        1437..1994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99973"
FT                   /db_xref="GOA:D4ZD52"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD52"
FT                   /protein_id="BAI99973.1"
FT                   /translation="MLRHYFITNDLDDLEKVEQELEAEGITEPQIHILSEKDADVENHH
FT                   LHEVEPVLKLDVVHSTEIGAVIGFVISAATLMLAYEMGWTQSAAGWLPFIFLAIVILGF
FT                   CTWEGGFIGIQKTNIHFERFQELLHKGKHVLFVDVDPNQEPVFAKIINEHPKLEPAGLG
FT                   SATPHWVVRWQDKFHSFMKTMP"
FT   CDS_pept        2190..3668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0004"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99974"
FT                   /db_xref="GOA:D4ZD53"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD53"
FT                   /protein_id="BAI99974.1"
FT                   /translation="MAIAVVILLLVLVSVVFHFVSPWWFTPIASNWTAIDDTITLTFWV
FT                   TGIVFIAVNGFLAYCVFRFRFDKNKRADYEPENKKLEVWLTVFTTIGVAAMLAPGLVVW
FT                   SEFVTVPDNAETFEVVGQQWHWSYRLPGKDGILGQSAVDLMDEKNPFGLNPNDINAQDD
FT                   LLISSNIMHILLDQPVKVLMRSKDVLHNFAVPQFRVKMDLVPGIETYLWFTPTRLGRFE
FT                   MLCEELCGMAHYTMRGQIVVDTAQDYQIWLDKQLTFKETLDAPAGDLHLGKNLYVSCAA
FT                   CHGNNGQGNETLNAPMLAGQPAWYLTRQLNYYKSQVRGSHQQDIYGQQMAAMANTLVDA
FT                   KAIKDVTAYIASLPALAISPAAVNNGPLARSITSGQRLFTNCAYCHGDKAEGKFALNAP
FT                   RLAGQHAWYLKRQLQNYRASIRGAHREDLYGTQMIMMSRLLQNEQAIDDVVAYITRLKP
FT                   IFDAGYHQSVSREVKATESPSITGQSHVTQEVSR"
FT   CDS_pept        3665..5479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxN"
FT                   /locus_tag="SVI_0005"
FT                   /product="alternative cytochrome c oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99975"
FT                   /db_xref="GOA:D4ZD54"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD54"
FT                   /protein_id="BAI99975.1"
FT                   /translation="MNYTAIVDQADKSHHPTSFMTKYIWSQDHKVIAIQYSITALFVGL
FT                   VALALSAMMRLQLGFPDSFSFIEPSSYLQFVTMHGMIMVIYLLTALLLGGFGNYLIPLM
FT                   VGARDMVFPYLNMLSYWTYLLAVIVLLASFFVPGGPTGAGWTLYPPQTILPGTPGNDAG
FT                   IILMLVSLAIFIVAFTMGGLNYVTTILQARARGMTLMRMPLTIWGIFTATVLGLLAFPA
FT                   LLVSAIMMMLDKLVGTSFFMPAILSLGEPLNYTGGSPVLFQHLFWFFGHPEVYIVALPA
FT                   FGMVSDVIATHARKNIFGYRMMVWAIVAIGGLSFVVWAHHMYVSGMNPYFGFFFATTTL
FT                   IIAIPTALKVYNWSLTLWRGNIHMTVPMMFAIGFIFTFTHGGLTGLFLGNVVVDLPLSD
FT                   TYFVVAHFHMVMGVSPIMVLFAAIYHWFPKVTGRFLHTGLGKFHFWMTFIGTYSIYLPM
FT                   HYLGFLGVPRRYFAMGPTEFIPESAQSLNASITISALIVGLVQLIFLLNIIWSTFKGKK
FT                   SGPNPWNATTLEWQTEYTPPRHGNWGEKIPVVYRWAYDYSVPGVKADFIPQNVSPEEVE
FT                   MMDEPISASTDSKTEIKPPEPGDDKGGA"
FT   CDS_pept        5476..6171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0006"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99976"
FT                   /db_xref="GOA:D4ZD55"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD55"
FT                   /protein_id="BAI99976.1"
FT                   /translation="MMNFFSSIYSKLTEKPWLAQSEAALEHELIEYQAGYPGKTGLKFF
FT                   IAVVTVIFFLFSVTYLSRSQYADFQALAGDPWSPLYQPLWLWVNTGCLLLASLCLHFSL
FT                   GQVSEDKLNRLLGLLILSVIFSLLFIFGQWSVWQQLSLQGFAINSNPANSYFYMLTAIH
FT                   GLHLLGGLFALARVLVIFSRKVKLDILQRSLVLCAWYWHYLWLLWIFIFALLTASPSTY
FT                   NTIASWCGL"
FT   CDS_pept        6242..6934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0007"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99977"
FT                   /db_xref="GOA:D4ZD56"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD56"
FT                   /protein_id="BAI99977.1"
FT                   /translation="MSTDDKQEKAAAPIATDDWQGAVSDWGSDKQVFNMPWGKLMMWLF
FT                   LLSDTFVFSVFLIGYMNVRMSSMDSWPLTSEVFALTIAGHHIPLVLIAIMTFILITSSG
FT                   TMAMAVNFAYRGDRRKTVLFMTATALLGASFVGMQAFEWTKLIVEEGVRPWGNPMGSAQ
FT                   FGATFFMITGFHGLHVTAGVIFLLVIARRVARGHYEGKGYHIVEITGLYWHFVDLVWVF
FT                   IFALFYLW"
FT   CDS_pept        7090..7410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0008"
FT                   /product="integral membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99978"
FT                   /db_xref="GOA:D4ZD57"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD57"
FT                   /protein_id="BAI99978.1"
FT                   /translation="MEQTQPKLHPISLYLKIWALLFVLSTMSYMVDYFEVQGLLRWTLI
FT                   LLFMSLKAGLIITIFMHVRWERLALKLVLFLPPLAIVVFISLMAIEGDYTFVNRLFSFI
FT                   SV"
FT   CDS_pept        7488..8189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0009"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99979"
FT                   /db_xref="GOA:D4ZD58"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD58"
FT                   /protein_id="BAI99979.1"
FT                   /translation="MLRQVRAKLWLGAGILLMVTLVLVSISFMLVKASPSVNLSLQSAS
FT                   LLQEPITLSDFTLVNHHKQYFTQADLRGQWHLLAYGYLNCPDVCPATLLLLNSLMFSLQ
FT                   KDNQFADVQLLFYTIDPDRDSTEKLAEYVAFFGEDIIGLKPVDTEVLAGIAKQFEQELG
FT                   IRVKISRPEGDEGSYQVGHGLAIYLLDPQGRLHAVFEPSVDPFGNRHFTKDDIYHDYVL
FT                   IRKNANRFTMQ"
FT   CDS_pept        8326..9297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0010"
FT                   /product="inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99980"
FT                   /db_xref="GOA:D4ZD59"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD59"
FT                   /protein_id="BAI99980.1"
FT                   /translation="MTTKIILDTDPGIDDAMAIIFAEAHSEIELKAITCVYGNATIDNA
FT                   THNALFLKQKYGLQADVVKGAAKPMVRPSVGATVVVHGESGLGDFQAPDELSVAADPRP
FT                   AYQYIIDALRAEPGEITLVAVGPLTNLALALEAAPEIVTLVKEVVVMGGAFGVNDHRGN
FT                   VTPYAEANIHDDPHAADMVFGASWPVVIIGLDVTEQSFFTKDYLDRLRDDAGEVGQFIW
FT                   DISRYYLKFYSEKVGLEGCHVHDPSAIAYVIDPSLFTLREGPVRVVTDGPAEGMTIQKF
FT                   DKRKYMHDEWQSHESQRVGISVEDERLLSLYRQTIIDYSQKR"
FT   CDS_pept        complement(9383..10024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0011"
FT                   /product="transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99981"
FT                   /db_xref="GOA:D4ZD60"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD60"
FT                   /protein_id="BAI99981.1"
FT                   /translation="MIDLAVLPLYLTTVIALLLIPGPDMLLIASSSLSYGKKVGVFASL
FT                   GNATSGLILTLLAAMGVSALIAMNPMALQVLRILGGAYLMKMGWDCMRSGPADAPEIEQ
FT                   QSGLAKMLYRRAVFSNLLNPKALLFFVLFLPQFVSPQLTATSGEQMLALGLLLNVMGLL
FT                   FNLLLVLMVGTLGKSLLKNDKFRANQNKFMGMIFFALAIWLLGSQVQAMS"
FT   CDS_pept        10928..11152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99982"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD61"
FT                   /protein_id="BAI99982.1"
FT                   /translation="MFRYILSAIILYAFWLTYQDISSYLDEPVASEIQLLANQEHQRDS
FT                   QSGGQLAKVKHYNLIEEMSCDSNSECNSE"
FT   CDS_pept        11594..12403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99983"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR010602"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD62"
FT                   /protein_id="BAI99983.1"
FT                   /translation="MQKFIVKEALTDPESNLLFFGICLIIDRKQFSSFDSLIDLTNKED
FT                   CDSPLERLLGDFIGSDLSTAYYILAQGKPEQLSRLVNSQQAGELVKMAALSALFSQLHT
FT                   GQIDRDTLNHSIPSFIDSLVKNNHSIALFELINLLISNQFNQYHSQLVAYVQSKVIDEG
FT                   PAENQCIIDWDNQSIGYSEWESGLISGNYDVIDSLSHWAGFNAESEMNDEDLMAVFDDL
FT                   MNTPSELDERYFEALDYQQPFIADIQVGRNDPCPCGSGKKYKKCCLN"
FT   CDS_pept        complement(12414..12698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99984"
FT                   /db_xref="GOA:D4ZD63"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD63"
FT                   /protein_id="BAI99984.1"
FT                   /translation="MKTNTTTLFSTFYSEQAWNDYLYWQQQDKKTLKRINLLIKDCQRT
FT                   PFEGIGKPERLKENLSGYWSRRISDEHRLVYRANQDQLTIVALRFHYSS"
FT   CDS_pept        complement(12698..12949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0015"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99985"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD64"
FT                   /protein_id="BAI99985.1"
FT                   /translation="MSVYSFTEVRSNFKSVCDSVVNDCEPAVIHRRGAENVVMFSESEF
FT                   NSWKETIYLLSNPVNAKHLLDSIKQIDDGQAQERELLD"
FT   CDS_pept        13001..13108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99986"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD65"
FT                   /protein_id="BAI99986.1"
FT                   /translation="MYKIKYKYPETENTCLHTNLGLVGSQIWSFVGSQG"
FT   CDS_pept        complement(13343..16513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0017"
FT                   /product="helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99987"
FT                   /db_xref="GOA:D4ZD66"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD66"
FT                   /protein_id="BAI99987.1"
FT                   /translation="MSFIMQTGIYEQLITKVISNKLDKDKFFISERNMDTTEQTLWLTR
FT                   ALVHVFHLAISESKNTKDSPLAQIELANELIYWLQERIENLDLSDYTIAQPAKLLTAIF
FT                   DKQDPVSAKLSAHIDKITPLTGLTQSELFCGSNQGISLESEIKREILSSNKICWIISFI
FT                   KWTGLRIFMDELRTFTSNNKHKLQIITTSYMGATDLKAVQWLAKLPNTEVKLSYNHNQE
FT                   RLHAKSYLFMRDSGFHTAYIGSSNLSRSALTNGLEWNLKITNQEIPHIIDKTFSTFETY
FT                   WQQPEFDFFDGSEKASSKLNRSLNLGRGDKNNSNTVFFDLAPHQHQIEILERLDAERNL
FT                   HGRNRNLIVAATGTGKTLISAFDFKRFYQENPTAKILFIAHREEILKQAIESFRAVLKQ
FT                   PNFGELWVGQHKPDSYDQLFASIQTFNNQLDNMNLSSDYYDFIVIDEVHHVSAESYRKF
FT                   ISYFSPKILLGLTATPERHDGKNILDDFGGVIAAELRLPEAINLRYLCPFQYFGIDDNT
FT                   DLRQVKWENGRYNPSELTQVYTQNDQRLQKILQNIEELVTNPLEMRALAFCVNQDHARY
FT                   MAEKFCLKGIPSAVLTSKNASERHSVRQDLQLGNINILCVVDIFNEGVDIPEIDTLLFL
FT                   RPTESLTIFLQQLGRGLRHNDGKECVTVLDFVGNARTEYDFSQKFRALIGKTHTAISKE
FT                   IEHGFPHLPLGCHIELQKKTKEIILNNIKQAILNQQKLKSHIQNFQHHTVQKLTLSNFL
FT                   NFYPNIRLIDIYKKKPKDGGGWTRLLSDLLLIPRVNETTIAENYHRAIFNSIIKCDART
FT                   YLKFIRSLAINHFKWVDNGDAIEQRMALMCHYDFWSCSGDKLGFTSLSESLAALTHPEY
FT                   QNELIEVINYLLDNNDTQVQRLQTDFPCPLQLNARYTREQIIAGLGGSSFEKQAVSREG
FT                   VFNLRELNVELLFVTLQKSDQHFSPTTLYHDYAMSPTHFHWQTQNSARPDSGKGLAYIQ
FT                   HKDIGKKLMLWVRESNKDENGNTMGFVNLGWVNLAETSGSQPMNITWELHEPMPSYLWK
FT                   DAAKLANS"
FT   CDS_pept        complement(17008..18105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0018"
FT                   /product="Fic family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99988"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD67"
FT                   /protein_id="BAI99988.1"
FT                   /translation="MWIWQQANWPDFRWETDNIALLLRQVRFNQGLLLGKLDSEPSAQM
FT                   TLDTLLANIIHSSAIEGEKLNAFSVRSSLANKLGISDEKPYPTTVQTDGLAEMTLDALQ
FT                   NWQTELSLQRIMDWHKLLFPEGYTLFNPVQGGVLRGSEPMQVISGRIDKPKVHFEAPPR
FT                   SGLEDELTRFIDWFNRSQQDVAMDPLIRAAITHLWFVTLHPLDDGNGRITRLLTDLALA
FT                   QAESRSIHFYAMSVSILERRQAYYDILESTQKGELDITSWLVWFLDTLNSSLQKSLDDI
FT                   AQTVAKTNYWQRVDQTLLSGEQVKVLNRLLNGEFELGISSSQYQKVAKVSRATATRHLA
FT                   QLVEQSFLVKAGAGGRSTRYLLASK"
FT   CDS_pept        18468..18692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99989"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD68"
FT                   /protein_id="BAI99989.1"
FT                   /translation="MHAGNMQDHIQHLLQAINTNIAMLPNTLPSKKPAQRSQQTNQQGY
FT                   LPHLLADKSQHRVYVSWLLPAVFIFCIYN"
FT   CDS_pept        19334..19447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99990"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD69"
FT                   /protein_id="BAI99990.1"
FT                   /translation="MVRMLLFLKRESKATKSKLSPRSTQRSRRKKQTKSKR"
FT   CDS_pept        19444..19647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99991"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD70"
FT                   /protein_id="BAI99991.1"
FT                   /translation="MSSALPTGVDTAASFQNMDVLVEPTWKCLRRLAEVSALKPAASNK
FT                   HKYSHAAKYPTKQKYSQMNPTD"
FT   CDS_pept        19974..20978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0022"
FT                   /product="stationary-phase survival protein SurE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99992"
FT                   /db_xref="GOA:D4ZD71"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD71"
FT                   /protein_id="BAI99992.1"
FT                   /translation="MKIKTGLLSALIAQALLVSAPAAALNIVLTNDDSWNTHNIKAMKE
FT                   ALVAKGHDVIMAAPCTGQSGKGGSFGFFKSVKVDETKAEQYEFCIGDLDTSQSFEDYVE
FT                   GTPVMSVLYGIDVAAQKKWGKAPDLVVSGPNEGNNLGYMNNNSGTLGATMIALSRGIPA
FT                   IAVSASENSLSDATQGPKIASVVVNVIDKLEASRADNQPLLPAYMGLNINTPEDIDASL
FT                   GYRFTDVGWNGGGIALKFVEDFSDNEMIVGYFAQILLAQGAAESMEQALAMAKGMLQGK
FT                   QGVGFALSDVNDSNENSEGVAVKNGYITISTIDASVQATRAKRALTQQRLSGL"
FT   CDS_pept        20994..21665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99993"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD72"
FT                   /protein_id="BAI99993.1"
FT                   /translation="MKKCFIGLVSLAFLAACSSDDSNKVPQVSGIFSGVTYSEAGAPLK
FT                   VTATAINLAGSDQTAFTTIVTLWDERDQQISYSGIYHQDSNKLTFANEKYECIPDNNLW
FT                   LCSSAVESFTLAKVTPEAVSIDLVLGSYSAQLGSDSYGLVIAADNKFTILSAGCEANGS
FT                   LSYELDGQVLMFELADKTLEDTCGLDNLTGIINYVSDNDELFSLEFQTVNSDIPITWLK
FT                   R"
FT   CDS_pept        22121..24703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0024"
FT                   /product="ATP-dependent helicase HrpB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99994"
FT                   /db_xref="GOA:D4ZD73"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD73"
FT                   /protein_id="BAI99994.1"
FT                   /translation="MEWYYMQPTTPKSYVSEPSNKITSSINSLPIDKLYDEFKLAIKDN
FT                   HLVVESDTGSGKSTRLPLWCVEAGCVEAGNVEPKEGDRPKRVLVVEPRRVACLALSSFV
FT                   STQTELKVGHSIRFDSTVTDDTQVAFVTPGIALRWLQETGLASFTTVIIDEFHERRWDT
FT                   DLLLAMLKLKALSSPEFRLILTSATIDGERLTRYLGKTAGRLVAEGKRFHVELKYQASE
FT                   SHHLPDIRGVEQGVKTAVSGLLQQTDGDILVFLPGKREIQGAIQICQPLVLASGKPLEL
FT                   LALHGGISPVEQKKILQQAEHQRIIFATNVAETSLTIPGVTAVVDSGLERRTHQRNGRT
FT                   VLSLARISKASCAQRMGRAGRTQNGICIRLWGQSAPMEAMTPPELQREELVEPMLAAAC
FT                   CGYKLSELEFVDDLPVKSLAIAEQKLLAMGAIDADGQITPHGKKLSPLPIDTQFAHLIS
FT                   AMPDDTCRGLMVDLAAALSVPHGLFKLPTSEFDLKLLSEWEPLGCDAFTLIKIVRDKLP
FT                   DFLADADAGYVHKGARKEARMLAAQIRSALGLQTIEQSDALASKDIELRQRWLLAVIKA
FT                   APELAYVRREKRITALGNGFSEAQIGRVSRFCSEIKTVDGKESALAAVIFDLHSIAGKG
FT                   AKQTLNLASCMAPISFDLLLEAKLGEERLGDSKEKGQSHKLVVDTFYAGRVIGSRLKQV
FT                   EGEQAIEAIVRSISVGRQFKGLSQRLKNDIAAWNIWLALGKAKEQFTESGLVNSLGEEP
FT                   LVFDVYLMERLNELGVESFDDLQLIEADDLLFEGIPDWQREEFDTLYPTKLILADLKLN
FT                   VEYLPKRKLVTLVYANGSRKTGPKRWELPRWQGWKIQYKKASRVVDVK"
FT   CDS_pept        complement(24664..24963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99995"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD74"
FT                   /protein_id="BAI99995.1"
FT                   /translation="MWIKISILLVNCKKSDLAEKLYAKRILILLLKIDLIVQRSKTIFI
FT                   TWMLLNLYSVFLSKLKLENKTKYKKVVAKPLDYQVNKLINMAHFTSTTRLAFLY"
FT   CDS_pept        complement(25904..27265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="SVI_0026"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99996"
FT                   /db_xref="GOA:D4ZD75"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD75"
FT                   /protein_id="BAI99996.1"
FT                   /translation="MTEDTIVAQATAPGRGGVGIIRISGDQASEVAMAMLGHIPKTRYA
FT                   DYCDFKTADGVVIDQGIALYFKGPNSFTGEDVLELQGHGGQIVLDMLIKRVLETKDIRI
FT                   ARPGEFSEQAFMNDKLDLTQAEAIADLIDATSEQAAKSALNSLQGEFSTEVHALVEKVT
FT                   NLRLYVEAAIDFPDEEVDFLSDGKIAGSLNKIITRLDSVKASAKQGSIIREGMKVVIAG
FT                   RPNAGKSSLLNALAGKESAIVTEVAGTTRDVLREHIHIDGMPLHIIDTAGLRDTSDTVE
FT                   KIGIERAWAEIETADQVLFMVDGTTTDAVDPHEIWPDFIDRLPSKLGITVVRNKADLTG
FT                   ESLELTQDHGHPVYRISAKTGLGIDSVKQHLKSLMGYQSNLEGGFIARRRHLEALDLAS
FT                   SHLMLGKEQLEVYLAGELLAEELRMSQMALSEITGKFTSDDLLGKIFSSFCIGK"
FT   CDS_pept        complement(27388..29022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="SVI_0027"
FT                   /product="inner membrane protein oxaA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99997"
FT                   /db_xref="GOA:D4ZD76"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD76"
FT                   /protein_id="BAI99997.1"
FT                   /translation="MESQRNIFLIGLLFVSFLLWQQWQTDQAPQPVTTELTSVSTASNT
FT                   TDAHSSDVPDADSALPAATVASKELITIHTDQLVIKINPVGGDIVYSALVEHKLEQESD
FT                   EPFVLLEQTKDINYIAQSGLIGRNGIDSSVKGRAHFDSASQDYTMAADQETLEVPLTYV
FT                   AENGAKYTKMFIFHRGQFKIDVDYLVDNTTDKPLQVQMYGQIKHSIKKSSSSMIMPTYL
FT                   GAAFSTSDIRYEKYKFDDMADKDLDKKTLGGWAAMLQHYFVSAWIPPENDQNTIFSSIS
FT                   AGGQANIGFRGAIYDIAPGATQTISSQFYVGPKDQEALSEISDSLNLVVDYGFLWWLAV
FT                   PINKLLMFFQSIVSNWGLAIILITLTVRGMLFPLTKAQYTSMAKMRNLQPKLAEMKERF
FT                   GDDRQKMGQAMMELYKKEKVNPMGGCLPILLQMPIFISLYWVLMESVELRHAPFMLWIT
FT                   DLSVQDPYYVMPILMGISMFVMQKMQPMAPTMDPMQQKMMQWMPVVFTVFFLWFPAGLV
FT                   LYWLVGNLVAITQQKIIYAGLAKKGLK"
FT   CDS_pept        complement(29026..29283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99998"
FT                   /db_xref="GOA:D4ZD77"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD77"
FT                   /protein_id="BAI99998.1"
FT                   /translation="MAKTHSPLQWLATTIIRGYQILISPLLGTNKCRFHPTCSYYAIEA
FT                   IHLHGFVKGSWLTAKRVLKCHPLHPGGIDPVPSKKHRCNK"
FT   CDS_pept        complement(29250..29606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="SVI_0029"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAI99999"
FT                   /db_xref="GOA:D4ZD78"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD78"
FT                   /protein_id="BAI99999.1"
FT                   /translation="MTSYTFTRELRLLTPAQFKSVFAKPIKASSAEITLLAIPNSEQHP
FT                   RIGLTVAKRFVKKAHQRNRIKRIIRDNFRLHQHELPPVDIVVLVRNGVVEMENAELHKL
FT                   VEKLWRKLTRRYNG"
FT   CDS_pept        complement(29621..29758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SVI_0030"
FT                   /product="ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00001"
FT                   /db_xref="GOA:D4ZD79"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD79"
FT                   /protein_id="BAJ00001.1"
FT                   /translation="MSKRTFQPSNLKRKRSHGFRARMATVGGRKVLARRRAKGRARLSA
FT                   "
FT   CDS_pept        30205..31593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SVI_0031"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00002"
FT                   /db_xref="GOA:D4ZD80"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD80"
FT                   /protein_id="BAJ00002.1"
FT                   /translation="MAVTLWQQCLGRLQDELSAQQFSMWIRPLQAEMDGNTLVLYAPNR
FT                   FVLDWVRDKYINIINQFFTEQMGSDAPKLRFDIGSKPAAPRPIQATPAMAPPRVQMNTR
FT                   PAKTTFNMNMPEPAIMANHRSNINPAYQFENFVEGKSNQLGKAAALQVAENPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNAIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQVILTSDKYPKEIDGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMRKAQESGVNLPDEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVA
FT                   RPRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIR
FT                   TLSS"
FT   CDS_pept        31613..32713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SVI_0032"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00003"
FT                   /db_xref="GOA:D4ZD81"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD81"
FT                   /protein_id="BAJ00003.1"
FT                   /translation="MKFSIDRDALLKPLQLVNGAVERRHNLPILANLLVEVSGHSLKMT
FT                   GTDLEVELVGQVQLEGDVVEGRITVPAKKFLDIVKSLPDQVELKIEQQENRLLLRSGRS
FT                   RFTLATLPAEEYPNVEAFQSDIEFTIKQGTLKSLIDATQFSMANQDVRYYLNGLLLETD
FT                   GNVLRAIATDGHRLALSHRQIEATLPEKQVIVPRKGVVELQRLFEGEDLDVTIAIGDNA
FT                   IRATTSSAVLTSKLVDGRFPDYRRVLPKGGDKVVIASRNQLKQALLRASILSNEKFRGV
FT                   RVQLENNLLKITANNPEQEEAEEIIDVEYDNTPLEIGFNVSYLLDVLNNLPSDDVRITL
FT                   IDGNSSALIENHIEEDSMYVVMPMRL"
FT   CDS_pept        33111..34208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SVI_0033"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00004"
FT                   /db_xref="GOA:D4ZD82"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD82"
FT                   /protein_id="BAJ00004.1"
FT                   /translation="MSLTRLHIETFRNIASAQLLPAEGINLIYGLNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVIQHSDDKLTLFAKLNVQNKESKIGLRRFRSGETEVKIDGDKIKR
FT                   LSTLAESLPIQVITPESFALLFDGPKSRRQFIDWGAFHCDKSFHSAWVNVKRILKQRNQ
FT                   LLKNEAGYSQIQYWDTELVRYSEVVTDIRTQYVNSLNEQLKGIIGEFLPQVDVKVSFTR
FT                   GWDSKTDYAQLLETQYPRDVSSGNTASGPHKADLRLRVGTLPVQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKNSIYLVDDLPSELDAKHRQLLLQQLTDTGAQVFVTAIEPAAILDS
FT                   LNTPPSKVFHVEQGRVTVIEQPTRE"
FT   CDS_pept        34210..36630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SVI_0034"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00005"
FT                   /db_xref="GOA:D4ZD83"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD83"
FT                   /protein_id="BAJ00005.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEVV
FT                   DNSIDEALAGHCSEVIITIHADNSVSVKDDGRGIPVDIHPEEGISAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEKLQLTIRRNGKLYEQFYTMGVPDAPIKEIGDATS
FT                   TGTELRFWPSHETFTTNIKFHFDILVKRVRELSFLNSGVGIRLIDERDNRDEFFQYQGG
FT                   ISAFVDYLNVNKTAVNKDVFHFIQERDDGITVEVAMQWNDGFQENIFCFTNNIPQRDGG
FT                   THLAGFRGALTRNLNAYMEREGYNKKGKTNATGDDAREGLTAVISVKVPDPKFSSQTKD
FT                   KLVSSEVKSAVEQTMGEKLGDYLMEHPNEARLIVGKIIDASRAREAARKAREMTRRKGA
FT                   LDLGGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKA
FT                   RFDKMLSSQEVATLITALGCGIGRDEYDPDKTRYHNIVIMTDADVDGSHIRTLLLTFFF
FT                   RQMPELIERGYIYIAQPPLYKVKKGRQEQYLKDELALTEFLTNLALDGGELHSSADAPA
FT                   ISGAPLEKLVYQYREVETIFDRLNMRYPTLLTERMLYHPALDAEMLADEAKVKQWCDEF
FT                   VADLTEKESGGVMYSADPVMDPERKVYLPNVHIRKHGIDTSYLFTYDFLNSSDYERMAK
FT                   LAAALEGLIVEGGYIKRGERMKEISTFVEALNWLMNDSRRGLYIQRYKGLGEMNPEQLW
FT                   ETTMDPETRRMLVVTIEDAIGADQLFTCLMGDQVEPRRQFIEENALNVANLDV"
FT   CDS_pept        complement(37045..37242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00006"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD84"
FT                   /protein_id="BAJ00006.1"
FT                   /translation="MLLMPLLSSVSATLTQSFPGDELPATDEKLNRLTKVITPNLAKFF
FT                   IEFISLLLITSLSRNDRLID"
FT   CDS_pept        37280..37528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00007"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD85"
FT                   /protein_id="BAJ00007.1"
FT                   /translation="MIKLKPMKENMRIRDLYVIMKGDDGATSHQMFGLLRKGSFSQGAM
FT                   VKESNKSIASFTINFDKNIANSINFRKSSIEIWAHKA"
FT   CDS_pept        complement(37533..38267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0037"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00008"
FT                   /db_xref="GOA:D4ZD86"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD86"
FT                   /protein_id="BAJ00008.1"
FT                   /translation="MLSNSKGYPIDLNADLGEGGANDAALLQLITSANIACGGHSGDQS
FT                   SMHTAVRLALASGVNIGAHPSFPDRKHFGRQPMIISDQELLASIYQQINSLKAVCDSLG
FT                   AKMFHVKPHGALYNLAAFNERLGLLLIETIKRIDPSLKLMILAASPLVQLARQQGLDVI
FT                   EEAFADRRYLHNASLAPRQMQGAVIENDTQALEQVELLLGNKPLPTLDGALLRLKADSI
FT                   CIHGDSEHALSFAKQISARLTA"
FT   CDS_pept        complement(38388..39317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00009"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD87"
FT                   /protein_id="BAJ00009.1"
FT                   /translation="MIEVLTPGFHTTVQDLGRTGYRHLGVSVSGALDRQALMLANRLVG
FT                   NPDNAAGLELTAGTFELKFHRDAWFTLTGAKYEIKIGAREIWHGWRNKIQAGETLSLRG
FT                   PKSGMRAYLAIDGGVDVSICLGSRSTLVTAALGGHLGRALKIGDRIPLGEKLSLSKPIG
FT                   AVQRGYSSEIRALPGPEMALFTQESRKVFWSSQWQVSNESNRMGARLSGQALSLEQEQS
FT                   LNSHAVMPGTIQVPPSGQPIVLLADGQTTGGYPKIATVIEADLWKLAQTRPGDKLQFTH
FT                   VSPNQAEDANYEWQQYFYRLQKAIDSCS"
FT   CDS_pept        complement(39314..40018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00010"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD88"
FT                   /protein_id="BAJ00010.1"
FT                   /translation="MNQDLLPKLFRLGEKALVLDCASLSSSSSKLEIQRKIWHVADICR
FT                   TSGDFEDIVPGNNNLTLFFKDGKKIPLWINQVNQVWPRKLVQEKPGRLIKIPVQYGGEY
FT                   GPDLNFVAQYNKLEPQEVIAIHTSTQYSVLFLGFQPGFPYLDGLDKRLFTPRLATPRLS
FT                   IPAGSVGIGGEQTGIYPAQSPGGWQLIGRSTVNLFDNDRTKPSLLSPGDTVQFIDIESL
FT                   DEVEEAKSEVPR"
FT   CDS_pept        40416..41231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00011"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD89"
FT                   /protein_id="BAJ00011.1"
FT                   /translation="MMGDVEHALMSPQDVADKVLKLPSKLAELGRRLKDESVDIKVLVE
FT                   EIHDDPVLSVEVMKLCNSPVFKRGDREVTSLQQAFVQLGRDQLRRLVTTCMVREMIVIK
FT                   PIYYRRFGLQIWRHSMQVAYLASELATELSDQDPDTAFLLGLLHDVGKIAIFKMLLDEF
FT                   QLAEPGEQPSSWLFRQVMTSKSLSLSALLAQCWNLPRCFESSLSQLANLDSKPTETLAA
FT                   LVWRANLISECSMLYHGKKLDEPCLARLLIDADLSRDEFEVLHKKLKEI"
FT   CDS_pept        complement(41330..43399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="SVI_0041"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00012"
FT                   /db_xref="GOA:D4ZD90"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD90"
FT                   /protein_id="BAJ00012.1"
FT                   /translation="MNFENLLIEIGTEELPPKSLRKLAESFLSNFTDELKKAELSFESA
FT                   VWHAAPRRLALSVNQLATAQADKVVEKRGPAVAQAFDADGNPTKAAMGWARGNGITVEE
FT                   AGRLKTDKGEWLLHQAKVVGVETKSLISAMAQRALDKLPIPKPMRWGSNKTQFIRPVHT
FT                   VTMLFGSEIVAGELLGIKSDRVIRGHRFMGQASFELDHADNYLSALKEKGKVLADYEVR
FT                   KTIIKTDAEAAAAKIGGIADLEDELLEEVCSLVEWPVVLTASFEEKFLDVPAEALVYTM
FT                   KGDQKYFPVFDKTGQLLPNFIFVTNIVSKDPQVIISGNEKVVRPRLADAEFFFENDKKQ
FT                   TLEDRLVSLETVVFQKQLGTIKQRVERISEMAGFIASSIDANAEDASRAGLLSKSDLMT
FT                   NMVMEFTDLQGTMGMHYARLNGETEAVALALQEQYKPKFSGDTVPTASISICVALAEKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGILRICVENNLPLDLVNLIAKAQELHGSNLSN
FT                   ETTAEQVLEFFMGRFRAWYQDQGVSVDVILAVLARRPTAPADFDSRIKAVAHFRTLDQA
FT                   SALAAANKRVSNILAKIEGDIPASIDASLLTENAEKALAEKLNELQPKLAPLFAAANYQ
FT                   EALALLADLRESVDTFFEDVMVMADDEALKNNRLALLSSLREQFLHAADISLLQ"
FT   CDS_pept        complement(43411..44316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="SVI_0042"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00013"
FT                   /db_xref="GOA:D4ZD91"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD91"
FT                   /protein_id="BAJ00013.1"
FT                   /translation="MTTKHDVKTFQGFIMTLQEYWAQQGCAIVQPLDIEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPCRRPTDGRYGDNPNRLQHYYQFQVVLKPSPSNIQELYLGSLE
FT                   AVGVDMSVHDVRFVEDNWESPTLGAWGLGWEIWLNGMEVSQFTYFQQVGGIECSPVTGE
FT                   ITYGLERLAMYIQEVDSVYDLVWTDGPMGKIMYGDIFHQNEVEQSTYNFEHADVDVLFR
FT                   LFDDCEKACERLLALEKPLPLPAYEQVMKASHAFNMLDARHAISVTERQRYILRVRTLA
FT                   KGVAQSYYQAREALGFPMCK"
FT   CDS_pept        44498..45073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="SVI_0043"
FT                   /product="DNA-3-methyladenine glycosidase I"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00014"
FT                   /db_xref="GOA:D4ZD92"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD92"
FT                   /protein_id="BAJ00014.1"
FT                   /translation="MDKKRCGWVGDDQIYLDYHDYVWGRPVYDSKELFAKLCLDGQQAG
FT                   LSWITILKKQKNYEAAFANFEPAIIAKFDAVKVEELLQDKGIVRNRLKVNSIIKNARGY
FT                   MANFSDTKSEQGNDFSEFLWSFVGGSPIVNHFNSMEEIPVKTPESEAMSKALKKMGFNF
FT                   VGPTICYAFMQAVGMVNDHATYCFCYDK"
FT   CDS_pept        complement(45438..48677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0044"
FT                   /product="amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00015"
FT                   /db_xref="GOA:D4ZD93"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD93"
FT                   /protein_id="BAJ00015.1"
FT                   /translation="MIKHKFTPLGAAIALSLSLPIMASESTSDKAAKWQVNAPTNAPFE
FT                   QVKIDVSEGTWMNISVSPNGKTIVFDMLGDIYQIPMQGGEAKVLAKGIAWQMQPTYSPD
FT                   GKYIAFTSDENGGDNIWIMDADGSNPRAVTDETFRLLNSPAWSPDSQYLVARKHYTGSR
FT                   SLGAGEVWLYHIAGGEGIKLTERPNEQKDLGEPAYSPDGRYIYFSQDATPGKTFHYSKN
FT                   SVKGIYKIKRYDTETGDIEVLVQGTGGAIRPTPSPDGTKLAYIKRDGFQSSLYLLDLKS
FT                   GKKEKLYGKLDRDMQETWAIHGVYPTMSWTSDNQEIVFWAGGKINKIDVESKSVKQIPF
FT                   SVKTELAVQPAVRFKQDLDKDVFDVNMLRMAQVSPDGKKVVYEALGKLWIKSLSNKSDK
FT                   HSRLTKLDSELRELYPQWSRDSRSVVFTTWDDQQQGTVKVVSVRNKRSKTLTKEPGKYV
FT                   EPTFSPDGSFVVYRKAKGGYITPKTWSQNTGLYKVDIQGKQNTRITPDGYQPQFGADSE
FT                   RVYFMDQGETPEFASINLDGFQKRVHYTSKLGTEFRISPDGKQLAFAERFKVWVTPFAK
FT                   HGETIEIGPKASNLPVSQLSVRAGESISWNGNSDQLYWTLGPELYQMSVDIEYKDQRKT
FT                   NNDEQTNSDIAKVEPKITDLGFTQKADVPRGTIAFVGGKIITMEDDKVIENGVVIIKDN
FT                   KIISVGDSSTQIPSEATVIDIKGKTLMPGLFDAHAHGAQGEEEIIPQQNWELYSNLSLG
FT                   VTAIHDPSNDTTEIFAASEQQKAGNIAGPRIFSTGTILYGANGPGYTSHIDSLDDAKFH
FT                   LERLKKVGAFSVKSYNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLTMIVDGHTGI
FT                   EHSLPAASIYNDIKQLWSQTEVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPS
FT                   DLLDARSMRRPTAPDEHYNHFNVARVANEMNDLGVKPNIGAHGQREGLAAHWEMWMFAQ
FT                   GGMSNLEVLKTATINPAKHFAMDHQLGSIKQGKLADLIVIDGDPLEDIRVTDRVTYTMV
FT                   NGKLYNAETMNQLNGGSKNRGKERKPFFFEH"
FT   CDS_pept        complement(48942..49082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00016"
FT                   /db_xref="GOA:D4ZD94"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD94"
FT                   /protein_id="BAJ00016.1"
FT                   /translation="MTGLALFIELALLCYSYCFYASSFIITASLTPALKPKSYNSCKKS
FT                   S"
FT   CDS_pept        complement(49102..49542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0046"
FT                   /product="MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00017"
FT                   /db_xref="GOA:D4ZD95"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD95"
FT                   /protein_id="BAJ00017.1"
FT                   /translation="MSTLIAIGFKPIKQQPMTLVTKANVTCSHGVEQDFFGRPGKRQVT
FT                   VMSKEQWLNVCCELDTMLPWTTRRANLLVEGLSFTPAHVGKILEIGDLKLEITGETDPC
FT                   KKMEISHAGLEAALTPDWRGGVTCRVLNDGVIREGDAVLLIS"
FT   CDS_pept        complement(49577..49810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="SVI_0047"
FT                   /product="SirA protein homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00018"
FT                   /db_xref="GOA:D4ZD96"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD96"
FT                   /protein_id="BAJ00018.1"
FT                   /translation="MNQADHHLDAIGLRCPEPVMMVRKSVRKMEAGETLLIIADDPATT
FT                   RDIPSFCEFMDHKLISSSTDKTPYQYLIQKGL"
FT   CDS_pept        complement(49977..50444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00019"
FT                   /db_xref="GOA:D4ZD97"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD97"
FT                   /protein_id="BAJ00019.1"
FT                   /translation="MTPAINALKKAKIEFVIHEYHHQPGCDSYGLEAAEKLGLQLEQVF
FT                   KTLVVQLDGKQLVVAIIPVDSKLNMKLIAKAAQAKKAAMANADDVQRSTGYKLGGVSPI
FT                   AQKKTLKTYIDISAENHLQIYVSGGQRGLDIELAPEQLQLITKARLAALTN"
FT   CDS_pept        complement(50441..50971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0049"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00020"
FT                   /db_xref="GOA:D4ZD98"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD98"
FT                   /protein_id="BAJ00020.1"
FT                   /translation="MELVLLADKPEAIPQIAKWYNDEWGTPTLNQGANDSSRSTLTLES
FT                   KLKDYLNRDKLPQILLATHQDEGCGTQVIASAQLRFQEMTTYPETSHWLGGVYVDKAHR
FT                   GKAIGQCLINGILDLARQHQVSELYLQTEDHSGGLYKKMGWKAVEQVTYHGVKVLVMKL
FT                   KLNDFYCEQQRQA"
FT   CDS_pept        51312..52139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00021"
FT                   /db_xref="GOA:D4ZD99"
FT                   /db_xref="InterPro:IPR007876"
FT                   /db_xref="InterPro:IPR038531"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZD99"
FT                   /protein_id="BAJ00021.1"
FT                   /translation="MKQSLALLISISLCACSAIPVKKESGRVDTNFDFGAQSASVDKKI
FT                   AIVKPTGVFTVYQQMVSNQNSMLVNLGVRQERKDSFVQVRDHYNQEVRKAFQNGVEILI
FT                   TRKGFTYTGPYETFDEITYGDKKNSYLAIVPKFDIKVGKADVKRKSFSSYAQEKGFIKI
FT                   DGSFVLKFIEPLTGQVMAQKRVDLSSLNIAEPYITQWETKASGGGLISGAIGGAIKHAS
FT                   KPDVLVDNVEKAYANAMTKFYQGSMKQLVKYVSTEEINSFEADVKELKGIKRY"
FT   CDS_pept        complement(52212..53375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA-1"
FT                   /locus_tag="SVI_0051"
FT                   /product="fatty oxidation complex, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00022"
FT                   /db_xref="GOA:D4ZDA0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA0"
FT                   /protein_id="BAJ00022.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKALIKRNPKL
FT                   DPNTIEDVIWGCVQQTLEQGFNIARNASLLAGLPKQIGGVTVNRLCGSSMDALHQAARA
FT                   IMTGQGDTFIVGGVEHMGHVPMNHGVDFHPGLASNVAKASGMMGLTAEMLGKMHGITRE
FT                   QQDEFAVRSHKRAHAATVEGRFANEIHPIEGHDTNGALITVEHDEVIRPETTMESLSGL
FT                   RPAFDPANGTVTAGTSSALSDGASAMLVMEEEKAKALGLPIRARILSMAVAGCDAAIMG
FT                   YGPVPATKKALERAGLTIEDLDVIELNEAFAAQSIPCMKDLGLMDVVDEKVNLNGGAIA
FT                   LGHPLGCSGTRISTTLINLMESKDAKYGLATMCIGLGQGIATIFERP"
FT   CDS_pept        complement(53394..55547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB-1"
FT                   /locus_tag="SVI_0052"
FT                   /product="fatty oxidation complex, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00023"
FT                   /db_xref="GOA:D4ZDA1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA1"
FT                   /protein_id="BAJ00023.1"
FT                   /translation="MIYQSPTIQVELLEDNIARLCFNAPGSVNKLDRETINSLNAALDA
FT                   IQQNSDIQALVLTSGKGAFIVGADITEFLGLFAQDDSVLLPWIAEANVVFNKLEDLPFP
FT                   TISAINGFALGGGFETVLATDFRIADTTARVGLPESKLGLVPGFGGTVRLPRLIGADNA
FT                   LEWITSGKDQRPEAALKVGAIDAIVAPENLQASAIQMLKDAVAEKLDWQTRRARKQAPL
FT                   TLPKLEAMMSFATAKGMVFKIAGKHYPAPMTAISVIEKAANLGRDEALKIEHQAFVKLA
FT                   KTDVTQALIGIFLNDQLVKGKAKKAGKLAKKVDTAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLGEASKLLAAQIKRGRSTPEKMAKVLNNITATLDYAPVKDVDLVVEA
FT                   VVEHPKVKSMVLAEVEQHVADDAIITSNTSTISINLLAKALNKPERFCGMHFFNPVHKM
FT                   PLVEIIRGENSSEETIATVVAYASKMGKTPIVVNDCPGFFINRVLFPYFAGFCGLLADG
FT                   GDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMAKDGKDAIDIMF
FT                   GAERFGQKNSKGFYAYSVDRRGKPKKDVDAVSYELLGAEFGELKQFESDEIIARTMIPM
FT                   IIETVRCLEEGIIASPAEADMGLVYGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRELAANNGSYYQSK"
FT   CDS_pept        55835..57154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="SVI_0053"
FT                   /product="prolidase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00024"
FT                   /db_xref="GOA:D4ZDA2"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA2"
FT                   /protein_id="BAJ00024.1"
FT                   /translation="MDKLASHYLAHIAELNRRVTDIVTRGNLSGLVIHSGQPHRQFLDD
FT                   IDYPFKVNPHFKAWLPILDNPHCWLLVNGRDKPQLIFYRPVDFWHKVADVPDAFWSEHV
FT                   EIKLLTKADKVAELLPRDISKWAYIGEHLDVAEVLGFKTRNPDAVMSYLHYHRATKTQY
FT                   ELECMRRSNEIAVQGHVAAKNAFYNGGSEFGIQQEYLKASCQGENEVPYGNIIALNQNA
FT                   SILHYTKLEHASPHPRKSFLIDAGANFFGYASDITRTYAFEKNIFSDLIEAMNKAQLEL
FT                   VDMMRPGLKYVDLHIETHKKIAQIMLDFNMASGDVEGLVEQGITAVFFPHGLGHMLGLQ
FT                   VHDMGGYLHDERGTHIAAPDAHPFLRCTRTLAVNQVLTIEPGIYIIDSLLDGLKQDKRQ
FT                   AQINWNTIDELRPFGGIRIEDNVIVHGDRNENMTRDCGLA"
FT   CDS_pept        57248..57865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00025"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA3"
FT                   /protein_id="BAJ00025.1"
FT                   /translation="MIDSYQIPSVDLVVEEEIKHSRFISFLFHCQSTDELKCVLTKVRA
FT                   EYPGANHYCYAFVSAEPGNSMAIGSSDDGEPAGSAGRPMLATLQGSNVGEIGAIVVRYF
FT                   GGTKLGVGGLVRAYSSGVRQGLIQLQTQLKQIRYPGLLECEYSQLQDVEYLLNLCDGVI
FT                   SDRCFTDKVLVTFELPKRYQDKLNTDLATMSQGKLKANFELE"
FT   CDS_pept        58020..59477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH-1"
FT                   /locus_tag="SVI_0055"
FT                   /product="potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00026"
FT                   /db_xref="GOA:D4ZDA4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA4"
FT                   /protein_id="BAJ00026.1"
FT                   /translation="MQYRTIIRITGLLMGLFSLSLLPPALVAVIYKDGGGTAFIQAFVL
FT                   SLFLGFILWYPNRRHKKDLRTREGFLLVVLFWGVLGSIGAVPFIFSSQPDLSITDSFFE
FT                   SFSALTTTGATVIVGLDYLPKAILFYRHLLQWLGGMGIIVLAVAILPVLGIGGMQLYRA
FT                   EMPGPVKDSKMTPRIAETAKALWYIYFLLTVACAFSYWVAGMNVFDAICHSFSTIAIGG
FT                   FSTYDASIGHFDSPAINMVCVVFLLIAALNFSLHFAAFTRRGINLRVYFKDAEFKVLII
FT                   VQLVLTGICFATLYHTGIYDSPEETFDYALFQAVSISTTAGFGTESFHMWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVMRMILLLKQGSRELKRLVHPRGMFSIRIGNKALPDRVIDAV
FT                   WGFFSAYALVFVICMLALLAMGMDNISAFSATAACLNNLGPGLGEVASNYASINDGSKW
FT                   ILLLAMLFGRLEVFTLLVLFTPTFWRS"
FT   CDS_pept        59590..60117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00027"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA5"
FT                   /protein_id="BAJ00027.1"
FT                   /translation="MSNTLIIYSTVDGQTKAICELMQGISESAGDSVTLTSLEGAQGLN
FT                   LSYFDKIMIGASIRYGKHRPELYQYINRHQAVLNAKKNAFFTVNVVARKPEKNTPETNP
FT                   YMKKFLSLSLWQPQQLGVFAGKIDYPKYRFLDKTMIRFIMWMTKGPTDTSGTYDFTDWQ
FT                   RVEEFAKAFAGR"
FT   CDS_pept        60259..60378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00028"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA6"
FT                   /protein_id="BAJ00028.1"
FT                   /translation="MDDQGVSMDTSGTYDFTDWQRVEEFAKASSVDSSSCDEN"
FT   CDS_pept        complement(60430..60747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0058"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00029"
FT                   /db_xref="GOA:D4ZDA7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA7"
FT                   /protein_id="BAJ00029.1"
FT                   /translation="MSTDMQKDIDVDAMVTNAENAAKWLKAIANPNRLMILCLLLDNEL
FT                   SVTQLNDTVPLSQSALSQHLAVLRTQDLVSTRKSSQMVYYTLKNSQVTEIISIMHKQFC
FT                   A"
FT   CDS_pept        complement(62123..63565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH-2"
FT                   /locus_tag="SVI_0059"
FT                   /product="potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00030"
FT                   /db_xref="GOA:D4ZDA8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA8"
FT                   /protein_id="BAJ00030.1"
FT                   /translation="MLNFRPLLFILGIFLSTLTVFMFIPLIFALIYGEETVGAFMISSL
FT                   VTATVATACMHQGKSKQLNLNIRDMFLLTSLTWLIVSVFAAMPFTLYHGINYTDAFFET
FT                   MSGITTTGSTVLSGLDSMDHSILIWRSLLQWLGGIGFIVMAVAVLPFLNVGGMRLFRTE
FT                   SSDWSDKAIPRTQDMAKNLFYIYILLTVLCGFAYHMAGMDWFQAINHAMTTLSTGGYST
FT                   SDSSMAAFSNNAHWVGIFFMAAGGLPMLMFVNCIQQRSLLVWNDAQVKGFLLFIFTVSS
FT                   CLAFWLWSSREIEPIDAMRLASFNVVSVVTTTGYGLTDYTAWGALANVTFLFLMFAGSC
FT                   SGSTSGGIKIFRFQIAIAIMREQLKQQFHPNGVFRQRYNNRPIGDDIVRSLVTFILLFM
FT                   FVIIALSVILVMTGLDPTTSFTGAITAVTNVGPGLGDIIGPAGNFSSLPDVAKWALAIG
FT                   MLLGRLEILTVAVLFHPGFWKY"
FT   CDS_pept        complement(63643..65052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="SVI_0060"
FT                   /product="potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00031"
FT                   /db_xref="GOA:D4ZDA9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDA9"
FT                   /protein_id="BAJ00031.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDNDKNRLRSLQDKYDL
FT                   RVVVGHGAHPDVLKEAGAEDADMLIAVTNSDECNMAACQIAYTLFGTPTKIARIRSEQY
FT                   LALKDKLFLSSETKQSDNRTRGGFIIDELIAPEQLVTSYIRRLVEYPGALQVLEFAEGR
FT                   LSLVAVKAYYGGPLVGNALATLREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   LADSRHVRAVMSEMQKLDNSYRNIMIAGGGNIGMGLAKQLQRNHSVKLIEHRQERAEEL
FT                   SERLENTTVFCGDASDQELLLEENIDQTDVFIAVTNDDEANIMAALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SKTSKVVGKKIGDIKLPPGTTIGAIVRDEEVLMAHDKTVIEQGDHVILFLVNKKFIGEV
FT                   EKLFQPSAFFF"
FT   CDS_pept        complement(65062..66339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="SVI_0061"
FT                   /product="ribosomal RNA small subunit methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00032"
FT                   /db_xref="GOA:D4ZDB0"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB0"
FT                   /protein_id="BAJ00032.1"
FT                   /translation="MNLRALAAKVAFQVLEKGISLSVALPDQQKHLESGKDKALLAELS
FT                   YGVMRHLPQLDKLVSDCMSKPLKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGLVKVVNGVLRNIQRQEKPLPTDNDTLAFNTPSWIVKRLKAAYPENWQEVIEQS
FT                   HQRPPMWLRNNKRSQTRDEYLAALAEIDIPASAGKSSDAILLESPRDVAQLPGFDQGAA
FT                   SVQDGAAQWAATLLAPKDGELVLDACAAPGGKTCHLLELANIQLVAVDFDEKRLERVQQ
FT                   NLDRLSLDAKLVHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQSDID
FT                   ELAALQSKILDHCWQWLKPGGTLLYATCSILPQENEQQIRSFLERADDATLIPISEQPH
FT                   PDDIGWQITPGTENMDGFYYARLVKG"
FT   CDS_pept        complement(66339..67298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="SVI_0062"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00033"
FT                   /db_xref="GOA:D4ZDB1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB1"
FT                   /protein_id="BAJ00033.1"
FT                   /translation="MKPLNIVFAGTPDFAARHLQALIDSEHNVIGVYSQPDRPAGRGKK
FT                   LQASPVKILALEHDIPVYQPKSLRDEAAQQELSGLNADLMVVVAYGLILPQVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDKETGITIMQMDIGLDTGDMLLKTQLTIQDDDT
FT                   SGSLYDKLALQGPDALIQALTGLAKGELQAEKQDETLANYAKKLSKEEAELDWNKPALQ
FT                   LWREIRAFNPWPISHFSHNDASIKIRQAKVSESISDAPAGTIISADKNGIEIATGEGVL
FT                   SLQNMQLPGKKPLSVGDILNSRGDWFTPGTRLKNKEAS"
FT   CDS_pept        complement(67306..67818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def-1"
FT                   /locus_tag="SVI_0063"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00034"
FT                   /db_xref="GOA:D4ZDB2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB2"
FT                   /protein_id="BAJ00034.1"
FT                   /translation="MSLLKVLRFPDERLRTFAKPVTEFNTGLQTQIDNMFETMYEEKGI
FT                   GLAATQVDYHRQLIIMDLQDEEERPKVFINLEIVASSGHFSNEEGCLSVPGIYADIERA
FT                   EHVTIKALDRDGNEFTLEADGLLAICLQHELDHLKGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLEAKQG"
FT   CDS_pept        68000..69100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0064"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00035"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB3"
FT                   /protein_id="BAJ00035.1"
FT                   /translation="MGTPMKRLILLGLILLNCSFVFADTLTLKSGHPDSYVVKKGDTLW
FT                   DISAHFLKDPWRWPKLWGVNPQIANPHLIYPGDRLTLVFIDGEPRLVVKPHIRKSPQGR
FT                   IMAKDSAIPAIDLALIRPYLVQNRVVDSDWFETQPMVLGGESDSRLHVVGDVIYIQAEL
FT                   TMGDKFGVYKQGREFNSEEGDSLGVEVILTASGRVIESGPISKVKLLSNFRETVAGSRV
FT                   LLIEEDSLMSAYFVPRAAKISSPASVLASEKHYREMGKLDVLYLDKGREDGVETGHVFS
FT                   IFRDGEDIVINGDGQPVLPQERSSYEAMFSSVSSTNSIKMPDIYRGKLMVFKVFDKTSM
FT                   GLIMINERPVRVADKLVTPDSLLISE"
FT   CDS_pept        69295..70314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0065"
FT                   /product="DNA processing protein DprA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00036"
FT                   /db_xref="GOA:D4ZDB4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB4"
FT                   /protein_id="BAJ00036.1"
FT                   /translation="MDVEELRQMLEHEPDALPLPESLLKRSLTPDFARVESALLWQQAA
FT                   DNHYILTLDDPDYPHLLKQIIDPPTIIFVKGDLHGLKFPGIAIVGSRAASQTGLQVAYR
FT                   LASEITSLGFAVVSGMAVGIDGSAHQGCIDNDGRSLAVLGSGVDVIYPRRHRTIYEEIQ
FT                   HHGAIVSEFWPGTQAFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITAKLALDQGREV
FT                   FAVPGNILAGQSQGCHDLLKDGAKLVENAADIIEEVTALSEFHLEELRKRHHIEEVKAI
FT                   DLPFASLLASVGYETTTIDDVVEHSGKAIDLVLEQMLELELQGWVAVVPGGYIRLKRS"
FT   CDS_pept        70317..70790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smg"
FT                   /locus_tag="SVI_0066"
FT                   /product="smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00037"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB5"
FT                   /protein_id="BAJ00037.1"
FT                   /translation="MFDILMYLFENYVHSEVEFLVDEDELTQELTRAGFHQSEIIKAIS
FT                   WLEHLAELQEGDTPYLCDHAQHSFRIYTQNEMDKLDVECRGFLLFLEQIKVLSVITREM
FT                   VIDRVMELDEPMLILEDLKWVVLMVLFNVPGNESAYEKMEDLIFEQPDGRLHS"
FT   CDS_pept        complement(71093..72892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0067"
FT                   /product="collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00038"
FT                   /db_xref="GOA:D4ZDB6"
FT                   /db_xref="InterPro:IPR002169"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB6"
FT                   /protein_id="BAJ00038.1"
FT                   /translation="MQKYNRMNLMLRKSVLALAIALPALVGLSACSTSPQIITDTSLLQ
FT                   KITQASDESLFDASSPLLTQSAFEQVAARLNTTASLSEANSLLYYLRAFSYFGPVDELD
FT                   DNSFTLLTSGLSNLASSEIFVSSARLQEQFAVTLYRYYANNEQASALARLIPLLDNQFI
FT                   QLAKSPSDQENDYALWETLRAYGLLLNVARKDSEGELNKLLLGLELDKTLLAFSGSDNS
FT                   IRNDKDWPKRNAYWALGLYRLALPASEDANATEDEATLDKAVADIARQDISVRGDAAKD
FT                   AYTLGYHVNSFAGLEECEKNSDICRIPELSEVLPIEHHCTDGLFILAQDLNEQELAISC
FT                   TKLTSQESNFHTLLETNNQPTANDFNDALRVIAFKNWSQYNAYGQLLFDISTDNGGMYI
FT                   EGTPSKPGNQATFFAYRQFWIQPEFAIWNLNHEYVHYLDGHFIKYGGFGHFPEKMVWWS
FT                   EGLAEYISKGDDNAKTLSIVKKKLDEAPSLEEIFATEYKDGLERTYSWSYMAIRFLAEN
FT                   YHKDFVQLSQYLKTDYFEGYEELLAELTQHQDEFSSWLGARAEQFDDSEDQAKPRLHKQ
FT                   NRYSYRDYLAPLHLIKDGAHKHY"
FT   CDS_pept        72993..73556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0068"
FT                   /product="DNA topoisomerase I-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00039"
FT                   /db_xref="GOA:D4ZDB7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB7"
FT                   /protein_id="BAJ00039.1"
FT                   /translation="MSKIDDQLFSSHEHALEKEYELCPKCGSELSVRHSKHGGFIGCNS
FT                   YPVCDYTRPLVQHESIETQVIPGSECPECGHELAVKSGRFGIFIGCTNYPDCKHIEKHD
FT                   QEEPEDQIACPSCNTGKIEHRTNRFGKGFYACSGYPKCKFLVNYPPVAEACPECDFGIL
FT                   VERKGAAGSRLECPKKTCKYKRAI"
FT   CDS_pept        73658..74215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0069"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00040"
FT                   /db_xref="GOA:D4ZDB8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB8"
FT                   /protein_id="BAJ00040.1"
FT                   /translation="MLQLDPSETSEVIENGGVIAYPTEAVYGLGCDPDNDVAIEKLLAL
FT                   KQRPWQKGLILVASDYSQIAPYLDDTQLTEKQLAFAFSKWPGPFTFIMPIRSDISKLLC
FT                   GNFNSLAVRVSAHPGIQAICNKLGKPLVSTSANITGQQPAMSVDEVTMQFEGVIAGVVT
FT                   GKLGCEANPSTIIDALSGKVLR"
FT   CDS_pept        74320..75237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="SVI_0070"
FT                   /product="coproporphyrinogen III oxidase, aerobic"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00041"
FT                   /db_xref="GOA:D4ZDB9"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDB9"
FT                   /protein_id="BAJ00041.1"
FT                   /translation="MPVPDISAVKSFLLALQQQICEGLEQLDGKGVFKADSWEREEGGG
FT                   GTSRVLTKGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYI
FT                   PTTHANVRFFIASKEGADPVWWFGGGFDLTPYYPFEQDVIEWHQHSKSFCDPFGDEVYP
FT                   KYKKWCDEYFYLPHRDETRGVGGLFFDDLNQEGFDTSFEFMQAVGTGFLTAYAPIVKRR
FT                   KDTEYGEKERDFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWEYMYT
FT                   PEAGSPEALLYTDFLKPRDWLGLN"
FT   CDS_pept        75259..75414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00042"
FT                   /db_xref="GOA:D4ZDC0"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC0"
FT                   /protein_id="BAJ00042.1"
FT                   /translation="MAQALTETYAYATSPRNQVRWEYMYTPEAGSPEALLYTDFLKPRD
FT                   WLGLNK"
FT   CDS_pept        75438..75593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00043"
FT                   /db_xref="GOA:D4ZDC1"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC1"
FT                   /protein_id="BAJ00043.1"
FT                   /translation="MAQALTETYAYATLPRNQVRWEYMYTLEAGSPEALLYTDFLKPRD
FT                   WLGLNK"
FT   CDS_pept        75826..76650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="SVI_0073"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00044"
FT                   /db_xref="GOA:D4ZDC2"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC2"
FT                   /protein_id="BAJ00044.1"
FT                   /translation="MTDRYAVFGNPIAHSKSPFIHGLFAEETDQVLKYEALLAPIDGFE
FT                   KSLSEFWLNKGKGANVTVPFKEQAFNLCDELSELAQLAGAVNTLTLLENGRVRGDNTDG
FT                   LGLVADLERNFGSLAGKRVLLLGAGGAARGCILPLLNAEVAELCIHNRTHKKAEVLAEL
FT                   FAEYGNISHIATNELTASFDIIINSTSSSLSGDVPQIPESVIDRDTNCYDMMYSKQKTA
FT                   FNTWASSLGATSVVDGLGMLVGQAAKSFELWRGVKPEVLTALDALRIKLDAE"
FT   CDS_pept        76647..76910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00045"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC3"
FT                   /protein_id="BAJ00045.1"
FT                   /translation="MNQSVLFPDLQDWNDTKQEVVFPAQVQGANIQCRISLPRLTKLHG
FT                   EELTGEVEVLAAFEVCRFDIEDYFEELIEQEMFDEDGGVSWC"
FT   CDS_pept        complement(76976..77530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0075"
FT                   /product="carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00046"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC4"
FT                   /protein_id="BAJ00046.1"
FT                   /translation="MPVSLRAYKGVSPQFDDSVYLDDACVLVGDIFLDTDSSIWPLVAA
FT                   RGDVNHMRIGKRTNVQDGAILHVTRKSPSNPDGNPLLIGDDVTIGHKAMLHGCTVGNRI
FT                   LVGMGAIILDGAILEDDVILGAGSLVPPGKVLKSGHLYVGSPAKQVRTLTEAELRFLPQ
FT                   SADNYVRLKNEYLNEEIVTPV"
FT   rRNA            78082..79626
FT                   /gene="rrsA"
FT                   /locus_tag="SVI_r001"
FT                   /product="16S ribosomal RNA"
FT   rRNA            79951..82855
FT                   /gene="rrlA"
FT                   /locus_tag="SVI_r002"
FT                   /product="23S ribosomal RNA"
FT   rRNA            83011..83130
FT                   /gene="rrfA"
FT                   /locus_tag="SVI_r003"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        84125..84874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0076"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00047"
FT                   /db_xref="GOA:D4ZDC5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC5"
FT                   /protein_id="BAJ00047.1"
FT                   /translation="MSKIITSIKENVLIISIHRSEAKNAINQEMYRDLNDALRSAMTNA
FT                   SVRSILIKGLPEIFCAGNDMKDFVAMARGEPDKYAGGFMKSLITCYKPVVASVSGFAIG
FT                   IGTTMLQFVDFLYVSPTAMFQTPFVPLGLCPEFASSIRLEQIIGMRKARAMLLSGETMA
FT                   AEESVALGFSTKMVENPDEVAFDKAAELALMAPNAMQKTKELLTSQCPLFVDAIEIENK
FT                   ALLDLVTKSEAKEAITAFFEKRKPNFV"
FT   CDS_pept        complement(85145..86188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0077"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00048"
FT                   /db_xref="GOA:D4ZDC6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC6"
FT                   /protein_id="BAJ00048.1"
FT                   /translation="MIVNENKAHQSLSLHKGWNTLLEAASISLGLNDSLETSNKPAAHQ
FT                   DRYHLFDIRKKLYRLFEHSQDRYLPIKIAERVNPLTFGSYSLTLWTAPDLETLLKLAAK
FT                   YSAVISAPIRLRYHTTPQGDAELWVVNNEPLYKETHISYMGATLFIVTFSKILKEITAN
FT                   DKLKIQIQMVLNYFDDSAQKEYELRTKIKITTGHPIRKICIPKRHLYQSLPSSEPDIHF
FT                   TALSLLRKEAEKIEKDDLILKIYNVLGETDCLFNLTGKGLAAKLNMNIRTLNRHLSNYH
FT                   TSYRGVVEKYKMERALYLLENTDENMTEITYQLGFTDLSTFSRAFKRWTGQSPTNIRTN
FT                   KTFKLEI"
FT   CDS_pept        complement(87187..87384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00049"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC7"
FT                   /protein_id="BAJ00049.1"
FT                   /translation="MNYTVFQKPEGFRSLHIAMVTQWFIELNFDCSSFTRKSEAISNNS
FT                   TPVSVHTDFLFCIVKERGAK"
FT   rRNA            87428..88972
FT                   /gene="rrsB"
FT                   /locus_tag="SVI_r004"
FT                   /product="16S ribosomal RNA"
FT   rRNA            89279..92183
FT                   /gene="rrlB"
FT                   /locus_tag="SVI_r005"
FT                   /product="23S ribosomal RNA"
FT   rRNA            92339..92458
FT                   /gene="rrfB"
FT                   /locus_tag="SVI_r006"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(92549..92665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00050"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC8"
FT                   /protein_id="BAJ00050.1"
FT                   /translation="MDKSPAYIDVDMGTDKFELNSQNIIKSQTQKSHLNKVA"
FT   CDS_pept        complement(93252..94220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldB"
FT                   /locus_tag="SVI_0080"
FT                   /product="lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00051"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDC9"
FT                   /protein_id="BAJ00051.1"
FT                   /translation="MNDRVNIQTKPLSSELMLNTQEQQAFWDRVTESEIKTSDNISLAY
FT                   MYIEHPGSERAIVISNGRIESYLKYKELIFDLYNQGYSVFAVDHRGQGLSTRTTSNPHH
FT                   GYIDKFSSYIDDLAFFIDAVVTPKQYRSLFLVGHSMGGAIGTLYMDKYPNTFTAAVFSA
FT                   PMYGIKLPLCSRFIRWLANLLDTKDNAEPNYVLGGKDYHADDFPKNDLTSSQARYEDYR
FT                   HLYQLRPELQLGSPTNHWLVESIDVGPKLVEAARHSTTSILILQAEMDTVVDNLAQNHA
FT                   VGGQCQLVKIPNARHEIFMEKDDIRNFAVEALLKFLAIHQA"
FT   CDS_pept        complement(94334..96154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00052"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD0"
FT                   /protein_id="BAJ00052.1"
FT                   /translation="MRKIFAPSLLVIALSACQINPASTESALVFASTENSITYNPVTVG
FT                   VSDPRLKAIIETDWQIKLDSDPSQAFSEGDASAAGKLPDLSPENLANLNQRKQTLVTTL
FT                   KALDKDSLSKEDKINAQILQGQLQNSVDLYRYKDHYLPITAESGFHAYIASIAKARFAT
FT                   VQDYDNYIAKLSNLASYFAQQTYWLKQGLKSGITPPRVTLNGFEDSISAFMVPVKDSGY
FT                   FEPFTQYPKHFTQVQKDALTAQGKIIIEQKVLPLYQAFYDFMTKEYIPGARTDIACASL
FT                   PDGAAFYENRVRYYTTLDMTSDEVHQLGLKEVKRIRGEMQAIIDSLGFKGSFAEFLHFL
FT                   RTDPRFYPKTAEELLKEAAFIAKKADAMLPKYFGKLPRTPYGIQAVPAEIAPKYTTGRY
FT                   SGSNRDDEAGYYWVNTYALDKRPLYELEALTLHEAVPGHHLQISLNKELTKLPNFRRYS
FT                   YISAFGEGWGLYSEYLGLEAGFYQDPYSNFGRLTYEMWRAARLVVDTGMHAKSWSRQRA
FT                   LDFMAGNTALSMHNVTTEIDRYISWPGQALSYKIGELTIKRLRNQTEAELGDKFDIRAF
FT                   HDAILENGSVPMSVLEQQITDFISYQKQQK"
FT   CDS_pept        complement(96324..97700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="SVI_0082"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00053"
FT                   /db_xref="GOA:D4ZDD1"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD1"
FT                   /protein_id="BAJ00053.1"
FT                   /translation="MKQPTQISWDQSMVEKYNYSGPRYTSYPTALEFDDSFTEEKLLTS
FT                   IKNSKSDKLSLYIHIPYCAKICYYCGCNKVITRHQHKADQYLEYLATEIIKRAPLFKDY
FT                   LVTQIHWGGGTPTFLRPDQILNLSELIKANFNVAEVGEYSIEVDPREIELTMLDTLKEA
FT                   GFNRISIGVQDFNKKVQIAVNREQDEQFIFDLMAKAKELGFVSTNIDLIYGLPHQTPAT
FT                   FAETMQRVLDLDPDRLSVFNYAHLPSRFAAQRKIKDEDLASPQQKLEMLHQTIETLTGA
FT                   GYQYIGMDHFAKPDDELAILQNEGRLHRNFQGYTTQEECDLLGLGVSSISQIGDCYAQN
FT                   QKDIRPYFESIDANGHALWKGCDLNRDDEIRRVVIKQLICHFELDMAQIDDKLDIQFED
FT                   YFHEDLKLLQTFIDDKLVNIADRKITISPTGRLLIRNICICFDIYYREKARQQQFSRVI
FT                   "
FT   CDS_pept        complement(97941..98408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0083"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00054"
FT                   /db_xref="GOA:D4ZDD2"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD2"
FT                   /protein_id="BAJ00054.1"
FT                   /translation="MTTTLIVIGFIIIAALTGYAIALLLKLRKQSSQKKKHQQELADIN
FT                   QARQDEHLNSIRYIATAMLEDRCELSEGVMRIAKLFSILSMSEQVEARYPAIFKHFAII
FT                   QDHPIMDKRKTLEKQQRMKLDFSRMRSEAELETEILEEAKQLISFTPSQLH"
FT   CDS_pept        complement(98482..99027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0084"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00055"
FT                   /db_xref="GOA:D4ZDD3"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD3"
FT                   /protein_id="BAJ00055.1"
FT                   /translation="MSHSKKTRKANENAPKLAPRTKKSDRGLEGKKKKSGNKAGSRHNA
FT                   NMVGGSDGSTSSRKDPRHGSKKAIKLDLPSQVQVIAPKKDQGPKLTDEQKLFKLEEDPR
FT                   LNQLLDMLEEGKELGQDDQKWLNKTLNQIEALMDRLGITEEEDLGQIVQSTPTVSDDDL
FT                   LDKFESGADLLKDYQNKD"
FT   CDS_pept        complement(99076..99753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00056"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD4"
FT                   /protein_id="BAJ00056.1"
FT                   /translation="MLRCPLCHNENTSLFNQDRKRSCYICHHCQLVFSDANSHLPPQVE
FT                   KKRYQLSASKYQKPLKQFLLSLIQQIAQETEHPLTGLNFGRLADTQTLDTISAQGHELR
FT                   QYDPYFCPDRSLLKQEYDFICCYRVFEHFRFPFKEWSLLCKLLKPGAWLAINTKLLTEI
FT                   HAFERWHHKNNLTHVSFYQTDTFEFLAEQAGFKLLFAANDLILVQKPSGSDIKRGQSSL
FT                   IDL"
FT   CDS_pept        complement(100493..101113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cytcB"
FT                   /locus_tag="SVI_0086"
FT                   /product="soluble cytochrome cB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00057"
FT                   /db_xref="GOA:D4ZDD5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD5"
FT                   /protein_id="BAJ00057.1"
FT                   /translation="MKKLALALSVLACISSPAMAEGNAEVGKTKAIVCSACHGVDGNSV
FT                   IDMYPKLAGQQASYLMKQLHDFRSAAKTGGKEGRNDPIMGGMAMMLSDQDIEDVAAYYS
FT                   SQTKSAVEVKDIPALGEQLYKGGDMTRGITACIACHGPEGAGVELAGFPAIGGQHANYL
FT                   KIQLNKFSDTNRNNDLNGMMQDIAKKLTSDDIEALSKYISSLK"
FT   CDS_pept        101282..101986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="SVI_0087"
FT                   /product="GTP-binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00058"
FT                   /db_xref="GOA:D4ZDD6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD6"
FT                   /protein_id="BAJ00058.1"
FT                   /translation="MTESRIDFRKAKFLISAPDIAHLDEYLPGDAGIEIAFAGRSNAGK
FT                   SSALNLITDQKSLARTSKTPGRTQLINVFELDEHRRLVDLPGYGFAQVPLALKKKWQKA
FT                   LGEYLQERKCLGGMVVLMDIRHPLKDLDMQMIEWAVESDIPVLALLTKADKMKQSERMK
FT                   MVNEVRKHLADFDDRVKVEPFSSLKGIGKAKVLDILNTWCHPQWLIDALAEAEAEEAAE
FT                   EKNSASHSEAKG"
FT   CDS_pept        complement(102764..105517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="SVI_0088"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00059"
FT                   /db_xref="GOA:D4ZDD7"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD7"
FT                   /protein_id="BAJ00059.1"
FT                   /translation="MPKIAENPLVLVDGSSYLYRAYYSPPHLTNSKGEATGAVYGVINM
FT                   LRSLLKQYEPTQMAVVFDAKGKTFRNDMYEDYKAQRPPMPDDLRTQIEPLHRIIRAMGL
FT                   PLVCISGVEADDVIGTISTQASKSGRAVLISTGDKDMAQLVDENVTLINTMTNTIMGPA
FT                   EVTEKFGVGPELIIDLLALQGDKSDNIPGLPGVGEKTAVAMLTGAGGIDKILAAPEKMP
FT                   ELGFRGSKTMPAKLAEHSEILKLSYALATIKLDVELEQDWQDLTIKPADRDELIECFGE
FT                   MEFKRWLADVLDNKTDSGKSEKNTDEEVIKQDIQTEYTTIYTHEELDLWIDKLANADLI
FT                   AIDTETTSLNYMDAKLVGISFAIEAGKAAYLPLGHDYLDAPEQLDQAEALAKLKPLLEN
FT                   PELKKVGQNLKYDISIFANVGIKLQGIAFDTMLESYVFNSVATKHNMDDLALKYLGHKN
FT                   ISFEEIAGKGVKQLTFNQIDLETAAPYAAEDADITLRLHQHLWPRLEKEPELASVFTDI
FT                   ELPLIQVLSDIERGGVLIDSMMLGQQSGELARTIDELEQKAFEIAGEKFNLSSPKQLQV
FT                   LFFEKLGYPIIKKTPKGAPSTAEEVLVELALDYPLPKIILQHRSLAKLKSTYTDKLPLM
FT                   VNAKSGRVHTSYHQANAATGRLSSSEPNLQNIPIRTEEGRRIRHAFIAREGKKVLAADY
FT                   SQIELRIMAHLSQDEGLLTAFAAGKDIHRATAAEVFDVDFGEVTTEQRRRAKAVNFGLI
FT                   YGMSAFGLAKQLDIPRPEAQKYIDTYFKRYPGVLKYMEETRAEAADLGYVSTLYGRRLY
FT                   LPAIKDRNAMRRQAAERAAINAPMQGTAADIIKKAMINIAHWIATETHGEIDMIMQVHD
FT                   ELVFEVDSDRAEEMQAKVCQLMADAVSLDVELLAEAGIGDNWEQAH"
FT   CDS_pept        105941..106597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="elbB"
FT                   /locus_tag="SVI_0089"
FT                   /product="enhancing lycopene biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00060"
FT                   /db_xref="GOA:D4ZDD8"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD8"
FT                   /protein_id="BAJ00060.1"
FT                   /translation="MKKIAVLLSGSGVFDGSEIHESVLSMLALSKLGVDYQCFAPNILQ
FT                   MHVVNHLTGEVESLQSRNVLVESARIARGEIKATEELELDEFDALIIPGGFGAAKNLCN
FT                   FATNGSDCVIAPEVASFIGQFADSCKPVGFICIAPVMIPLLYGEGVIGTIGNDSETAQA
FT                   FNLMGGKHQAAVVQDIIVDEINKVVSTPAYMLAANIAEASVGIEKLVKKVVEMIG"
FT   CDS_pept        complement(106791..107630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="SVI_0090"
FT                   /product="glpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00061"
FT                   /db_xref="GOA:D4ZDD9"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDD9"
FT                   /protein_id="BAJ00061.1"
FT                   /translation="MVEIGRLPNERAAQALIDYLKGEKIECKILPAEQGVSICVLNDHH
FT                   SIRARQEFDLFIHNPHDPKYLQASWDNGDSKLKLDYGSPSLQLVTQFITGAGPLTLGVI
FT                   FICILVYAGFNLGFAEPIYQQLSFFNAVPGSSLSEFWRLFTPSLLHFSALHIIFNLLWW
FT                   WYLGGKIENKLGLTPLLTLLLVAGTLPNIVQYFVGGPHFGGLSGVVYAVVGYTWIMGNK
FT                   RPELGIGLPPAYMGFMLIWLIFGFTDMFGLSIANGAHIGGLLVGLGQGLIDSKRIKR"
FT   CDS_pept        complement(107658..107966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpE"
FT                   /locus_tag="SVI_0091"
FT                   /product="thiosulfate sulfurtransferase glpE"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00062"
FT                   /db_xref="GOA:D4ZDE0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE0"
FT                   /protein_id="BAJ00062.1"
FT                   /translation="MSNFQHFSVNQLIQLAQTNSDIQIVDIRDATSFASGHVQGAVNLN
FT                   NENLANYVAEADMDKPIIVICYHGISSQGAAQYLVEQGFDDVYSLDGGYQAWHEANA"
FT   CDS_pept        complement(108052..109077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="SVI_0092"
FT                   /product="threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00063"
FT                   /db_xref="GOA:D4ZDE1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE1"
FT                   /protein_id="BAJ00063.1"
FT                   /translation="MKALSKLKPEQGIWMVDAPKPELGHNDLLIKIRKTAICGTDVHIY
FT                   NWDTWAQNTIPVPMVVGHEYVGEVVEIGQEVRGFSIGDRVSGEGHITCGHCRNCRAGRT
FT                   HLCRNTSGVGVNRDGAFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELAKKMGATRTVNVAKEKLED
FT                   VMTEIGMTEGFDVGLEMSGVPSAFHSMLDTINHGGKIAMLGIPGDDMAIDWSKVIFKGL
FT                   IIKGIYGREMFETWYKMASLIQSGLDISPIITHHYKIDDFQQGFDAMRSGQSGKVILSW
FT                   D"
FT   CDS_pept        complement(109275..110468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="SVI_0093"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00064"
FT                   /db_xref="GOA:D4ZDE2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE2"
FT                   /protein_id="BAJ00064.1"
FT                   /translation="MATTSFYNQINQQLAEVKAEGLYKSERIIVSPQQTEIRVNNAEVI
FT                   NFCANNYLGLANHPELIKAAQDGLNAHGFGMASVRFICGTQDIHKQLESSLSEFLGMED
FT                   TILYSSCFDANAGLFETLLSAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMAALEE
FT                   QLKAAKEAGARNILIATDGVFSMDGVIANLKGVCDLADQYGALVMVDDSHAVGFIGQDG
FT                   RGTHEYCEVMGRVDIITGTLGKALGGASGGFTAAKKEVVDWLRQRSRPYLFSNSLAPSI
FT                   VTASIHVLEMLKTGQALRQAVWDNSRYFREKMTAAGFTLGGADHAIIPVMIGDAKLAGD
FT                   FSNRLLEENIYVVGFSFPVVPKGQARIRTQMSAAHTKEQLDKAIESFTRIAKEMGII"
FT   CDS_pept        complement(110754..111410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0094"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00065"
FT                   /db_xref="GOA:D4ZDE3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE3"
FT                   /protein_id="BAJ00065.1"
FT                   /translation="MKTRDKIIHASLELFNEHGERTITTNHIAAHLGISPGNLYYHFRN
FT                   KEDIIRSIFSLYESHLEKSFHPYEGEPVNVELLIGYFDAIFYAMWEFRFMYANLTDILS
FT                   RDDELKKQYLQVQQQVLTRSCHVLIKLEQDGVIAIEPDEIPPLAETIRMIVCFWISYKQ
FT                   THSPDIKITKSSLYEGLLRILMLSKAYATPNSRSTFVRLEQYYQELAEEPSEELA"
FT   CDS_pept        complement(111432..111617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00066"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE4"
FT                   /protein_id="BAJ00066.1"
FT                   /translation="MKSLLVGSAFLTISPNIPHSLQAILKYLTNEFCLMNSVGASMFVN
FT                   QVNKLATLSREASQII"
FT   CDS_pept        111761..113029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="SVI_0096"
FT                   /product="3-deoxy-D-manno-octulosonic-acid (KDO)
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00067"
FT                   /db_xref="GOA:D4ZDE5"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE5"
FT                   /protein_id="BAJ00067.1"
FT                   /translation="MNRFFYSVLLYLLLPLLVLYLAIRAIKSADYRGRWGERFGLTSLK
FT                   QSDLLIHCVSMGETLAAIPLIKAIQAAFPQLTITVTTTSPTGSAEVVKAFGSSVQHCYL
FT                   PFDISICVRRFLKQVAPKSCIIMETELWPNLVHQASKSGIKLMLANARLSEKSAEKYRK
FT                   QAKLTLPMLQSLDLIAAQSEQAAERFIDLGVKPENISVCGSLKFDLSISAEKIEQAKTL
FT                   RLEWHKSDCPIWVAGSVHPGEFEAILNAHRQLLADKPDALLIMVPRHPEQFNAAANKID
FT                   GAGFNLSRRSLNESLQPNTQVLLGDTMGELLTFYGAADQAFVGGTLIDNGGHNPLEPAA
FT                   LGLPVFVGPQHWDFAEITGLLEDAGALKVIASESELAGELISKFNDQAAYEAASEAGLK
FT                   VVSANRGALKQQFELAKQLNDLK"
FT   CDS_pept        complement(113131..113856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdkA"
FT                   /locus_tag="SVI_0097"
FT                   /product="3-deoxy-D-manno-octulosonic acid (KDO) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00068"
FT                   /db_xref="GOA:D4ZDE6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE6"
FT                   /protein_id="BAJ00068.1"
FT                   /translation="MQIKQTSQGAIAYCVTAAQAITTEWFDVSFWQQLGAVTGSSKGRY
FT                   TTWFVKPALNKADTESEWVLRHYYRGGLIEKLSKDKYLFTGLHRTRAVAELALLTQLFN
FT                   EGFSVPRPIAANVERSGLHYRADIIIERVEGAQDLVARLSKEVMTDQQWRQLGSCIAKF
FT                   HQRGVYHADLNAKNILITDDEFYLIDFDRGEIRAPKTKWQTANLSRLLRSFNKEKGKLP
FT                   ALAFTESNWQELLKGYSKP"
FT   CDS_pept        complement(113978..114844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SVI_0098"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00069"
FT                   /db_xref="GOA:D4ZDE7"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE7"
FT                   /protein_id="BAJ00069.1"
FT                   /translation="MTSIARTLIIGKHGQLAQALIASKPRYINATAIGRDDVDIGSLDS
FT                   ILAAIEQTHADLIINTAAYTQVDMAESRRDLAFSVNRDGAGNIALAAKLTQTRLIHLST
FT                   DYVFNGQKNKAYCVDDESSAINVYGTSKQAGEQAVIAANYEKACIVRSSWLYSQFGSNF
FT                   VKTMLKLITEQPELSVINDQISCPTSASELGLFIWNLSQEENLAPIYHWSDAGTASWYE
FT                   FALEIQGIALSLGKLDTRIPIKPISSSQFPSAASRPKFSLLDITASRQIMTAKPWQENL
FT                   AAVLKQL"
FT   CDS_pept        complement(115208..115753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="SVI_0099"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00070"
FT                   /db_xref="GOA:D4ZDE8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE8"
FT                   /protein_id="BAJ00070.1"
FT                   /translation="MNITDTPIADLKLLSPRVHEDERGCFCETFRDSWFRQQIADVTFV
FT                   QENHSRSIKGCLRGLHFQSPRSQGKLIRVVVGEIFDVAVDLRKHSPSLGQWFGTYLSAK
FT                   NRQQMWLPAGFAHGFYVTSDSAEIIYKCTDYYAPEFEKTLTWDDDTLAIDWPLRGQLPI
FT                   LSSKDKIGLSFDDITQGL"
FT   CDS_pept        complement(115793..116599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0100"
FT                   /product="glycosyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00071"
FT                   /db_xref="GOA:D4ZDE9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDE9"
FT                   /protein_id="BAJ00071.1"
FT                   /translation="MTVSLIITTYNWPKALDRVLKSTLIQSIQPDEIIIADDGSSEATK
FT                   HVIDKHRAKTNISIIHSWQEDKGFRLSRSRNNAISKSSMDYIILIDGDMVLERHFIADH
FT                   IKHSERGFFAVGKRVRLSESMTSKQLSLPGEISPFSKGISRGREHSIRLPLLSKLFSKT
FT                   QMNSVSSIQSCNIAFWKLDAISINGFNNDFVGWGPEDKEFSLRLLNNGILRKNIKFSAI
FT                   AFHLYHKENSKGMLKVNTDILALCLAQKSNWCSNGLNEFSKTKPAL"
FT   CDS_pept        116862..117905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0101"
FT                   /product="heptosyl transferase, glycosyltransferase family
FT                   9 protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00072"
FT                   /db_xref="GOA:D4ZDF0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF0"
FT                   /protein_id="BAJ00072.1"
FT                   /translation="MSLNLANINSLCLLRLSAIGDVCHAVAMVQAIQRQYPKLKITWVI
FT                   GKIEYQLLKHLNGVDFVIFDKSQGWRSYFKLRGDLAGKKFDVLLHMQVALRATIASLAI
FT                   SAKVRIGFDRARAKEGQWLVTNQSVEPLATPHVLEGFMGFAKVLGVTDLTPKWDIPVPV
FT                   ADTEFAKKMLPDGDKTLVICAAASKAERNWLPERYAAVAEHAISKGFRVILCGGPAALE
FT                   LELAKNIELSCAVPLENQVGKTSLTQLLAVLKQAAIVLAPDTGPAHMAVTQGTQVIGLY
FT                   AHSNPGRTGPYASLENVVSVYHDVIASQAEGKVAWGTRAKGEELMNLISIDLVISRFDL
FT                   LSHGLAD"
FT   CDS_pept        118013..119089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00073"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF1"
FT                   /protein_id="BAJ00073.1"
FT                   /translation="MMLLAPKILFVPVSTTEGIGEFMRSKIIADEVMNRWPKAKIDFVL
FT                   NRHVSYIGDCPYSTHLVDDTPTKKIREVNQLITELKPDLVIFDAAGRKAQLKHAHNMGA
FT                   KVIFISQHRRKRSRGMKIARARVTDSHWVVQPKFVIGDISRFDKFLLGLIKRKHPIYTG
FT                   SIFTSPTSEQQKALFDQYDIKQGEYLLYSAGSGGHSLKNGLAADLFAQVAKTIFRETGI
FT                   PSLMVFGPNYPKSLPDLEGVIAIPHLNTCEFINLLAGAKAAILSGGDTMLQSIALKIPT
FT                   LAVAISKDQPGRINSCVAANLILACGSEQLDILTKTRQLLEVEYLKNLQEKMAVLNDIN
FT                   GLDIGMSEIARLLGCSES"
FT   CDS_pept        complement(119196..120047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00074"
FT                   /db_xref="GOA:D4ZDF2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF2"
FT                   /protein_id="BAJ00074.1"
FT                   /translation="MKKAIFTLAIGDNPMYRAAIESFRIYADKVGADLIVSEELHYQVD
FT                   IKNPKYDANPAWSEKLYIGELLKKYDRVLYLDADFIITPEAENVFDTLDDLNSIYMFNE
FT                   GRYRDRTPVIKEACDLLGDVPNWDSVSNLPVYFNMGMLLISKECPLFEHLSVEKLQSVC
FT                   NKIKFYEQTLTNYMIQKHKISYKCVESKFNRMDLLGLDNYRQADFIHYAGRGFRDKCPL
FT                   REVRYIADYCEMFHDQVSESQRKQLKKDAWNLYIAKLQRKTKLPYSLLNTVVTPLIGKK
FT                   WL"
FT   CDS_pept        complement(120099..121277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00075"
FT                   /db_xref="GOA:D4ZDF3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF3"
FT                   /protein_id="BAJ00075.1"
FT                   /translation="MRVFRELKQLYPMPNSALSWLSSMSIISSTQLESAKRLLFISPVA
FT                   LGDFLYLKTFLIALKKQNSHIEIDIWLDDNRNNSDAWRLSRSKIMQQWIEAEPAFTRSY
FT                   GCCSSEKQQRAQIFDAQAINYDLIITHSGSKSEQFSNVAREIGPDAFIVSSIGKSKYFG
FT                   LIDSFLFRHSDRLFKLEENNLPAKHHITDRYYQLLNRIVGIKLDKNDFMPSLTIPNEIA
FT                   IITQNWLKTQFTDSGRQGPLIFLNHLSTNSKRDWQESQLFELIKLIGNKSPDSRFVVNV
FT                   TKENYKKVSDAIKNNINLASLQVSVFTVNEHFFELPSMIASADLVITVETAIMHFATAS
FT                   NRPLIAMMRQKKPYWAPPSSQTSRVLYASKGKGYVSDISVNQVLDTYVEMTR"
FT   CDS_pept        complement(121295..122371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egsA"
FT                   /locus_tag="SVI_0105"
FT                   /product="glycerol-1-phosphate dehydrogenase [NAD(P)]"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00076"
FT                   /db_xref="GOA:D4ZDF4"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF4"
FT                   /protein_id="BAJ00076.1"
FT                   /translation="MSNTTRKFSTRHLEFPAQLLVEKDAIANTQLLSNLQSPKRVLLAI
FT                   DEGVKHLAKHALSDIWFSETSTVHIIERADFSNVSQVDAICAKKQIQTVVAFGGGKVLD
FT                   VCKRLASLRHIELIVIPTALSSDCISSPIAVIFDDSGKKLSLPAAIPNVIIVDTELCSQ
FT                   APTRLTQAGIGDLLSNYSALLDMNYAKDRAHVDGFSYLLAKSAANEILGVQHLAVNDQA
FT                   VITQLAEGLILSGLAMGFSGDSRPCSGAEHLISHALDFLNLGNGLHGEQVALGMKFCHH
FT                   LRLLLNLPGLNHAVLSCIDNFKIRSTPETLNISKSEFFEALSISPDMRQGRVTFLESLD
FT                   SIPKVHLEKAYLNAFVPV"
FT   CDS_pept        complement(122372..122791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0106"
FT                   /product="glycerol-3-phosphate cytidyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00077"
FT                   /db_xref="GOA:D4ZDF5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF5"
FT                   /protein_id="BAJ00077.1"
FT                   /translation="MSKKVLVVGVFDLFHRGHVEFLQKAAEFGDELIILINGDEMTEKY
FT                   KRRPIYNEDDRAAILNSLACVSQVEVTNSFDIKPIIEKYGIDIIAHGDDWEHESYLAQI
FT                   RCTPAYLDEQGVSLAYTQYHKSVSTSAILKQIKES"
FT   CDS_pept        123095..124168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00078"
FT                   /db_xref="GOA:D4ZDF6"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF6"
FT                   /protein_id="BAJ00078.1"
FT                   /translation="MICFDVLHPYYLPQYLPVKDELNKRGESVYFIVYRNLEQQTALDA
FT                   LVSEHQLNVHWVDDTEQALAFYLKNKPKWVIFGNTFDYAEKLKGLSRRALMQHGIGPKS
FT                   CYYTVSESDMDVRFVEGQYRLKRLQQLFPGKTFVDTGYAKLDPIIQGVEKGLDIGALGL
FT                   DPAKPTLLYAPTFYPSSIEKMGWDWPAEFSEYNILLKPHYFSLSKPNYKKQKQLLEHWG
FT                   RFDNVYLAPVEQVNLLPFMASADLLISDASSALFEFAALDKPVVWCDFYHLRWSYRGIF
FT                   KFRFNNRMDEDLYKYAGVAVHAASYKELKSVVDEQIANPESFAMQRSKYIYELAGKVDG
FT                   LSSQRIVDYLLSDESEL"
FT   CDS_pept        complement(124223..125176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaD"
FT                   /locus_tag="SVI_0108"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00079"
FT                   /db_xref="GOA:D4ZDF7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF7"
FT                   /protein_id="BAJ00079.1"
FT                   /translation="MIVVTGAAGFIGSNLVKALNDMGRCDIIAVDDLSDGTQMFNLADC
FT                   EIADYLDKDDFLAKIKAGDFNGQLEVIFHQGACSSTTEWDGKFMMANNYEYSKSMLHYC
FT                   QMNKCQFIYASSASVYGGSDKFVEQRQFEKPLNVYAYSKFLFDQYVRQQKLTTQVAGLR
FT                   YFNVYGPREQHKAGMASVAFHFNNQIKATGVCRLFEGVEGYQDGQQLRDFVYVKDVVKV
FT                   NLWLWQNPEISGVFNCGTGEAQSFNDVANAVINYHDEGKIEYIPFPEKLKGAYQHYTQA
FT                   DLTRLRQAGYTQAFKTVEQAVPEYLDWLKSQHFIGQ"
FT   CDS_pept        complement(125247..126254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00080"
FT                   /db_xref="GOA:D4ZDF8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF8"
FT                   /protein_id="BAJ00080.1"
FT                   /translation="MIERVLVIRHDKIGDFVLSWPALFLLKKAMPKASIEVFVAPAVQA
FT                   LAATCPYVDHVIVDTGDDKAITEKFIARNYDAVLVSCSQFRIYKMIRHLDTAYKLAPKL
FT                   NWYQYLYQHRVDAKYKKGEPCWRGGCMMVEHFLTHHGYTIPTLPQQYWDMSAEREKWQN
FT                   YYGRQQDEKLIFVHPGTGGSSGSVAPADFSSLLINIDSRTQANCKFVLTYNGNEELLAR
FT                   DIFDSLSAKSIKVIMAKPLSSLADFAKSIVAADMFMAGSTGPLHIAGLHNVPTVGFYAG
FT                   RHSAPIVRWQTLSHSHKRLSYAPPVGKSTGRNMALINFDAVEKDMVAYLDANYA"
FT   CDS_pept        126617..128047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="SVI_0110"
FT                   /product="bifunctional protein hldE"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00081"
FT                   /db_xref="GOA:D4ZDF9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDF9"
FT                   /protein_id="BAJ00081.1"
FT                   /translation="MKVSLPAFEKAKVLVVGDVMLDRYWIGPTERISPEAPVPVVRINH
FT                   IEDRPGGAANVALNIAALGGQVSLAGIVGQDETADALTTGVQALGVEPKWHIVAGKPTI
FT                   TKLRVMSRSQQLIRLDFEEAYSAVESQALLNGAIEQLASVEVVVLSDYGKGALVDPQPF
FT                   IQQARAQGVKVLIDPKGSDFSRYRGATLLTPNLSEFEMVAGEVSCEADLIEKAHKLLKQ
FT                   FELEAILVTRSEKGMTLITSDELELHIPTVAREVHDVTGAGDTVISALATAIAAGSSLA
FT                   EACAIANTAAGIVVAKLGTSTVSRIELIEALSLSRGEVGVGVVAEDQLVYALEQAKLRG
FT                   ERVVMTNGCFDILHAGHVSYLQEARALGDRLIVAVNNDDSVKRLKGDGRPVNPLDRRMA
FT                   VLAGLASVDWVVPFSEDTPQRIISHLLPDMLVKGGDYKIEDIAGGKEVMAAGGVVKVLC
FT                   FEDGISTTKIIENIMASQ"
FT   CDS_pept        128162..128641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="SVI_0111"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00082"
FT                   /db_xref="GOA:D4ZDG0"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG0"
FT                   /protein_id="BAJ00082.1"
FT                   /translation="MHTKAIYPGTFDPVTNGHTDLIERAAKLFKHVVIGIAANPSKQPK
FT                   FTLEERVELIKLVTAHLDNVEVVGFTGLLVDFAKEQQASVLVRGLRAVSDFEYEFQLAN
FT                   MNRRLSADLESVFLTPAEENSFISSTLVKEVAYHGGDVSQFVHPEVSKALLKQVK"
FT   CDS_pept        128648..130144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0112"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00083"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG1"
FT                   /protein_id="BAJ00083.1"
FT                   /translation="MIKVVKSYLAKLGLIFSLIFSSSLLAAPWVDVSDIYLRADIQALA
FT                   DEGVITVPVNTYPLMWSGIGVDLAKTEPSILTPALAEAYARVNYYYRSAVDNRGNTRIK
FT                   AAAATDAARFRHFGSDYREQGDVQVTHEYVGERFAFKVSASAHYDPLDEEEFRLDDSYL
FT                   AMALGNWMLTAGAVEQWWGPGFDSALHRSNNARPLPSVLISRNNSAAFETPWLSWLGPW
FT                   TLTAGISRLEEDRAVANPLLWNFRSSVRPFRQLEVGFSWSTQFCGEGEECSWKSALKSI
FT                   TGQRDCRGAGVEGCTNYGNQMAGYDVRFSDTWLNIPFGVYYEKTCEDAKGSAPWDIVDC
FT                   SHLGGLDTRFNFDAAQFKLFFEYTDTLVACGEDDNAFNCMYEHATTYKSGSRYYGKTYG
FT                   STYESDATVYALGLIGQFKDSKGITSILRYAQLNKDGSSPATEWVAQRAQEDLLMLELS
FT                   YRMPLLKGMMSVGGTVSRSEFETQESESDASLFGTYEYRF"
FT   CDS_pept        complement(130293..131108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="SVI_0113"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00084"
FT                   /db_xref="GOA:D4ZDG2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG2"
FT                   /protein_id="BAJ00084.1"
FT                   /translation="MPELPEVEVTRQGISPHLVGQQVIGLVVRNASLRWPVPQIAQQIV
FT                   GQVIRNVRRRAKYLLIDTDAGTTIVHLGMSGSLRIVPRSTQVEKHDHIDLELASGKILR
FT                   FNDPRRFGAWLWCELPEEAHPLLSKLGPEPLKDNFTPKYLFDSLRNKKKAIKLCLMDNH
FT                   IVVGVGNIYANEALFAAGIHPQTEAGRLDIERLTILVTQVKQILASAIKQGGTTLKDFT
FT                   NADGKPGYFAQKLHVYGRGGDTCTQCGNLLSEIKLGQRATVFCGICQTR"
FT   CDS_pept        complement(131146..131634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0114"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00085"
FT                   /db_xref="GOA:D4ZDG3"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG3"
FT                   /protein_id="BAJ00085.1"
FT                   /translation="MALSRKKWNNIIIIASIMMISILTLLNTKTAKLPDDALPLFDDKS
FT                   PLVQLQLDDLWLNKGSTDWQCHSDILNCQAWAKAWSGIHLSALDQGIDILAVINEDIAK
FT                   NTAHTLVIQIADKQQPQLWQFYPRQGLLESPAKNWYLIPPSQREALSPIIKAKALIDN"
FT   CDS_pept        complement(131816..133615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0115"
FT                   /product="molybdopterin biosynthesis MoeA protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00086"
FT                   /db_xref="GOA:D4ZDG4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012182"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG4"
FT                   /protein_id="BAJ00086.1"
FT                   /translation="MSIPFTNPLSIPILGFCAYSGTGKTTLLKKLIPELNSRSVRLAVI
FT                   KHAHHNFDVDVPGKDSFEMRKAGARQVLVASHVRWALMTEHAVEGDPQLPHLLQQIEQD
FT                   KVDIVLVEGFKKLELPKIELHRAAHGKPLLHTQDENIQAIACCDDTQVPNGLHRLDIND
FT                   VSQIADFVIKYIDKWQVSPATLPLAPSTGCEFGSSKTLSVTQGVDHILSLVDPITASEH
FT                   LLLDELSGRVLAEDAISPLNVPQNTNSAMDGYAFKFSEPRLNRYTIVADVMAGHQYEGR
FT                   LQDNEAVRIMTGAPIPPGADTVQMKELAIEQGSAVSFQGDIVLGQHVRLAGEDIAKGKT
FT                   ALAAHKRMQAPEQGMLASLGFGQLPVFRRPKVAVFSTGDEVCQPGEPLKPNCIYDSNRF
FT                   TIKSMVRKLGCEVIDLGIIHDSEDALAEALQQAAIDADVVISSGGVSVGDADFIKLALE
FT                   RVGKINFWRINMRPGRPLAFGQIGDSLFFGLPGNPVAVMVSFIQFVQPALRKLAGEKDW
FT                   QASLVPAIADCTMRSREGRTEFTRGIYRLAQDGKLHVTTTGAQGSGMLTSMVKANCLII
FT                   IGEPDEQLNSGDIVYIQPFADLL"
FT   CDS_pept        complement(133630..134220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="SVI_0116"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00087"
FT                   /db_xref="GOA:D4ZDG5"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG5"
FT                   /protein_id="BAJ00087.1"
FT                   /translation="MSLQIDAVILAGGMARRMGGNDKGLVELNSQPMIKHTIDRIKPQV
FT                   KQILINANRNQTRYAEFGFPVISDEDTGYLGPLAGMITAMANTQADYLLVVPCDCPLLP
FT                   SDLVPRMLAQVEHQGADLAVASDGKREQPVVLLLKPSLRDSMKAFLDAGERKVELWYTK
FT                   HDRVVTDFSDQANAFVNVNTPEQKQQVAKAIAK"
FT   CDS_pept        complement(134338..134490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00088"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG6"
FT                   /protein_id="BAJ00088.1"
FT                   /translation="MLLFYGDPEVCLLHDSAPPPKLTRGKTLAQAFAKIARSANGFISG
FT                   GLCKR"
FT   CDS_pept        complement(135994..136650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00089"
FT                   /db_xref="GOA:D4ZDG7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG7"
FT                   /protein_id="BAJ00089.1"
FT                   /translation="MLSLSASQTRRALLLLVGFHILIICASNYLVQLPFQFFGYHTTWG
FT                   AFSFPFVYLATDLTVRIFGQDSARRIIFKAMLPALIISYLMGVVFHQASFQGFTALTEF
FT                   NSLVFRIAFASFAAYLIGQLMDIKVFAKLRDTKSWWVAPAASTLIGNLVDTLVFFGLAF
FT                   YASSDSFMAEHWPEIASVDYGFKLIVSLCLFLPAYGLLLRVLEQKIVNSEQESRC"
FT   CDS_pept        136980..137723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00090"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG8"
FT                   /protein_id="BAJ00090.1"
FT                   /translation="MRILIYKFLLMILITLPVQALAETPIIRVATDNWIGYTNLDGSGY
FT                   YFDILKRVFPQGDWQVDIEIVPFSRVRYLLHQQKVDMALGFYPDDKVNSIYSDIPVEID
FT                   TVDIAVTPELAAMWQGVDSLAQKKVQALLEYRFDELIPVPMYYEESVNLLDLLNRVNQG
FT                   KIDAVLDYKPDILSKVAELDQPRQFVIIDNVFRLEVYFVFSNTDKGSQLKIHFDKELKK
FT                   LIDSGELDRLFRDYVGEDATRLSLK"
FT   CDS_pept        complement(137767..139113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="SVI_0120"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00091"
FT                   /db_xref="GOA:D4ZDG9"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDG9"
FT                   /protein_id="BAJ00091.1"
FT                   /translation="MLPQAIEYLTDKLQQLNFQSHCDPIIQVSVNIKAVPVIAWLAAQP
FT                   IYPRIYWKGRDTEEEVAAIGCCKDFFYDETTDDNQLAMEYQAQRALTKNQDIRYYGGVA
FT                   FDRSTEAWPEFGRARFVLPRVELRRSGTEFKLVVNLNCDKQDTQSERRHAMESLGSLAP
FT                   AKPLPPPNKVSLLGRSDRPDRHHWTELVNRVTDPKFIHETPKVVLSRLTQLEVNEEINP
FT                   WMLLACWQGRNPSSFQFGFQFSPNRTFISCTPERLYRRRHRELFTEALAGTTTRGLNQE
FT                   EDALLATQLQEDSKNSHENQLVSQHIVDVLSPLSRYVGAEESPKVFKLSHIQHLHRSIR
FT                   AELKPEVDDFQLLLAMHPTPAVGGLPREAAMDFIRQQEGYARGWYAGACGYFNHYESEF
FT                   AVAIRSALIEPGRINLFAGAGIVSGSEADAEWAELENKLTTILSILTEV"
FT   CDS_pept        139664..140830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0121"
FT                   /product="HD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00092"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH0"
FT                   /protein_id="BAJ00092.1"
FT                   /translation="MNSKTLVKYPVSKLAIGMFVSAIDQQGQVAIANAGQIRSQNAIIK
FT                   LKKNGINYVWIDIERSADSCGLKRAISPKPIVKKIKPSRDKSQLVAKKLLLEAKDLVQK
FT                   VLSEVFEGKAIEVAPFEVLADNMIESVMLDDDALKCVSALRTKDAYLLEHSINVAFLLV
FT                   TFGKYLKLDKDILRQMAVGGILHDIGKIKVDNKVLHKPGKLTPQEFEHIKLHQVFAIEI
FT                   MAETKGLSDLSKDICLMHHEKLDGNGYPRGLKGDEIPLHGRMSCIVDIFDALTATRCYK
FT                   EAMSPAAAFKILLSLTPFHLDDKLVYEFIRCVGVYPVGSLVELSDGRIGIVWEAKDRDA
FT                   LHPILKCFYSIKHKRYTNVTMVDLLKSDLHIERGVSPRALDVDPAPFY"
FT   CDS_pept        140923..141561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00093"
FT                   /db_xref="GOA:D4ZDH1"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH1"
FT                   /protein_id="BAJ00093.1"
FT                   /translation="MKRVLPVIVILLSLALLIPGVTQPILSISGSIEKSELAQAGIAHL
FT                   ADGSGSARDMLTMMSSMLGFDTLQGEVEVFQKTRSIWGTVEELYQSGNILVALLVGLFS
FT                   VVIPALKLICMLILQGPISLKAKLKLSQFTGIIAKWSMADVFVVAVIVSYMAGNASAGM
FT                   GDLLKTTASFDVGFYYFAAYCVFSIFSGYLMGRPSEVHITDEPGIEARA"
FT   CDS_pept        141588..141803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00094"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH2"
FT                   /protein_id="BAJ00094.1"
FT                   /translation="MELAVSLAPYSLSMPSYLVGPLGYGLNSQLSTLNSQLSIPNSQSS
FT                   ILDLQTIYDANNDPCRIEVISGLLVP"
FT   CDS_pept        complement(141809..141907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00095"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH3"
FT                   /protein_id="BAJ00095.1"
FT                   /translation="MIAQLMERKKLDWLLFIESLFNPKYPFLLTNS"
FT   CDS_pept        complement(142155..143090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00096"
FT                   /db_xref="GOA:D4ZDH4"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH4"
FT                   /protein_id="BAJ00096.1"
FT                   /translation="MQMKLLILKKYLPFYALATLCLFPFISSPIALVLGFTLASLGLIP
FT                   SNLDLAALTKRLLSYSIIGLGFGINLNTAISISRDNLPLILGSIIFTLVLGYLLTRALK
FT                   FDSKTGQLISAGTAICGGSAIAAVSPAINANSEQTAIALSTVFILNSIALFLFPALGHL
FT                   FAMSQYDFGVWCAIAIHDTSSVVGAASAYGEEALTTATTIKLARALWIIPIALLSALMF
FT                   GGDKKKITIPYFIGFYCLAIAIAHWFPQGQIAYQAIFELSKRILVLCLFLIGGGITVAK
FT                   MRAAGAKPLILGLTLWLSIGTGSLVYILYV"
FT   CDS_pept        complement(143222..146809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0126"
FT                   /product="cellulose synthase operon C protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00097"
FT                   /db_xref="GOA:D4ZDH5"
FT                   /db_xref="InterPro:IPR003921"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH5"
FT                   /protein_id="BAJ00097.1"
FT                   /translation="MDSVDWLLGQLKLAQAMKRDDIVLSTLERLFAIEGNNVSGLYYQA
FT                   NMYLQTKQLDKATAAWKKLQQLAPKSQKTLALNSIFSIRNEKKSEFQRARLLAHSGRYL
FT                   ESLLAYDSVFPNGIPTPSLQLEYLQVEGHIASRWQSVKTSLEKLNANNPDVPIFQLALT
FT                   KHIGKRHPADPWVLASYRRLALRPDIGEQAALSWLYALDSLPISTSVTEQYAILSSYYP
FT                   SNRTIQRANQEGKKRLARELILQKDPTYRAKRKGLALLDEGKNNQAAKQLRYALTTRPD
FT                   DPELLGAIGTIYLRGGNQTQALAYFKKAQELDKDPDAASKWRSLIKVSSYWAYLKQGDT
FT                   ALKENRYTDAKHLYEKSIKITPAAPDAYNGLAELALMQKQYKQAERYYQLALNRDQNNN
FT                   SALRGRLNVALAQGELGTAIKLAEHYTPQQQLAINGKIQSLRSDQASQAIELALSAGDM
FT                   DQAKRSVSRLLALKPSSPWLRADIADTLRILGNPKQADDLMLAWDQASSDPQMHFAYSL
FT                   YLSRNDQARAAVDALAAVPKTRLTPAMKRNLVRLSLNLDLDNIQARYLYAHEASVKAIS
FT                   KLAQEYRHDPQAMMRITETWYKLGEATRAQTSYAAITPQKDWSFSTQLAYAKLMLTMHA
FT                   FEDFNDWQARSEHLSNLTLLSISERQSLHQLATQANIAEAEQDYQQELYASALARYLKV
FT                   SKQAEPYKTQGLIGVLQSSIPLEQQTQYEYIAAALYSKRGQLTASQLMSVARVFNRLGR
FT                   HTQANHLNELLPDSASAMEFRDSMAIAMTNKQWHTAGISGYKALNSDRIAKNRNQDKAS
FT                   PEKPSLHLLYDQADDYWLTRNVKKDIDTLHDRLDGHVMIGYDFGARDGENKMSQVPIEA
FT                   RIPIPSLDGHLILRAEHVNIASGDIDYLNQHQDHHEIPIDQQASGTALGVGWEADNWSA
FT                   DIGTTPLGFTHSTWVGGITVKGDLADLGWRINASKRPETSSILSYAGLSVPQGSIDPQG
FT                   TEWGGVVRTGLKIGTSYDQGGPYGIWTSIQYHKLTGDNVADNTRLGLLAGSYYKLIADE
FT                   DQGLSVGTNFMYLNYNKNLSEYTLGHGGYYSPQSYFSVSIPVNYYKRYHDTWSYLLSGS
FT                   ISNSWTQEDGPYLTGEASSSGGGFGYTFQAAIENRISKHWYLGMSLDLQRSDFYEPNHF
FT                   ILYAKYTFSDRWQSITMPANTPILYSSFD"
FT   CDS_pept        complement(146998..148113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsZ"
FT                   /locus_tag="SVI_0127"
FT                   /product="endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00098"
FT                   /db_xref="GOA:D4ZDH6"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH6"
FT                   /protein_id="BAJ00098.1"
FT                   /translation="MKKLVWLTCLSLMLTSLSSQVFALECQWPEWNTFKTNYLQDGRVV
FT                   DASDPRLITTSEGQSYGLFFALVANDKQAFQQILTWTETHLAEGDLTAHLPAWLWGQKT
FT                   TGTYGVLDNNSASDSDLWIAYSLAEAGRLWDNYYYKSLSHLVASRILREETLEVPGIGN
FT                   VLLPGPQGFDKPDGSYRLNPSYVPLQLLSRMATLYPKYTWQSLYKTSATMLTDTAQHGF
FT                   SPDWVTLKSGVYTADDITGNLGSYNAIRSYLWIGMLNDADKEKSTLLQTMQAMVAATQQ
FT                   LSAPPREVDTLNGQYTEAGSPGFSAALLPFLSASNQAALVEQQAERAHSLLQRNDGKHY
FT                   YDNVLGLFGEAWYQERFRFGEHGELQTQCQK"
FT   CDS_pept        complement(148110..150440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsB"
FT                   /locus_tag="SVI_0128"
FT                   /product="cyclic di-GMP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00099"
FT                   /db_xref="GOA:D4ZDH7"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH7"
FT                   /protein_id="BAJ00099.1"
FT                   /translation="MSLLGHCDPVIFLLESLTMLISRLTMIAALGLAISASAFAQQPII
FT                   PVTAPALSAQASNTSIPIVSQRVISFSQLGYTGSIKILGSENSIYVGFGSRLDEVVSKA
FT                   TLHFDLTPSPALLALVSHIKVYFNNELMGVVSISDGQQGKKNSVSMPLDTRFFSNFNQL
FT                   RFELIGNTNTSCANPNDSSIWAEIGLSSHIDLQVQKTLLKSELSLLPAPFFDERDFNKL
FT                   KLPVVMGSDYDLDEIKAAGIAASYFGTLSEWRSTSFPLSFDKMPDENAIVFITNNNKPE
FT                   FLKDFPDADGPYLQVISHPRDPYVKLLLVIGRDSEDLNTAIKGLALGTSLLTGPIAKIN
FT                   SVNQIVPRQAYDAPNWISTTRPTSLSELVKQKSALQVEGRTPPPIRVDLRLPPDLFTWQ
FT                   SRGIPMDLNYHYSPPTKNDSGSRLSLSINNQFIEAFNLTTDGQSGESSQLRIPLIDDNF
FT                   LSSSDNIPIPAFKVGSNNHIKFEFSFASVTEGMCQVTQPSKQYAVIDGNSTIDFSGFPH
FT                   YIEMPNMHAFSNSGFPFSRMADLSETVVVVAEKPSAAALQSFLNIMGVIGADTGYPGIN
FT                   VQLIDRWDKQLLQDKDILSIGVAPSLNTAEYDTDQVNLTLNAGKRLMKFPNKNEELLDL
FT                   KPSSSKQDPTEMISVQAQGAFAAITGIESPFSAKRSLITIMAANPQDLSLVDEALSDSG
FT                   KVEHMFGSVVTIRNNEVASYNVGEHYYSGKLPIWQLVWYHFSNHPILLAFIVVFLMLIV
FT                   TIVLWRILRPIAAKRLQDNEDES"
FT   CDS_pept        complement(150373..153027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="SVI_0129"
FT                   /product="cellulose synthase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00100"
FT                   /db_xref="GOA:D4ZDH8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH8"
FT                   /protein_id="BAJ00100.1"
FT                   /translation="MFSCLNLIFKTWIVSQFAAQKTFIEEAEGAPASWLGELVLAIWFT
FT                   TAFLFLKPTIAGVPSWKLLFIGYPQINFARPVLFDLIRFVIQTSWLLLFQQQTKHVLST
FT                   RIHQVFNITVKRIKSAFYLPLNTLSLGVQWLEAWATKPSRLKSSTQAMPSKPQVKRPHN
FT                   LLNYTLFFLVAVLAFLCFTVPFNFNAQIIFVCLLWALAMMFRRMPGRFPTVLLIILSVT
FT                   ASCRYIWWRYTSTLNWDDPLALFLGGILLMAETYAWIVLLLGYFQNIWPLNRKPVALPV
FT                   DQTTWPEIDIMIPSYNEGLDVVRATVYASLGVDWPKDKLNIYILDDGKRDDFRDFAKEA
FT                   GVNYIRRPTNEHAKAGNINYALAQTKSEFVAIFDCDHIPTRAFFQLAMGFFLKDPKMSL
FT                   VQTPHHFFSPDPFERNLASFRDIPNEGNLFYGLIQDGNDMWDATFFCGSCAILRRAPLE
FT                   EVGGIAVETVTEDAHTSLRLHRLGYHSAYLKQPLSAGLATETLSAHIGQRIRWARGMAQ
FT                   IFRLDNPLTGSGLKWQQRLCYVNAMLHFLSGIPRIIFLIAPLTFLLLHSYVISAPAFAI
FT                   ILYALPHMVHASVTNSRIQGKYRYSFWGEVYETVLAWYIAKPTTVALFAPHKGNFNVTA
FT                   KGGLIDKSYFDWVFSLPYLTLVIMNIIGLGFGVYRIGWGPDDEIGTVIVNILWTIYNLL
FT                   ILGGAVAVAAEEKQVRKDHRVAVALPMSVRLHSGHLLRAVMQDFSLGGIRVKLEGYDEQ
FT                   NHLFLPNQELEIILHRSDQQFVFPTIVTYAQDGILGLQLAPLSNQQQVDYVQCTFARAD
FT                   TWTKWQQSYEADKPLASLSRVLRVGASGYQQLLRHSPTPVKACVRPILFFCEFTWSLRP
FT                   RHISTRVSNHANF"
FT   CDS_pept        complement(153031..153831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00101"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDH9"
FT                   /protein_id="BAJ00101.1"
FT                   /translation="MKRLIIISLKSGTGSTTVTANLAQMLHQLGKNTLVVDCVASNVLK
FT                   LHLGLPFKVDDGWVKRLLQASPWQEANFESPLGVDFIPFGQINNQEALAFRANKPDLFA
FT                   HLFQELNRATSTSSQNDWQLIHLSIDDLTDPSVARFCDAADLILCVVSPEPSSYYVMQN
FT                   TIKHHRFIQHHLERSKKLKFLINQFQAETQVGRDFLLVFKKELDTQLIPVVLHKDTALV
FT                   ESIANLTTVQHHAPHSQAAKDYQLLAFWCISHLAALGTDSGKES"
FT   CDS_pept        complement(154070..154312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00102"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI0"
FT                   /protein_id="BAJ00102.1"
FT                   /translation="MKLATSSKDIETIYSSFNIKKHHYIEISENENYQDVKQKWLSLST
FT                   MKNTYTSNKIDTQEQDINKTQDNHQQHAINNPIQA"
FT   CDS_pept        154605..156170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0132"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00103"
FT                   /db_xref="GOA:D4ZDI1"
FT                   /db_xref="InterPro:IPR017745"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI1"
FT                   /protein_id="BAJ00103.1"
FT                   /translation="MLTPITQETVHSCIYTYLFTSNDSALHYVNSLCLSNDEFSFVSCV
FT                   DLERFNSGVDANNHVGLGSLLVEKSIKLFFSSGVSGNNKSTVMDIINDLSSLNIKPKST
FT                   LVIFSPDRLLVSYNSESWDAFLNAIKCYASKRQLVIKLLIYGSLATSVIKPMLLTNNTK
FT                   LSGMASLQKADGETYHYHVDFWSNAHGVKSDANFILGLNASGQFYVKQEYDDLMQVMTR
FT                   DSADSDCIYISRTVLDENIQLPANVIVADSNHALIEQLDRPSASTVIFSCASQEEIKNL
FT                   ALACYQLRKSAGSRLKILIREVNQCLRYLDEQFLLRAGVNLILPFTVSYPRCISQMEAL
FT                   QGQVFTRVIPNTLEGLLKYNQIYEYKGYITNTIFVDYCSSLMQSFEQTRIRFAVIKLTI
FT                   LPGMQAEECLRLCHIRRDGDLVTVCRTAIYVLFSAVRISDVDVALNNIFEYPVRDLFRT
FT                   VDVLNNLHDIEQELSTIVGQAMSVSTEVEKLSRVTAIFEPNIANVNQVSPSLAKRKQYR
FT                   YFTA"
FT   CDS_pept        156167..156328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00104"
FT                   /db_xref="GOA:D4ZDI2"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI2"
FT                   /protein_id="BAJ00104.1"
FT                   /translation="MNINDFSLTVIICLLLGLATGYFIRDMAQVAQRIYRRYVKKPSHL
FT                   VEVKTKNS"
FT   CDS_pept        156345..157982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00105"
FT                   /db_xref="GOA:D4ZDI3"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI3"
FT                   /protein_id="BAJ00105.1"
FT                   /translation="MTNKNITPNVFMLSGLGWWNVYFIIKIALYLKGSIDFHPVENFAF
FT                   LALLLFPLASKRLAIARTLIAVPIGLWLMHFDSYLPPLNRLWSQMGQLMQFETSYLIEL
FT                   LGRFVSPSALLAIFTLCIGYFILSKYLRISVLVVGLLVYISLPEPATVIAPQPGAAVAN
FT                   TANVTSVSETVPKAREVTVINDDVLNNLKNDFFTNELKRSVSFNPTAKDDVPFDLLFLS
FT                   ICSVAWDDIEISGLSDHPIFKEFDIMFDRFNAATSYSGPALVRLLRANCGQETHGELFD
FT                   APASNKCYLFENLAKLGFKENLLMNHDGVFDNFLELLQQKGKLNAALMPLDGFKPYEKA
FT                   FDGDDIYRDKDVLDHWWQQRIRNDNNQVVALYNTISLHDGNRVIGGESPTNLISYKRRL
FT                   KNLLDDLYGFFQELKASKRNIVVMLVPEHGAGMRGDRMQIPGMREIPAASIVHTHVGLK
FT                   VFGDNMKRVGDTVHITDPSSYLAVSQLVSNILDSNIYKTNTFDPKVLTTNLPKTKMVAQ
FT                   NSGTTVMEVKDKHYISLDGSTWSEYPTD"
FT   CDS_pept        158101..158265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00106"
FT                   /db_xref="GOA:D4ZDI4"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI4"
FT                   /protein_id="BAJ00106.1"
FT                   /translation="MIRNIPVNQPKSVIYSWYFVFTLGVKILAGLAGKDLVKATYCGFR
FT                   VWGYLNQAY"
FT   CDS_pept        complement(158474..159841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="SVI_0136"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00107"
FT                   /db_xref="GOA:D4ZDI5"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI5"
FT                   /protein_id="BAJ00107.1"
FT                   /translation="MEIKMAQHFDYICLGAGSGGIASANRAAMRGAKVLLIEAKALGGT
FT                   CVNVGCVPKKVMWYGAQVAEALHLYAKDYGFDVTVNKFDWSTLVDSREAYIDRIHGAYD
FT                   RGLENNKVTLVRGYGRFVDQGTIEVDGEHYTADNILIATGGSPTIPNIPGAEHGIDSDG
FT                   FFALREQPKRVAVIGAGYIAVELAGVLHSLGSETHLFVRKHAPLRSFDPMLSEALMESM
FT                   ATDGPSLHINSTPQAVEKNADGSLTLKLENGESYEVDTLIWAIGRKPSTGNIGLENTQV
FT                   KLNDKGYVIVDEQQNTTNPGIYCVGDIIQGGVELTPVAVKAGRLLSERLFNGMTDAKMD
FT                   YKLIPTVVFSHPAIGTMGLSEPDAIAEYGKDNVTVYVSGFTSMYTAITAHRQACKMKLV
FT                   CAGPEETVVGIHGLGYGMDEILQGFGVAMKMGATKKDFDSVVAIHPTGAEEFVTMR"
FT   CDS_pept        complement(159976..160530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0137"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00108"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI6"
FT                   /protein_id="BAJ00108.1"
FT                   /translation="MSLFNINSHVTHNNFLIKPIWLLLILLLNSPCQANDKTLLTNADA
FT                   PHPGIGVALDSEGKPIAIPTKGSAMEYQPPQAYPSKKNKSKKTKSKKRKTTKGSKRKST
FT                   KTLSRKQTLASRIQVANDPGCRWLDKRMDKLEKSLSYAGNQTSYGFHRDELKIRHKEWL
FT                   CMKCGAEGPKQRDHDACQYRR"
FT   CDS_pept        complement(160769..161296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00109"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI7"
FT                   /protein_id="BAJ00109.1"
FT                   /translation="MYATGGRADSQDYTEWNLGVEYSISLSDTVEANLGYQRLEFYGDE
FT                   RCSDNELFGDLAYQAQTWLIPTLSYTYSTQAGGYFLEVSIHSPWQLSQGLTVTPYVSQA
FT                   FDFQYASEEHNGVNHFQLGIEAECLISDRLALSGHFSRTLAQEDIKLEARADGNEASLD
FT                   QTYAGIHLIWSL"
FT   CDS_pept        161817..163859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="SVI_0139"
FT                   /product="oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00110"
FT                   /db_xref="GOA:D4ZDI8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI8"
FT                   /protein_id="BAJ00110.1"
FT                   /translation="MSNPLLTSTKLPQFSKIKPEHIQLAVEQGIANCRSKIDQVLAQSV
FT                   SFSWDNLVAPLEEVDDELGKIWSPVSHMNSVVSSEEWREAHDACLPLLSEYGTFVGQHQ
FT                   PLYQAYKSLRASSEFEQMSQAKKQVIEHSLRDFELSGIGLSDQDKLRYGELVKRMSELT
FT                   SSFSNQLLDATQAWSKLITDEGELAGLPESAIAAAKAMAKAKEQEGWLFTLDIPSYLPV
FT                   MTYSDNRDLREECYRAFVTRASDQGPFAGKYDNGPLMDEILALRHELAQLLGFESFAHK
FT                   SLATKMAESPKQVLEFLSELASRSQEQGATELAELTEFAKQEFDASDLQPWDLSFYAEK
FT                   LKHHRYEISQELLRPYFPEDKVLSGLFYTVSRLFGLSITEQKEFDTWHKDVRFFHISDS
FT                   DGVHRGSFYLDLYAREGKRGGAWMDDCRGRRQTPNGLQDPVAYLTCNFSGPVDGKPALF
FT                   THDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWCFEEEALAEI
FT                   SGHHETGEPLPKAMLDKMLAAKNFQSGMVMLRQLEFSLFDFRLHLEYSPEQGAHIQAKL
FT                   DEVRRQVAVVKAADFNRFQHSFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFNL
FT                   GTGRSFLENILQMGGSEEPMVLFKRFRGREPKIDALLRHSGIGGE"
FT   CDS_pept        164077..164607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00111"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDI9"
FT                   /protein_id="BAJ00111.1"
FT                   /translation="MNLYFRLIWLFIWRIRHCNSIGFLDTSRISYRVWPLDCDINFHVT
FT                   NSRYPAFLDLARTYMMAEMGFLKKFIKLKWMPIVNAAEFTYIRDIKPFTKFEIETKIVG
FT                   WDEKYVYIEQRFVSESTLHCIVHVRCVFVCGGKQVPIETMIKEVNFEGPVPELTPEVIK
FT                   WKQFLQLKKERNI"
FT   CDS_pept        complement(164653..165303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="SVI_0141"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00112"
FT                   /db_xref="GOA:D4ZDJ0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ0"
FT                   /protein_id="BAJ00112.1"
FT                   /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRIIELSDPFSRKEFCQV
FT                   YPPGKVPLLKTRSGDLIPESSIIIEYIDHEFSTGTRLLPREHKIALDTRLQDRLIDNDF
FT                   SNILFELEHQKIESKEKNQIRIKHLENNITRFLQYLNTQLEDKHWLCGDSLTLADCALF
FT                   PCLYCAQDHFKLFEFDNLDRYWHQAQLRGAFQQVKEEVELVKIEVLSGRRPIP"
FT   CDS_pept        complement(165460..166353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0142"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00113"
FT                   /db_xref="GOA:D4ZDJ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ1"
FT                   /protein_id="BAJ00113.1"
FT                   /translation="MDAGQLYRMLVFANVVEQGSLTAAAEELGISRSMVSQHLKKLELR
FT                   CETQLIQRTTRKMGLTQDGQNFYYYCAELLQLAKQAENSTRPDNIELHGNIRILAPVCF
FT                   GEHDLLQHMGEFHRLYPKIRISIQLEDSPMDLKDNKIDIAIQTGARMDPRIDAIKLAQF
FT                   DEYLVASPEYLEQHGSPLHPDMLQMHLWVLQASNQLPKRYQIQNSYGDNFKLNINPSTT
FT                   CNSNLGVMSLVKQGLGIGILPSYLAQPQIASKHLVHILSDYHLQEGLIYATHPFNDVIP
FT                   PKVQAFIDFIKERLMA"
FT   CDS_pept        166557..167255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00114"
FT                   /db_xref="GOA:D4ZDJ2"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ2"
FT                   /protein_id="BAJ00114.1"
FT                   /translation="MSRQESFSAVYQRASDRKGGDEGLESLLPNSNSNLSLDDIGQYSD
FT                   AQLLSEMSKKVFQSGFVWRIVENKWPAYEKAFFNFEPMKVLMLSPEQLHDRASDATLIR
FT                   HMKKTMAIYDNALMIQDIAREHGSLAEFIANWPGEDITGLWAQLKRRGTRLGGNTGPYF
FT                   LRAMGKDTFLLTGDVQAYMKAHKLVDFGFSSKSGLKQVQAVFNGWQQESGRSFADISRI
FT                   LAYGVGDNRV"
FT   CDS_pept        complement(167383..168141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00115"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ3"
FT                   /protein_id="BAJ00115.1"
FT                   /translation="MTVKMKLHYSLLLSGLLLSASSFAQAAESNSSSEVLGGTITGNLT
FT                   FASDYVFRGESETMDGDVPVVQGTLGWGNNDGWYAGVFASNIKFADPNLEIVTAPFIGK
FT                   AGEFGDSGFTYDVMVFSYLYPGASYSNYTELWLKVGKQFGRANIQLEVTPTIDDWFGVN
FT                   GWQGVNYAIHPSYAFSNGVNVSGSVGYQDLDGEGAEGWGHWNLGLSKVYLGLKFDLRYH
FT                   GSTVDETHKVYGTQTEIFDDRLVIGINKSF"
FT   CDS_pept        168558..169736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0145"
FT                   /product="multidrug resistance protein, AcrA/AcrE family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00116"
FT                   /db_xref="GOA:D4ZDJ4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ4"
FT                   /protein_id="BAJ00116.1"
FT                   /translation="MIGVLMRQIVKIASFLSVALWITACGQNGDVKPGHKPGSTEVGVI
FT                   KVTTLSQDIRIELPGRSKAFLEAEVRPQASGIITERSFVEGSDVHKGQSLYLIDSATYK
FT                   ARLLSTEADLASAKAGLVSAKAKALRFNELIKINAISQQDFEEADAQYKEALAKVAVAN
FT                   AAINTAKINLVYTEVKAPISGRIGKSSVTAGALVTANQTQILAKIQQLDPINVDIAQSS
FT                   AQLLRLKAKLRQGKLQATDNADVQLILEDGTTYAHAGVLRFAEVSVDENTGSVTLRAEF
FT                   PNPEGLLLPGMYVRAVLNAGTDPQAILVPQKAITRNSKGQAVAMLVNSDNKVESRVVTT
FT                   AEVIDHQWRIIDGLAVGDTLIVEGLQKIRPGAAVKPVAAASSTSASQSANQK"
FT   CDS_pept        169752..172895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0146"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00117"
FT                   /db_xref="GOA:D4ZDJ5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ5"
FT                   /protein_id="BAJ00117.1"
FT                   /translation="MARFFIDRPIFAWVIAIIVMLAGVLSIFGLPVSQYPSIAPPTVVI
FT                   SASYPGASAKTMEDSVTQVIEQRMTGIDNLRYISSTSDSFGNAQITLTFNAEADPDIAQ
FT                   VQVQNKLQLAMPLLPQEVQAQGVKVNKSSSGFLMVLGFVSKDGSLDKNDIADYVASNIQ
FT                   DPMSRVTGIGEIQLFGAQYAMRIWLDPLKLTQYKLTSIDIMASIREQNAQISAGQLGGS
FT                   PSVGGQELNATVSAQSRLQTPEQFEQIIIKSDSSGANVYLKDVAKIELGAESYAVESFY
FT                   NGKPAAGLAVKLATGANALATANAVRAKIEEMKPFFPQGIEVVYPYDTTPFVEQSIEGV
FT                   VHTLFEAVILVFLIMYLFLQNLRATLIPTIAVPVVLLGTFAILSAVGFSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMQEEGLSPVEATKKSMDQITGALVGIGLTLSAVFVPMAF
FT                   MSGSTGVIYRQFSVTIVAAMGLSVMVALILTPALCATMLKPMKKGQTHINTGFFGWFNR
FT                   SFDKLTSRYTDSVAAMIKRTGRVMLIYLALVVAVGWIFMRMPTAFLPDEDQGIMFTQAI
FT                   LPVNSTQESTQKVMEKVTDFYLNEESENVESVFSVSGFSFAGSGQNMGIAFVSLKDWTE
FT                   RKGAGQDVKSVAARAMGKFMQMKEAFVFAFVPPAVIELGTANGFDFYLQDRNGQGHEKL
FT                   VEARNMLLGMARENPNLVGVRPNGQEDAPMYQIHIDQAKIRALGVDINSVNSVLGTAWG
FT                   GSYVNDFIDRGRVKKVYVQGEAKYRMQPEDLDSWYVRNTKGEMVAFSAFATGSWEYASP
FT                   RLERFNGLPAMNIQGGTAPGYSTGAAMVDIEEMVKKLPSGFGVEWNGLSYEERLSGNQA
FT                   PALYALSIIVVFLVLAALYESWSVPFSVILVVPLGIIGSLIAMNARGLPNDVFFQVALL
FT                   TTVGLATKNAILIVEFAKEYYENGANLVDATLHAVRVRLRPILMTSLAFGLGVVPLAIS
FT                   TGVGSGSQNAIGTGVLGGMMSATFMGIFFIPIFFVVVERMFSKREKKKAVEAETSARL"
FT   CDS_pept        173048..173479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00118"
FT                   /db_xref="GOA:D4ZDJ6"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ6"
FT                   /protein_id="BAJ00118.1"
FT                   /translation="MDNQNYAGLKIRFVAALIDLGIMIPTVYLPLSLIYGGEYWEGEQA
FT                   LHGFWDLFLGYVLPFIATIFFWLKYLGTPGKMITKLKVVDAETGNKLTVIQALGRYFGY
FT                   FLAALPCFIGLIWIGLDERKQGWHDKLAKTLVIRKAEKG"
FT   CDS_pept        complement(173775..175361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0148"
FT                   /product="efflux pump component MtrF"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00119"
FT                   /db_xref="GOA:D4ZDJ7"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ7"
FT                   /protein_id="BAJ00119.1"
FT                   /translation="MPLKSAVSSEEHSGAFVRFLNIVERLGNLLPHPITLFAMFCMAVI
FT                   VISGIAGYFELSITDPRPLGSSGRSEDGLIHVVSLMNAEGLRMIVSNLVTNFTGFTPLG
FT                   TVLVALLGVGIAERSGMLSAAMRSLVIGTSKRLVTLTIVFAGIISNTASELGYVVLIPM
FT                   AAMIFHSLGRHPLAGLAAAFAGVSGGYSANLLLGTVDPLLSGITEAAAQMIDPLYTVGP
FT                   ESNWYFMFISTFLITILGALVTEKIVEPKLGKYDASEAAVDLSHQKMDSVSALEKRGLK
FT                   AAGIAILILSALLALTIVPEGAPLRNPETGLVAGSPFLKGIVAFIFICFAIPGMVYGKV
FT                   VGTMKRDKDVIDAMSHSMSSMGMYIVLVFFASQFVAFFKWTNLGAVLAVSGADALSAIG
FT                   LTGPLVFLLFIMMCGVINLMLGSASAQWAVTAPIFVPMLMLIGYAPETIQAAYRIGDSV
FT                   TNLITPMMSYFGLILAVASQYKKNLGIGTLIATMLPYSIVFFIGWTLFFFLWVFVLEMP
FT                   VGPGAATYYTP"
FT   CDS_pept        complement(175575..176771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00120"
FT                   /db_xref="GOA:D4ZDJ8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ8"
FT                   /protein_id="BAJ00120.1"
FT                   /translation="MQLMTILLLISVGMTFFMMGYVATTPHQNSKARLCFSMMLIGLLS
FT                   LMIELAIFEEGASYLYIVSISGPLSVSVPIFFYLYFKASMGLNDEFQWRNAKHLLVPCV
FT                   YLIVMMPYNLLGEAAKQHFFALVYTNEPIPWQLSLMPIRFSRLLLISGLGSVYLYLSWR
FT                   ELHVEMNKKKNDVLREINRLKVGFIGISISFAIVFGFFLFRLPHKFTWMISSIVIIITA
FT                   ISCMIFYYLPVLGKKIMTHQALDSIRSQAFDRTLDSAPTSHAVTDIAISVTAISVNKQY
FT                   RSSVTSNQSEEVIRDLVHLMNEGVYKDSKLSLGKLAGQLQISTHHLSQIINQQTQGNYF
FT                   DLINQYRIQDAKGLLLEGEMSVIDIAYEVGYNSKSSFYTEFKRRTQMTPHKFKQSHKH"
FT   CDS_pept        177040..179424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0150"
FT                   /product="aculeacin A acylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00121"
FT                   /db_xref="GOA:D4ZDJ9"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDJ9"
FT                   /protein_id="BAJ00121.1"
FT                   /translation="MIKNNKYKTYLTPIAVALTLSLAGCNGSDKDANEAEVLPSTVKIE
FT                   YTSFGVPHITASNYRALGYGQAYAHAQDNMCTLAEQIIEVRAQRAITFGAGDSNANVNT
FT                   DFGTLALNIYKDAENAVAGMTQEQADLLTGYVEGFNQAVLDKGGAQNYPSPCRGADWVP
FT                   ELSIVDLHAYHLKLAMFASGGALTTQIATASPVPSSKSLQKMLQEVASKNQDLGSNGWA
FT                   LGRDKTESGSGMLLSNPHFPWVGNLRFVENHLQIPGEINVTGVSFVGVPGVLIGFNENI
FT                   AWTHTVSQSKRFTTYKLTLDAEDPTRYLYEGEYLDMTSQEFTVSVKNGDGTSSEVLKTL
FT                   YSSHYGPMIGWYPDGTAVSYRDANANNGNMVSQWLAMDRAKTIEEFEAAFETYQGIPWV
FT                   NTMATDDKGNAFFIDGSRAPNLNSFAAILVKDFVNNDPVGKALWQGGRGQLVLDGSMSL
FT                   FEWVDTGKTPIPGVVPFERAPKLLRSDYVFNANSSHWLNNVEEPLEGYSIVYGPEQTIR
FT                   SPRTRMNATMLQEKSAQGISGADGKFNLEELKQVVMSQRGQLSEMIKDQLVDRCTGVGN
FT                   ITLDSQDVVDITAACEVLANWDGLYTNTSQGAHLFREFLKVFDVGGEQVLSDSLFELAF
FT                   DVKKPVSTPSQLAKHTGSVTSDPVLQALASTVQHLASVNIPLAAPLGALQYHMKNDEKL
FT                   AIPGGGTIDGVFNINTGGSAKVKSYGYPVFHGASWLMALEFTADGPKADAFLTYGQSHD
FT                   PESEHFADQTRLFSKGEWRPVLFTEQQIKDDLVETIELTLK"
FT   CDS_pept        complement(179637..179786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00122"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK0"
FT                   /protein_id="BAJ00122.1"
FT                   /translation="MIKIAKKMRGIHLNISTIASKLWFRIHAEKIVDSVSRLVVNKELK
FT                   PLAC"
FT   CDS_pept        180279..180815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0152"
FT                   /product="lemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00123"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK1"
FT                   /protein_id="BAJ00123.1"
FT                   /translation="MIIAYLWYVSLVKKRNAGREALSGIDVQINKRSNLVPNILKIAQT
FT                   FMDHEKALLTDITELRAQVSKSYDANDIADIGEHLAVAEQLNNKMGQLMGKVEAYPELK
FT                   SDNTMLEAMQTYNEIEVHLSAARRFYNAAVTELNHAVEIFPGSILASMANIKIMPFYEA
FT                   DDAAKASIDAADFIK"
FT   CDS_pept        181049..182032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0153"
FT                   /product="transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00124"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK2"
FT                   /protein_id="BAJ00124.1"
FT                   /translation="MITFTILSLIISILLSVSPALAGDKIKSDPQSESRSQPERKPHYK
FT                   ASYSETGLVVTQQASTATHFSDSTDVSANNNGVSGTQGSGKWIKSANSTSAVMSTAVKS
FT                   NKPHMLDNNSLIQAPSTPIPSYLQPSTSKSEILSTGISTNISQQIKVYQYKQTNGVMVF
FT                   SDHAPGADEYQVLLYDCYACGPDSDLDWRRMPLFSHDYDDLIGLAAKRYKLDPALIRAV
FT                   IHAESAFNVFALSRSGAMGLMQLMPETAKELGVSNAFRPDQNIDGGARYLAQMLKRFDG
FT                   DLELACAAYNAGPTTVAQYNGIPPYPETQAYVKRVKILLQRYRKLG"
FT   CDS_pept        complement(182274..183713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0154"
FT                   /product="Na+-driven multidrug efflux pump, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00125"
FT                   /db_xref="GOA:D4ZDK3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK3"
FT                   /protein_id="BAJ00125.1"
FT                   /translation="MQANATQSISGSSKQSINRTFWRYAIPSVAAMLVNGFYQIVDGIF
FT                   IGQYLGYEGLAGINMAWPIIYIFAGIGLMIGMGSGSLLSINRGQEQGSASTGTGEETLA
FT                   QSLKTNHTLATAAVLIIGFGLLGSLVLFMSGTSLLLAQGGTGNTLILAQQYIAPFSWSV
FT                   TFTILASAIPILIRNDESPNLATGLMVMGACLNILLDYIFIVQLNMALHGAAIATVSAQ
FT                   IAVASCGVIYFLSSFTKMKISNLTLNFANIRFDIKLARQILLLGSSSFVMYLYTSFVFA
FT                   LHNRLFMEYGSPVTVGAFAIVGYLMVLYYFVAEGLGEGMQPPVSYFFGAKQTENIKKVL
FT                   VLATKVTITAGIAWLLVLNLFPSTIIGLFNAEDTSLIQEATSGIRLHLFAMFLDGYLVL
FT                   AIMFFMAVNQGKKALGISIGNMLIQLPFLYFLPPWLGVKGVWLAMPISNVLMFIIVAPM
FT                   VWHYLKTDKDRKVNQFLESRF"
FT   CDS_pept        183861..184757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0155"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00126"
FT                   /db_xref="GOA:D4ZDK4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK4"
FT                   /protein_id="BAJ00126.1"
FT                   /translation="MNWTLYQLEAFVLSVNHGSFSAAARKLGRAQSRVSTAIANLEVDL
FT                   GFELFDRSAKLPVLTKHGEDMFIQAQAVLEQCQRLQSRAMTLNTGQEIALTVAMDEAVP
FT                   VNAFELLFEQVAIQFPLLKLTIINGSRDDIASWVDEGKADMGIVFHVRELPGSLEFMSI
FT                   GQFRQSLIVSPKHALAKISSPSIADLNQYRQLVIRDRVGDSQAKALSPNHWYIDSYYYM
FT                   TALVIRGVGWALVPEHVVNAEWYSGDVVELSTEYIPDPLLVEMGVVNRRDKAYGPVMEW
FT                   FFIEIESMFKSNKLQTY"
FT   CDS_pept        complement(184827..185669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00127"
FT                   /db_xref="GOA:D4ZDK5"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK5"
FT                   /protein_id="BAJ00127.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHAILLQVLKSMHKKNKPLAYIDTHAGA
FT                   GGYALTDEFAQKTGEYLEGVAKIWDKDDLPESLQQYIEDVKHFNQGKSELSFYPGSPGF
FT                   VDMNMRDKDRMVLHELHGTDHALLDEQLGSDKQVRVIKADGLKGLLGAVPPLERRGLVL
FT                   IDPSYEMKTDYQDVPNAIIKAYKRFSTGVYILWYPVVKRAQTEEMLKMLIGSGIKRQLR
FT                   IEQAVKADSDEFGMTAAGLWIINPPWQLDETATEMLDYLSPLLNQGGGKITVKWEVGE"
FT   CDS_pept        185855..186631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00128"
FT                   /db_xref="GOA:D4ZDK6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK6"
FT                   /protein_id="BAJ00128.1"
FT                   /translation="MPSTLQTSKPLGIFFNAQYPSLEAICQRWGLVFDKEAEFELVFEQ
FT                   NTLILNKRDEPKLKGISVDFVSGAVAHRRKFGGGRGQSIAKAVGLKQAVNPSVVDGTAG
FT                   LGRDAFVLASLGCTVTMVERHPVVAALLEDGLRRAYEDADIGDWMRERMILVHGSSLES
FT                   VIELGKEIDVVYLDPMYPHREKSALVKKEMRVFQSLVGADMDADGLLAPAIALATKRVV
FT                   VKRPDYAEDLDGVKPSMVIATKKNRFDVYVKAPMKG"
FT   CDS_pept        186995..187405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0158"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00129"
FT                   /db_xref="GOA:D4ZDK7"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK7"
FT                   /protein_id="BAJ00129.1"
FT                   /translation="MTHNVAELFAGKKVVLFAVPGAFTPTCSESHLPGYVVLADQFQAK
FT                   GIDIIACVSVNDAFVMKAWGQAQNASELMMLADGDASFTKALGLEMDTAGFGGVRSQRY
FT                   AMVIDNGVVTQLNVEAPKSFEVSKAEAVLAAL"
FT   CDS_pept        complement(187498..189327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0159"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00130"
FT                   /db_xref="GOA:D4ZDK8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK8"
FT                   /protein_id="BAJ00130.1"
FT                   /translation="MDIRRELDGYLHSGDTSQLELAKTQLQHIVASLSNNNDPDVESLS
FT                   FLLTLFIQDLDTDYRAAGKLAGNPRLLLAHAETEMLDNNRRLADYAAQGQDDNASLSEI
FT                   SLSNEYLRLTRQLPPLVYRLSQLTQGYLIGKDLRLEDILQSTITELKLWHDKLESLALI
FT                   GIYDIQEIDEFALGGGDEQVIEIGENFRSELLSLSNRYNREVNSTYNLLQDNQEVQERL
FT                   RSSIVEVEQAILTLITIKAEQDQRLKQELQIALYAVVSLLALFAVIYLLLQQSRVVSPL
FT                   KRLNHAFQTLSESNNRERLEINRRCETGQIAGHFNQLLQRFEDEDDFQRRQMTLVSCSL
FT                   SKLVQRISQITHSADETQNVVSQAQSQTDEIRNLAHEVSSTSALVENSAEQTKLQMKTS
FT                   QAEAQAMLLATEETQQAVVKSHQSLSSLTTSVEDVSKIIDVIGNIAEQTNLLALNAAIE
FT                   AARAGEQGRGFAVVAGEVRSLSHRTQDSLKEIMAILNQLNQANGELEVSMTGIEQATQR
FT                   QRERAQGLSSVALSVQDQASEMAETAKQGAINAQQQVNYLDEFVHAMKLLKDQALSASK
FT                   QSEVIGCEVQQSVQDIQTSLGISKNDTSLAQVA"
FT   CDS_pept        complement(189597..190907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="SVI_0160"
FT                   /product="osmolarity sensor protein EnvZ"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00131"
FT                   /db_xref="GOA:D4ZDK9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDK9"
FT                   /protein_id="BAJ00131.1"
FT                   /translation="MKWLIRLLPRSAFSQTVVLIGSLLLINQLVSYLSVAAYFIQPTYQ
FT                   QINQLIARQVKLLFVDGVDVGREYLTMVDALNAKVPDDGMQIYNQKQAREAGLEQATYY
FT                   ALLSSQMSEHLGGKAEVRIAQGEFFEIWIRPPQAPSVWIKIPLTGFNKYDLSPLTLYLM
FT                   VIGALSVAGGWWFARQQNRPLKRLQKAAISVSMGDYPEPLPLSGSTEIVEVTNAFNQMS
FT                   HSMKQLEQDRALLMAGISHDLRTPLTRIRLASEMMVAEDQYLKDGIVHDIEDMDAIINQ
FT                   FIAYIRQDQESIREQEQINHLIQDVVQAESNREGKIAVVLNECPEIPLQSIAIKRVLSN
FT                   LVENAFRYGNGWVRLSSHFDGRRVGFSVEDDGPGIPESEIPKLFQPFTQGDTARGSVGS
FT                   GLGLAIIKRIVDRHQGEVVLTNRVAGGLHAQVWLPLE"
FT   CDS_pept        complement(190971..191696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="SVI_0161"
FT                   /product="transcriptional regulatory protein OmpR"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00132"
FT                   /db_xref="GOA:D4ZDL0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL0"
FT                   /protein_id="BAJ00132.1"
FT                   /translation="MGQETSKILVVDDDMRLRALLERYLMEQGYQVRSAANSEQMDRLL
FT                   ERENFHLLVLDLMLPGEDGLSICRRLRQQGNTIPIIMLTAKGDEVDRIIGLELGADDYL
FT                   PKPFNPRELLARIKAVMRRQSQDVPGAPTQQEEEVTFGEFTLNLATREMYHDEEAISLT
FT                   SGEFAVLKVLVSHPREPLSRDKLMNLARGRDYSALERSIDVQVSRLRRLIEKDPANPRY
FT                   IQTVWGLGYVFVPDGTSRR"
FT   CDS_pept        193007..193537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0162"
FT                   /product="glyoxalase/extradiol ring-cleavage dioxygenase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00133"
FT                   /db_xref="GOA:D4ZDL1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL1"
FT                   /protein_id="BAJ00133.1"
FT                   /translation="MGDRQGKKAETLAQFHLAIPVHQLPAAKQFYCDVLGAKEGRATEH
FT                   HLDVNFYGHHLVLHATPEDASHLFDSFEADFHGESVQIPHFGINLDKLTWSQLAKRITL
FT                   MGYEFLDAPHIRLQGLPGEHASMFILDPSGNALEFKAFLNHDEVFSKVFDPQTKELFTL
FT                   DELMVSVSSEGLT"
FT   CDS_pept        193696..194181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greB"
FT                   /locus_tag="SVI_0163"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00134"
FT                   /db_xref="GOA:D4ZDL2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL2"
FT                   /protein_id="BAJ00134.1"
FT                   /translation="MKALLITRKGWQALDKELKYLWKEYRPEITKKVQEAAAQGDRSEN
FT                   ADYTYNKRLLRQIDGRVRYLVKRVEELKIVDYSPQQEGKVFFGAWVELENEAGEVVQYR
FT                   IVGKDELDTKLGYITIDSPMSRALIGKQVDDEIVVQTPSGAKEWYVNKIQYKAFTDE"
FT   CDS_pept        194174..195079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00135"
FT                   /db_xref="GOA:D4ZDL3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL3"
FT                   /protein_id="BAJ00135.1"
FT                   /translation="MNEPMAAKKLAHRRDPISDPLILDWQNIELPRTWADEINFKTRTN
FT                   VGRLFRSLFKKGNGRAELPDSFPPGILGKEDLPKYLQQEFHGIPNGNYSNNITKGYISA
FT                   FDVTMLGKMKPVRREIASWFNSCKRVLDLGCAGGHMAAALKDEGIADVWGLDPSPYLLK
FT                   HGAKANPKVNFIQGLAEDLKFSDRRFDGITASFLFHEMPPQYIDLALGECHRVLDEGGL
FT                   LAISEPSSIQFKASWWTMLKQYGFSGIYFKWLARHVYEPFVPAWHKQDIEQRLQGHGFE
FT                   VLINRRGMPEHTVLARKCTL"
FT   CDS_pept        195307..197649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0165"
FT                   /product="S1 RNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00136"
FT                   /db_xref="GOA:D4ZDL4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL4"
FT                   /protein_id="BAJ00136.1"
FT                   /translation="MQMTHNIAQIIAQELNVREQQVSSTISLLDDGATVPFVARYRKEA
FT                   TGGLDDTQLRTLHTRLSYLRDLNDRRDVIISSINTQGKLTPELNRALFEADSKTRLEDL
FT                   YLPYKPKRRTKGKIAIEAGIKPLADHLLNNRNADIEQEAAKYIKAQAGFTDSKLVLDGA
FT                   RFILMERFAEDAALLQKVRQHLSQNSVLESRMIKGKEKEGAKFRDYFEHTEKLSKIPSH
FT                   RALAMLRGRNEGILSLSMNADPSNESKQGSYCEVIIADHFKLNLSTGDVDSWLKTVVTA
FT                   TWRIKIALQMETEFIAKMREHAESEAINVFARNLGDLLMAAPAGAKTTLGLDPGLRSGV
FT                   KVAIVNNTGKLVAHSTIFPHAPQKQWDKSVRTLANLAKMHKVELIAVGNGTASRETDKL
FT                   AAELIASVKAELPRLTKIMVSEAGASVYSASELAANEFPDLDVSIRGAVSIARRLQDPL
FT                   AELVKIEPKSIGVGQYQHDVSQSQLSLSLEGVVEDCVNGVGVDLNMASAPLLAQVAGLN
FT                   KTLARNIVTYRDENGQFTQRKQLLKVARLGPKAYEQAAGFLRIFDGDNPLDASSVHPEA
FT                   YSLVETIAKAKGQAVEALVGNTELLRTLSAEEFITDKFGLPTVTDILAELDKPGRDPRG
FT                   EFKTATFKEGVEQVKDLKPDMILEGVVTNVTNFGAFVDVGVHQDGLVHISSLTDKFISD
FT                   PHTIVKAGDVVKVKVMEIDVERKRIALTMRLDEKAGDKPAPRAVQRSNSGGSKPNQQAK
FT                   SHNKSQPKQANAAMGNAFADAFAKLKK"
FT   CDS_pept        197970..200027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0166"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00137"
FT                   /db_xref="GOA:D4ZDL5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL5"
FT                   /protein_id="BAJ00137.1"
FT                   /translation="MASRFSFLGPFRSILCFCFIALILVTLSRIGLGLWQIERVSAVDG
FT                   WSHLLLQGLRVDLATLCWLWGVAALGTAIFSGDHAIGRGWKLILRIWLTLGLWLILFLE
FT                   VSSPSFIQEYGIRPNRLYIEYLIYPKEVLSMLWGGRKLEMILGFLISGASLVGGWKLSG
FT                   YLLRDLIYSRWYWRPVIALTVIVITLLGARSSLGHRPLNPALVAFADDPLVNSLVVNSA
FT                   YSLFFAINQMGNEANAAKIYGRMDEQTIIDTIRRESGRDPSGFPLASAPSVSFNPASYQ
FT                   GKPKNLVIILQESLGARFVGNLGGLPLTPNIDALSKEGWSFENLYATGTRSVRGIEAIT
FT                   TGFTPTPARSVVKLGKSQEGFFSIAELLKSHGYETQFIYGGESHFDNMKSFFLGNGFSN
FT                   IVDGDDYDNPSFVASWGVSDEDLLRRADQEFKQFHKEGKPFFSLVFSSSNHEPFEFPDD
FT                   KVELYEQPKQTVNNAVKYADYAVGEFFKLAKQSDYWKDTLFLVVADHDSRVGGASLVPI
FT                   SRFRIPGIILGDGVEPKKDLRVVSQIDMAPTLLSMIGISDSYPMLGQDLTRVSDDWPGR
FT                   ALMQYDKNMAYMRGDDVVVLQPEREATGFKYDFDTETLSVKPQSDEMKQAALSWALWGS
FT                   MAYQQGLYRSASQEERLAFKPAEDAAKLLLALENEEDNRATSQASEMLLR"
FT   CDS_pept        complement(200024..200533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0167"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00138"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL6"
FT                   /protein_id="BAJ00138.1"
FT                   /translation="MLVVTNYPQVPIATTNAATDAARVDSQQRPPIVPTPELVKSHEER
FT                   PFTAQHERTAEQPEIQARLNERMLGKHQGGGQQQEEKQQQDTEKQAQASSIARDPLRGR
FT                   PALNRRDIRIAQQADSVSNHKQTQPQKGELVGQSKEFYQAVSLHITSFYQEQALPKTEP
FT                   GISAFV"
FT   CDS_pept        complement(200613..201398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="SVI_0168"
FT                   /product="bioH protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00139"
FT                   /db_xref="GOA:D4ZDL7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL7"
FT                   /protein_id="BAJ00139.1"
FT                   /translation="MSQAQLHIESIGPVSAPEIVMLHGWGMNSAVFTPLHLSLSEYRVH
FT                   YVDLPGFGHSSAIEGDINDWLEVLISRLPEKAIWVGWSLGGLLATLAALNYPNRVTGLV
FT                   TIASSPCFMAREEQKWPGIPPHVLSQFGESLHKDLGKTVERFLTIQAMGSATAKEDIKQ
FT                   LKKLVLARPLPDSKALLQGLNMLECVDLRPKLDLINLPWLRIWGRLDGLVPRRVPPLMP
FT                   LNETLYRDIILPKASHAPFVSHTDEFLAGFVTWIEEITN"
FT   CDS_pept        201495..202202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="SVI_0169"
FT                   /product="competence protein ComF"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00140"
FT                   /db_xref="GOA:D4ZDL8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL8"
FT                   /protein_id="BAJ00140.1"
FT                   /translation="MKLWLGASLPNRCLMCHQSVSLPSTGICVTCLDSGLYQQPVCLGC
FT                   GRGLQIQSRYCGTCQSTEPLLVISPCSYHQGLGRWVGSIKYRAQFAGLPALSAALVARI
FT                   HKLEAAGFIHRPQVLVPVPLHETRLKARGFNQAWIIADTLSKRLNIPIETHSLVRSLDT
FT                   QSQAGLTGKQRRKNLKNAFNLDDYFPYQRIALIDDVVTTGTTAKEIASLFERRHIHVQV
FT                   WCLARAEAPGLLD"
FT   CDS_pept        complement(202434..204980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00141"
FT                   /db_xref="GOA:D4ZDL9"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDL9"
FT                   /protein_id="BAJ00141.1"
FT                   /translation="MLKTGLFLLTLFCSLSLTSPVIAADSQRVISVSNSNLDPVITSPD
FT                   AFLGYPLGQWHLRHDQVNYYLKQLARDSAKVSIEDTGQSHEARQQLTAVITSSENQTKL
FT                   NDILAQRQTVKSGANQAGPLVIWLAYSIHGDEASGAHAALSLSYFLASSKEPWVKQLLD
FT                   EAVVLITPSQNPDGMDRFSTWTNNYRGQTDVSDSNHKEHRQNWPNGRTNHYFADLNRDL
FT                   LFLRHPETRGRVALFHRWQPHYVGDFHEMGRDKSYFFQPGVPSRTNPATSKPNQLLTEK
FT                   LAHFHRKALDGLKQSYFSREGFDDFYYGKGSTYPDINGSVGILFEQASSRGQVQITKNG
FT                   ELRLSQAIENQLATSISSLKGCLALKDELIEYQSDFYQGRDKVLQRGRQTGFLLGAPAN
FT                   RARIEDLTKLLSQHKIKFYYLTNTVNQGGIDFNPDTSLFIPINQPQKSLLLAMFDNSTE
FT                   FEDPTFYDVSSWNLEHAYHLQMVRNSKLDIDVLSPQAPAKFNFKMSEQAVAVLVNWQQD
FT                   LAAPMLQALLQDNLLVKFALKPFTIKVAGETKKFPAGTLQIPLKQAGHTASEIKDKLVK
FT                   LAKQYPLNLYSVTTSASTSGIDLGSPSFKIIKPIKPLLITGRGTDASEVGQLWYYLDSK
FT                   LSVPVTLVDVGHISKIRLNRYTHVIMASGNYSSLDEQFARQLGKFTSDGGTVIAQKGAL
FT                   TWLNKNNLLKSDIKDTRFYLRLFDTRGLSYGDKEKLAARQSIGGAIVELKLDPSNPISF
FT                   GIRGNRLPILKNMAIGLTTSSTPFTVAAKYADEPLLSGYLAKEYQASFSNNPAIVLETR
FT                   DQGAIVGLADNLMFRNIWLGSEKIYANALYFVPALN"
FT   CDS_pept        205232..205810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhgI"
FT                   /locus_tag="SVI_0171"
FT                   /product="yhgI protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00142"
FT                   /db_xref="GOA:D4ZDM0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM0"
FT                   /protein_id="BAJ00142.1"
FT                   /translation="MITISDAAQAHFVTLLADQPEGTHIRVFVISPGTATAECGVSYCP
FT                   PDAVESDDTELEFTGFNAMVDAKSVPFLEDATIDFVTDQLGSQLTLKAPNAKMRKVNSD
FT                   ASLNERIEYVIQSEINPQLASHGGNIMLMEVSEEGVAILQFGGGCNGCSMVDVTLKNGI
FT                   EKQLLDMFPGELTGVRDITEHQAGEHSYQ"
FT   CDS_pept        complement(205929..207266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="SVI_0172"
FT                   /product="DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00143"
FT                   /db_xref="GOA:D4ZDM1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM1"
FT                   /protein_id="BAJ00143.1"
FT                   /translation="MTPVELIRNKQKNRQLLALALPMILSNITVPLLGLVDTAVVGHLS
FT                   NAYYLGGVAVGSTIITLILWMLGFLRMATTGLVAQSYGAGDTQAQYKLLLQASSLALIL
FT                   GLSAVLLQLPILNTALMLTDASLEVQRYTREYFEIRIWSTPFALLNLVLLGWLLGRQQP
FT                   KAAMWQLIVANLANIGLDLLFVLGLGWGVQGAALASVFADMSGFMVALTMVYKQVQKTG
FT                   GFDFLKLYKSLSLSSYHKLLSLNADIFVRSLCLQIAFAFMTFHGAGLGDNTVAANVILL
FT                   NLLLLISYALDGIAYYAEAEVGKAYGQRNKTLMREAVTLAWFWSAISALLFTLVFAFGG
FT                   ESIIKMLTNIEEVRSVADEYLFWIVLLPILSFGSYLFDGVYIGAAKGKVMRNSMIISTF
FT                   GVFFPVWFFLQDSGNHALWAAMSCFMLARSITLTLHYRYKLKDADF"
FT   CDS_pept        207289..208350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0173"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00144"
FT                   /db_xref="GOA:D4ZDM2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM2"
FT                   /protein_id="BAJ00144.1"
FT                   /translation="MFKNALITLLVLFSLSLQAFTAQAAVILLYHHVSDGTPAITSVTP
FT                   AQFKEQMQYLADNDFIVVPLSQVVDAIRNLRPIAEKTVVITFDDGYKSVAETASPILKE
FT                   YGFPYTLFVSIEPIKAKYRGMMSWEELIKLSKEGAEIANHSWGHEHLIRKLAGETEPQW
FT                   ILRTEKNILDSEAEIRKATGQDHKMFAYPYGEYNQALEDIISRNGFVGLGQQSGAAGRY
FT                   SSLTALPRFPVAGVYADLASLKVKMHSLNMPVLSLTPKDSELKDGNWRPELTLTLDISD
FT                   IYPHQMMCFIQGQGAKKPLWLSENEFSIRAEFDLPPGRSRYNCTVPSKTKSGYYWFSQA
FT                   WVRPNDDGSWSKE"
FT   CDS_pept        complement(208392..209432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB-1"
FT                   /locus_tag="SVI_0174"
FT                   /product="chemotaxis response regulator protein-glutamate
FT                   methylesterase CheB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00145"
FT                   /db_xref="GOA:D4ZDM3"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM3"
FT                   /protein_id="BAJ00145.1"
FT                   /translation="MISVLVIDDSPLVRQLLSHLLNSADDIKVVATAEDPYEARDLIKK
FT                   LNPDVLTLDIEMPKMDGIAFLRNIMKLRPMPVVMVSTLTAKGAAITLEALSIGAVDFIS
FT                   KPKADLTHQLMEYKQELIDKVHLAYKSKARPRSLSASITKPLNGEMFTNRLIAIGASTG
FT                   GTEAIQSVLRQMPSNTPPVVIAQHIPAAFSASFARRLDNNCVMKVIEARGGERLRQGTA
FT                   YLAPGNKHMIIERRGGLLFTKLVDSDPVNRHKPSVDVLFNSVAESAAKSTIGIILTGMG
FT                   KDGVKGLLNLKNRGAYTIAQDEASSVVWGMPGAAVELNAHHEQMHLDRIPQKLLFLLKT
FT                   ENSKAS"
FT   CDS_pept        complement(209505..210371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR-1"
FT                   /locus_tag="SVI_0175"
FT                   /product="chemotaxis protein methyltransferase CheR"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00146"
FT                   /db_xref="GOA:D4ZDM4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM4"
FT                   /protein_id="BAJ00146.1"
FT                   /translation="MELVDKKEFSMTKKNFEFIQSLAYEETGIVLPERKKHMVYSRLSR
FT                   RLRHLGLDNFNQYCDHIQSEPGELMNFVNALTTNLTAFFREEHHFDYLDKEITPLWRRR
FT                   RNKRLRIWSSACSTGEEPYSIAMTLAEHFSGSEWDLKILATDLDTNVLSKAAKGCYAED
FT                   SITGLADRYRKKYIKITPNGIQIKQSIQNKIHFKQLNLLQKWPMTGPFDVIFCRNVLIY
FT                   FDNETKAKIIAKFRKLLAPDGLLFIGHSETLTNLSDEFELIGQTIYQPLRGGHAKVIGE
FT                   RKKAVIG"
FT   CDS_pept        complement(210493..214071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0176"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00147"
FT                   /db_xref="GOA:D4ZDM5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM5"
FT                   /protein_id="BAJ00147.1"
FT                   /translation="MFEQALTEVSNALISNEAPKFSDLFLPGWELLTSRIDELYQKRQR
FT                   DETALKALDICNANVMMADADHNITYLNDAVNVMMTKNEKTLQTELTGFDVKKLVGQNI
FT                   DIFHKNPAHQRRMIDGLTTTYETTIQVAGLHFNLIANPIFNNGVRTGTVVEWQDITAKL
FT                   AREAEEKQQAADTGRIKQALDVCKANVMMADADYNIIYLNESLNEMLSENERTLQQSLA
FT                   KFDMKTLMGTNIDIFHKNPAHQRGMLDKLTSTYATSIEVSGLTFDLIATPVFDNGVRTG
FT                   TVVEWQDITAKLAKEKEEAKQAADTSRIKQALDVCKANVMMADADYEIIYFNDSLTEML
FT                   TENEKTLQQELRSFDMKTLLGANIDIFHKNPAHQRGMLDKLTSTYETSIQISGLTFELI
FT                   ATPVFDKGQRTGTVVEWQDVTAKLVKEKEEQELAADTNRIKQALDVCKANVMMADADYK
FT                   IIYFNDSLNEMLSENEKTLKQSLKKFDMRTLMGSNIDIFHKNPAHQRGMLDKLTETYST
FT                   SIQVSGLTFELIATPVFDNSQRTGTVVEWQDVTAKLAREKEEKQQAAETGRIKQALDVC
FT                   KANVMMADADYNIIYFNESLNEMLGENERTLKQSLSRFDMRTLMGSNIDIFHKNPAHQR
FT                   GMLDRLTETFETNIEVSGLTFGLIATPVFDNGERTGTVVEWQDLTDKLAREAEEQQLAA
FT                   ENARIKQALDNVSANTMVADADLNIIYMNNAVGNMFRNAQSDIIKDLPNFDANNLIGVN
FT                   IDDFHKNPAHQRGLLGGLTSTYSSQLLIGGRTFKVVANPIKDDKGDRIGTVVEWTDRTA
FT                   EVAIEHEIDTIISSAAAGDLSHRVSTEGKDGFFLNLSNGLNRLVGIADNVISDVVNMFD
FT                   GLAKGDLTRQINGEYEGQFGKLQTDANATVSRLTEVLGGISESANTVTSGAEEIAQGNA
FT                   DLSQRTEEQAASLEETASSMEQMTATVTQSAQNATLANELAQEANSKAEHGGKVVEQAV
FT                   SAMEAINDSSKRISDIIGVIDEIAFQTNLLALNAAVEAARAGEQGRGFAVVAGEVRNLA
FT                   QRSAGAAKEIKELIRDSVGKVTDGTQLVNQSGETLEDIVQAVTKVADMISQISIASDQQ
FT                   SSGIQEVNKAISQMDEMTQQNAALVEQVSAAGEAMADQARNMKTQLGFFQTSGNTSSGM
FT                   ASAPLALVSGDTHGNLSISKEEWNEF"
FT   CDS_pept        complement(214278..214853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW-1"
FT                   /locus_tag="SVI_0177"
FT                   /product="purine-binding chemotaxis protein CheW"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00148"
FT                   /db_xref="GOA:D4ZDM6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM6"
FT                   /protein_id="BAJ00148.1"
FT                   /translation="MTEQIQNEPPQHDHGMKQDNDEDSQQYLTFIMANEEYGVEILSVQ
FT                   EIRGWESTTVIPNAPSHVKGVINLRGTIVPIIDLRQRFGIEVLDYGATTVVIVVKVAIA
FT                   NEHKVIGIVVDAVSDVFSVNNDDVRDAPNFGEGTDLSFIKGLTNASDKMVILLDINMLL
FT                   GSEVLPEAEQLSNLINTLDAPQQQVVNA"
FT   CDS_pept        complement(215036..217144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="SVI_0178"
FT                   /product="chemotaxis protein CheA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00149"
FT                   /db_xref="GOA:D4ZDM7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM7"
FT                   /protein_id="BAJ00149.1"
FT                   /translation="MEIDLSQFSQVFFEESLEGLDAMESELLNLDVTSPDDEAINTIFR
FT                   AAHSIKGGSATFGFSQVANYTHLLETLLDEIRDGRRQMTSEHQEMLLLSVDLLRNMFDA
FT                   LMRKIDFDDPQLAQLEEQFNIEIDKGTQDSAPKEPDSSSDTSTEEESLGLHRWIIDFQA
FT                   GVDILRCGNDPYLMFNELSQLGDLSVNLAEHSSPEFTDIDPEACYLNWQLELITDQPLE
FT                   RLHEVFEWVEDECSISYSSTPIMNENTELDNEVSTIAPSGQDLSQESASEAVQANVESN
FT                   RVDETKASSQGSKPKAVSQAKTPETSSIRVSIDKIDLLINMVGELVITQAMLGQIGQQD
FT                   EIDEESLIALKQGLEQLATHTRDLQESVMQIRMLPISFAFNRFPRLVRDIGQQLGKKVN
FT                   LVLKGEDTELDKTVMEKIVDPMVHLVRNSLDHGLETPAERLAKGKSEVGTITLNAFHQG
FT                   GSIIIEIIDDGAGLDTDRILRKAREKGLVGQEEELSTEAIHKLIFKPGFSTADAVSDLS
FT                   GRGVGMDVVRRNINDLNGTIELKSIQDKGSRFTIRLPLTLAILDGQLVRVGKHIYVVPL
FT                   VSIHESLQVEPNKINRLSDGHELIQLRNEYLPVIKVYQEFRHTSDAKEIKDGLVMVVDS
FT                   NNEKIGLLVDELLSQQQVVIKSLEDNYNRVPGVSGATILGDGTVALIIDVTGLVSMAGI
FT                   TNIKEHAA"
FT   CDS_pept        complement(217185..217547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY-1"
FT                   /locus_tag="SVI_0179"
FT                   /product="chemotaxis protein CheY"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00150"
FT                   /db_xref="GOA:D4ZDM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM8"
FT                   /protein_id="BAJ00150.1"
FT                   /translation="MKKILAVDDSASMRQMVCFTLKTAGFDVTEACNGDEALKVAQQGE
FT                   YDLVISDVNMPIMDGLTLIRNLRTLPNYKFTPLLMLTTESGTEKKQEGRSAGATGWIVK
FT                   PFNPDQLLATVRKVLG"
FT   CDS_pept        complement(217544..217858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00151"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDM9"
FT                   /protein_id="BAJ00151.1"
FT                   /translation="MSEQRIRLDSELTIRNIQPIFTQLSALLTHDEELHIDASQLSRVD
FT                   TAGAQLLYLFSRTCASRSLKVDWLNCRPELKANLENLGISIPEIAIQELPAEQDEEKIL
FT                   "
FT   CDS_pept        complement(218254..218946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0181"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00152"
FT                   /db_xref="GOA:D4ZDN0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDN0"
FT                   /protein_id="BAJ00152.1"
FT                   /translation="MAKTFRIIAVALLGLVLLGLGGVISVQQQKSKQTNAIITSMQDTE
FT                   LDLATSFVFPIAKPLAPFSLTDQDGNAFTNSQLNNKWSLFFIGYTSCPDVCPTTMGKLT
FT                   AAYPKLLENADLQVVFLSVDPQRDTRAKLFSYMNFFNPEFIAITGGHGQLFPLTRDLGF
FT                   VYAMVGDGEDYQVDHSASMALISPDGSKVAIIKPKSSAPGKLPQILNKHLITDIQTIIA
FT                   NYKPAPRS"
FT   CDS_pept        complement(219014..219928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE-1"
FT                   /locus_tag="SVI_0182"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00153"
FT                   /db_xref="GOA:D4ZDN1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDN1"
FT                   /protein_id="BAJ00153.1"
FT                   /translation="MAKPLSISATEPKTHNESLQWRAYYEMTKPKVVALMLLTVLVGMC
FT                   LAVPGSVPLQPLIIGMLGIGMMAGAAAAFNHLIDRRIDGLMARTYNRPLPKGRISITKA
FT                   LIFSFSLALLGFALLYTLVNELTAWLTFASLVGYAIIYTTYLKRATPQNIVVGGLAGAM
FT                   PPLLGWTAITGEFHGHALLLVIIIFTWTPPHFWALAIHRRAEYAKVDIPMLPVTHGVEF
FT                   TKTCILLYTLLLAIACLLPVIVGMCGPIYLVGSTILSCGFIYKAWELKYDDKPGLAMQV
FT                   FRFSIYHLMILFIVLLVDHYLWV"
FT   CDS_pept        complement(219997..220980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0183"
FT                   /product="cytochrome oxidase assembly protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00154"
FT                   /db_xref="GOA:D4ZDN2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDN2"
FT                   /protein_id="BAJ00154.1"
FT                   /translation="MGIQNLLRVTLVFTLCVILMGAYTRLSDAGLGCPDWPGCYGMMKV
FT                   PSQHSELMQAQDAFPGQEVEPKKAWLEMIHRYIAGALGLLVLIIFILCLKKLDAPKKLP
FT                   TFIAILILFQAALGMWTVTMKLMPIVVMSHLIGGFALISLLLLLYLRTKPLRIPGGDFV
FT                   ARRLAPLALTGMGVLILQIILGGWTSSNYAALACTSLPICEGNWYQNLQPAQAFNPFQG
FT                   THETYEFGVLDYYSRMTIHVAHRFGAILTTGILLWLAYKLFTQSQSALLKRASLVLTGL
FT                   VVLQVALGISNVVLHLPLGIAVSHNGGAAILLLTLVFINYALWRKA"
FT   CDS_pept        complement(220980..221525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0184"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00155"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZDN3"
FT                   /protein_id="BAJ00155.1"
FT                   /translation="MNSPKKSGAKPLILLFLVFVLPVAAAKIVLSLDLYQGGATNKGKL
FT                   LPVGTSYLSLKMDNPKPREWQLLYLLPNKCDQQCQDHLYILQQSHIALGRDQDRVHTLI
FT                   LLSQDSDTHALASYSFETAKANDAMIKMLDRQQMIVVDPLGSLVMEYPAVNGIDKQIMQ
FT                   GKSLVADLRKMLKLSRLG"
FT   CDS_pept        complement(221675..222511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00156"
FT                   /db_xref="GOA:D4ZEC6"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEC6"
FT                   /protein_id="BAJ00156.1"
FT                   /translation="MAKLSRRRNTYLWATRAASATASVIMFLILVKLGFWQLDRAEMKE
FT                   QWQAELTHRQSSAPLTYAQLLTFPAAKQVTGYRLSVRASPAMSKIFLLDNQVFNGRVGY
FT                   LALQPMQIAAEGPWILVELGFVAAGLDRRILPDVDVITTKVSLNGRLYQRQANPMSSAL
FT                   MPEAGWPKRIQNLNLDAISQLLGKPLAPGVLQPDRLDGIDLPHPWSPIPLSSQKHRGYA
FT                   LQWFSMALAFALLILYFIYSRRSKTLTKQQDESIKNNNPHRTNIDAMTVANVNKTK"
FT   CDS_pept        222572..222691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00157"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEC7"
FT                   /protein_id="BAJ00157.1"
FT                   /translation="MINIASEQIADAALVAHRYVFLRRERLVIIFSLVFSDDI"
FT   CDS_pept        222922..223140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00158"
FT                   /db_xref="GOA:D4ZEC8"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEC8"
FT                   /protein_id="BAJ00158.1"
FT                   /translation="MNLLIIFKIVLVLLLLFIMFNLARALFILVKGESETPASHFLGRR
FT                   VIFSVLVVLFILVALGSGVITPNPRPY"
FT   CDS_pept        complement(223195..224070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0188"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00159"
FT                   /db_xref="GOA:D4ZEC9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEC9"
FT                   /protein_id="BAJ00159.1"
FT                   /translation="MTTKHEHYYVPAQSAWPIIGAVGLFLIAFGAGSYVQQLKTGGGSG
FT                   GIILLTGVAVIIFMIFGWFRTVIAESMSGLYSKQMDRSFRQGMSWFIFSEVMFFGAFFG
FT                   ALLYARMIAVPWLGGDSNNAMTNEVLWPGFEAIWPLLTTPDGTKTEAMPWTGLPLYNTI
FT                   ILLTSSVTLHMAHVSLEKGKRSAITVWLGITILLGMSFLTLQVEEYIHAYQEMGLTLAS
FT                   GVYGNTFFLLTGFHGMHVTLGTVFLIVLFMRVLKGHFTPDKHFAFQAGSWYWHFVDVVW
FT                   LCLFIFVYVL"
FT   CDS_pept        complement(224067..224636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxG"
FT                   /locus_tag="SVI_0189"
FT                   /product="cytochrome c oxidase assembly protein coxG"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00160"
FT                   /db_xref="GOA:D4ZED0"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED0"
FT                   /protein_id="BAJ00160.1"
FT                   /translation="MSNNQGKSNRKLIGMLIAGAVGMFGFGFALVPLYDVLCEQLGING
FT                   KTQNSASTYKPITIDKNRTITIEFMAQIQSDMPWEFKPEVKRMQVHPGELIRTNFTAKN
FT                   LSLKDTIGQAIPSVSPGQGAAYFNKTECFCFNQQRLMAKESAELPLIFFVDPDLPDSIK
FT                   TLTLSYTLYNITDRGYVGSVEQGAAR"
FT   CDS_pept        complement(224639..226234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0190"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00161"
FT                   /db_xref="GOA:D4ZED1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED1"
FT                   /protein_id="BAJ00161.1"
FT                   /translation="MEVGQVEETKDHQDEHHQQHPSGIKRWLFTTNHKDIGTLYLWFSF
FT                   IMFLTGGAMAMVIRAELFQPGLQLVEPNFFNQMTTVHGLIMVFGAVMPAFTGLANWLIP
FT                   MMIGAPDMALPRMNNWSFWILPFAFAILLSSLFMEGGGPNFGWTFYAPLSTTYSPDSTA
FT                   LFVFSIHIMGISSIMGAINVIVTIVNMRAPGMTWMKLPLFVWTWLITAFLLIAVMPVLA
FT                   GTVTMVLTDKYFGTSFFDAAGGGDPVMFQHIFWFFGHPEVYIMILPSFGIISAIVPTFS
FT                   RKRLFGYSSMVYATSSIAILSFLVWAHHMFTTGMPVFAELFFMYCTMLIAVPTGVKVFN
FT                   WVATMWRGSLTFETPMLFAIAFIILFTIGGFSGLMLAITPADFQYHDTYFVVAHFHYVL
FT                   VTGAIFSIMAAAYYWLPKWTGNMYDERLGKIHFWCSVISVNVLFFPMHFLGLAGMPRRI
FT                   PDYAVQFADVNQIVSIGGFAFGLSQFIFLALVIKCIRGGEKAAAKPWEGAEGLEWTLPS
FT                   PAPYHSFTTPPEIK"
FT   CDS_pept        complement(226277..227398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0191"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00162"
FT                   /db_xref="GOA:D4ZED2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED2"
FT                   /protein_id="BAJ00162.1"
FT                   /translation="MKRVLYSFLALLFTPYVLASGMPFNMTKGVTDISGQVYNLHMIIL
FT                   YICCAIGVVVFGVMIYSMINHRKSKGAVAANFHESTKVEIAWTITPFIILIAMAIPATK
FT                   TLVAMEDSSDADITIKITGSQWKWHYSYFDQDIEFYSLLSTPREQIEGTEEKGENYLLE
FT                   VDKPLVLPINKKVRFLMTSEDVIHSWWIPAFAVKKDANPGFINEAWTRIDIPGTYRGQC
FT                   AELCGKDHGFMPIVVEALSQADFDIWVAEQKNQASAAAAEAEASLSQSLSMDELMAQGE
FT                   QVYMSRCAACHQPNGMGLPGVFPPMKGSPITTGPLMDHLEIVINGKAGTAMQAFGKQLT
FT                   AQEIAAVITYERNAWDNNTGDTVQAADVSQHGQ"
FT   CDS_pept        complement(227830..228348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00163"
FT                   /db_xref="GOA:D4ZED3"
FT                   /db_xref="InterPro:IPR004596"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED3"
FT                   /protein_id="BAJ00163.1"
FT                   /translation="MVMKNMIGNSPRHPGLWTNPLNQASIEQECGSITTVTSYTQGRVE
FT                   LKQVSNQLATLSHQGQWIVLISPPNIGYKQMLAEAGVRMDRVLLVHAKDEIETLWAMEK
FT                   ALISGTSSAVICWTQALDSRDNRRLKLVEKSARALGIVIEDANNHLHSKAHTQRDTHFS
FT                   QASLFGSLH"
FT   CDS_pept        complement(228378..228995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="SVI_0193"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00164"
FT                   /db_xref="GOA:D4ZED4"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED4"
FT                   /protein_id="BAJ00164.1"
FT                   /translation="MRPLTPRQAEILELIKRNIIDTGMPPTRAEIAKRLGFKSANAAEE
FT                   HLKALAKKGCIEIIPGTSRGIRLTQAAEPEDLGLPLIGQVAAGEPILAQEHIEQHYKVD
FT                   PAMFRPSADFLLRVRGDSMKNIGILEGDLLAVHKISQAKNGQIVVARVEEDVTVKRFEK
FT                   KGSMVYLHAENEDYAPIVVDLTSQSLSIEGLAVGVIRNGSWQ"
FT   CDS_pept        229267..231690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="SVI_0194"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00165"
FT                   /db_xref="GOA:D4ZED5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED5"
FT                   /protein_id="BAJ00165.1"
FT                   /translation="MSKKDSLWYKSLRWIQKQLVQTVVVPHDPFADLNLDPDKPVVYVM
FT                   KTESLSDIAALSEITGKYRLPSPYDELVVDGDRTPRVVCLEGAKPLFGERESNEFFLNS
FT                   FMDLLKVHKEKPELDIQLVPVSLYWGRTPGKEDDTMKAAVLERQNPTWLRKCFMILFLG
FT                   RHNFVQFSNAVSIRHMADEHGTDKRIAHKLARVARVHFSRQRKVMTGPVLPKRQVLFQD
FT                   LLNSESLKKAIKEEAASKKISEAEAKAKAMEYLDEVAADYSESLVRIAERFLTWLWNKL
FT                   YKGINIKGAEQIRQLHHDGHEIIYVPCHRSHMDYLLLSYILYYEGMVPPHIAAGINLNF
FT                   WPAGPMFRRGGAFFIRRSFRGNKLYTVVFREYLDQLFTKGYSVEYFTEGGRSRTGRLLA
FT                   PKTGMIAMTLNSVLRGMERPVTLVPVYLGYDHVMEVATYHKELSGKKKKKESVWQLFGA
FT                   LRKLGDFGQGYVNFGQPITLNNYLDEEVPGWKEEMAKDPEQRPKWLSPVVNTLANRVMT
FT                   SINDAAAVSSVTLTSLVLLASEQHALERSQLVKQLDLYLKLLKDLPYTEFTSVPEGDGE
FT                   LLVQQGLDLKKLQLDSDPLGDIISIEDSIAVAMTYYRNNIIHLLIVPSLIASCLTQHEH
FT                   VTRDEIIATVKDFYPLLKAELFMGIEDIDTRVSQILDLFIAQGLVTESEYLTPVDSQIN
FT                   QLLLLAGTVSETMQRYAIIFNLLAARPLMERFELEGESHRLAQRLGALHGITAPEFYDK
FT                   KLYGALSVKLKALGYILDSDKRGDVERIRQRANGLLRSSVRQTIEDSVAAEHKA"
FT   CDS_pept        231702..232946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtr"
FT                   /locus_tag="SVI_0195"
FT                   /product="tryptophan-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00166"
FT                   /db_xref="GOA:D4ZED6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED6"
FT                   /protein_id="BAJ00166.1"
FT                   /translation="MNAAKSGTERRSLIGGAMIIAGTAVGAGMFSLPVVGAGMWFSYSI
FT                   AMLICVWFCMLVSGLLLLETNLHFEPGASFDTLTRETLGNFWRIVNGLSIAFVLYILAY
FT                   AYISGGGSIVNHSLEAAGIKLPQSAAGLVFALGLAFVVFISTKAVDRITTIMLGGMIIT
FT                   FFLAVGNLLIDIDTVKLFNPDGEKTYLPYLLAALPFGLVSFGYHGNVPSLVKYYGKDPA
FT                   TIIKAIVLGTLIAFVIYVCWLVATMGNISRSEFVDIIAQGGNMGVLVGALSGVIASDWL
FT                   TSMLTLFANLAVASSFLGVTLGLFDYLADLFGFDESRSGRLKTATVTFVPPTVLGLLFP
FT                   DGFLIAIGFAALAATIWAAIVPALMAHRVRKMYPEYEGFRVPGGTPVIVIVILFGIITG
FT                   ACHLLAMADLLPVFG"
FT   CDS_pept        233090..233746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0196"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00167"
FT                   /db_xref="GOA:D4ZED7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED7"
FT                   /protein_id="BAJ00167.1"
FT                   /translation="MKITQAERDAVYKTIFNRRDVRAEFEATPIPDDVLKRILTAAHHA
FT                   PSVGFMQPWDFVIVRSDETKQKLKQGFIQANREAEALFEGERKEQYRSLKLEGIQEAPI
FT                   GICVTCDRTRTGPLVLGRTANLDMDLYSSVCAVQNLWLAARAENIGVGWVSIIHDHVLH
FT                   QTLGIPEHIVPIAYLCLGYVSHFHDQPELEKRGWLKRQSLNSLIHEEQWQDKSHK"
FT   CDS_pept        complement(233754..234758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0197"
FT                   /product="AraC-type DNA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00168"
FT                   /db_xref="GOA:D4ZED8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED8"
FT                   /protein_id="BAJ00168.1"
FT                   /translation="MKFNTSFIRACYMGAVFTGVERVYGITTEELNIPQALMDEPMALI
FT                   PFGQICIWLERLEQVTQDPAYMLKLAQHLDFSRLNVPGISFLATTDLAMSVRRINYGIA
FT                   SFQSGASYYIIQSGKIIKWCYRNPYAFNQHKTHDSLRVVIMLFNTLKHFLGDEYRPLQV
FT                   HISGPKVGKQDAESLFNCPVIWNAPQTEIWIDTDALVQQSSVPLEESSTISMPRTVFEQ
FT                   YLDMPQPHDTPKVLFEMVNYARFYGLPTVDKVAALFNISRQQLQRRLLLHGFNFTSIRG
FT                   YILSNQGIKYMLDGRSIEEITLLLGYANKQSFSKAFKRFRNCTPQEYLARIKP"
FT   CDS_pept        234976..235317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00169"
FT                   /db_xref="GOA:D4ZED9"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZED9"
FT                   /protein_id="BAJ00169.1"
FT                   /translation="MSLISMPFVDSGLDTTLHIVAAIVMITTLAAMAIGFWKIHELPIN
FT                   KAHKEEHHQIGLITALTWIGFLWHWVWVLAVFVAFVDGEKALRRLRDIWHEDKEPEQTK
FT                   TQGKEANNA"
FT   CDS_pept        235460..236533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0199"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00170"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE0"
FT                   /protein_id="BAJ00170.1"
FT                   /translation="MDISGGSIVQSPHIQLRPASSQVKGQVKHIYVVPNQTVEAGQLIY
FT                   ELDDKPYQIAFNKSVVAQESAELELALAKEDVHLANKAHLAALTDIDISENQQQAGSKD
FT                   LKWKQKTLARFMEQNRLVPDTITKSQLDEQNNGVDIAQAKVNAYGSEVDKANLAANSTE
FT                   LDIGKARLTIQSRDSDLKAQIENVAQAQWELDSTKIYAPANGYVTNFIMREGQFVGQVP
FT                   RMQMYTEEKYVLMRVNHQAIRNVKVGQRAEFTSAVYPGKVFNAEVEGIIEATGESQGSL
FT                   IARDDNVRQLTGVNVNNKHHFVRLKLYETGDYDIPVGAVGLAWISGEKPVAFLGFLDVI
FT                   RGIVIRMKSQIYYFYSM"
FT   CDS_pept        complement(236597..237802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0200"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00171"
FT                   /db_xref="GOA:D4ZEE1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE1"
FT                   /protein_id="BAJ00171.1"
FT                   /translation="MSSFLHGCRYFILPLLITFIALILIQVTEASWQIWYAIIAQLPYW
FT                   LLSIAAAMALQFNRSRLACLALLLVAFYMSKQSSAQVFTMVNNHTDELFIGGAIVISWF
FT                   AFIKDRGLVSSHGILRALGIMIGLGLGFIWLEVIERFQAEIIEKSPVNVTSQTLTLAPI
FT                   ICCLILVFFRAMWRANLVNTAILTTLGIWVFYYFQPDAFPLAVLLSSLAVIYLFTILID
FT                   SYFLAYRDELTGLASRRALYNLVLSLGRKYSVAMLDIDHFKKFNDTYGHDVGDQVLKLV
FT                   AAKMAQVSGGGKVFRYGGEEFTIVFPRKNAQTILDDLEDVRESIEDYSIVLREDKRTKK
FT                   SNSQAKARRSKSKNAGKKTVSVTISIGVAERHSGESFDQALKRADQALYRAKKRGRNQI
FT                   CI"
FT   CDS_pept        complement(237963..238376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0201"
FT                   /product="flavohemoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00172"
FT                   /db_xref="GOA:D4ZEE2"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE2"
FT                   /protein_id="BAJ00172.1"
FT                   /translation="MALTQKQIQLVQHSFSLVEPIAEKAAEIFYDALFGIDPSLKPLFR
FT                   NDMKVQGRKLITMLKAAVDGLEDLETLVPALQQLAQRHNAYGTKKSHFTPVGNALIHTL
FT                   KVGLGDAFTEEVRQAWVSVIHIIADTMKPEIKA"
FT   CDS_pept        238572..239387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0202"
FT                   /product="antigen, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00173"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE3"
FT                   /protein_id="BAJ00173.1"
FT                   /translation="MRINQYIQGQPCWVELASHDALAGKQFYADLFDWEIQDMPIPGGI
FT                   YTMFGLTPDQDAASEGGDVIGAAYQMPKEMTERGVPTTWLVYFAVDSVDETVEKVKAEG
FT                   GSLSMGPCDIGTAGRMAMFIDPEGARFAVWQAGDHIGARRQGEHGTLCWVELASRDPES
FT                   AKTFYPKVLQWTSQAGDMPEFEYTEWLVGDKPMGGMLQMNQEWGDIPPHWTLYFTVDNC
FT                   DETVAKARKLGGKECVPPTDIANVGRFAVINDPQGGFFSVITLNSEPNT"
FT   CDS_pept        complement(239384..240397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0203"
FT                   /product="ribonuclease, T2 family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00174"
FT                   /db_xref="GOA:D4ZEE4"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR033130"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE4"
FT                   /protein_id="BAJ00174.1"
FT                   /translation="MHARFSILISLILIFSSNAYATPATGSFLADKSCELYQSKSKKTN
FT                   PDSLHTQAGTRYAIFERLGSRQQPDWVRVKTQAKYSPMRWVSAKCGDISLDSTQVQISP
FT                   PKATTSKQVNTCQLAQSQDSHLLALSWQPAFCKLKGQGKPECQGDRSARYDSSHFTLHG
FT                   LWPNKNSCGRDYGYCGKVKHKPAHFCQYPQVSLSHDLRSRLNRVMPSAKYASCLQRHEW
FT                   WKHGTCTEQDPEVYFGKAIAFTEQVNQSDFVKHFIADRIGKVVSRSELNTAFNKSFGNQ
FT                   AYRKLSLQCTQGSLREIQIKLPGSLSSDSIKTLLPKTTNARKGSCGQQFLLNSAGN"
FT   CDS_pept        240651..242681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0204"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00175"
FT                   /db_xref="GOA:D4ZEE5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE5"
FT                   /protein_id="BAJ00175.1"
FT                   /translation="MKQLSIRQKIILGFSTIGILLIAASGFFYQSLSHISRANLDIETI
FT                   AVPVQKQSNALQLKLLQMVKLVAVANTQKIREELLNSQEEFNQLRLSFTQQSNTLKSKI
FT                   SDQAQMQSALGDSNDLFNHFIEASDAMIGAKLENLVASEEFKQNFDKFADARFSAANAM
FT                   LDLELITVAAEQQRLLEEVIGTGTRIDDMLFTMGNTMAGLMRVDELDSLLAHQEDMAFL
FT                   LSNIRSNFDYLKRQAEPLDSQSLLDEARANLKIVFYYLEQPGDLYRLQREVIVQEQAAQ
FT                   AAYGQVQQYFSGSLSELEHLVILADERFMALQQTAKDEIVTGETLAIVLAVVFVIMACL
FT                   VSMMTTRAMLRPLNAVNRALARIASGDLSRRVTKVNDDEFGILIDSINKLAEDLTQLLN
FT                   DIRKNAHRLDESATSYSEQSQRIAGVASVQIERIDEVKRSAEQMSASSNTVRDVADTSA
FT                   TNVTEASEHSHEIREIADANNARVARLSERLLGAVEIMARLTSHSKNIGGILDTIVSIA
FT                   EQTNLLALNAAIESARAGEHGRGFAVVADEVRNLAMRTQESTAEIQITISALQQETASA
FT                   DEAIGSAQSQAFECEELSQELTRAIKLMDSSLSSIEQMSKNIAQVAQEQLSDSESIVSG
FT                   MNEAVKAAEKNSDEAADMSQGSTKMNELAHSLTNSVDRFQL"
FT   CDS_pept        complement(242761..245892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0205"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00176"
FT                   /db_xref="GOA:D4ZEE6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE6"
FT                   /protein_id="BAJ00176.1"
FT                   /translation="MLKKIIQASIKQRLMVLIVTIMITVWGVQELRNTPLDALPDLSDV
FT                   QVIIKTPFPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGYSFFGDSYVYVIFEDGTDIY
FT                   WARSRVLEYLNQVGSRLPQGVQPSLGPDASGVGWIFEYALVDRSGNLDLSQLKSLQDWY
FT                   LKLELQSVAGVSEVATVGGMELTYQIVIEPDKLAIYKLDIAAIKDAISKSNSEAGGSVI
FT                   EMAEAEYMVRAKGYRQTLDDFREIPLGVTSPSGTPLLLKDVATVRKGPASRRGIAELDG
FT                   EGEVVGGIIVMRYGENALATIKAVKEKLEQLKSGLPEGVEIIPTYDRSQLIESSVENLF
FT                   YKVLEEMFVVGLVCMLFLMHARSTLVAVITLPLAILIAFIVMNKMGVNANIMSLGGIAI
FT                   AIGAVVDGAIVMIENMHKHLEHFEQENKRRPDMNEHWKLVAEASVEVGPALFFSLLIIT
FT                   LSFMPVFALEAQEGRLFSPLAYTKTFAMAAAAVLSITLVPVLMGFFIRGKIPKETSNPI
FT                   SRCLIAMYKPALTLVLKFPKMTLVVAFIALMSAWYPMSQLGSEFMPELDEGDLLYMPTA
FT                   LPGISASKAAEILQQTDRLIKTVPEVKRVFGKVGRAETATDPAPLTMLETTIMLKPRDE
FT                   WREGYTLKDVIDQLQQTVKIPGLTNAWVQPIKTRIDMLSTGIKTPVGIKITGADVNELQ
FT                   KIGTDIEAILSKLPNTKSAYAERVGGGRYIDITPKLDVASRYGMTLTDIQDVVRYAIGG
FT                   MKIGESVQGAERYPINLRYPRELRDNIEKLRELPVITKTGHYLPLRNLADIEITDGPPM
FT                   LKSENGRLISWVFVDIEGTSIGEYISQAKSALENELVVPPRYSYDFAGQYEYMQRVDEK
FT                   LKQVIPMALGVIFILLMMTFGSTVQACMIMFSLPFALVGSTWLLYALDFNMSVAVAVGM
FT                   IALAGVAAEFGVVMLVYLNNAIKYRKEKGKYEAVSDLKEALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGTGAGNDVMQKIAAPMVGGMVTAPLLSLFVLPALYLLVYSRKLNK"
FT   CDS_pept        245916..246020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00177"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE7"
FT                   /protein_id="BAJ00177.1"
FT                   /translation="MPIEAWSLVSLSMINLTKDIFANGGLNINIVKHI"
FT   CDS_pept        complement(246027..247184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0207"
FT                   /product="heavy metal efflux system protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00178"
FT                   /db_xref="GOA:D4ZEE8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE8"
FT                   /protein_id="BAJ00178.1"
FT                   /translation="MFNSAKPTSLNDGGTIKYVCPMHAHIISDVPGTCPICGMNLEKVE
FT                   VSGSSKEIQIHVSGGMQQALALKVAKVEKDTLWKFVQTVGQIDYDESKINHIHARVTGW
FT                   IEKLTIKSVGDKITKGQLLYEIYSPDLINAQDDFLLAQDTLRRTGKNSGYQDLLKKAGI
FT                   RLELLGFNKSQINTLKKSKKTQYRVPFYAKSDGIVKELKVRDGMYIQPATEIMSIVDLS
FT                   KVWVIADVFENEQSWLEVGQRAVVSVPAMGFKGIEGKIDYIYPELDPVTRSLRVRIVVQ
FT                   NHKLELRPNTLAKIDIFGGPNADVLVIPQEALIQTGKENRVIVKLENNSFTARKVTVGM
FT                   LSQGKAEILDGLDEGELVITSGQFLLDSEASLKGSLMRLTSGHQH"
FT   CDS_pept        complement(247852..248553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00179"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEE9"
FT                   /protein_id="BAJ00179.1"
FT                   /translation="MKTLISLILSALVLFSVVPTALAHEHAQQHEHGQHHNMKADHACP
FT                   MHAEVTGQKGETCPKCGMKLTALKASSHHGQGCDSYPHHDASAHKHGEDKANHTCPNHK
FT                   QSTHKHGEAVANHACPSHKQSTHKHGEAVANHACSNHKDSTHKHGEAAANHTCPNHKDS
FT                   THKYGEAAANHTCPNHKDSTHKHGEADANYACPMHPSITGKEADTCPKCGMNLAPMQAK
FT                   ADTKPSVHHKH"
FT   CDS_pept        complement(248845..249285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0209"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00180"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF0"
FT                   /protein_id="BAJ00180.1"
FT                   /translation="MFSLIRRHTLIAFTLLAMLSQGLLSNGSMMVGKAQAHEAMMSGSH
FT                   HSQMMSMKDGVACHSEQTGNIPHCCDSEQVNQALPDEAQSCCNSNGYCQGDCNHCLVIS
FT                   MTGTLFDTKSWPGFSPSELALATQMPYFHSISISKDIRPPIA"
FT   CDS_pept        complement(249499..249942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00181"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF1"
FT                   /protein_id="BAJ00181.1"
FT                   /translation="MESIMKTFITVAALIFASLASFSSSAASISFPDSLSVTGINGETI
FT                   FATHEIQLTKGKNLIELKYHDTFEVNADDSGAWVKSAPLYLIINANNQVQYQAMTPIID
FT                   TEDEAYDFINKPVISLQSPQGESKNVTLLTHYQVMAQLLLAKK"
FT   CDS_pept        complement(250115..250633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00182"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF2"
FT                   /protein_id="BAJ00182.1"
FT                   /translation="MLKQMTHLVLIITLVGQFLLTPVMAMPRFLHALTHAHMSEMDSSD
FT                   TRMKMSMAQAQAQQSSRVTSQVTYSSDLDTSSKVEMAMHHGEKECATLVANMMANNGDI
FT                   LIDCDALCEMMAAGGCISHCASPSGILIHPQFSLLIPESNGKVHTLSWSTQTVDLATFN
FT                   PPPIWTSLT"
FT   CDS_pept        complement(250865..251458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0212"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00183"
FT                   /db_xref="GOA:D4ZEF3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF3"
FT                   /protein_id="BAJ00183.1"
FT                   /translation="MGKEMAKNKPSSGQVRIIAGQWRSRRLPIHDLEGLRPTTDRVRET
FT                   LFNWLAGDLSGARILDCFGGSGALCFESLSRYASYAKVFELQASAAEQLKLNLKTLKCD
FT                   SSMADVIKGDTLKLLTLEPQEGFDIVYIDPPFRKDLAEKSIQLIAEHNWLKENAQIYVE
FT                   TESELTQLSVPSNWVQLKEKKAGQVIYRLYQYQP"
FT   CDS_pept        251822..254053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="SVI_0213"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00184"
FT                   /db_xref="GOA:D4ZEF4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF4"
FT                   /protein_id="BAJ00184.1"
FT                   /translation="MAKKGFFSWFRRDKSKDEVEAPEVEVTNKAEELAEKEAEALVLKE
FT                   AEALAERDAAALKAAAEQERLAAEALAEEARQEAQARQEAEAQARQEAEAQARQEAEAQ
FT                   ARQAAEAQARQAAEAQARQAAEAQARQEAEAQARQEAESQARQEAESQARQEAETQARQ
FT                   EAESQARQEAEAQARQAAEAQARQEAEAQARQEAESQARQEAESQARQEAESQARQEAE
FT                   SQARQEAESQARQEAESQARQEAESQARQEAESQARQAAEAQARQEAEAQARQEAEAQA
FT                   RQEAEAQARQEAEAQARQEAESQARQEAESQARQEAESQARQEAESQARQEAEAQARQE
FT                   AEAQARQAAEAQARQEAESQARQEAESQARQAAEAQALVEKETAAQQEAEDLVLREAEA
FT                   VALREAEALALAEKETAAQQEAEKQPEPQAKPAKEGFFARLKRGLKRTSENIGSGFVGL
FT                   FKGKKIDDDLFEELEEQLLIADVGIETTTRLIDSLTEQASRKQLKDGEALYELLREEMQ
FT                   KTLDPVSIPLVPDNADGPFVILMVGVNGVGKTTTIGKLAKQYQAQGKSVMLAAGDTFRA
FT                   AAVEQLQVWGQRNDIPVIAQHTGADSASVVFDALQAARARKVDVLIADTAGRLQNKAHL
FT                   MDELKKIVRVMKKLDENAPHEVMLTLDAGTGQNAISQAEFFKKDVGVTGITISKLDGTA
FT                   KGGVIFAIADKFGIPIRHIGVGEQIDDLRTFDAKDFIDALFTQENEEQK"
FT   CDS_pept        254177..254872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SVI_0214"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00185"
FT                   /db_xref="GOA:D4ZEF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF5"
FT                   /protein_id="BAJ00185.1"
FT                   /translation="MIQFEQVSKVYPGGQKALTDVNFHLQRGEMAFLTGHSGAGKSTLL
FT                   KLITVIERANTGRVSINGHNIAKLSRKDVPYLRRDIGMIFQNHHLLMEKSVFDNVALPL
FT                   VIEGFSLGEIKKRVLAALDMVGLYGKERHHPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDSGTTVLIATHDLGLIARMKYRTLTLKQGRVLGGEEPT
FT                   SAPESPFTV"
FT   CDS_pept        254908..255873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="SVI_0215"
FT                   /product="cell division permease protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00186"
FT                   /db_xref="GOA:D4ZEF6"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF6"
FT                   /protein_id="BAJ00186.1"
FT                   /translation="MSKKPKLTRSKLPISGRIVMFFIRHIQHAMGSMGELWRNPISSIM
FT                   TMAVLGVSLSLPAALQVLVKNAETITQSWNSAAEISLFVNDARSERTIQSLIARIKVYP
FT                   EVSEVNYINRDQALEEFRSLSGFGEALSYLDTNPLPAVVTVTPSLRYSSPAGARELLKK
FT                   LEHEPEVSFGRLDIEWLERLQAVVKLLERTVLAIAALLVLAVVLVIGNTIRLAIMNRRD
FT                   EIEVMKLVGATEAFIQRPFLYTGIWYGVIGGILAWIIINVLVLYLDSALVELLGLYGSK
FT                   LQMESLSMVELFQLVGLASFLGWLGSYLSVRHHLRAIEPS"
FT   CDS_pept        256319..257179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="SVI_0216"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00187"
FT                   /db_xref="GOA:D4ZEF7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF7"
FT                   /protein_id="BAJ00187.1"
FT                   /translation="MTDITQSMALVVPHGSGSLEAYVHSAHNISMLEAKQEHELAKRLQ
FT                   ETGDIQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPNVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNLRKSKKRLGWFSDAEVGMVAEN
FT                   LGVSKADVTEMESRMAAQDPAFDLASDNDDDIQDYAPALYLEDHSSDLANQVETDNFEA
FT                   DNQTRLLAAIKTLDERSQHILQARWLNEDKTTLQELAATYQVSAERIRQLEKNAMNKLK
FT                   GRMEA"
FT   CDS_pept        complement(257517..259001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="SVI_0217"
FT                   /product="O-succinylbenzoate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00188"
FT                   /db_xref="GOA:D4ZEF8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF8"
FT                   /protein_id="BAJ00188.1"
FT                   /translation="MQRVPVISPLHQSANTHPQAVAISWRSKGLNTALSYLSLSQRVIC
FT                   LGEQLLAAGLTRGDRLACIDNNSVELIMLYWACIDQGILFCPLSPRFPQTQLTELVERY
FT                   ALSHVWAGELHQDLLSQDLLTHTKLVLAIDMSLSSDSLAKSIDAKLPVNIILTSGSIGQ
FT                   PKAALHSLNNHIENAEGSRCFIPLQSSDSWLLTLPMFHIGGLAIINRCVLAGASVVLQD
FT                   RESKISEQLARDKITHLSLVSTQLIRLLKQDPSSLKLVKALLLGGGAISSTLLAQLKTL
FT                   NVPSFTSYGMTEMGSQITTGYANEDGSSGHLLPGRELKIQDNKIYVRGKTLFLGYLTPH
FT                   PPEHSVTDPQTHALTKNEKQITLPVGPDGWFFTKDRGYWNDDGNLCILGRCDNMFISGG
FT                   ENIQPEEIEAILKQHPEIEEAIIFPLAHDEFGNLPAAIIKGYIPQQSELDTLVCSQAAR
FT                   FKRPRQYYLWPEVEQTSLKISRKQIIEAVLGKELGS"
FT   CDS_pept        complement(259016..260122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="SVI_0218"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00189"
FT                   /db_xref="GOA:D4ZEF9"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEF9"
FT                   /protein_id="BAJ00189.1"
FT                   /translation="MSAIDITTHRDSSMIISSAQLYSYQIPLDKLLPVGKQRIDQRSGL
FT                   VLRLQVKGNSEAAKTADLRTELVEISPLSGLDIDGHPLMGFSQESMEDVSQQLVERLDS
FT                   LIDKPLIHLLDLADETQYPSLAFGLSLLYAKLIGQLDDSGLSQRKNTVIPLIYHTEGDP
FT                   ISTLHDRVRALSRDTHSVKIKVAQASLEEEIQLVHQVLAIRPDLKLRLDANRGFTLEQA
FT                   IEFAACLPIHAIEYIEEPCIDHNDNPMFYRAIGMPWALDETLNEPTFKFEMQPGLTALI
FT                   IKPMLMGTLEKIQKLQHQADLYGVRTILSSSLEASLGIEALARLNQIMSPDEAPGLDTL
FT                   GAFSTDLIIESGKTKCLRCDDLNLIKSV"
FT   CDS_pept        complement(260080..260862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0219"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00190"
FT                   /db_xref="GOA:D4ZEG0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG0"
FT                   /protein_id="BAJ00190.1"
FT                   /translation="MLALTCHGNKIKPALVMIHGFLGSGADWASVLPELSKHFYCICID
FT                   LPGHGDSPALTLDTPGLYRVATQVHQSISALDINRYHLLGYSLGGRISLHIARQYSEQI
FT                   LSLHLESAHPGLTCSRDRQARLSNDEMWNARLACQNMHKFLNAWYQQGVFSELSESKRQ
FT                   ALVETRSKNCAQGLQSIYLATSLAVQEDLSQLPNQIPTPCHYYVGKNDSKFLALALDWQ
FT                   HKSQLTVHQFEQAGHNVHLAATDKFCQQLILQLTETPQ"
FT   CDS_pept        complement(260862..262571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="SVI_0220"
FT                   /product="2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic
FT                   acid synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00191"
FT                   /db_xref="GOA:D4ZEG1"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG1"
FT                   /protein_id="BAJ00191.1"
FT                   /translation="MQIEKTAELNLLWGTLILEELARLGVQHVCMAPGSRSTPLTLAAA
FT                   KQTKLQQHLHFDERGLGFMALGLAKASLAPVAIITTSGTAVANLYPAIIEAWLTHVPLI
FT                   VLSGDRPPELLDCGANQAIVQPAIFSQYAKQINLPTPDLAIRPESLLAKIDEAISNQSR
FT                   PVHINCMYREPLYPSTMSANFTKYLSTLGIWQDTSQSYVQYSSAKLQSIPSQESLARFV
FT                   HGKGVIIAGTLSPKESPEALILLSQKLGWPLLTDAQSQLRQHPSVIGNIDQLLDQPKAK
FT                   AILQQAERVLVFGGRLISKRLISYLAEQKWKRYWQVLPAQMQLDPSHSTKQVWLCDLHT
FT                   FASLPWPRSSQVNWALQLTQVNDSLETLFQHQIDNGEFGEAMVIRSIAKSQTPSQQLFI
FT                   GNSLPVRLYDMFAPMTPEYGSVYTNRGASGIDGLLATACGIAKHCKTLTTLVIGDISQL
FT                   HDLNSLAIARTMKTPFVLVILNNDGGNIFNLLPIQDEKLRNDYYRLSHGLEFGYGAAMF
FT                   GIAYNQVDDIEGFHAAYQDAIEFNGPSVIEVTVAQDQASQQIAKIASWVKQN"
FT   CDS_pept        complement(262702..263142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0221"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00192"
FT                   /db_xref="GOA:D4ZEG2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG2"
FT                   /protein_id="BAJ00192.1"
FT                   /translation="MDQLDKFDKAIIKALRENARQSISNISEAVSLSRSAVSERIKKLE
FT                   STGIIRGYQVLLSESQKEGVSAYFEIQHRCPRCADVVPVFHSIPEVVTCRGITGDMDLL
FT                   VYVRAPSMKRLHEIREFIDSQTDIIKIKTHVVMSEWIDNRDE"
FT   CDS_pept        263444..264709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0222"
FT                   /product="amino acid permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00193"
FT                   /db_xref="GOA:D4ZEG3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG3"
FT                   /protein_id="BAJ00193.1"
FT                   /translation="MDQIKGTIGRWQGAGLMATTLLGTGVFILPQMTIATAGNDALLAW
FT                   LLLTLAIIPVTLIFGRLAGAFPHAAGPAYFVEKAFGRTAGRTIGLIFLLVVPLAAPAAI
FT                   LMTFQFVDAMVPVSGWSQIAMELGLLVLLFLLNFRGIHVSAKLQFVLTIAIVSVVVLMF
FT                   GAGGLNLHKLESISRVTSSDASLIMAAAGIAFWSFLGVEAMTHLANDFKDPKKDMIPAM
FT                   MIGTVLVGVVYLACTGLLLMTPVETGTGLAMVASFDNLLGGYGAQVIGILGIAGGLATV
FT                   NVYTASVSRLLWSFSREGILPGYFASLNRHQVPARALAAVLLAMALVIVLTHISGQELE
FT                   HLIAWTNGVFVIIYLMSMLAAAKLLSKRYLPLVAIGSLFCIMLGFALGSSMLYALIMIL
FT                   VVAPILWWQKNHLSRKQELQAA"
FT   CDS_pept        264820..265665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00194"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG4"
FT                   /protein_id="BAJ00194.1"
FT                   /translation="MICGGYRMDSAALLSHIDELPRLPKAVSELLDLVNNDAASVAEIT
FT                   EKISHDPLVSARILRLVNSAHYGRSREVGSIDEAVVRLGMQTLRTLVIASAVIGAVPII
FT                   AGIDLGEFWGKTFEVSLYGQELAKRCGAAPDTAFTCGILHDIGELLIATIEPDKSAKIR
FT                   ELAANGDKKSLIEQDILGYESADVAALLAKNWNFSPELVEGIKYQNHPYKADPFSKQAA
FT                   LLALSHIVLDEWDEVDENERTSWLSQQATAVGLKMEVGGLQDKILELRGKGLDIAKQLT
FT                   "
FT   CDS_pept        complement(265733..266185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0224"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00195"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG5"
FT                   /protein_id="BAJ00195.1"
FT                   /translation="MLAKLKQFLTSHSQAITPEEKARQLDLAAVSLLLEVVFADETLSE
FT                   EEAELLPQLMIKALSLTQAEAEVLIDEAKKIQGDSISLYEFTKEINEQCDVEQKQKLIL
FT                   AMWKLAYADGQLCQYEDQIIRRTADLLYLRHSELIQMRNLAMDSQA"
FT   CDS_pept        complement(266313..266831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00196"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG6"
FT                   /protein_id="BAJ00196.1"
FT                   /translation="MKLSAVIGLLLASTTLSTPATAGWFDNLFSAEEAKPQVVQTQSND
FT                   LVGSVMSQLGLNKSQAEGGLGSLLSLAKSTLGGNDFSSIASAIPGIDSLLSAAPALDNE
FT                   SGMSGLLAKAGDLGSSLQGGAQVYDAFEKLGISKELAAPMVDIVKGYLDANAGEGTTDM
FT                   LMKGLSVIL"
FT   CDS_pept        266941..267726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00197"
FT                   /db_xref="GOA:D4ZEG7"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG7"
FT                   /protein_id="BAJ00197.1"
FT                   /translation="MQKVSNFGILAALFCLFNYLLETPMPLSAILTEAYNFFRNHISQL
FT                   AVLTVPILFVQVGIQLWLSMEIRGADLENPQFGASHMAAMMALLLVFSLLIAAFTIFLE
FT                   IRSQGHEASTALILKTSLNFVPGLLLAGVFSGLAILAPVMIFAAFGPLWLIGLTMSIYI
FT                   FARLAYVNFMIVVERLTPFEAIKASFKFSGPIAFKTLMVLMLYIPLSLVGGAISALVDS
FT                   FFPAQLIVEVFIAFIGLFINVALFRLYMVSRPNKVDGEA"
FT   CDS_pept        268089..269321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00198"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG8"
FT                   /protein_id="BAJ00198.1"
FT                   /translation="MNDQQFNQELNDIAESYVKLVLAIGLHDPFYVDAFYGPEVWRLEC
FT                   KKLTLSELHKMAKAQLKCLNNLDLYLINTKLISRLNFLNKQVSSVVYYLSHLQGDIGSF
FT                   DVESEGLYDTQSQKFGLCSFESIQDELDKLLPGKGELAERFEQFRAEFIVPQSKIPAVF
FT                   EASVDKARALTGAHIELPDEESFSIEFVTDKIWTAYNWYQGNYKSLIQLNQDQPLYIER
FT                   CLELASHEGYPGHHVFNLLQERDLVRTEQWIEYAVYPLYSPISFLSEGSANYGLSLIMS
FT                   KQEVIDFERDILMPLAGIQGDIEKYHKVLACYKKLAYLDNLVCEQLTDGHISEEDAQNL
FT                   LIKYGLYTHSRAKQRVKFYLSNRAYVINYNHGEESVARWVEKDGETRKHEHWKRFEALL
FT                   KRPLTASQFKV"
FT   CDS_pept        complement(269373..269741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00199"
FT                   /db_xref="GOA:D4ZEG9"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEG9"
FT                   /protein_id="BAJ00199.1"
FT                   /translation="MIYSQFQQSPFQARFSGVKGWMAFAIGILVITLALIALPFLLLFG
FT                   AISFILLSLFGRLFLKRQLAKFQQQQAQSTNASSQQQDSFSTPSEHQSQPIFTDNAFTD
FT                   NRHQAKPHQGRTYEHDPS"
FT   CDS_pept        complement(269956..270930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0229"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00200"
FT                   /db_xref="GOA:D4ZEH0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH0"
FT                   /protein_id="BAJ00200.1"
FT                   /translation="MNLDNLARIDLNLLVILQVLLEEQSVTRAASRLHLSQSALSKSLN
FT                   RLRDTLGDPLFHRTAHGLKPTAHAVQLGQKLPDMLQGLYQLTQPPSFTPASSNRQFSFA
FT                   MVESAYETLLPYFIGPLLNNAPNLKLDTYVWMGQSMQALQKGQIDFGISGRDLHPQSDL
FT                   KIDRLPDGIAHKTLFTDKQICLVRENHPIISAFKAGKWNLEIYLEMSHVQVRCEGNDWW
FT                   ALDYHLANLGHRRRLSTTVPDFYGAASVCAHSDLIFTLPSSFARHAGKLYPLVELPLPF
FT                   EFIPLAYVLLWNSRNNEEPGHKWIRETICKSVAEAFDNETLGN"
FT   CDS_pept        271026..272240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0230"
FT                   /product="drug resistance transporter, Bcr/CflA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00201"
FT                   /db_xref="GOA:D4ZEH1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH1"
FT                   /protein_id="BAJ00201.1"
FT                   /translation="MRKIMRRNLLPILMSMVVLSPLAIDIYLPSMPTMAAEFSITSSEV
FT                   QSTLVLFLFAMGVGQILIGPLADRYGRRPIAIFGVLLYGVSSLFAAMAMEFHWLQLARV
FT                   LQGLAACSTSIVVFSAVRDCFSPKEGARYYSYLNGVICVIPALAPTLGGLLALQFGWRS
FT                   TFIFMTLYAIVIMLVVGYRLPETRPKNTDTTGPLYRWSRYKPVLSEPHFMFYALCCMAG
FT                   MAAILSYVSYAPVWLIDHLGMSELTFSGLFGLNAAVNIAACFLAPMVINKLGNRPTVIL
FT                   ALCTMLLSAVSQVLVQTWGPQAGLAAAFSFMLPMILLCIGFALLLGPATSMALSAFGER
FT                   AGTATAMLGFIQMSGASLLAGLVQQTDLTAPYAVALVMGGLAIMLLAMLAMPRLDHWHQ
FT                   EQHAN"
FT   CDS_pept        272594..273190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00202"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH2"
FT                   /protein_id="BAJ00202.1"
FT                   /translation="MARPNCPKCHYPLKACLCESIELMRVSTELIVLQDPSEVGHAKNS
FT                   VRLLSLVISETRVLVGEGPDDFAELRQYLDASTKPVYLVYPSDKSKNAEEERFDDEVIL
FT                   LLLDGTWRKAYKLLQLNPWLLQYPSLHLDLQSGSNYTIRKASRSDSLSTLEAAAMMLKA
FT                   IDPKMSVTPLTRALSAMVNQRLNSMPASVRKRYES"
FT   CDS_pept        273599..275212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0232"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00203"
FT                   /db_xref="GOA:D4ZEH3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH3"
FT                   /protein_id="BAJ00203.1"
FT                   /translation="MSMTKFKNASSIGLYSLLVFIIAIVTSYLYAFRLVTNEVEADSEQ
FT                   LLNFIEHKLSVSVKNLEKLNEVDFAGCDSKGRETLEEFLFDHLVAGLFLIRHLDSPPWI
FT                   YCSVVGNVAVSQGDRDLNNVTYLDKNKKRTISVMGYDWQGIEKKDLFLTLETEDRINAV
FT                   RIALEDSYSFFEDLCVDCRHVEVRLANGDLILDLGGVVGSAVLNEIRVPSREFPIYIDA
FT                   VVGRKRVIGAMLNSLSLTIPISIVFSLLCFYIIHLIGTQHYSLGYRLTLAVKRRELVAF
FT                   YQPIIDAQTGYIVGAEALVRWIKPNGSVESPGAFIQTLEQSKLINKVTLQLVNNMPNDL
FT                   AEVLQCSPNFRCSINLVPQHLELPFFADELVTLSKNGYPCHQLAIEITERLPLKDLREA
FT                   GMNVEKMKALGVCIELDDAGTGYGGASYLQELNIDVIKIDKLFVDTLIISPDRTQVLDA
FT                   NIQMAKTLGMQIIAEGVEEPSQSKALLEKGVRFQQGYLFAQPMSAVEFVKFWRIRQESY
FT                   ADQFLNSTQVPSLVGEFKEE"
FT   CDS_pept        275213..275587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00204"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH4"
FT                   /protein_id="BAJ00204.1"
FT                   /translation="MKLLFNSQTRKGIKGYILMLSWGCLLISTCTLASDKQTLIQKADG
FT                   AREQSREIEQDQLQKARDAAGETQAREKELYNKMHANDWEAKQMKKAKQQFNERESRED
FT                   KYLREARQAASKERKIPKPI"
FT   CDS_pept        275725..275940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00205"
FT                   /db_xref="GOA:D4ZEH5"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH5"
FT                   /protein_id="BAJ00205.1"
FT                   /translation="MAKSIEQTIKQCRHCSKKTVHHRASSKTGLIMFLVHIVLTIVTAG
FT                   VWLVLLLIWMLLNTKIGGWSCQECGK"
FT   CDS_pept        complement(276023..276187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00206"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH6"
FT                   /protein_id="BAJ00206.1"
FT                   /translation="MLQVKMMPDMEILSLPITIKNINSIGYDKELAQYGFSLNSPQSEA
FT                   DFFGAESDY"
FT   CDS_pept        276922..278250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0236"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00207"
FT                   /db_xref="GOA:D4ZEH7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH7"
FT                   /protein_id="BAJ00207.1"
FT                   /translation="MIRKILGLVLMLGALASTSVQATQAEDIKSFTLDNGMKIMVLEDS
FT                   SIPNANMYLFWKVGSRNEVPGITGISHFFEHMMFNGSKKYGPKMFDRTMEAAGGANNAY
FT                   TTENLTVYTDWFPANALETIFDLEADRIGHLDIDAKMVESERGVVASERTTGLENSNWR
FT                   TLQEEMKGIAFRAHPYSWSVIGHESDITAWTLDDLVQYHKTYYAPNNAVVVIAGDVKFA
FT                   EVKALANKYFAPIAAQAPPREVTTIEPVQKGERRTYIQKASVSTPNVMLAYHVPATSHE
FT                   DYYALDLLSSVLSEGNSSRLYQSLVEKQVAIEVETYLPMTIDPNLFYVMGVANPGITAV
FT                   ELEKGMISQINRIAREGVTEKELEKVKNIKLMNFYRSMETINGKANTVGTYELYFGSFE
FT                   KLFNAPEAYNKVTPADLQRVAQIYLRRANRSVAVLAATEETDE"
FT   CDS_pept        278247..279692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0237"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00208"
FT                   /db_xref="GOA:D4ZEH8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH8"
FT                   /protein_id="BAJ00208.1"
FT                   /translation="MNTLTHLTKRSNKLMAAITLASVLALSACASTTTSTSVDTGSFSM
FT                   PAYEHLVLDNGLTIYLMPQREVPLVTVSAVVRAGSVNDTTSGVAAMTAQSLLLGADGKS
FT                   KADIEQMVDFLGASIYADAGKEGSYIGADFMAKDSKTILPLIKSLLLSPNLDADEFDKL
FT                   RQREIAGLSQAKESPRSVIGRYFDKLVFGAHPYGNATSGTSESLAELNISQLRAFHKSY
FT                   YQPSNTAISVVGDFDPEQMKVELSKLFGQWQNSEKILALNLKAQQPELSSPSVLLVDKS
FT                   DAIETTFLIGGKGISRDNPDYVGLKVVNTILGGRFTSWLNDELRVNAGLTYGARSGFIA
FT                   YSQGGVFRISTFTKTSTTKETIDLALKTYARLWETGIDQLTLDSAKAYVKGQFPPKFET
FT                   SGQLAGLLSDMYLYGFDNGFINDFQAKVDGLTLAETQRLVTRYFPQQNLQFVIIGNAET
FT                   IAPIAAEYGEVKTLDIKAVGFGG"
FT   CDS_pept        279807..280367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00209"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEH9"
FT                   /protein_id="BAJ00209.1"
FT                   /translation="MAISNARTSKLEQPLSDADVDWCHIQETIKVLLLAMAQIELSLTD
FT                   GEHNVTSLGALFTDMARHLEGMNSYINQLDDTPEEVLVHGENLAAAVNEGVVAFQFYDR
FT                   VTQRLQHVIMGLALMEELLSSQKQRISPEAWEKLQEEIEASYSLDCERKMFNLVLQGIP
FT                   VHEALKLYKDQHQVTPQDDIELF"
FT   CDS_pept        280348..280893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00210"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI0"
FT                   /protein_id="BAJ00210.1"
FT                   /translation="MISSYFRLNFVSCAIALCVFIPQLSWAEKANFGNFCTALAGHWQG
FT                   SAAKLKQHPTQVSVQAICSADQQQLLVSVSSNANHNLSETWWFRRRGESAFLIYFDGVN
FT                   EDKSQSFSLYRQYGSYTLLGEGELNKRPALIQLRFEPKGNGWLWLQNVQYLDDDTDRYL
FT                   FYRGIDMMPVSLAENPRN"
FT   CDS_pept        complement(280908..281372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0240"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00211"
FT                   /db_xref="GOA:D4ZEI1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI1"
FT                   /protein_id="BAJ00211.1"
FT                   /translation="MFHIALYEPEIAPNTGNIIRLCANNGCQLHLIEPLGFDLEEKKLR
FT                   RAGLDYADLTCVTRYKDFPSFLEAMDGKRIMACTTKGSRPHSELSFKKDDVLLFGPETR
FT                   GLPMEIIESLPTSQRLKIPMAGMSRSLNLSNAVAIISYEAWRQIGFEGAL"
FT   CDS_pept        281616..282596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0241"
FT                   /product="zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00212"
FT                   /db_xref="GOA:D4ZEI2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI2"
FT                   /protein_id="BAJ00212.1"
FT                   /translation="MFKALVLTQEGKKTLANIIQIQESDLPEGEVLVDVAYSSLNYKDG
FT                   LAVTGTGRLIRNFPMVPGIDFAGVVCDSRDPRYKKGDQVILTGWGVGENHWGGMAEKSR
FT                   VKADWLVPMPQACDEQKAMMIGTAGLTAMLCVQALQDANITPESGAILVTGASGGVGSV
FT                   AISLLARLGYKVVASSGRVEQNSELLLSLGASEVIDRSELEQDSRPLEKQRWAGIVDTV
FT                   GNKVLATALAQMNYGGAAAICGLAGGFALPTTVMPFILRGVSLLGIDSVSCPLEKRQAA
FT                   WERVIELLPESYYQQAAQTIGLDEVAGYADKIVKGQVTGRVLVKI"
FT   CDS_pept        complement(282671..283585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0242"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00213"
FT                   /db_xref="GOA:D4ZEI3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI3"
FT                   /protein_id="BAJ00213.1"
FT                   /translation="MELEDIYRQDLSLLIALQILVEECSVTQAAKRLHLSQSATSRILA
FT                   RLRDMLNDPLFTRVGQKLVPTQFALDCYSQLQQPTGQLIALLTPKEFIPSECQQKFTIA
FT                   ATDYAMQALVPFVLPAIYSKAPNIKLEIIPVHHRELQSQLSQQEADLAICRPISQTQQL
FT                   NQKYLGKVGVSCLLSPEHPLADSTLTLTDYLFFPHATIAISDGVKALLDSAIATAERNE
FT                   LLRTSHLDSALALLNFHPLIITLPEGMAELAASKHRLRLKPLPFDIPSLDYKLFWHSRS
FT                   ELDKAHKWLREEITASIRQLLKQ"
FT   CDS_pept        complement(283664..285046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="SVI_0243"
FT                   /product="sensor protein CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00214"
FT                   /db_xref="GOA:D4ZEI4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI4"
FT                   /protein_id="BAJ00214.1"
FT                   /translation="MTMSKLPNRIFIKLLLGFWLCSSLIIAIVGLLPLLQQSHDRAPLP
FT                   HHLSKLLIKVADRVSVHLEDNSQTINTHRFKRLTHIRDINNKPVRFYIVDHQGRVINSH
FT                   QVSRSLRRFMLMADEAERPMTHQFKSELIFGPYKFDAKGEQYSIYGRLADHHPRPWFFF
FT                   FAENKLLTLSLAIMLSGLLCGLLAWHLGKPLRTLRLSADALAAGDLTSRVDQATINRKD
FT                   EIGQLAYAFNSMADSIENMLQSQQRLISDISHELRTPLTRLQLALALARKKGQESAETE
FT                   RIGYEAEQLELMIAELLELSKVKLNAHESKLSLGLAEILGQVLDDADFEAEQQGKSLSI
FT                   NIDEEIKLPLYPRPLSRAIENLLRNAIRYANTHVEIKVSESITSIIIEIIDDGPGIENE
FT                   QDLEAIFKPFYRPQSARERESGGWGLGLAIAEAAVTAHKGSIVAKNAISQGLNVTIVLP
FT                   RA"
FT   CDS_pept        complement(285046..285729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="SVI_0244"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00215"
FT                   /db_xref="GOA:D4ZEI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI5"
FT                   /protein_id="BAJ00215.1"
FT                   /translation="MNHLLLIDDDLGLSELLAQLLELEGFELTLAHDGQSGLDLALEKD
FT                   YDLILLDVMLPKLNGFEVLKSLRANKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELVARIKAIIRRSHILPNDKQSCLHEYGDIKLDPSRHEVYCQDQLVILTGTEFGLLF
FT                   EMIQNAGDLISKESLSEKVLNKKLMPFDRSLDMHLSNLRKKLPERMDGRPRVKTIRGKG
FT                   YIWLP"
FT   CDS_pept        285991..286464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0245"
FT                   /product="spheroplast protein y precursor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00216"
FT                   /db_xref="GOA:D4ZEI6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI6"
FT                   /protein_id="BAJ00216.1"
FT                   /translation="MKASLLAIVASTALITSAVYAENGQDEAQHHMKSERLAHHGGMGQ
FT                   MFKGLDLTDEQKSEIKLLMKKQKSAMKANHPSKEERQAKKAEFLNLITADNFDETKAQK
FT                   LMQVRQDKIKYKKLEGMKVQHKVYKLLTPKQQEQFKDNFEKGHSRKGERKAGH"
FT   CDS_pept        286571..287440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0246"
FT                   /product="cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00217"
FT                   /db_xref="GOA:D4ZEI7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI7"
FT                   /protein_id="BAJ00217.1"
FT                   /translation="MNQTSQYDFWVKLASRAAVATALTLIIIKMAAWMYSGSASMLASL
FT                   TDSFADALASIVNFIAIRYAIVPADQDHRYGHGKAEPLAALAQSAFILGSAFLLLFHGG
FT                   DRLINPTPVHHAMLGVVVSIIAIILTFALVVLQKKALAATSSTIVEADALHYKSDLYLN
FT                   AAVLVALVLSQYGWWWADGLFAILIAIFIGQQALGLGYRSIQSLLDRELDDDTRLKIIE
FT                   LAQQDPQVKGIHDLRTRESGKTTFIQCHLELDGSLSLREAHVIADKTEARIREAFSDAE
FT                   VIIHQDPV"
FT   rRNA            288071..289615
FT                   /gene="rrsC"
FT                   /locus_tag="SVI_r007"
FT                   /product="16S ribosomal RNA"
FT   rRNA            289922..292826
FT                   /gene="rrlC"
FT                   /locus_tag="SVI_r008"
FT                   /product="23S ribosomal RNA"
FT   rRNA            292982..293101
FT                   /gene="rrfC"
FT                   /locus_tag="SVI_r009"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(293114..293215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00218"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI8"
FT                   /protein_id="BAJ00218.1"
FT                   /translation="MDKPPDICTGKFELNSQNFIKSQTQKSHLNKVA"
FT   CDS_pept        294658..295989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiA"
FT                   /locus_tag="SVI_0248"
FT                   /product="paraquat-inducible protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00219"
FT                   /db_xref="GOA:D4ZEI9"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEI9"
FT                   /protein_id="BAJ00219.1"
FT                   /translation="MIAEPIKQTSDNEFMVACEECGLVVNIPELSCGQKGSCPRCDHTV
FT                   IKQIRLPYHRVVAYGIACLIMLVLSVSFPFMSFSVNGMGQEITLLNTAETLQHFENSAL
FT                   AILLMLTVLILPALYILLMLYLYYHAANAKHLGHSINRPKAVKYLCRVLFKIQPWLMVD
FT                   VFLIGVLISLVKISALADIGLGNSFWAFCIYSFLVVKCVSLVDRTWLWQQFFPMQPIQG
FT                   VDVGDSHLSNNHVACHMCNQLNPMPTANHGKCLRCESHLHPYNPQDSLQYAWAYLLVSI
FT                   VFYIPANLYPMMYTVSLGESDGSTIIGGVILLWEMGSWPIAMVIFIASVLIPVSKMCTL
FT                   VYLYYSARKRSNDSSYVAIKRMRLYRVTEFIGRWSMIDIFVVAILVALVQLHNLMSISP
FT                   GPAAICFAFVVIFTMLSAMSFDPRLFWVAKGKSKQASELNSIQQ"
FT   CDS_pept        296002..297663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="SVI_0249"
FT                   /product="paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00220"
FT                   /db_xref="GOA:D4ZEJ0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ0"
FT                   /protein_id="BAJ00220.1"
FT                   /translation="MRKQIMSNNQPAEAKIQNLKQVSAVWCIPILALAIGIWMFVQYIS
FT                   SQGPVITIRMPNASGIEIGKTAIKSLSVNVGVVTNVQLSEDYSYTLVTAQMNRDSDRML
FT                   KEDTSFWVVKPRIGSGGITGLDTLLSGAYIEMQPGDDKEDREHFVALENPPVAPVDAKG
FT                   LRIILTSHHAGKLGVGDPVLYEGFTVGRVESVSFDIKSKLANYQLFIFEPYDSLARTNS
FT                   AFMMLSGFNIQMNAEGVNVNVGSLESLMTGGVTFMTPDGDSESRQTEQLVHYRLFDSVH
FT                   DYREKMYEKHLDFVMMFTESIRGLKVGAPIEYRGIKIGTVKKVPLRLPTSKEGFSNKEI
FT                   PVLVRIDLGRIYDHSDEGSLEELQASFETEFNSGLRATLKTGNLLTGALYIGTDLYKGE
FT                   KLPNTRQYAGFNIFPTKTGELAEVQKQLTELLHKFNKLPVEDTLKSMTATLKVSQKTLL
FT                   SAERVANDLDRLLKQNDTQSLPGDIRTSLQQIQKTLNAFGPDAAPYQNLEGALSRFEEV
FT                   MIELQPVLRQLNEKPNSLVFGDDKAKDPIPVGGHKS"
FT   CDS_pept        297660..298229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00221"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ1"
FT                   /protein_id="BAJ00221.1"
FT                   /translation="MKKWLVITVLTLMVGCSSTPSELVTYLLPSGNTASAAHHGNDQNL
FT                   LIVAPVDVASYLADMGLVYQVSPTEIVEARQSLWAEGLSKQLTRRITNDLRQKQTGFWP
FT                   TQLTSTLSTAGIPRLQIRINRFNGVYTGVAEVAGEWMLIDAKGELQTVHPFIFSVPLAA
FT                   DGFAAQVEALSLGVDELTTQVAVSLK"
FT   CDS_pept        complement(298297..298713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SVI_0251"
FT                   /product="mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00222"
FT                   /db_xref="GOA:D4ZEJ2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ2"
FT                   /protein_id="BAJ00222.1"
FT                   /translation="MSVSIAKTKRIHVAVGVIMNSDNQILLAKRLNHLHQGGKWEFPGG
FT                   KVEQGESVTQALTRELKEEVDLTITDTSSLMTISHDYPDKQVLLDIHWVTGFTGEAHGI
FT                   EGQLVKWVSKLDLQDYDFPDANKPIIDKILELES"
FT   CDS_pept        complement(298719..298931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00223"
FT                   /db_xref="GOA:D4ZEJ3"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ3"
FT                   /protein_id="BAJ00223.1"
FT                   /translation="MTTLVKCPTCQAEVIWNSESKFRPFCSDRCKLIDLGDWASEKHAI
FT                   PAKPEFDHETLDVEGYDESSFFKED"
FT   CDS_pept        complement(299029..299763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00224"
FT                   /db_xref="GOA:D4ZEJ4"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ4"
FT                   /protein_id="BAJ00224.1"
FT                   /translation="MTELIYEQPLNEKTRSYLRLEYLEQQLQMNLTQDHQERCFLPLFS
FT                   LCELAERCDYRGEVLKDLNKQILLLSNWKNLPHIDKQQVDKYLSLLSNARADLQMSERP
FT                   GKPLKQNRFLMALRQRFNMPGACCNFDLPQLHYWLAKPWDTRRQEYSQWLDTFRVLLTP
FT                   ISLLLELTRLTTEYTDAVAKAGFYQGTSNQALSLIRVQLDSNQGCYPTISGHKNRYAIH
FT                   FVQFDQQKHSDRTIEFKLATCI"
FT   CDS_pept        complement(299772..300377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="SVI_0254"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00225"
FT                   /db_xref="GOA:D4ZEJ5"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ5"
FT                   /protein_id="BAJ00225.1"
FT                   /translation="MPKYLIGLTGGIGSGKTTVANLFAELGIELVDADIVARDVVAIGT
FT                   RGLNQIASHFGKQILNQDGSLDRSALREIIFNQPKERIWVNGLLHPMIRTEMLNQLAAT
FT                   SSPYTILVAPLLFENELDKLVNRTLLIDISPSQQSQRTLSRDAVTSEQVEKIISSQAPR
FT                   AEKLAKADDVIDNQGEISALKSKVIALHNNYLKWSNNS"
FT   CDS_pept        complement(300410..301327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="SVI_0255"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00226"
FT                   /db_xref="GOA:D4ZEJ6"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ6"
FT                   /protein_id="BAJ00226.1"
FT                   /translation="MTELITILSHNLWLFSAIAFIFAAVIGSFLNVVIHRFPVMMKREW
FT                   QQECNQYLNEYHKELIDPISNELERAIDGYPEKYNLIVPGSACPKCKTDIKPWHNLPVI
FT                   GWLMLQGKCASCSSPISARYPIIELLTGLAVAFLALHFGPTLEFAFATVLTFVLIALTG
FT                   IDLDEMLLPDQLTLPLLWLGLIINLDSTFASPSDALIGAAAGYLSLWSVFWAFKLLTGK
FT                   DGMGYGDFKLLAVFGAWFGWQLLPQIILLSSIVGAVVGIMLIISKRLNKGNPIPFGPYI
FT                   ALAGWIAMIWGNNINTWYLSTLYS"
FT   CDS_pept        complement(301388..302659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="SVI_0256"
FT                   /product="type IV pilus biogenesis protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00227"
FT                   /db_xref="GOA:D4ZEJ7"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ7"
FT                   /protein_id="BAJ00227.1"
FT                   /translation="MATASTIKKRQARAKKSNVNSQPKIYTYEWKGVNKAGQKTSGELK
FT                   GATAAEVRSQLKTQGVNPKSVKKQSASLFQLGAPKINAMDIAMITRQIATMLSAGVPLV
FT                   TTIEMLGRGHEKVKMRELLGTILNDVQAGIPLSDALRPHRQYFDDLYVDLVAAGEHSGS
FT                   LDAVFDRVATYREKTEALKSKIKKAMFYPAAVVVVAFGVTALLLLFVVPQFEEIFSGFG
FT                   AELPAFTQLVIGISDALQASWYIFAVIIIVAVFLFKRAHRSSQKFRDQVDASLLRIPAI
FT                   GPILHKAAMSRFARTLATTFAAGVPLIDGLESAAGASGNAVYRKAVLKVRSEVMAGMQM
FT                   NVAMRTTNLFPDMLIQMVMIGEESGGLDGMLNKVANIYEMQVDDAVDGLSSLIEPIMMV
FT                   VIGTLVGGLIVAMYLPIFEMGKII"
FT   CDS_pept        complement(302689..304398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="SVI_0257"
FT                   /product="type IV pilus biogenesis protein PilB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00228"
FT                   /db_xref="GOA:D4ZEJ8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ8"
FT                   /protein_id="BAJ00228.1"
FT                   /translation="MPTTGLHLGLSTLFIRKQLLSEEQIASAIAKSRQNKQSLVSTIVS
FT                   EKLISAREIAELCYEEYGTPLLDLDEFDVASIPEDFLNKKLIEKHKCLPLFKRGNRLYI
FT                   GTSDPTNITALEDFQFSAGLHAEAILVEDDKLTKAIEKILEDDISALDISGIDESALAD
FT                   IEVDDPSKREEEQKSESGDDAPIVIYINKILTDAIRKGASDLHFEPYEKRYRIRFRIDG
FT                   ILHEVSEPPVNLSARISARLKVMSKLDIAERRVPQDGRIKMKLSRTKSIDFRVSTLPTI
FT                   WGEKIVMRILDSSSAQLGIEKLGYEDDQRELYEEMLEKPQGMILVTGPTGSGKTVSLYT
FT                   GLNILNTEARNISTVEDPVEINLEGVNQVHINLKAGLTFASALRSFLRQDPDVVMVGEI
FT                   RDLETAEIAIKAAQTGHLVLSTLHTNSAAETLTRLINMGVPGYNIASSVNLIIAQRLSR
FT                   RLCPECKQAEDIPEHELQRLGFKQANIDEGITTYKPVGCDLCSGGYKGRVGIYEVMKIS
FT                   DEIARIIMEGGNSLQIATMAKEEGMRDLRESGLLKVIHGVTSIAEINRVTSF"
FT   CDS_pept        complement(304497..304943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0258"
FT                   /product="pilin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00229"
FT                   /db_xref="GOA:D4ZEJ9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEJ9"
FT                   /protein_id="BAJ00229.1"
FT                   /translation="MKGINLKNRLNKKAQGFTLIELMIVVAIIGILAAIALPAYKDYVT
FT                   TASGGASMKAVSSMTSTAAACVTSDIACASVKTNMDAMKLTGLVEFNKESTVVYTGDQC
FT                   MVTATIAATGAVSYAATAVTGSGGTDELCQEGAGVTPAAVTPTP"
FT   CDS_pept        complement(305970..306887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="SVI_0259"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00230"
FT                   /db_xref="GOA:D4ZEK0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK0"
FT                   /protein_id="BAJ00230.1"
FT                   /translation="MLENDIRLAVKAALEEDLGYQAPIQAATSHDVNSQDKMTGLDKAN
FT                   ADITAQLIPADKHAQASLITREEGVFCGKAWAEQVFNQLGGEVAIHWHVDDGDLLVANQ
FT                   VLCELSGPARAILTGERTAMNFIQTLSGVATLTKHYVDKIAGTNTKLLDTRKTIPGLRT
FT                   AQKYAVTCGGGKNHRIGLYDAFLIKENHIMACGGIAQAISKARELHGDKLVEVEVENIL
FT                   ELQQALEAGSDIIMLDNFDVTMMIEAVELNKRLADDKQAKLEVSGNVTIDTIADFAKTG
FT                   VDYISVGALTKHVQALDLSLRLKN"
FT   CDS_pept        307073..307177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00231"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK1"
FT                   /protein_id="BAJ00231.1"
FT                   /translation="MADQALSATLLLNVTFTADERASISANDWHWSFQ"
FT   CDS_pept        307235..307813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="SVI_0261"
FT                   /product="AmpD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00232"
FT                   /db_xref="GOA:D4ZEK2"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK2"
FT                   /protein_id="BAJ00232.1"
FT                   /translation="MIKTKLIPDFELGWAKGVKRCVSPHFNSRPDNEVSLLVIHNISLP
FT                   AGCFGTPFIDQLFQGCLDVTADPSFKDLHGLQVAAHFLIRRDGQVTQYVSCDDRAWHAG
FT                   ESSFQGQEECNDFAIGIELEGTDTEDYTESQYLELIRLTLGLLARYPKLNVDAIVGHCD
FT                   IAPGRKTDPGNSFDWIRYKCELTLGLSRP"
FT   CDS_pept        307912..308763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampE"
FT                   /locus_tag="SVI_0262"
FT                   /product="AmpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00233"
FT                   /db_xref="GOA:D4ZEK3"
FT                   /db_xref="InterPro:IPR031347"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK3"
FT                   /protein_id="BAJ00233.1"
FT                   /translation="MALFSLLIAVMVERLKLLPKSWQLESFLTLYSNNLFGKKQLESEA
FT                   VMALAILLPAISVYVATWALKGMLWGGLSLLFWVGISILCFSHQKQRTAFKRYMQAACR
FT                   GDSQACYHFAEELDCKRAIEAVSESDLGAKVGQSVTWLNYRFYGAVALYLIFFGPAGAV
FT                   LYCTVRFFADESRQQSLELPLVDKVLMLLDWLPSRIFSFGYVLSGQFSQAFTRWRKLGL
FT                   SLNHSARDIVTQVALAAEPSPEASGTPICVQATLALLQLSKRNFILLLTTLSLLTIFGV
FT                   VA"
FT   CDS_pept        309099..309851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="SVI_0263"
FT                   /product="pyruvate dehydrogenase complex repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00234"
FT                   /db_xref="GOA:D4ZEK4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK4"
FT                   /protein_id="BAJ00234.1"
FT                   /translation="MAYSKINQPKISDVIMGQLEQMILEGSLQPGQKLPPERELALQFE
FT                   VSRPSLREAIQKLEAKGLLLRRQGGGTYVKEQLWQSLADPIVELMHSDSESQYDLLEFR
FT                   HATEGMMAYFAALRGTDADMQNIKRTIMEVDGAIEIEQQAEAIVRFYRAIAEASHNVAM
FT                   LHLVLSLAPVLHKNVAQNLELLNRREEASTRANEHRLALLAAIVRRDPDAAREASNEHL
FT                   SYIEEIMLTVRKEDSRLQRSLRRLKSGD"
FT   CDS_pept        309966..312626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="SVI_0264"
FT                   /product="pyruvate dehydrogenase complex, E1 component,
FT                   pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00235"
FT                   /db_xref="GOA:D4ZEK5"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK5"
FT                   /protein_id="BAJ00235.1"
FT                   /translation="MSEHMLQDLDPLETQEWLSALESVVREEGVERAQYLLEQVLDKAR
FT                   LDGVDMATGINTNYINTIPTSQEPAYPGNTTLERRIRSIIRWNAIMIVLRASKKDLDLG
FT                   GHMASFQSSAAFYEVCFNHFFRAPNEVDGGDLVYYQGHISPGIYSRAFVEGRLSAAQLD
FT                   NFRQEVDGEGIPSYPHPKLMPEFWQFPTVSMGLAPMSSIYQARFLKYLDGRGLKDTSAQ
FT                   RVYAFLGDGEMDEPESRGAISFAAREKLDNLCFLINCNLQRLDGPVMGNGSIIQELEGL
FT                   FRGAGWNVVKVIWGNNWDSLLAKDTTGKLLQLMNETVDGDYQTFKSKDGAYVREHFFGK
FT                   YPETAALVSDMTDDEIFALKRGGHESSKLYAAFKNAQDTKGKPTVILAKTVKGYGMGGA
FT                   AEGKNIAHQVKKMDMSHVLQLRDRLGLQDLLTDEKVAELPYLSLEEGSEEYKYLHARRD
FT                   ALHGYTPQRLPNFTKPLELPEIEDFKPLLDEQKRDISTTMAFVRSLNILLKHKGVSKNI
FT                   VPIIADEARTFGMEGLFRQIGIYNPKGQNYTPQDREIVSYYKEATSGQVLQEGINELGA
FT                   MSSWVAAATSYSTNDLPMIPFYIYYSMFGFQRVGDMAWMAGDQQARGFLLGATAGRTTL
FT                   NGEGLQHEDGHSHVQANTIPNCISYDPTYAYEVAVIIQDGMRRMYGDQENVFYYLTLMN
FT                   ENYAMPAMPEGAAEGIRKGIYKLESYQGSKQVQLMSSGTIMNEVRKAAKILSEEYDVAS
FT                   DVYSVTSFNELTREGQDVERYNMLHPEAEQKQAYIAQVMGTAPAIAATDYMKNYAEQVR
FT                   AFMPSESFKVLGTDGFGRSDSRDNLRRHFEVNAGYVVIAALTELAKRGDIEKSVVAQAI
FT                   AKFNIDADKINPLYA"
FT   CDS_pept        312640..314511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceF"
FT                   /locus_tag="SVI_0265"
FT                   /product="pyruvate dehydrogenase complex, E2 component,
FT                   dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00236"
FT                   /db_xref="GOA:D4ZEK6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK6"
FT                   /protein_id="BAJ00236.1"
FT                   /translation="MTIEINVPDIGADEVEVTEILVSVGDKVEEEQSLIAVEGDKAAME
FT                   VPASRAGIVKEIKVAIGDKVATDALIMIFEDEAASAPVAQAAAAPVPVAATAAPASVEL
FT                   KEVNLPDIGDDEVEVTAILVSPGDIITEDQAILSVEGDKASMEVPAPFNGVLKEIKVEI
FT                   GDKVSTGSLVMVFEIAGSSAAPVAAPVTPVAAPVATAASVLEVAVPDIGDDEVEVTEIM
FT                   VKVGDTVTEEQSLISVEGDKAAMEVPAPFAGTIKEIKVATGDKVSTGSLIMIFEVAGQA
FT                   PAAAPVVAAPAQVAPVQASASTAKPAKTDFVENDAYAHASPVIRRLAREFGVNLANVKG
FT                   TGRKNRVIKEDVQNYVKAAVKQVESGSVKAAAGGNELNLLAWPKIDFSKFGETEVKPLS
FT                   RIQKISGANLHRNWVKIPHVTQWDNADITELEVFRKAQNAAEAKKDSGMKITPLVFIMK
FT                   AVAKALETFPTFNSSLSEDGQSLILKKYVNVGIAVDTPNGLVVPVFKDVNKKGIHELSD
FT                   ELKVISKKARSGKLTASDMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPV
FT                   WNGKDFEPRLMLPLSLSYDHRVVDGAEGARFISYLNSCLSDIRTLVL"
FT   CDS_pept        314672..316102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SVI_0266"
FT                   /product="pyruvate dehydrogenase complex, E3 component,
FT                   lipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00237"
FT                   /db_xref="GOA:D4ZEK7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK7"
FT                   /protein_id="BAJ00237.1"
FT                   /translation="MSNEIKTQVVVLGSGPAGYSAAFRAADLGLETVIIERFSTLGGVC
FT                   LNVGCIPSKALLHVSKVIEEAKAVADHGVVFGEPKIDLDKLRGFKNSVISQLTSGLGGM
FT                   SKMRKVDVVNGFGKFTGPNTIEVVGEDGVKVVHFEQAIIAAGSRPIELPFIPHSDPRVW
FT                   NSTDALELKEVPGKLLIMGGGIIGLEMGTVYASLGSQIDVVEMLDQLIPAADKDIVRVY
FT                   TKKVKNKFNLMMQTKVTAVEAKDDGIYVTMEGKKAPAEAVRYDAVLVAIGRAPNGKSID
FT                   AEKAGINVDERGFINVDKQMRTNVANIYAIGDIVGQPMLAHKGVHEGHVAAEVISGLKH
FT                   FFDPKVIPSIAYTDPEVAWVGLTEKEAKEQGIAYETASFPWAASGRAIASDCSDGMTKL
FT                   IFDKETHRVIGGAIVGVNGGELLGEIGLAIEMGCDAEDLALTIHAHPTLHESVGLAAEI
FT                   YEGSITDLPNPKAKKKKK"
FT   CDS_pept        316292..320752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0267"
FT                   /product="sensory box protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00238"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK8"
FT                   /protein_id="BAJ00238.1"
FT                   /translation="MLLTKIIKNVCLLILFSTCLTPVTASDFVMRVFGEREGLEAGTIN
FT                   DISFDSHGFVWVATEQGLYRLSNSKIRRIDKQKFDLRLSSEYINMVEPLSEKHLLVSNY
FT                   SDTYLYNMLQNKFVRFGSETLFPDYKGGGIIAQVKQGDHYIFLTLDGELLQYSYEKSLL
FT                   ERIVFLPTNADIPWGNLAVLDDGRMIVGTEFELELRDSQGQRIAAFPWGEEFGLMKQLF
FT                   KDSQGRIWLSSSEGVYRVYADTLEIQAVEALSFYATNIAEDNLGDFWISGRLGLIKWRP
FT                   GDTEYQTYKQQLKQVADMDYIYDIEIDDSGLIWVGGAGEGLAIVTSEPDFLVDTYTAAS
FT                   PYSLSDEIIWGIYAEGEHVWLGTDNGLFSINKLTQTSSRLFPQGLELNDSIYGVDSLDA
FT                   DNLLLSTTNGLFVVHKATFTAQRFSQWTHGESSLENKIVYASYQDPLIQGRWWFMTSTG
FT                   LYFWEPGLFDPQAMPVLSDDLSSRIIDIRTVIRDESGTLWLGGTQVFGYLDNQGEFHSK
FT                   LAKFSDGSTEVGVNNIEIIDANTFWLGTSPRGLLEYTLDSGEARALNKDWEIDCTSVYF
FT                   IQEIADFRLIACPNSLLRYSKSTGELKVIGHDDGLLGEELNDGSYFYDPSEGLYVGTPD
FT                   GAMLLDVDSLSNRLMLDGVFLEAVSVFYDEGMQIDLIPQDEKIIKPGARMISFQITSLN
FT                   YLDDTPMTLQYRLRRERDIPEAKYLLLDGQSQLNITGLQYGKYTLDILSQENGIWSAKP
FT                   YSFSFTVKQYWWQMSWVKSLLLLSLLCICIGVILYRQRQVQAFKRINTALVESEERLRQ
FT                   SLKGSDSELWEWRHDSQMFSLENQREEKEDDRGNIFLKLEDVPIHREDRDKVVNAWDNM
FT                   QQGLSDRFDVEYRYRRKDKSWGWTRVLGRPVEVDAESGSILRVAGIYSDITLQRQLEDD
FT                   VKLLAQAFGNTSEGVLILDGAERIKVSNKAAQTIVGASAEMLNGKFFSELILAKEGRSD
FT                   DIVCLLKQEISWTGEQEFLREQGGSCPVWLNVSAMLGSKGNITHYVAVFSDITERKRSE
FT                   ADLRRLANYDVLTGLPNRSLFATRLTQSIDGAEHSGEKLALIFLDLDRFKHVNDSYGHS
FT                   MGDALLVEAANRLQSCISPEHTLCRFGGDEFVILLRDAANLDTINHICTQLLEQIETPF
FT                   ELYGREFFISTSIGVSLWPDDAREAEVLINNADQAMYHAKEEGRGNFQYFSSERNSEAL
FT                   YHLRLEAELRKAIERDEFELHYQPQVNILKGDKLCGMEALLRWHHHEDGLIRTDIFIKV
FT                   AESCGLIVDIDLWVLRQACIQGKIWSKSYAEPFKLSVNISAVHFRQPDFIQGVKRILQE
FT                   TELDPRLLGFEITEGVLMKELDTAKEHLLELRALGIDVAIDDFGTGYSSLAYLRHFDVD
FT                   TLKIDRSFLIDIATNEADQAIASSIIELARNLKLNVVAEGVETKEQLEQVFSRGCYVIQ
FT                   GYYFSKPLTVVEIEKYMDNSSPIFQ"
FT   CDS_pept        320873..323095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0268"
FT                   /product="Patatin-like phospholipase family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00239"
FT                   /db_xref="GOA:D4ZEK9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEK9"
FT                   /protein_id="BAJ00239.1"
FT                   /translation="MIRLLTLFLVLTFSFSALADEVRPKIGLVLSGGGAKGAAHIGVLK
FT                   ILEQNRIPVDYIAGTSIGAYVAGMYALGYSATEIEKIMLNENWSDGYSDTIPRQALSYR
FT                   DKRQRDRFNIPLNLGYSDEEVKLPNGLLRGQTMSQLLQRSTDLVHQFGHFDELAIPYRA
FT                   VATDLETSQAVVISNGSIVKAMQASATVPGALQPVEYEGKLLIDGGIGNNMPVDVVKAM
FT                   GADIIIAVDIGSALVKKQELTSTIAVLNQLSTMLTNASTERQKALLTNDDILIRPDVGE
FT                   MSTTDFTIMPEAFSLGEEAALKHLISLQGLSVSEESYLAYVARKKRLSHRWLDELDHPI
FT                   VNIVFNNDSKVSESLLRQALGLKEGEVVSQERLAKGIADVYALDKFERVNAEFIDSDQG
FT                   RVLTLNTHAKSWGPNYFQLGFSWEDDFTLDSAVSLDLAYTLTNLTPTGGEWRNEVKLGF
FT                   EKLISTEFYQPLDYDQAFYTRAKLGYEIKNWELFGKNSNILKITQNQYRADVGIGYNYV
FT                   KEGILELGFTAETGLLENALFVKDLAYHSYGGYFKFGYDDLDSINFPTSGNRLTLDVYY
FT                   RKEDNPNFNFDELGELAENSVQVELDWRGALSVGNHAFVGIASLATVAKDAGISVHVSR
FT                   LGGFLNLSGYHKNALVGPHKVFGAFVYQYDLGRDVLGMTDYPLYLGTSIEAGNVWQLKD
FT                   NVDLDDLIYSGSLYFGTDTSMGPAALGFGWADNGETSIFLFLGRNW"
FT   CDS_pept        323238..325289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0269"
FT                   /product="peptidase, M13 family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00240"
FT                   /db_xref="GOA:D4ZEL0"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL0"
FT                   /protein_id="BAJ00240.1"
FT                   /translation="MNRVSKLALGIALSLGLAACSNETTTPVVQQIEKVSGVEKVNFDS
FT                   SVRHQDDFYYSVNGHWLANTPIPADKSNYGAFSVLYERSQNALKKIIDETAAKPNKAEG
FT                   SSEQKVGDFYASYMNTDIIEKLGFSPLSDQLGDIAQAKDHQDIASLMGSLLVSGVQIPF
FT                   GFYVNNDAKNSTQYAVYLHQSGLTLPDRDYYLKDDDKFVANRAALNTYVADIMTQAGSK
FT                   NSERVADSVAKIETFIAQSQWSRVESRDANNSYNKMDRAELQAKVTNFDFVQFSASADI
FT                   DKVTEVIVRQPSYFEKFGAKFTQFSVAQWQDYLAFHLVDSYAELLSKNFVDLHFDFHSK
FT                   TLMGIEEQKPRWKMAVDASDQVIGELVGKEYVKQYFKPEAKQRMEGLIQALIKGFEVSI
FT                   DEIEWMTPETKVAAQEKLAKFTYKIGYPEKWKDYTDLKITADHLVGNYQAYAKFEYKTM
FT                   LDKLGKPIDRTEWHMTPQTVNAYYNPVMNEIVFPAAILQPPFFNMGADDAVNFGGIGAV
FT                   IGHEISHGFDDQGAKYDGDGNLRDWWTDADRAEFQKRGAQLSAQYAGYEALPGKHVNGD
FT                   LTLGENIGDLGGLTVAARAYHLSLNGKPSPVIDGLTGEQRLFIGWSQVWRRNYRDEELG
FT                   RRLMTDSHSPSHFRAMGTPRNIPAFYQAFDVKEGDKMFLAPEDRVKIW"
FT   CDS_pept        complement(325403..326068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0270"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00241"
FT                   /db_xref="GOA:D4ZEL1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL1"
FT                   /protein_id="BAJ00241.1"
FT                   /translation="MTSPKLKAIIFDMDGVLIDSEPSWQKAIFQTLELLGLPIRFEDTL
FT                   QTTGLRIDQVVSYWYQKFPWDNYDNEKTANAIVDQVVNMISTTGQAMTGVEQALKFCRD
FT                   NDYKIGLATSSSSPIIEAVLNKLKLAHYFDSIQSAEHLAYGKPHPEVYLNCAKALDIDP
FT                   MTCVAIEDSFNGLVAARAANMQTIVIPAVEQQGEPRWILAHQQLRDLTQLPEVLDSKF"
FT   CDS_pept        326485..329082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnB"
FT                   /locus_tag="SVI_0271"
FT                   /product="aconitate hydratase 2"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00242"
FT                   /db_xref="GOA:D4ZEL2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL2"
FT                   /protein_id="BAJ00242.1"
FT                   /translation="MLEAYRKHVAERASEGVVPKPLDAHQVAELVEVVKNPPAGEEAFI
FT                   LDLLENRIPPGVDEAAYVKAGFLDAVATGEVTSPILTSAHAVELLGTMQGGYNIDPLIA
FT                   QLDVTAQAPLAVKALSKTLLMFDSFHDVVEKMQAGNEFAKQVVHAWADADWFLNRPKLA
FT                   EKISLTVFKVTGETNTDDLSPAPDAWSRPDIPLHALAMLKNARDGIVPDEAGTLGPIKE
FT                   IEQLKTKGFPLVYVGDVVGTGSSRKSATNSVLWFMGDDIPNVPNKRGGGFCLGGKIAPI
FT                   FFNTMEDAGALPIELDVTKMDMGDVIDIYPYQGIVKRHDSDEVISEFSLKTAVLMDEVR
FT                   AGGRIPLIIGRGLTARARAVLKLEDSKVFVLPKDVADTGKGYTLAQKMVGKACGVTGIR
FT                   PGQYCEPKMTSVGSQDTTGPMTRDELKDLACLGFSADLTMQSFCHTAAYPKPVDVNTHH
FT                   TLPDFIMNRGGISLRPGDGVIHSWLNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAF
FT                   AAATGVMPLDMPESVLVRFKGEMQPGITLRDLVHAIPLKAIDMGLLTVEKQGKVNFFSG
FT                   RVLEIEGLESLKVEQAFELSDASAERSAAGCSIKLDKEPIIEYLNSNIVMLKWMIAEGY
FT                   GDRRTIERRIIAMQDWLANPELLEADADAEYAAVIEIDLSDIKEPILCAPNDPDDAVLL
FT                   SDVKDTKIDEVFVGSCMTNIGHFRATGKMLDKFATTLPTRLWIAPPTKMDRDQLTEEGY
FT                   YAIFGRVGARIEIPGCSLCMGNQARVAEGATVVSTSTRNFPNRLGTGANVYLASAELAA
FT                   VAALLGRLPSADEYQTYAKELDATAADTYRYLNFDKMQSYTEKAAEVIFQSAV"
FT   CDS_pept        complement(329188..329583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0272"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00243"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL3"
FT                   /protein_id="BAJ00243.1"
FT                   /translation="MTSPDYNPVVTALKLKRKSRLLEVTFDDGKTFQLSCEILRVYSPS
FT                   AEVHGHGNPVLVTHKKNVNIKALDPVGNYAVKISFDDGHDTGLFSWKVLYDLATHQADL
FT                   WAQYLTRLKTEKASREPLIDMLVKYHN"
FT   CDS_pept        complement(329712..331037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="SVI_0273"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00244"
FT                   /db_xref="GOA:D4ZEL4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL4"
FT                   /protein_id="BAJ00244.1"
FT                   /translation="MSEMTPREIVHELDSHIIGQQNAKRAVAIALRNRWRRMQLDPDLR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLAKAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DSAVKLTREEHMKKSKVKAEEAAEERILDALLPKPKEDWDNEKPDDSGTRQIFRKKLRE
FT                   GQLDDKEIEIDVSAPQTGIEIMSPPGMEEMTNQLQSMFQNMGPGASKRRKMPIKEAYKL
FT                   MIEEEAAKLVNQEDMKEQAIELVEQHGIVFLDEIDKICRRGESTGPDVSREGVQRDLLP
FT                   LVEGCTVNTKHGMVKTDHILFIASGAFQMSKPSDLIPELQGRLPIRVELQALTADDFKR
FT                   ILTEPHASLTEQYVALMATEGVKIEFTVDGIEAIAQAAWQVNERTENIGARRLHTVMER
FT                   LMEELSYGASDKSGTESVIDAKYVKDHLDELVQDEDLSRFIL"
FT   CDS_pept        complement(331115..331639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="SVI_0274"
FT                   /product="ATP-dependent protease HslV"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00245"
FT                   /db_xref="GOA:D4ZEL5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL5"
FT                   /protein_id="BAJ00245.1"
FT                   /translation="MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNARKVRRLYHNKVLA
FT                   GFAGGTADAFTLFERFEAKLEMHQGHLMKAAVEMAKDWRSDKMLRKLEALLAVADSECS
FT                   LIITGNGDVIQPEGDLIAIGSGGPFAQSAATALLENTELTATEIAEKSLTIAGGICVFT
FT                   NQFKTIEELNY"
FT   CDS_pept        complement(331855..332439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0275"
FT                   /product="cell division protein FtsN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00246"
FT                   /db_xref="GOA:D4ZEL6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL6"
FT                   /protein_id="BAJ00246.1"
FT                   /translation="MTNRDYANRKPSRKGKAKSKTTRRKSKAPAPRRFPLVLLLVTLGL
FT                   VTGFGYFLWTINNSAKDLDEGEAAVAEQSVVKPTQKKDPKALPPKPKEKWTYQKELVNM
FT                   KVEVDIPEVSGPAHRYRMQCGSFRTQPQADAMKAVIAFQGLDSNITKAKGTTGDWYKVS
FT                   LGPYDRKRLAEKHRHVLQKAGINGCFLMFVN"
FT   CDS_pept        complement(332460..334205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="SVI_0276"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00247"
FT                   /db_xref="GOA:D4ZEL7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL7"
FT                   /protein_id="BAJ00247.1"
FT                   /translation="MKSHIQSLLIQALDVLKQQEVIPTDFEARIQVDRTKDKTHGDFAT
FT                   NLAMMLTKTARKNPREIAQLIIDSLPQDSQVAKVEIAGPGFINFFIDENALANQLMAAL
FT                   KDDHLGISLPEQQTIVVDYSSPNLAKEMHVGHLRSTIIGDSVVRALEFQGHKVIRQNHV
FT                   GDWGTQFGMLLAYMEELRAKNGEQAQMELSDLETFYRAAKVRFDESEEFAVRARKLVVS
FT                   LQSGDEYCNKLWREFNDISLNHCHDVYARLGVSLTREDVRGESAYNADLVEVVKELDTQ
FT                   GLLSESNGAKVVFQDEFKNKEGDPLPVIIQKADGGYLYATSDMAAMSYRSKVLNADRVL
FT                   YFVDLRQALHFQQVFKLARKANFVRPELSLEHMGFGTMNGADGRPFKTRSGGVVKLVDL
FT                   LAEADIRALELVRSKNPDMDEAELEKIAKVVGISSVKYADLSKNRTSDYIFSFEQMLSF
FT                   EGNTAPYLLYAYTRVIGIFKRAEDIDLSQAKILLEHDKEKNLGNKLAQFGEVLSRMVSK
FT                   GQPHAMCAYLFELAGAFSSFYEACPVLAAETEEQKKSRLLIAKLTAKTLKQGLDLLGIE
FT                   TLDRM"
FT   CDS_pept        complement(334339..336534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="SVI_0277"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00248"
FT                   /db_xref="GOA:D4ZEL8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL8"
FT                   /protein_id="BAJ00248.1"
FT                   /translation="MPLFVEVALPVPMRQTFSYSVPESVTSVPAQGMRVKVPFGRQQLI
FT                   GLVIGTSDTCNLAPNQIKSIIELLDDEPLLPDSLYKLTVWAARYYFCSLGQMLSQALPV
FT                   ALRKGAEVTADTTIFWSLTTSGNAASLDTLKRAPAQKKVIEALLKTEMTQEELTSLALS
FT                   KPAMKALQDKGWIAKHERTNKIDLSWRDNLELGEEPLTLNPEQAVAVATLNQQSGYHCT
FT                   LLEGITGSGKTEVYLALLESVLKQGKQALILVPEIGLTPQTISRFKSRFKVKVAVIHSG
FT                   LTDNQRLTAWRQAKTGEAAIIIGTRSALFTPMAYPGTIILDEEHDSSFKQQEGVGYHAR
FT                   DLAVMRGHLEKIPVLLGTATPSLESLQNALSGRYKHLELGQRAGNAEKVRQGIIDISNQ
FT                   PLKTGMSHALLNEIRIHLDAGNQVLLFLNRRGFSPALLCHECGHLHECDRCDAFFTVHQ
FT                   SLGEIRCHHCGNHYAIPRQCHNCGSTMLMGQGVGTEQLAEALEKEFPKYPVVRIDRDTT
FT                   SRKGALEGHLNAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAPERF
FT                   GQLYTQVSGRAGRARKPGTVLMQTHQANNAILRELMHKGYGEFARAQLNERKQALLPPA
FT                   WHMLLIRAEAHLAIDADNFLSQVAQFLPQNEECEVIGPMPAPMDKKAGKYRRHLIFQTK
FT                   SRNLLQQAFEHALPQIEALPLAKRCRWSLDRDPQDLL"
FT   CDS_pept        336644..337426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEL9"
FT                   /protein_id="BAJ00249.1"
FT                   /translation="MTKMIKVALYLILFIAAPFIGAGYANAHISHVSINEQQFILGGYP
FT                   KFRVNIVSQDASLDKMQFVVRQASGEERLMVKPINNFLLLVTGVEDVMDPSATLVVREY
FT                   RVNKWRDVKVFSLFKGRHLSQELAAKSSAAHLNIESRASEAPSSMYKIASMSQSSTQLS
FT                   SGRGNKPAQYRHSLYDKSCTLKHTPAMTLWRIGTEHGKAWGLSTYGAMLAIFEANTKAF
FT                   NQGDINGLRADALLRCPSQTLRAKYSNHKMAKQTFEAL"
FT   CDS_pept        337648..337860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="SVI_0279"
FT                   /product="ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00250"
FT                   /db_xref="GOA:D4ZEM0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM0"
FT                   /protein_id="BAJ00250.1"
FT                   /translation="MKTGIHPDYAEITATCTCGNVIKINSTAGKSLHLDVCGACHPFYT
FT                   GTQKIVDTGGRIDKFNKRFGALGKK"
FT   CDS_pept        338511..339758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0280"
FT                   /product="malate oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00251"
FT                   /db_xref="GOA:D4ZEM1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM1"
FT                   /protein_id="BAJ00251.1"
FT                   /translation="MSDLRQQALDYHEFPVPGKTAVSLTKPAETSLDLALAYSPGVAEP
FT                   VREIAADPDNAYRYTAKGNTVAVITNGTAILGLGNLGPLASKPVMEGKALLFKHFANID
FT                   ATDIEVKHRTTEEFINTVEAIADTFGGINLEDIKAPECFEIEKALIERCSVPVFHDDQH
FT                   GTAIVTTAGMINALEIQGKSMEDAVIVCMGAGAAAIACMTMMVKCGVQRENVYMLDRKG
FT                   VIHARREDINEYKALFANNTDKRTLQDVIKGADAFLGLSGPDVLGAEDVALMADKPVIF
FT                   ACSNPDPEIKPEIAHNVRKDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASKINDEM
FT                   KIAAVHAIAALAKEEVPASVLAAYPDVTSLSFGPDYVIPKPMDPRLLSNVAKAVAQAAI
FT                   DSGVAVITELPENYMS"
FT   CDS_pept        340316..341923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshH"
FT                   /locus_tag="SVI_0281"
FT                   /product="MSHA biogenesis protein MshH"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00252"
FT                   /db_xref="GOA:D4ZEM2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM2"
FT                   /protein_id="BAJ00252.1"
FT                   /translation="MLTYKKVLLKEDNLTLVITLPQPFNMDSFSWYEFSILVMGLLSIL
FT                   VFVFFGHRWLSMQLLGIEDLAVRSKLILENEYDKALAERGDGRPRMINRALTHLLLELD
FT                   DAQKQRARFDQFIRSNTFLDPETGIGNRLFLKNRLDALSNDKGMMAPGVLFLLEMEDMD
FT                   LLQQELGEDSIDEMLHQTISDITQILDSQANSIFSRRSFNQFAIVVPQISLKDVEKLAA
FT                   KLLKVCLSQNVPETQNSEDFFHIGAAYFKVGDTKEQLLDESERALRAAQFQGSSGWFMY
FT                   DKGAVDEELARGSVRWRSFLEYALVNKRLVVFSQPVVDSDMDTHHLEVSSRIRDNKNNL
FT                   IRATLYIPMAIKCGLTPQFERQVIETVLFDLLSNPKDKITKFSINLSLDTLMSRAFIRW
FT                   LKTTLLEYRHLTSRLIFEINEDIVVHHKEQLKPKLNMIKKMGASLCVDRVGQQVVSTQY
FT                   IKECHFDLIKLHRSIVTQIHLRQENQLFVRSLIGGLYRTEVQVFAEGIESFEEWQTLKI
FT                   LGVSAGQGSLFSEPVEEI"
FT   CDS_pept        342256..343206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00253"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM3"
FT                   /protein_id="BAJ00253.1"
FT                   /translation="MEKSLLTRLAFWQNSNSKLELGIYVCPDKLVVYQANNSDGISSTE
FT                   TESHVGERLETESITHEFAFNGSNWSSVFASIAKQFKSAQLHITLCSSFYQLLIVDKPN
FT                   VEPNEMSQALLWSVKDMVTQAVTDLHIDYFDSPLPNSTKLSVVVTERARLSAMVLAAQE
FT                   HHLQVLGISIEEMAVTGLFEQDNQARLILCHTPGQELLLTVVKQGQLYMQRRVRGFNKL
FT                   DTVSVDDLAMGMVDSLSLELQRSMDYFESQLRQAPVVSIELLINGQVDKLAELVSANFD
FT                   QKVNAMAIDTVEAKIALLTCGEFYRVDTRESGVQT"
FT   CDS_pept        343203..343808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00254"
FT                   /db_xref="GOA:D4ZEM4"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM4"
FT                   /protein_id="BAJ00254.1"
FT                   /translation="MTLKTRVNLFSDTLLPPVLRLSFKRLTQTLIFMLVLFGITNLATY
FT                   VLVSGLETNKAELAKQKANLDRQKKNLEVAMAKRAPDAKLVDQVELLSQQVELKQMLIG
FT                   ELSQREALTSHGYSMLFKDLARVANSNIWLNRIRVENNEYIFEGFSSAPNGVPLWVERL
FT                   KSTETLTGHAFATMAMSRGKDQPLAFILTTKAEIGESK"
FT   CDS_pept        343805..344461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshJ"
FT                   /locus_tag="SVI_0284"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00255"
FT                   /db_xref="GOA:D4ZEM5"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM5"
FT                   /protein_id="BAJ00255.1"
FT                   /translation="MKQKWNEWAAKFDVLSQRERVMVASAVLVVIGMLSYLPLESLLLE
FT                   HLSLVKQNKAIASENKVSLQQIDLYQQRLAQNPNDEYNNRLKVLKRQDESLDEQLSFQM
FT                   VDMVPANHMPALLSELLGKVTGITLHEFTSIAPTPLLAIGEDKKMNLYSHGIRLTLEGD
FT                   YFSVLKFMEAVEGMPSKLYWKEIDYKVHEYPTANVVLELYTLSINKDFISVATQG"
FT   CDS_pept        344481..344771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshK"
FT                   /locus_tag="SVI_0285"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00256"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM6"
FT                   /protein_id="BAJ00256.1"
FT                   /translation="MLFMTSAQAETLRDPTRPGYGSQIVRSSVSSHGSDLVLNSVIKAG
FT                   SASHAVINNKIYQVGDRVQGVRITAIENNSVSLSDERKLTMYQVITESKGN"
FT   CDS_pept        344777..346459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshL"
FT                   /locus_tag="SVI_0286"
FT                   /product="MSHA biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00257"
FT                   /db_xref="GOA:D4ZEM7"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM7"
FT                   /protein_id="BAJ00257.1"
FT                   /translation="MNALKVITPLLTLLLVACQTTDRPEPVAAKEALLESVQTASNKRA
FT                   TPPPAKMPESIQKELASAELLAGLEPSRRAERRFDVSAHDVDAKIFFPSLVQGTPLSVA
FT                   VHPDVTGNISLSLKGVTLSEALQVVEDIYGYEVSRMGRILRIYPAGMRTETFPLNYLYM
FT                   ERHGLSLTSVNSGRISDNSNSSSSNNNSSSGNNSSNNSSGSSSSSNETTNGTFIRSTTK
FT                   SNFWGELKETLVSIVGKTGGGRQVVITPQAGLVTVRAYPNELRQVRSFLKTAETHLQRQ
FT                   VIIEAKILEVTLSDGYQQGINWQNVLGHVGDTNIEFGTSSGGNSLSDQITSVIGGVTSL
FT                   KFSGTDFAAMINLLDTQGDVDVLSSPRVTALNNQKAVIKVGTDEYFVTDVSSTTVAGNT
FT                   PITTPEVELTPFFSGIALDVTPQIDGEGNVLLHIHPSVISIKEQTKTIKISDSTLELPL
FT                   AQSDIRESDTVIMARSGDVVVIGGLMKSENIELLSKVPLLGDIPLLGELFTNRSKSLKK
FT                   TELVILLKPTVVGADTWTNELQRSKELLDRWYPEEQVATEQGQ"
FT   CDS_pept        346463..347371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshM"
FT                   /locus_tag="SVI_0287"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00258"
FT                   /db_xref="GOA:D4ZEM8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM8"
FT                   /protein_id="BAJ00258.1"
FT                   /translation="MYLQHFGLAETPFSLTPNTEFFFGLAPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLICRKLMNELPQRFHCAYLPNPYLSPAELRWAVALELGLKYSADIDQ
FT                   LQLTGLIQQQLLALCAHGHSIVLVLDEAQALPDESLEALRLFTNLETESRKLLQVVLFA
FT                   QPELDERLNQHCFRQLRQRITFSYCLRPLTLDEADAYVQHRLSVAGSQGQPLFDPKNTR
FT                   VLAAASKGIPRLINILAHKSLLLSFGEGTERVEYRHVKGAIIDTQDTKLSYKTQWFWFM
FT                   GLSLISVASGLGLHLFYGASL"
FT   CDS_pept        347368..348591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0288"
FT                   /product="MSHA biogenesis protein MshN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00259"
FT                   /db_xref="GOA:D4ZEM9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEM9"
FT                   /protein_id="BAJ00259.1"
FT                   /translation="MSVINSMLKDLDKRQQSHELENLNVAPVQYQAKPESLSKLPWVLF
FT                   TIVSALLLCGIVYSWQALSSAQLVSSNSTSSQLSNVAKRDLALATEVQSSESDAHLELA
FT                   ETSLVKASAASMQDTTSISKRARKFETESVRAVTSSDKTFSSIQLAEEPLSAKLKVIAS
FT                   DPVTSSVPVNAATSVITSDTAVEPISLVVSSVVVTPISVKPSSMAVTEVQVSNEQLAQR
FT                   RYRLAIEAENQGLLSDAIVYYSEVLTLTPVMHQARRKLAALYYGQGRLGSASDILIKGS
FT                   ALFPEEYDYPFLLARVQQASGDIKLAMSSLELIPDESQLAKQKWTMQSSLAQKAGKYPL
FT                   AEESYRKLLRQDPHLARWWMGLGYALDSQLEYDPAKQAYRQALSADGLSQQAREYIKNR
FT                   LVQLGESE"
FT   CDS_pept        348588..350333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshE"
FT                   /locus_tag="SVI_0289"
FT                   /product="MSHA biogenesis protein MshE"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00260"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN0"
FT                   /protein_id="BAJ00260.1"
FT                   /translation="MKPKLKMRLGDLLVQEQIIGEAQLLEALAEQRSSGKKLGRTLIDL
FT                   NCITEEQLLRFLSQQLNIPFLDISKRPIPSKVVNLLPEVQARRFRALVVEDNGDSVLVV
FT                   MSDPADLQAMDNLEVQLLPKLLKIAVVTESQLLDAFDNLYRRTDEIAQIAGKLEEEYAA
FT                   DDQFDLASLTQGDSDNETTVVKLLQSIFEDAVQMRASDIHIEPGEKVLRIRQRIDGQLH
FT                   ENLLPEVSIAAALVLRLKLMAGLDISEKRLPQDGRFHMEIKGHKIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPEILARIRKQIKRPHGMLLVTGPTGSGKTTTLYGILSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSHVLRTTLRQDPDIIMVGEMRDRE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCQ
FT                   SCSGDYQLTAQDSAWLNSVSHLDFSQATFKIGSGCQSCNGSGYRGRIGVFEILELDESM
FT                   VEAMRTGNPQDFALAAKNSPNFTPLAESALKYLGEGMTTIEEVAKLVEDVTESHIPLSA
FT                   DMVTQ"
FT   CDS_pept        350425..351645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshG"
FT                   /locus_tag="SVI_0290"
FT                   /product="MSHA biogenesis protein MshG"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00261"
FT                   /db_xref="GOA:D4ZEN1"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN1"
FT                   /protein_id="BAJ00261.1"
FT                   /translation="MPVYKYRGRDAQGQQVTGVVDATSESAAADQLMSRAVIPLELIEA
FT                   KEKQDFSLAALFKAKVSLSELQIFSRQMYSLTRSGIPILRAIAGLSETTHSQRMRDALN
FT                   DISEQLTAGRPLSSAMNHHQDVFDALFVSMVHVGENTGKLEDAFMQLSGYIEREQETRR
FT                   RIKAAMRYPIFVLIAITIAMVILNIMVIPKFADMFSRFGADLPWATKLLIGTSSLFVNY
FT                   WPAMLVGVIGGFIGIRYWHSTEKGEKQWDKWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADSVDNAYMHDRIVAMRRGIESGDSMLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGFVAGIVLILALGIYLPMWDML
FT                   NVVKGGN"
FT   CDS_pept        352163..352285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00262"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN2"
FT                   /protein_id="BAJ00262.1"
FT                   /translation="MLNLVKGGDLALFSQSKAGISLFLMLGNVQDRQDRQDRQD"
FT   CDS_pept        352391..352906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00263"
FT                   /db_xref="GOA:D4ZEN3"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN3"
FT                   /protein_id="BAJ00263.1"
FT                   /translation="MLSQQKADGELLGLFSKMIAIVLLLALLAILGFRYFGSVNNIAAQ
FT                   GLRVDHTRLLNVLGMIKGKWLAQGRPKQMMLDWDTGFSISADSQSSQTISAMNLVKMSS
FT                   GGWPLPNKRDSTGCEQLWYKLLGPDTMSQQFVSSISPGGNVCNYIVIDSGRMSYQLATG
FT                   YVNFLTND"
FT   CDS_pept        353040..353672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshB"
FT                   /locus_tag="SVI_0293"
FT                   /product="MSHA pilin protein MshB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00264"
FT                   /db_xref="GOA:D4ZEN4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN4"
FT                   /protein_id="BAJ00264.1"
FT                   /translation="MSNSRSRQQGFSLIELVIVIVILGLLAATAIPRFLNVTEDAQDAS
FT                   LDGVSGGLATAVGFVRAQWEVDGRSNSTVILDGTSLSLDTRFGYPTGMVTSGGDSGLGN
FT                   TSATAMTDVSCQEVFKYILQSAPRNVVYTADARNQRYTARMLEGVGSTATDLNGNTVNG
FT                   IDLCVYHQVASLVLNQTTGVPTPIPALDVSKGITYNPATGTVVSFTN"
FT   CDS_pept        353769..354284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA-1"
FT                   /locus_tag="SVI_0294"
FT                   /product="MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00265"
FT                   /db_xref="GOA:D4ZEN5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN5"
FT                   /protein_id="BAJ00265.1"
FT                   /translation="MKQQNGFTLIELVVVIIILGILAVTAAPKFINLQSDARESTLQGM
FT                   KGAIQGANSLIFAKAALAGDESKAGSTDVNIGTTASPINVSTTFGYMTAEETAFELGMD
FT                   AGFVAKGGTPQNGTEDWIVDESGTPGSSGTMVIYQRGAPNGTNTCQLTYKEATSTTLPT
FT                   MVIVDTGC"
FT   CDS_pept        354299..354799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA-2"
FT                   /locus_tag="SVI_0295"
FT                   /product="MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00266"
FT                   /db_xref="GOA:D4ZEN6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN6"
FT                   /protein_id="BAJ00266.1"
FT                   /translation="MKKQNGFTLIELVVVIIILGILAVTAAPKFINLQGDARESTLNGF
FT                   RGALQGANSLVFSKAAIAGEERIADGTAWAANTGNTAGVDIGTAEAIKTVFGYIPASSA
FT                   ALANAMDVDLTEWVITGSGPLVISPKDAPTATCHFTYTEATTNSAPTYTLYTPGNNDDP
FT                   FAC"
FT   CDS_pept        355002..355526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshA-3"
FT                   /locus_tag="SVI_0296"
FT                   /product="MSHA pilin protein MshA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00267"
FT                   /db_xref="GOA:D4ZEN7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN7"
FT                   /protein_id="BAJ00267.1"
FT                   /translation="MLDNWSGCDMNNMKQQGFTLIELVVVIIILGILAVTAAPKFINLQ
FT                   GDARLSTLNGFKGALQGANSLVYSKAALGGDEKIESGDWANNDGVDIGTGTLAQTNLGY
FT                   LQADIDEITNAMDVDADDWQLDASVTGELKVAPVNAPAETCHFVYVEASETTTPTYKLY
FT                   TPTGNDDPFAC"
FT   CDS_pept        355722..356186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshC"
FT                   /locus_tag="SVI_0297"
FT                   /product="MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00268"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN8"
FT                   /protein_id="BAJ00268.1"
FT                   /translation="MRMMQNTGFTLIELVTTILLIAILSVVALPRLMTSSSYSAFTLRD
FT                   EFISELRKAQLMAMNNQDSCFQVNVDENGYQLHSFSNNTCTGTSRTEAMQTFAGGASLT
FT                   TRPPDANHTFNVKFDVKGVTNMGCSGPCINVIADETLVINIESEGYIHGR"
FT   CDS_pept        356176..356751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshD"
FT                   /locus_tag="SVI_0298"
FT                   /product="MSHA pilin protein MshD"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00269"
FT                   /db_xref="GOA:D4ZEN9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEN9"
FT                   /protein_id="BAJ00269.1"
FT                   /translation="MAVNSFKKTKALAHLSHKSKGFTLIELVVGMVVLSIALVLLTSML
FT                   FPQADRAAETLHRVRSAELAHSLLNEIWSKRYDQNTNPNGGVPACGASARPDLGLPAGL
FT                   PCTPKNDLGPDGENRNAFNDVDDYDGLVLSSNMLNSDNTYASEYPNYQLAVSVTYLDLP
FT                   SLNRKLITISVTTPSNEVITYNAARSNY"
FT   CDS_pept        356751..357572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshO"
FT                   /locus_tag="SVI_0299"
FT                   /product="MSHA biogenesis protein MshO"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00270"
FT                   /db_xref="GOA:D4ZEP0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP0"
FT                   /protein_id="BAJ00270.1"
FT                   /translation="MRSARGYKSSGFTLVEMVTVIIILGVMMLGVSSFVIIGTRIFVDS
FT                   TSVDQVLSQSRFVIERMTREIRNAVPNSLRVTENPVSFQCIEFVPIQASASYLDLPISP
FT                   GVASETGIVMTPSQGINLEHRMLVYPLQISHIYSATPTASEGRLFDIDEYDDTTNTVTF
FT                   DHAVRFSEASPRSRFFMVDQAVSYCFFANGNIRRYTGYDMFNDDQPTPTDMGGDASSAL
FT                   MAENVVIDGSWPILYTPGTLINNAVVQLTPQFEVNEQEFQYQHQVQVVNVP"
FT   CDS_pept        357574..358053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mshP"
FT                   /locus_tag="SVI_0300"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00271"
FT                   /db_xref="GOA:D4ZEP1"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP1"
FT                   /protein_id="BAJ00271.1"
FT                   /translation="MNQDTHKTFRGLASRPLLRGGMAKQQGSALVIGVFVITVMFLMAS
FT                   ALINILEDADEQVNLEVWGIRALAAANSGADSALALLFPLDASAATCDASSQWLVPDVP
FT                   GFHACIVELTCVDTQVDTVHHYRITSTATCETGNCTDNNANCLRVNRQVEVEARD"
FT   CDS_pept        358046..362485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00272"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP2"
FT                   /protein_id="BAJ00272.1"
FT                   /translation="MIDTLMFRGRQVTQRILILVLLMGSGLLPAYAADWTATFIEGVNS
FT                   YSRDGEIEFNGTAKLYNSSQTGFLPSFDVEEDERSCVPPNQNTKRCKSGGYTARLPLDR
FT                   IPFNQCRSTSDNDIGPPDFFNPEIELVAGEYGDVVLSGGTNNKITFTTSEGIYKLKSLK
FT                   ATNGILELAAGQYWIESLQINSGVRIIFPPTGTVSFFVRDDYTHLNSSLAYSAAQFLLY
FT                   AYSDVTISGDVYFRGFVVAEDEFELNGGAMLEGGVTADEISLGNSSWIYFNDTAASINV
FT                   VPDCDVEPVLPVVPLQCPAGQDGVAGITYRSYDATSWKPGQNISPVDHNDFNNLIDTVK
FT                   STTNQLGESIESQVEGYGYDINPHSSQGDRYAGIFEGYLDVPETGNYIFGIDGDDAIEL
FT                   LIDGQLVVGFYGLHGQCGRPCETGDIALAQGTHKIEMRFHEATGAEAYHLYWQPPSATS
FT                   LVKVPENAYLTCPLPQFEFGRVTLSGGSAVINFENSYASAPVIILMPSLDGANPTQDGP
FT                   ATVRLVSSGAATASIEQNEPPGNKVSADDMSEVDYFIMEPGYRFLARGKALQAGKLVTN
FT                   KYQGKRLPAAGRGYENISFSHKFGAKPAMVGQTLSRHNNRFITTVINNVSSQGDNFDIA
FT                   IEASEVLGSINQDETLGYVAGLGSGSMEINGEAVLYEFDYAKNHGDSYRTRTLLQQCAY
FT                   QTNYQNTYTSQPYVIASKNSHKGGDGGWVRRCRHSVFNNTVSFAVDEDQQSNTERNHLA
FT                   EDIGYFAFEAVPEPPVTNHYRIEFSSGAISCAAKNIIIRACDDGNCTTETSVLSSVDLT
FT                   KNGNLYSKVDFTGHTVPGVELWHGDGGSVLVGLVAENSSASYRCFIDGQEVDTDKCKLD
FT                   YQDTGFYFDVPNTSSCKDTANFELFAVKKDSQTQECVPLFSNQTKAIDFNFEYKIPSSV
FT                   NNEASLTLSSLNGSRDDVSIAGGATESLDVRFDKDGKAVLQANYPEAGVVRLKASHTLR
FT                   VNTPNGTEELLLEYADDFTAAPAGFHFFNTSSNKTCSSGDPYNASCDVLAKAGENFEMG
FT                   MKAVCWESDSDNDFSNNTALQNFKLDDIAITAKVDQPSAGSDGSFGYSSINFELNTGET
FT                   AAILEQSWNEVGTVTAELTQDLNYHGVTIPQDKSSSEVFGRFTPAYLEITGNTPEVSLS
FT                   CSSFTYMDQPFSFLSGTEPKIQVIGKSTSTSVTSNYQIDPWWRYKDKESSEQNLWSGRT
FT                   YSDNRGIAILDDKDAPDLSGKVLFLSEPAAAYLAGGQVNYLRTASAVAPFNALFNLDLQ
FT                   AADVTDEDNICFQADANSPCIGFTFTDIGKDKSRQQRYGRMLVENGYGPESESLRLPIR
FT                   AEYVSAVGATGPTWLINKEDQCSVYGTASSADNGELITTGINMQLPAGFPSITAHNNPQ
FT                   LTSQSGLIQAGVNQIYFTPPNAPAEAPIKLKQHVKPWLKWYWNYDGNNANDLYDPRASA
FT                   FFGTYRGNDKVISWREVN"
FT   CDS_pept        362946..365822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0302"
FT                   /product="MSHA biogenesis protein MshQ, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00273"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP3"
FT                   /protein_id="BAJ00273.1"
FT                   /translation="MACRPLFLVVLISLISVSVCLDAYAFDEIDESLYFPSVVQGHHGN
FT                   NNNVCHGVNDPQIRQNDSARINDTLGENLKYCSNNSGDGLPNDGCDTASGGDRYCTVTG
FT                   GDIRGLHTNGQNSFKYSHEAGGGIDNCLNGDTFLLGDDGNTQFGKIVVYNACTVTFSAN
FT                   HSEYRLKNILARSGATIILAPGDYFVEELKLESNCHILAQGDVRIFVKSAIEITGAKIN
FT                   ESGGGNVLLFGYDKMTLNGSTIIKANLYSDNHIYMNGSSTLHGRVTSRYLEMNSNSEIH
FT                   DQTATPSLLSHYRIEFSSGALRCTGKDISIKACADADCTNELSDPVSVELTKSGDVYNN
FT                   NVFSGNTSTQLWHTAGDTVTVGLGSTAPSGAYFCYIDGIEVANSDCTLDYADAGFILNI
FT                   PNELSNKPQEDLEITAVKISETSSLCVPTFQGVSKTVNFWSDYISPDESQRPASMSVFI
FT                   DDTALGQSYSAKTPITLAFDDTGKARFKLNYADAGTLALKVNYAGLVGDEDEMLEMEGS
FT                   DTFARYPVGLCVSPETICASANKDCPGFRKAGETFELSIRGMAWQSDGDLDFCDNLPTA
FT                   NYVQSNIDLSADLVAPAEGVDGTVGLSVYDHTAQSNSLNLLSQSIDEVGVFSFSATPPA
FT                   DYLAEGILIPKAYSQAVGRFFPNDFKVYGYGIMPACMAGLYSYMDEPFRLNVSVRARNV
FT                   AGETTENYFDDFASSVAFLVAENNGNGIDFQTRLSGMPSLDWSQPALGVQEIDDDILFS
FT                   RRLDGIADGPYTLLDIGLRILDDDGVLIDDADMNAATDDICAISNSCNAKRLSSQRLIH
FT                   GRIVMENVYGSEAETLRMPTTARFWDGDLWAVNTLDSCTKVIEPELPEPTQVVYSPILD
FT                   GAQQVSRTNAAGNTSASDFSTGRFSLGWQSIVSTPNRYRGQVTAPLVVPSWLQWYWHND
FT                   GDLSDPQASAFFGTYRGHDKVIHWREVE"
FT   CDS_pept        366206..367255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="SVI_0303"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00274"
FT                   /db_xref="GOA:D4ZEP4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP4"
FT                   /protein_id="BAJ00274.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSVVAIRTER
FT                   GNGGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSV
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEPTGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFTLNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALIRDLDRLLMQESGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEEN"
FT   CDS_pept        367391..368302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="SVI_0304"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00275"
FT                   /db_xref="GOA:D4ZEP5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP5"
FT                   /protein_id="BAJ00275.1"
FT                   /translation="MKPIFARGISNQFRLTLAIILSVILIVANGRLDPVRKSISSVLSP
FT                   LQYIANVPGTFLDWSAESLATRDMLARQNKELLRQQLLMSERLQRFEHLRQENERLRGL
FT                   LGSPVHMDSKKVVAEVMEVASDPYHQYVVINQGARTGVFVGQPVVDALGVVGQIVQVSE
FT                   LTSRVLLISDVTHGIPVRITRNDVRLVVTGTGVLDELELKFVSKSTDIRVGDLLVSSGL
FT                   GKRFPEGYPVARVMSVIKDDGQSYATVTAQPLAALDRIRYLLLIWPDKSERKEDLVQDV
FT                   SVPKSSEQKPDVNAEAKQEVSE"
FT   CDS_pept        368299..368787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="SVI_0305"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00276"
FT                   /db_xref="GOA:D4ZEP6"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP6"
FT                   /protein_id="BAJ00276.1"
FT                   /translation="MSMHIANGRWVVWLSLLGAMLLQIMPLPDVVEAWRPDWLLLVIIY
FT                   WAMALPHRYNILSAFALGVMLDILLGAHLGIRALSMSLVVYVVVLHFQRLRNFPMWQQA
FT                   LMIASLVCLHHLVVFWVQFVVSTVTFDESLFLPAISSLVIWPWVFWMLRRVRRLYKVR"
FT   CDS_pept        368790..369386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="SVI_0306"
FT                   /product="maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00277"
FT                   /db_xref="GOA:D4ZEP7"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP7"
FT                   /protein_id="BAJ00277.1"
FT                   /translation="MSFSDPLVLASASPRRKEILTQLGFSRADFSFTTLSADIDESHIS
FT                   GETPQVFVSRLAVEKALVGLDLCRVEGTPLVLGSDTIVILGDKILGKPVDEADALKMLS
FT                   QLSGKVHRVMTAVALTNGNKTVTRLVETKVQFCQLSEQDILAYIATGEPMDKAGAYGIQ
FT                   ALGGSFVERIDGSYSAVVGLPMVETRELLQEMNIL"
FT   CDS_pept        369443..370945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="SVI_0307"
FT                   /product="ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00278"
FT                   /db_xref="GOA:D4ZEP8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP8"
FT                   /protein_id="BAJ00278.1"
FT                   /translation="MSRIVKSKVQKKIGSELLINVTPTEARVALVEHGVLQEIHIERRM
FT                   KRGLVGNIYKGKVSRVLPGMQAAFIDIGLDKAAFLHASDIVPHTECVADVEKGNFVVRD
FT                   IAQLVRQGQDIMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGSSHIGVSQRIESEEVR
FT                   ARLKGLTQPFVDEDGGFIIRTAAESAGEQELVQDAAFLRRVWAKVSERRKRRGVSLLYQ
FT                   DLALPVRIVRDFVGTELDQIRVDSSMTFDELQTFTQEFMPEIADKIEHYSGPAPIFDLY
FT                   DVENEVQRALGRKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEDTIFNTNLEATQ
FT                   AIARQLRLRNLGGIIIIDFIDMLDADHQKRVLNSLELALSMDRVKTNISGFSGLGLVEM
FT                   TRKRTRESLEHVVCGECPICLGTGSLKTVETVSYEIFREIIRLDRSYKADEFIVYCSPA
FT                   VHHSLTGDDSHLVAELGVYIGKRVKLKNEPMYAQNKFDVVIM"
FT   CDS_pept        370945..374985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00279"
FT                   /db_xref="GOA:D4ZEP9"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEP9"
FT                   /protein_id="BAJ00279.1"
FT                   /translation="MSGKFCPRKFSRFCWQILASILVLFALMVSLFRGLLPQLDEVRNE
FT                   LVKYIDQQYQVRVNVGQLSAEWQAFGPALTVKKLVIPPQENLPFTLVVNDVHIKLDFWE
FT                   SLFTASPQIENVIFDGVYVALDLDKLNESKDATSAQEMDTDWLYRLLLEQLDRFSIKQA
FT                   SLQLLSKKHNYRPIFVKDLKWFNSPNRHRGQGKLYLDQDASQVELLSLQIDVHGSGNEP
FT                   DELKGQVYLAAQSLDLGKWASRQVNPYDDKAKLELEGVINLEAWMSLGNRSVESGLIEF
FT                   SPSWLEWDLNDQKQRFEIKGGQMEWLPTKTGWRFTSRDLAFESNRQAWPDFLFVAEKRE
FT                   EDLFTYVNRLDIDSLLPLLPLVPGMELAGLNHWQKLDPKGEIESIKLTKLKDLAPQLSL
FT                   SFDDLAWSQDGAIPASESIDFQLGWMNESLYLSAPKQDYRLDFASGFEEPLSFLGEAFE
FT                   VKYDLAAEAILVPQLKLSNQDISIDTSVRLGLGDQVHLNLLSKLKIYDVANVGNYLPLD
FT                   GMSQGLVDYLNAGLVAGHIQDGVVVWNGALSDYPYEDHSGVFQASFTLEDAEFKFQPDW
FT                   PAVADLQLMANFDNQAMALTIKRGHLFDVVVDGAQVNIPQIGARSLLEVKAELKTQGKA
FT                   ATRVIQASPLADSVGETLAVVQINGKVSASLELAIPLYEAEAGELVKEDLRGVVTFNKT
FT                   PVYISKPGILLDQVTGQVSFSNDIVTGDNISALLYQQPISLTFDTGSLGRNYGLNLDMK
FT                   GAWSLADLPAELDNPLQDFYSGDVNWNGAMTLIFDPSGYRIQAQVETDLVGAELALPAP
FT                   LTKAKDESRKLTAELIGDNKQSSLSIKLGKQMEFWGGFGQESGNRLAHYDLLLGRLFKP
FT                   GDRLKKDQGHLQLDIDHTELAPWLPLINKFVVGAKVSDGEQGSKARVDIPGAAAKELGT
FT                   QESFFPSLISLDANIADFSLMGQSLTELKMTAYPTPDSWRFEASSNEFDGRVDFYPDWA
FT                   SQGLKLVASKLHLAPKVKAPKDADFRVDTVLDNLPPIAVDVDDFSFYGSSLGHLVFQGS
FT                   PKGDSYLIQTLSLTTPEIKLRGKGIWLNDNNENQTQLDMKLTAKKFDDISAIIGLDPGL
FT                   KNAPVEVNAKISWQGAPYQFSLPSLNGQLEFELGKGHLSEVSDKGARIFSLFSLDSLLR
FT                   KLTLDFSDVFGKGLYFDSFTGTLDIDNGVVKTHDTEMDAVAGKVKVRGYTNLMSESLNY
FT                   DIRFVPQLASSVPTVVLLTTGGWTFGLGALALTKVLEPVIEVISEIRFQLTGTMADPKL
FT                   EEIGRKSKEIEIPESVLPSVKEPHLNQEPQKKLQLEQQQPDSGVEIPLTNVIQMPILTI
FT                   SAP"
FT   CDS_pept        375001..375849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0309"
FT                   /product="hydrolase, carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00280"
FT                   /db_xref="GOA:D4ZEQ0"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ0"
FT                   /protein_id="BAJ00280.1"
FT                   /translation="MQINLLQCQSSQDVSKNLEYIESQLSLLPRVEGEAQLVVLPECCL
FT                   LFGGHESQQLEYAGDSQSNPFKTALADLARRYDIYLVAGSIPVAAGEGRVYNRTYLFDN
FT                   QGQVLGEYDKIHLFDVDVSDGTKEYRESDTFCAGDKISVIDTPFGKLGLAICYDLRFPD
FT                   LFRAMRLAGAELIALPAAFTKVTGEAHWQTLIQARAIENQCFILAAAQWGQHNQGGRET
FT                   WGQSMVVDPWGRINAQKMTGCGWVQSKLDRDEMLKIRQQMPIASNNRFSEPKLQHKDAN
FT                   P"
FT   CDS_pept        375901..377352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tldD"
FT                   /locus_tag="SVI_0310"
FT                   /product="tldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00281"
FT                   /db_xref="GOA:D4ZEQ1"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ1"
FT                   /protein_id="BAJ00281.1"
FT                   /translation="MPFLTQVEQSLLQGGLSLDDLQGYLKLIHQYEVDFSDLYFQGSRH
FT                   ESWVLEDGIVKEGSFHIERGVGVRAITGEKTGFAYADEITPAALTASAEAARSIAVHGG
FT                   KSTKVQAWKRREMKALYQSADPIAAMEEIKKIELLKQADAYIRSLDSRIIQVVISLSGV
FT                   HEEILIVASDGTLAADIRPLVRFNCSVILEDNGKREHGASGGGGRHDYQVLMETDDKGL
FT                   PVCFSFAREAVRQASVNLTAIDAPAGEMPVILGPGWPGVLLHEAVGHGLEGDFNRKGSS
FT                   AFSGKVGQQVASKLVTVVDDGTMVNRRGSLSIDDEGVQTQKTVLIQDGILKGYMQDKLN
FT                   ARLMGEQSTGNGRRESYAHLPMPRMTNTYMEAGESDPAEMIKSVKKGIYAPNFGGGQVD
FT                   ITSGKFVFSASEAYLIENGEVTQAIKGATLIGNGPEAMCQISMVGNDLALDQGVGVCGK
FT                   DGQSVPVGVGQPTLKIDKITVGGTA"
FT   CDS_pept        377508..378899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0311"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00282"
FT                   /db_xref="GOA:D4ZEQ2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ2"
FT                   /protein_id="BAJ00282.1"
FT                   /translation="MSFLALGSCTVQASNLGFEQAWKQLLTVSDKLQASAQEVRRAEAK
FT                   HEAGKDLNLPSISLNGSYTRLEQPIEMDLRDLNPLASMDPASLPPAIGGALAAIPGSMF
FT                   ITPFTEQDIFRSSLQAMWPIYTGGKISAAQGIHAAMVAEKEQQLQLTTRDLFTQLVDRY
FT                   YGVAVSQAMARTRGELVASLEEHAEHAIKLEEQGQIAKVERLNAQVALENAKINFASAK
FT                   RQAEMAEIALSRMLHERQVNPSSQLFILNDVPSLPRLNKLTLTQHPALKLLEAKEAQAQ
FT                   GLVDVEKGQYLPTVFLYGNYTLYEDDSLFSKMEPDWMLGVGVKIPLLSRDGRSGKVKAA
FT                   KSALLQARYTKAQTKQDLSLLLDQSYRQLLQAQEEVESLDLSLSLATENKRLRDLAFSQ
FT                   GLSTSIEKVDAELKLTGVEMQQLGAKYRYVQAYARLMAVSGQLEEFLGRSSIETSAMQE
FT                   SKNAG"
FT   CDS_pept        378937..379860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0312"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00283"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ3"
FT                   /protein_id="BAJ00283.1"
FT                   /translation="MALGYGLKLAYTPKAVYMQGQIEAREYNISSKVPGRVEQVLVRRG
FT                   DKVEVGDLLFAIDSPELNAKLMQAEGGRDAAHAMQLEANTGARKQQVMASREQWLKAKA
FT                   GATFAKTTYDRIENLFVEGVLARQKRDEAFTQYQAAKYTEQAALAMYQMSQEGARVETK
FT                   AAAAGNARMAEGAVHEVNAILADSQMRAPKSGEISEVLLQPGELAPSGFPVVSLIDMQD
FT                   AWAVFQVREDQLKQFSKGQKLMLTLPALEREVEFTVSHISVMGDFATWRSTESGHDFDM
FT                   RTFEVELRPNSEIKDLRVGMSAILTR"
FT   CDS_pept        379878..381077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00284"
FT                   /db_xref="GOA:D4ZEQ4"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ4"
FT                   /protein_id="BAJ00284.1"
FT                   /translation="MNSLVALIRRELHALWHSPWQLALISYIPILSILCLWWLFSAGLP
FT                   RQLPVAVVDSDHSQLSRMLTRNLQANPVVAPQNFVDLASAVTAMRQAEVYGIVVLPYGL
FT                   QRDLITGHSPVIDVRYNSQFLLVGKLLSSQIQLTLGSGLLELAGVKQLLQGVPKSQLKL
FT                   HLSPVTSQTTALFNRNNNYVGFLVPPVLVALWQLLAMLTFSNSLSRELNSQGSFAADSG
FT                   IWPRVWAKIAVFTPIMLLHGGFILALLYQYLALPVAGSLGLLILAQLVMLLAVWLLVLL
FT                   VFFIMRDSARMASFGTALFAPAFAFMGITFPVHEMPLLAQWWRLIMPSSHYVDSHVGIV
FT                   SYGVGWETIAIQLTSYWGFLFIIPVLLLLSRRIENAAKTESYEQVSEPHLASKNSGADL
FT                   "
FT   CDS_pept        381074..382240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00285"
FT                   /db_xref="GOA:D4ZEQ5"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ5"
FT                   /protein_id="BAJ00285.1"
FT                   /translation="MISNSMMSFLQLVLAELKAIVADKAIAVTLFGGVLFYSVLYPLPY
FT                   LHQVPTEQQLVVVDLDHSSLSRRLIRHADASAKISVIGQVTSISQAQKWIESGRAHGLL
FT                   VIPQGFRRDLLLGKGVTLSYGGDASYFLIYSAVAEGLVTAGMDAGKHVQLLGMLAKGQA
FT                   PKQANLSLNSVKINSVPAFNPSLGYTSYVVPGLFLLILHQTLLIGTGILGAGQWRRKGY
FT                   WRDVSPLQLVCGRISAFMLIYLFFSSFYVGFCFYWYQVSVQASLSLVALWMLPFLLSTS
FT                   AAGIALSCLFVRRDLPTQVLLLVSMPIMFVSGFVWPLALIPEPLIWLSQVIPAVPAIMG
FT                   MLELNQMGASWSSVMPKWLQLWALFALFFMLAWYGVTRRLKSAVDETS"
FT   CDS_pept        complement(382867..385407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0315"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00286"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ6"
FT                   /protein_id="BAJ00286.1"
FT                   /translation="MLLMRLIKSAALFPLLALLFIGGCNGPSDDSDDNSGNTGDFALSL
FT                   SYKTFVDGQCAEATSNLSFSSNASICAVAKLTQGGRSSSGGFISFNATLGTLTPATKLT
FT                   DSSGMAQVILSNPGAALGAGILTAQFDTGATETSILSTTKNFEFIRTSTALGEETPKIS
FT                   ASIVNGAAIVTQFKVDETVQLQAQFLDPSSQGIANQLVTFTAGSVSLTPSTALTNTQGI
FT                   AQVNYTPGISDLGAANLNASLDYQEQNYQTNSLYEVLSVDAIGSEGVLKLGHFDSNNQF
FT                   IEGSLSTTLTPVDDKYIISAGGSFGITATLISQADDGTITRIQTPSSISFSSDCVTSNH
FT                   ASLDTPVTTLSGSASSTFQDTSCSGNSERDDQVIASTLVGNQTLTANLPFTLARQTLAS
FT                   LSFVSAEPTNIRIKGAGGTGSTESSLVSFKITGSNGQASAQQEVSFVLDTLVGGLSFSN
FT                   GLPTAQSITNSQGMVSVRVQSGTVPTPVRVVASATDADTGETITSQSEQLTVNTGLPQQ
FT                   LGFSLSASTFNLEADQFSGEKSTITVYASDSFGNPAPDDTTINFTSEGGQIVSNCVTVD
FT                   GNCSVEWTSTSPKVADHRITVLAYALGHETFFDTNGNNIFDDADGGSVTACLDSSGAPL
FT                   VCSGSGSDREAYRPNGFSDLPDAFRDDNENFTYDVGEKFFNTGASTSYQAADGKFNGPQ
FT                   CEGSLCGTGQANKTYIRKALTLTMSGSHAEFIIEQDGLKVFDSTDGTDLNLTAIPAGEQ
FT                   SNFEIRFFDDAGQIMPADTSLTISVSTGQLDFDPYTVLNTTQSGGSLTSFSITSDIDPL
FT                   STGEQAKISNIGIDVTTPKNIKSSLSLTIELSGT"
FT   CDS_pept        complement(385487..386026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00287"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ7"
FT                   /protein_id="BAJ00287.1"
FT                   /translation="MKVVGDSEHFKQPFDHDEDYVSRADTKREIAIYQELGKKLVVLSK
FT                   SQIERLELDELLYDNILKTKIIKINTEAYRRQLQFIGKLMRFVDIEELQLKMKNMLNQN
FT                   SNESAKQNVAEKLKDQLLSEGDSAVQALIEKYPDLERQKLRQLTRQSKKELTKKPDEAS
FT                   KSSIELVKYIRNELTE"
FT   CDS_pept        386167..387507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmbA"
FT                   /locus_tag="SVI_0317"
FT                   /product="pmbA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00288"
FT                   /db_xref="GOA:D4ZEQ8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ8"
FT                   /protein_id="BAJ00288.1"
FT                   /translation="MTTPSIDTELDSLKDAVSMALEYAKQLGTSGAEVAISKQQGLSVS
FT                   TRMKEVETVEFNKDGALGITLFRDGCKGSSSTSDLSPEAIREAVKAADGIARFTSSDPY
FT                   NGLAEAELMAKDFPDLGLYHPQEVTPAELIELAVRSEEAALDVDSRISNSDGASANAHT
FT                   GIKVYGNSHGFLNGYCSSRYSLSCVVIGETDGNMQRDYDYTISRKFNDLLSPEEVGRKA
FT                   SENTLGRLGGRKIATTELPVLLAPEIATGLMGHLVGAISGSSLYRKSSFLLDSIDTKIF
FT                   PDWFSIEEQPHMVGGLASANYDSEGVATQERSIIQDGVLCTYLLTSYSARKLGMKNTGH
FT                   AGGIYNWTLAHTGQTFDELVKEMGTGLIVTEVMGQGVNGVTGDYSRGAAGFYVENGVIL
FT                   YPVEEITIAGNLKDMYQNIVAVSKDRDLRSSIRTGGILLSSMKIAGN"
FT   CDS_pept        388035..388382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="SVI_0318"
FT                   /product="arsenical resistence operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00289"
FT                   /db_xref="GOA:D4ZEQ9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEQ9"
FT                   /protein_id="BAJ00289.1"
FT                   /translation="MTTLDFFKLLSDETRLISLLLIIEEKELCVCELMQALDESQPKVS
FT                   RHLAQMRKAGLLLDKRQGQWVFYRVNPELPDWIHKTLAEVSANNKALISSNITSLHQMG
FT                   ERPERVRACCN"
FT   CDS_pept        388408..389460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0319"
FT                   /product="arsenical pump membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00290"
FT                   /db_xref="GOA:D4ZER0"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER0"
FT                   /protein_id="BAJ00290.1"
FT                   /translation="MGIFERYLSVWVGLAILAGLVLGNLMPDVFTLVASLEYAHVNLVI
FT                   AVLIWVMIYPMMVQIDFSSIKDVKKSPQGLILTVVINWLVKPFTMALLAWLFFKVLFVD
FT                   WVDPQSATEYIAGMILLGVAPCTAMVFVWSQLTKGDPNYTLVQVSVNDLIMVVAFAPIC
FT                   ALLLGVNDIQVPWETLISSVFLYVVLPLVAGALTRKKLEADGDSESLNRFVGKLKPWSM
FT                   LGLLGTVVLLFGFQAQTIMDEPMNILFIAIPLMIQTYGIFFITYYIAKKMKLSHKIAAP
FT                   ACMIATSNFFELAVAVAISLFGLHSGAALATVVGVLVEVPVMLTLVAFVNSRRSKFEAD
FT                   TGTGTQAVET"
FT   CDS_pept        389578..390600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapA-1"
FT                   /locus_tag="SVI_0320"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00291"
FT                   /db_xref="GOA:D4ZER1"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER1"
FT                   /protein_id="BAJ00291.1"
FT                   /translation="MSIKIGINGFGRMGRLALRAAWDWDDVEFVHINDPAGDAHTLAHL
FT                   LTFDSVHGRWQHEATADGSGDRNYIVIGDKRIPTTGNSAIADTDWSACDLVIEASGVMK
FT                   SKAKLQAYLDQGVKRVVVTAPVKEEGVLNVVMGVNQDLYDKEIHRIVTAASCTTNCLAP
FT                   VVKVIHENIGIKHGSMTTIHDITNTQTILDAPHKDLRRARACGLSLIPTTTGSATAITH
FT                   IFPELKGKLNGHAVRVPLANASLTDCVFELERSTTEDEINALLKEAAAGELKDILGFEE
FT                   RPLVSVDYKTDPRSCIIDAPSTMVVNGTQVKLYVWYDNEWGYANRTAELARLVGSMDKG
FT                   "
FT   CDS_pept        390802..392061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0321"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00292"
FT                   /db_xref="GOA:D4ZER2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER2"
FT                   /protein_id="BAJ00292.1"
FT                   /translation="MLSSIKGLPEQVKQYLLITGNYWAFTLTDGALRMLVVLHFHQLGY
FT                   SPLAIAMLFLFYEIFGVITNLVGGYLGARIGLNKIMNIGLGLQVAALAMLLVPSSMLTL
FT                   VWVMIAQGISGIAKDLNKMSAKSSIKMLLVSEKAGGQDEARAADDAYAKQQKLYGWIAK
FT                   LTGSKNALKGAGFFLGGALLSLFGFTLAIAIMAIALTLVWVLSLCTLKRDLGKAKNKPK
FT                   FSQIFSKSRSINILSAARMFLFAARDVWFVVALPLYLGSQFGWDHYYVGGFLALWVIAY
FT                   GLVQTQAPRFTSKSDGSAPGGRQALLWVCALTAIPGLIALALSLNISPQLSLLAGLMLF
FT                   GAVFAVNSSLHSFLIVNYASDDCVSLDVGFYYMANAMGRLMGTVLSGYVYQVAGLEACL
FT                   WISSAMLGMTAVISIYLPKD"
FT   CDS_pept        392436..393806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0322"
FT                   /product="sodium:alanine symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00293"
FT                   /db_xref="GOA:D4ZER3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER3"
FT                   /protein_id="BAJ00293.1"
FT                   /translation="MEGITEFVSMINGFVWGVPMLVMILGVGLFLSVGLKLMPILKLGT
FT                   GFKLLWSGRIPDKDKSMKGEISPFNALMTSLSATIGTGNIAGVATAIFIGGPGALFWMW
FT                   CTALVGMATKFAEAVLAVKYREIDANGNHIGGPMYYIKNGLSSKWAWLGTAFALFGSFA
FT                   GFGIGNTVQSNSVADALSSNFGVPTWITGLVLMVLVGAVLMGGIKRIADVAGKLVPLMT
FT                   LFYIAAGLAVLAVNAAEIPDAIALIIHSAFNPVAAQGGFAGAAVWAAIRFGVARGIFSN
FT                   EAGLGSAPIAHASAQTNNPVAQGLVAMLGTFIDTLIVCSITGLAIIVSGAWTSGENGAA
FT                   MTSLAFSTALPMGNYIVAIALSVFAFTTILGWSVYSEKCVQYLFGVKAVKPFRVLWILV
FT                   VPLGAVSSLDFIWLLADTLNAMMAIPNLIALALLSPVVFKLTREYFINKREEEAAKV"
FT   CDS_pept        complement(393914..394087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00294"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER4"
FT                   /protein_id="BAJ00294.1"
FT                   /translation="MAQIIELVPNDVEMEAFIAPKNPQAADELQHRREIKKRLEELLAQ
FT                   AELQRAMSGDFY"
FT   CDS_pept        394161..394295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00295"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER5"
FT                   /protein_id="BAJ00295.1"
FT                   /translation="MSVFCVKSASTQDVNSAELEISDFTLVSADKQDIRLLTGKVRSA"
FT   CDS_pept        complement(394489..395181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00296"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER6"
FT                   /protein_id="BAJ00296.1"
FT                   /translation="MKQAIVSVSILASAILLSFSVSADVSGNIGATSNYLWRGVTQTQD
FT                   AVAVQGGLDYQHDSGFYLGTWASNVDFGDDTSYELDFYAGYAGSLGEDFGYDVSYLYYA
FT                   YPDSDSNVDFGELTGAISWKWFSLSYSYLVNAGSDVASESLDNTDMSYIDAGVSYPLSE
FT                   TLSISAHYGYSSGDIVTSWFGTSNYADYSVSLNKDTDFGSISFSLSDTDLNDDDPKITL
FT                   GYSYSFEL"
FT   CDS_pept        complement(395439..395714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0326"
FT                   /product="DNA-binding protein, HU family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00297"
FT                   /db_xref="GOA:D4ZER7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER7"
FT                   /protein_id="BAJ00297.1"
FT                   /translation="MNKTELVAKIAENADLTKAEAARALKSFEETITETLKSGDKISIV
FT                   GFGSFETTNRAARTGRNPQTGQEIQIPAATVPKFKAGKTLKDSVNQ"
FT   CDS_pept        complement(395954..396751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0327"
FT                   /product="chemotaxis protein CheY/response regulator
FT                   receiver domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00298"
FT                   /db_xref="GOA:D4ZER8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER8"
FT                   /protein_id="BAJ00298.1"
FT                   /translation="MSMLLPSELSILLVEPSDTQRKIISNRLSEEGIINIQNAKSLDEA
FT                   LTIIDRHQPDLVACAMHFEDGTALNLLKHLKSNDKYQDIQFLLVSSECRREHLEVYRQS
FT                   GVVSILPKPFSSVHLGKALNATIDLLSNDELDLNHFDVHNLRVLLVDDSMMARNIIKRT
FT                   ISNLGLRLITEASDGAQAIELMKSNMFDLVITDYNMPSVDGLALTQFIRNDSQQSHVPI
FT                   LMVSSEANEAHLSNVSHAGVNALCDKPFEPQLVKQLLYQLLDG"
FT   CDS_pept        complement(396835..397248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0328"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00299"
FT                   /db_xref="GOA:D4ZER9"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZER9"
FT                   /protein_id="BAJ00299.1"
FT                   /translation="MKYSMKKPPLGLSFLMLLYFILAIIALFRAINTQAVDLFSLGVIP
FT                   VLIGLVLRTNWANIVFKVYLGIQTLGLSAFGGTAIIAYQISPQDVKVILDGHDIPVPLI
FT                   AIVALVLLSFQIYLALAKSTKTYLQAEAPKGQE"
FT   CDS_pept        397341..397460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00300"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES0"
FT                   /protein_id="BAJ00300.1"
FT                   /translation="MFIFSGKLVCLFMLKAYRLTREFVLIRAGILVRIAKSSR"
FT   CDS_pept        397463..397987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00301"
FT                   /db_xref="InterPro:IPR025334"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES1"
FT                   /protein_id="BAJ00301.1"
FT                   /translation="MKISKMTEIEFWQLVTRETPAQDQVSLADNLKSKLASLSDQELLE
FT                   FDKIFGQQMRRAYFWSVWGAAYIITGCDSEYAFAEYRCFLISLGKDWYDKVIANPDDIG
FT                   QLAQWPEKDGYAYPFVDEYDLIAGQLFEDRTGEELPFVPSGKATPQGKKFTTKKKQLKL
FT                   AYPQLSQKFPF"
FT   CDS_pept        complement(398084..398377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00302"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES2"
FT                   /protein_id="BAJ00302.1"
FT                   /translation="MISSLKNILMISLLATSSLVSASELTSLEIDDTQTTADEVLSQYQ
FT                   ALTEDMSAEAQLEEIDKQLDQENIELLQSLCSPDAIDTNRSEESCIEQGPNI"
FT   CDS_pept        398747..399283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00303"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES3"
FT                   /protein_id="BAJ00303.1"
FT                   /translation="MKLTHLFLTGIVVSGAMLSGFAVADVVTENPVTERGVVKVTWQDP
FT                   KSFRDIKAVGGIQSRYETRTFEALTKSLDKEASKILKPEQKLELIVTDLDLAGDVRPTF
FT                   GATMNDIRLITDIYPPRITFSYSVLEGDKVVVVGNEKLTDMGFMHTTGRMNDRPLRYES
FT                   KLLADWMKKTLEPKI"
FT   CDS_pept        complement(399386..399697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00304"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES4"
FT                   /protein_id="BAJ00304.1"
FT                   /translation="MPHTRVIEQLKQNLQSAYRKSIDADGKLDELKKAGHVKFNRIFSA
FT                   DEGFTTSSNRFKPYVQELADELEELPTDSEKMPAALERFVRKLGVLIQTLQAFKEKSK"
FT   CDS_pept        399754..400635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00305"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES5"
FT                   /protein_id="BAJ00305.1"
FT                   /translation="MATSRHRLLLCLVWFTFSGFIPSALAGVEDRPPFFQIDYQGKTAY
FT                   LLGSIHVGQADFYPMAPLIESKFESAGSLVVEADAASADIVALIRKYGLNTLPIDLETK
FT                   TELDAYCKPRASACAALSGFAPWLQSIQVGMNRFEELGYSASYGVDQRFITMNRDRPLL
FT                   ELESTEFQFNLLASFDEKSQWAMVREAIESPDEDMHGLITAWRTGDTAHIAELMEGQML
FT                   EEGDTLMLDKLLWRRNIDMAARIRYLMQEPDTQHPLFIIIGAGHLVGDKSIPMEMTQHG
FT                   AKIASCWQQGCD"
FT   CDS_pept        400802..401428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="SVI_0335"
FT                   /product="chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00306"
FT                   /db_xref="GOA:D4ZES6"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES6"
FT                   /protein_id="BAJ00306.1"
FT                   /translation="MQTVVIPPPRAGFEQIPRSWDNKHNKVIARVDPGVFYISSHDEYI
FT                   FTRLGSCVAACIWDPLLGIGGLNHFLLPEKELHEDWHQLTSYSCRYGNLAMEQLINGIL
FT                   ISGGQRQRLKAKIFGGAQMTKTSVLNVGQSNIEFVKEYLKIEGIDTVSDDLGGPWPRKV
FT                   LFHPNSGKVLLKRMSPARIGQMMTEEKAYLNNIVKKPEDNQIELF"
FT   CDS_pept        401792..402556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0336"
FT                   /product="MaoC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00307"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES7"
FT                   /protein_id="BAJ00307.1"
FT                   /translation="MPKIYVSTSNVSLFQDKVAQYSSVCGFDFDGKTLPMTYMYVMAFR
FT                   LHAVIFTHDGITFPLLGMIHLKNSISQYRTLNVDENFDIECALTGSTVTDSGLEFDLVS
FT                   KAFVDGKLVWESSSTYLYRIENGKRRIRPPKANAMAWESPESWSLADDLGRRYAKASGD
FT                   YNLIHLHPVLSKRFGFDRVLAHGMWSKARCIAQMMPKIGARPCTVDVEFKLPLLMPADV
FT                   SFDSEMDEDDLVFELRDKRGRRPHLSGKISFI"
FT   CDS_pept        402811..404523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="SVI_0337"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00308"
FT                   /db_xref="GOA:D4ZES8"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES8"
FT                   /protein_id="BAJ00308.1"
FT                   /translation="MLSDIEISRQTKSSPISEIANKLGIEPSELSLFGDTKAKIRLSVL
FT                   DRLQGNLEGKLVIVTAVTPTPFGEGKTVTSIGLTQGLNAIGKRATACIRQPSMGPVFGI
FT                   KGGAAGGGYAQVVPMEELNLHLTGDIHAVSSAHNLATAAIDACLFHESRLSREEYIAQS
FT                   GSEPLNIDPKQILWRRVVDHNERSLRNISVGIGGNNGPVHDSGFDITAASELMAILALS
FT                   RDLQDMRRRIGRLILALDTQGKPITAEDVGVAGAMTVIMRDAIEPTLMQTLTGDPCLIH
FT                   AGPFANIAHGNSSIIADRIALKLSDFVVTEAGFGSDMGFEKFCNIKVRESGRAPDAAVV
FT                   VVTLKALKANSGQESAKDINDQDMPRLQSGFANLKWHIDNVSQYGVPVVVAINRFPTDT
FT                   QEELQWLKGAVAETSAFGCEISDAFCEGASGAEALARAVVSATEQASEFKFLYPLDVSL
FT                   EAKLMTIAEAGYGAKGIALTPEARQQLNQIKAMGLDGLGICVAKTPLSICHDPKVKGIP
FT                   TDFELPITQFKINAGAGFITALVGKVMTMPGLSVRPGYRNIDINQQDEIVGLA"
FT   CDS_pept        complement(404864..406468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0338"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00309"
FT                   /db_xref="GOA:D4ZES9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZES9"
FT                   /protein_id="BAJ00309.1"
FT                   /translation="MYRTISLIMLTVMTLIGTQVQAKEVDIASELSSLHQSIDRDVVQL
FT                   RLEQGELSQFTEYRIQQKSAQLHQRLKKLMNVAPLDVEQLAPYVTEHLKLIEEIDAHYL
FT                   QSITALKLMLGKDNDADIMMQLTNRELERDGMLQAKSVALNWAEQLSINTANVKQKFTS
FT                   SLLERADNLDSLVHYTQSRLKVAVDDASLAGKDVSSEQTAKVTQLNERLSHSSSSLRVA
FT                   VQLLDDLDQDTSELKQTLFSTSGNITQGVLNLDVASSLLEQWLATAKHQAIDNGPSVVF
FT                   KVFIFLLILMIANMIGKGVEKLVRKAVSNSKLNFSKLLQEFFTSLSGKAVFTIGVLIAL
FT                   SQLGFELGPLLAGFGVAGVIIGFALQDTLSNFASGMMILVYRPYDVGDLINAAGVTGKV
FT                   SHMNLVSTTIKTLDNQRLIIPNNKIWGDTINNITVEHQRRVDMTFGIGYGDDIEKAERV
FT                   LKDIVTSHPKVLKSPAPMIKLHVLGESSVDFIVRPWAKPEDYWDVYWDITREVKMRFDR
FT                   ENISIPFPQRDVHVYQN"
FT   CDS_pept        406845..407180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00310"
FT                   /db_xref="GOA:D4ZET0"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET0"
FT                   /protein_id="BAJ00310.1"
FT                   /translation="MLCTHCSKTFGVNAVQNQRGKGLNAQIQCPHCDAWLGKNPILTRL
FT                   KIVAFYAGFAALVYGYFEPEMRNLTTPLAIVAVIVLLISHMMDHLKVTQAPEIKEVDDS
FT                   EHRQKYR"
FT   CDS_pept        complement(407305..407430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00311"
FT                   /db_xref="GOA:D4ZET1"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET1"
FT                   /protein_id="BAJ00311.1"
FT                   /translation="MLEFLRENGKMIFWTSFFFIAIGGGIYYVDAALEAQVIEVN"
FT   CDS_pept        complement(407812..407913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00312"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET2"
FT                   /protein_id="BAJ00312.1"
FT                   /translation="MFMDTQGTVTLITMIYMFNTMDRSGKRQADQYG"
FT   CDS_pept        408293..409555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00313"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET3"
FT                   /protein_id="BAJ00313.1"
FT                   /translation="MLGDLCCILEKQMTVLNHRISCVAAACALFTTSAFAENPSLTNPA
FT                   ISAVLDGYYQNTERPMAERDEGFGLGHTEIAMSANIDDMFYGKLTAVIEMHHGETELGL
FT                   EEGFIQTLAMPGGFSIRAGRFLSDVGYLNNQHVHTDAFSDRPGAYRAFLGSHYFDDGVR
FT                   LSYVAPTDLYWTMGMEGFKGDSMRAAGGEHEEHEDHEGHSDHAEREYKNIGVYTAYTKI
FT                   GGDIGNGSWQTGLSYMRNENGRMVEAEHEDHASEDEGHDHSHSASFTGENTYIADFVYK
FT                   WAPNGNYKYQHLTISGEYFRVTDFAPLEDGHDHDHDHHSEASVDDMQAWYLSSVYQFTP
FT                   NWSAGVRYGETDVQELHGDHFHAQKLKETEVSLAWHQSHFSTVRVQYTNQKGTNFFGIE
FT                   DDNVLTLQYVMTLGAHGAHQF"
FT   CDS_pept        409587..410453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0343"
FT                   /product="adhesion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00314"
FT                   /db_xref="GOA:D4ZET4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET4"
FT                   /protein_id="BAJ00314.1"
FT                   /translation="MSYSSLASAELNIFACEPEYASLAKELAPNARIYSATTAMQDPHQ
FT                   VQARPSLIAKMRQADIAVCAGADLEVGWLPMLQMKSSNAKVRSTDQGLFYAAEQVETID
FT                   QLKSVDRSMGDVHAKGNPHLHFSPERMLKVAQALTAKLIAVDPASKAEYESALADFSLR
FT                   WTAAIPVWKKKAAPLNGKKVIAYHSSFKYLFTWVGIEQVADLEPKPGLPPSSSHLASLL
FT                   TRTEAGDVMAIIVASYQDERGANWLGDRANLPVQVLPMSVGGNDQSQDLFSLYDSVLDL
FT                   LLSVKAS"
FT   CDS_pept        410592..411329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0344"
FT                   /product="ABC 3 transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00315"
FT                   /db_xref="GOA:D4ZET5"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET5"
FT                   /protein_id="BAJ00315.1"
FT                   /translation="MSTHVLLGQQVLKRGIIFIDLAIAQVAALGAIVAHLNHDIEHLPF
FT                   SNVWMPALFALGGAGFIAWLSKRMADELEAIIGCFYVLSAVAAMLLLSNDPHGAEMLKQ
FT                   LLSGQILWVNWSQLIWPACVSALVLAVVFLRPSLLEGSGFYILFAIVITLSVELVGVYL
FT                   VFSTLILPALAVNKFGSRYRLGAAYLVGLTGYILGLLVSATLDLPSGAAIVATLAVSAI
FT                   LFRLALSLSLKTGQEVAIPAKVS"
FT   CDS_pept        411398..412180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="SVI_0345"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00316"
FT                   /db_xref="GOA:D4ZET6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET6"
FT                   /protein_id="BAJ00316.1"
FT                   /translation="MSHARLLAIMSRLESREYIVLLILRSLILAVMLLLAFVFGGLFCL
FT                   FRPRHRDNVHMFAKIFSYAAPVLGIKVIVRKPTSGLKDEPCIYLANHQNNFDMFTHTAA
FT                   VPKGTVSLGKKSLAWVPFFGQIYWLSGNILIDRKNRNKAFETMAQTAKKIKEKCLSIWI
FT                   FPEGTRSHGKGLLPFKSGAFHTAIAAGVSMVPVLASNQGHIKLNRWNNGIVIIEMMEPI
FT                   ETKGLAKHQVKELSSRIHVLMSAKLTQLNLEASALMAK"
FT   CDS_pept        412362..412835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00317"
FT                   /db_xref="GOA:D4ZET7"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET7"
FT                   /protein_id="BAJ00317.1"
FT                   /translation="MSIERLLKAQKQENQEIVDAILGDGSHPDVDYTIEHHFSSTNFDR
FT                   LEKAAVDAFKSGFEVNDAEEMELEDGSVIYCFDAVASHKLEVELLDQACEALLTLAAKQ
FT                   KVDYDGWGTYFIDENGDEVRDDDEDFEDDDEDFEDFEEEDDEDKDKDDKDTVH"
FT   CDS_pept        complement(412921..413865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0347"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00318"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET8"
FT                   /protein_id="BAJ00318.1"
FT                   /translation="MNELHWLIDMVQTIEVGLVVLDKNFDIQLWNGFMENHSGVSPNSI
FT                   KGSNLFEQFDYLPADWLKQKMESVFLLKNRAFISWEQRPYVFKFKNYRPITGRADFMYQ
FT                   NVTLLPLSSLTGQITHISMIVYDVTDVAINKLQLKSVNERLEHLSQTDGLTQLHNRRYW
FT                   QICMQKEFDRHARYGDETSLVMFDIDHFKKVNDTYGHMAGDKVIQHISHLLSQSLRETD
FT                   CAGRYGGEEFAVVLVKTSAEDALKFAERLRNKIETTELVYEGKPIKVTVSMGISDLQDR
FT                   VGNSGQWLSFADQALYKAKEAGRNKCLIYKSKA"
FT   CDS_pept        complement(413901..414896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0348"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00319"
FT                   /db_xref="GOA:D4ZET9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZET9"
FT                   /protein_id="BAJ00319.1"
FT                   /translation="MSIPVLICDDSALARKQMARTLPKEWDVDITFANNGAEGIEAIRA
FT                   GKGEVVFLDLNMPVMDGYEVLQTIQQEDLPALVIVVSGDIQIKAHERVKALGALDFIQK
FT                   PVSADAISNILQEYGILTIAIGDEVADSPMIEVDLRDACQEIANVAMGRAADLLAKLLD
FT                   VFVLLPIPNVNVLEVSELTMTLKATEEHSKVSALCQGFIGAGIAGEALLLFHDSSFKDM
FT                   AKLMGLENPEDKNTEIEVMIDTGNVLIGAFLNGISEQLHMKFSQSHPVVLGRHCTVNDL
FT                   IHDNSEKWSRTLAMEINYRIEDHDIQCDLLLLFTEDSLPTLNYKLAYLLD"
FT   CDS_pept        414965..415123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00320"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU0"
FT                   /protein_id="BAJ00320.1"
FT                   /translation="MVSFDRYLLEFWALRCNKQVFINFCLSEWVQKWKYYVTFLTMVNC
FT                   YLYIISN"
FT   CDS_pept        415186..415992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0350"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00321"
FT                   /db_xref="GOA:D4ZEU1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU1"
FT                   /protein_id="BAJ00321.1"
FT                   /translation="MARKFVQLIIDKQVAQVILNRPEKYNALNFEMFRELDEVIGELKR
FT                   DRKVHVVILSGSQGNFSSGLDVKSVSKSPIQAVKLLFKWLPGNANLAQRVSIGWRRLPM
FT                   PVIAVLEGVCFGGGMQIALGADFRISAGDAKLSIMEAKWGLVPDMAGLVSLREVVSKDQ
FT                   ALLLTMTAGVLSAQDALSKGLVTEVVDEPMVRALELAAILAKTSPDANAAIKMSINHSW
FT                   NSSIRSLLSRESFSQIRLLLGKNRLIAAKRQTSEPDKVYKDRQARW"
FT   CDS_pept        complement(416010..416936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0351"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00322"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU2"
FT                   /protein_id="BAJ00322.1"
FT                   /translation="MHFNPALVISLFFLLTAPAAIAADPQDASPTETITQENMTQDKAV
FT                   FPGKYDYLPKEEIIEITLGERKTEVLVRPWSGKKKLGSAILLANLGMGADGAGFQAYLR
FT                   RQLNPAGWATISLTPPNKVLTPNFATSPEEIAKAGEMKQAQKSTEMTEQYADDVWKKIR
FT                   EKQSQFLSQAIDQLDAIGAPYPGKRLLITSGQGAGLVITMLSNNLLAKPDILVIINPYM
FT                   KMKDENLGLAKQLAELDIPVLDIQSADGHRASYKTARLRAELSPQNAPYRYSQQTLVLN
FT                   LNNPMSWETALKLIEGFALRITNRAEP"
FT   CDS_pept        complement(417084..419990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="SVI_0352"
FT                   /product="RNA polymerase-associated protein HepA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00323"
FT                   /db_xref="GOA:D4ZEU3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU3"
FT                   /protein_id="BAJ00323.1"
FT                   /translation="MPFSLGQRWISDTESELGLGTVVGLEGRMVTLMFPATDENRLFSR
FT                   TEAPLTRVIYNPGDKIESHEGWSLTVNELEEKNELIIYHGIHTETGEQVSLRETLLNHN
FT                   VRFNKPQDRLFAGQIDRLDRFGVRYQSQLLRNKLATSDLLGLQGPRVGLIPHQQWIAHE
FT                   VGRRFAPRVLLADEVGLGKTIEAGLIIHQQLLTGRAERILVIVPDTLRHQWLVEMLRRF
FT                   NLKFSVFDEDRCIEAYADNENPFYTEQLVICSLELLRKKKRLEQAIDADWDLMIVDEAH
FT                   HLEWTEEAPSRAYRIVEALSQAVPGVLLLTATPDQLGHQSHFARLRLLDPDRFYDYDVF
FT                   LEEEKSYKDVASAAEALAGGDALSTDAIAQLTSLLSEKDIGATLELIQASDADVDKQQA
FT                   ARDELLQDLLDRHGTGRVLYRNSRASVKGFPTRILHAHPQAIPSQYVTAARVGAMMNGH
FT                   LDTAAKVKQALSPEKIYQDFESSSASWWKFDPRVDWLIEFLKTNRSKKVLIIASQAETA
FT                   LSLEEALRTREGIQATVFHEGMSIIERDKAGAYFAQETGGAQALICSEIGSEGRNFQFA
FT                   SQLVLFDLPLNPDLLEQRIGRLDRIGQNNDVEIHLPYLAGTAQECLMQWYHQGLNAFEQ
FT                   TCPSGHILFNEFSESLLSQLITQDETAMEELLSDTQTRYQELKTAMEQGRDKLLEINSH
FT                   GGDRAAKLVQRLAERDQDTQLIGSVIRLWDIIGVEQEDCGENTIVLKTSEHMMFPTYPG
FT                   LTEDGMTITFDRDVALSRDDIALITQEHPLVQTALDLITSSETGSTSVAVLKNKALPAG
FT                   TIFLELIYMADASAPKASQLYRYLPPTPVRILLDKNGNNLSDNVTYEGFNKQLSAVNRH
FT                   IASKLVNAYQTVLHPLFAKGEEFAQTELKLLAESARAKMTSQLTVELERLEALKAVNPN
FT                   IRDEEITHLKNQMTELNGYLDDSLLQLDAVRLVLVSHA"
FT   CDS_pept        420385..421779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0353"
FT                   /product="PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00324"
FT                   /db_xref="GOA:D4ZEU4"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU4"
FT                   /protein_id="BAJ00324.1"
FT                   /translation="MEQDDRKLFVLDTNVLLHEPLAIYSFKEHDVVIPMTVLEELDQIK
FT                   DRKRDVSRDARVAIRALEDILGGKTTPEQILQGVKLPRREDHGDACGTLSIFPDHQLEM
FT                   THASLPDNNNDNRIINTALHLQKIHKPRNVVLVTKDINMRLKAKGAGIKLVEDYRTDQL
FT                   IDDIRFLTTGFHQFKGDFWERKEHVSTESHGRHTVHTIPVKEVGDENFYINQYLIDEDS
FT                   NFCARVLEKTSDDLKLLDLGKDRLLNIDAWGIRPKNIYQGMAMQALLDPEIDLVILTGP
FT                   AGCGKTLLAMAAALEMVVERGLYDKIIVTRNTPEIAESIGFLPGTEEEKMTPWLAAITD
FT                   TLEVLHKNDVNPSGSMNYIMDKANVQFKSINFMRGRSIQNSVVILDECQNLTASQIKTM
FT                   ITRMGEGTKLICSGNLSQIDSNYLTAVTSGLTYIVERFKDFEGSANIYLNGVVRSRLAE
FT                   FAEENL"
FT   CDS_pept        422050..425757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0354"
FT                   /product="sensory box histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00325"
FT                   /db_xref="GOA:D4ZEU5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU5"
FT                   /protein_id="BAJ00325.1"
FT                   /translation="MKSTEPDLQLKSPIQKNYNRAVFYTYIGVIIMALITAWFFFDGQK
FT                   SQLMEKREEQVERRVLQIDLLLESSIRAVKSLRNVAVDHLRLGELVRKERLPQYEKFDE
FT                   SGQYFTLEPSYAESGEPFTNMGRITGAGSLNGRSEKFYQELEMLFELSLSFPVAIEAAP
FT                   KASSIYYISKHRIMSYFPWPSDEQRFRDELLNKNQFQLATPAMNPQRSVFWSPAYVDPG
FT                   GKGLLTTLGVPIYLEDEFIGSINLDMTLSSLAKQMHLYFKMPGTVILLDQNNNILSHSD
FT                   DDKSEISRVFHISQKIPSELHSIPESELFDAHEGIIRNGYYIHSVALQNAPWRLLYLQD
FT                   RDELFKDSWDKLELTFILVVLALSVLVTIVHWQTRRSFVNPASRLLTHLESCSLEPRKP
FT                   PEQISQGWEPWFQLVSRIFEENLQYTKHLAEQNRRLDKLVARRTARLKETTERREREYA
FT                   LLRSLLDSIPEAIVFKDKEGKYLGCNKAAERMLGYTESELIGQESIKLTTQEQSVRIKA
FT                   EDERVLAERTPLRYQEKVEFAGKPVLLDTLKLPFYNRRGELLGLIAVWRDVTREYESAE
FT                   QLRLSEERYHLAMDAVEDGLWDWYLDSKQIICNPAYYSMLGYKSNEFPALVSTLDDLIH
FT                   PDDRIRVQEYREQYLGDPIGAFDVEFRMRGKSGQYHWLLSRGRVVEYTVDNQPKRMVGT
FT                   HKDITRHKSNEVALLEAKQDAESANLSKSEFLANMSHEIRTPMNAIIGMLQLAQRTELT
FT                   AKQEDYLDKAGFSAQSLLRIINDILDFSKIEAGKLELEKVAFPLDKVLDHALDLNALKS
FT                   QQKGVELLLYAPVTAGLILEGDPLRLGQVLINMLSNAVKFTQTGEIELGCEDVGERDHR
FT                   ITLKFWVRDTGIGISKEQQASLFDAFAQADGSTTRKYGGTGLGLSISKHLVSMMGGQMQ
FT                   VQSEMGVGSTFSFTISFEIAEEAEVKPMIVPERLGSLKTLVVDDNPTALQIYATVMRDF
FT                   HFEVDTAANGSEALYKLEKSSVDLLLLDWMMPEMDGIQVIEELDRMVADGRLDKRPIVI
FT                   MMTGYAAEPLKEDADRSNIYAMLQKPFKASALFDEIISAFTEEPKVNSVIEVEAEEVVD
FT                   THVGMVLLVEDNFINQQVATELLKSAGYEVDVADNGQIAIDMIAEKDFDAVLMDIQMPV
FT                   MDGLTATKEIRKHFSLQELPIIAMTAHAMSGDREKSLSAGMNAHITKPIVLNELFDTLS
FT                   YWIKQKDEVS"
FT   CDS_pept        425969..428374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00326"
FT                   /db_xref="GOA:D4ZEU6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU6"
FT                   /protein_id="BAJ00326.1"
FT                   /translation="MKSYNLALAIALICVPVVDVVAASSNTASIIKKSQSTTGFLNLFY
FT                   AKADGELYLEANKLDQPFLLLTSLPHGVGSNDIGLDRGQLGYTRMVQFERHGPYLILKQ
FT                   LNTQYRASTDNAAELRAVKEAFAESVLWRGKIIDGKRDLVSINDLVINDLHGISSVLED
FT                   TKQGSYRLDKSRSLILPQGVKSFERNSDVDVLLTFNSTKAGNYVAQVTPDANHMSVRLR
FT                   YSFIQLPEEGYVARDYHPMSGYLAEEYLDYGTQVDQDIRQRHLLRHRLQKVNPGTEPSE
FT                   VIKPITYYLDPGVPEPIRSALLEGAGWWEEAFEQAGFIDGFKVELLPEDADPQDIRYNV
FT                   IQWVHRATRGWSYGSAVADPRTGEIIKGHVTLGSQRVRQDHMIARGLTAGWEDRQAAED
FT                   ASMALSLARIRQLAAHEVGHTLGFDHNFAASSNDNASVMDYPHPLATLKGDKIDISAPY
FT                   GVGVGAWDKYIVEYGYREYADSGEESAQLSELMAQVQRQGLRYIGEADSRSKGASNAYA
FT                   SLWDNGSDPVAELIRIDKVRAKAINDFSPSALLAGQPRGELSDIFVPIYLLNRYQITAA
FT                   AKFIGGTDYSYSEDVDGKSWHYIAPQLQKSALDALLDTLSPKALVISQALQESLVPKAA
FT                   NYSKTRESFDSGLGVIIDPLGMAEVLSRHTAQQLLAPQRLNRVNQGYIGDREQLSVPAL
FT                   VDKLLGSTLYEDMPNGAEQGVWMRVNSVILDELLASYHAKETRPEVKAQLAGRLRYTLK
FT                   QLKRKVKRVSAYEAAHFAWLADGVERGMKDAKVKLIAEPLKIPPGSPI"
FT   CDS_pept        428585..428890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00327"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU7"
FT                   /protein_id="BAJ00327.1"
FT                   /translation="MPELLHSMSHESAWLQKDSVSSPISEPKAPRGQNFSQGLVECDQA
FT                   CIILASGHCVTHCASMMGIIQSCSYILPATSSEQIPNRLWSIQTADAAQVYRPPMS"
FT   CDS_pept        429125..429427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00328"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU8"
FT                   /protein_id="BAJ00328.1"
FT                   /translation="MKLLTSVALSAVFVFSSASVVADIPDFSKTAAAKSSYDFSKNQPA
FT                   KGNLLQLDSTHHDFSKTVAAGKHYQFSKNEVSSKEKSSDSSTQHDFSTTSAMKRI"
FT   CDS_pept        complement(429584..429985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00329"
FT                   /db_xref="GOA:D4ZEU9"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEU9"
FT                   /protein_id="BAJ00329.1"
FT                   /translation="MTRCTSSNEETHMSKAITAALISALVCPGTGHFYLKKYKIGTLIS
FT                   AVSLSGLVYLLYQAVERARDISDQILSGAIPLDFNLIYPMITEQPSGSAALYISIATWV
FT                   FIISWLVGVIDAYRQGRALDKSLDKSGKR"
FT   CDS_pept        complement(429985..430371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00330"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV0"
FT                   /protein_id="BAJ00330.1"
FT                   /translation="MQVAPMKYANLISFTLATSLLSSIPVMAQENQFYDEQSSQTYQIG
FT                   IMIQAISAALAKPKDPDSLDTISRYGTDSRYYVMIRGWLVQELLGVQSQLDASHANEAE
FT                   SETKLKFIDKVTFLHEAIGRIDLE"
FT   CDS_pept        complement(431429..434509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0360"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00331"
FT                   /db_xref="GOA:D4ZEV1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV1"
FT                   /protein_id="BAJ00331.1"
FT                   /translation="MNFAQYSIEHKVVSWMFALLLLVGGSISFLGLGQLEFPEFTLKQA
FT                   LVVTAYPGASPEQVEEEVTLPLEDALQQLDAIKHITSISSAGLSQIEIEVHEHYGADEL
FT                   PQVWDEVRRKVNDKLGELPPGVVTPAVIDDFGDVYGILLNISGDGYTSRELQNYADFLR
FT                   RELVLVDGVKKVTIAGKITEQVVVEISQQKLNALGLDQDYIYSLINSQNVVSNAGSIRV
FT                   GDNRIRIHPTGEFNRVEQMERLLISAPGSTKLVYLGDIAQVYKDNDETPTNIYHGNGES
FT                   ALSIGISFSSGVNVVDIGVAINERLLELENERPIGIELNTVYDQSKMVDETITGFLINL
FT                   AESIAIVIFVLLVFMGVRAGLLMGLVLLLTILGTFIMMKVLNIELQIISLGALIIALGM
FT                   LVDNAIVVTEGILIGIKRGQSRLETSKQVVSQTQWPLLGATIIAILAFAPIGLSDTATG
FT                   EFCVSLFQVLLISLFISWITAMTLTPFFCHLMFKDGEVSGDDNDDPYKGWIFQLYRSSL
FT                   NLAMRFRAVTLLMVIAALFTSVMGFGYVKNVFFPASNTPMFFVDVWMPEGTDIKATEHL
FT                   LGRIEKDLLAQQATQDIGLVNLTSVVGQGAQRFVLSYVPEKGYNSYGQLLIEMTDLVSL
FT                   DKYMRTLEKELSLKYPEAEYRFKYMENGPSPAAKIEARFYGEDPVVLRQLATQAKAILD
FT                   AEPTAVGVRHSWRNQVTLIRPQLALAQARETGISKQDLDNSLLVNFSGKQVGIYRENTH
FT                   LMPIIARAPAEERLDADSLWKLQVWSSENNVFVPATQVVSEFSTEWENPLIMRRDRKRM
FT                   LAVYADPINGTDETADSVFKKIRADIEAIPLPNGYEFEWGGEYETAGEAQVSVFSSIPM
FT                   GYMAMFLITVLLFNSIRQPLVIWFTVPLALIGVVSGLLIFDAPFSFMALLGLLSLTGMI
FT                   IKNGIVLVDQINLELSEGKEAYQAVIDSSVSRVRPVLMAAITTMLGMVPLLSDAFFGSM
FT                   AITIIFGLGFASVLTLIVLPVTYTLAFRIPYPKQAKN"
FT   CDS_pept        complement(434571..435650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0361"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00332"
FT                   /db_xref="GOA:D4ZEV2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV2"
FT                   /protein_id="BAJ00332.1"
FT                   /translation="MKYLAKTFAAIMITGILAGCNAESIEVASQTIRPVKLLEVTDVNA
FT                   ASIRVFPAKIAATKQADLGFRVSGQVIDFTLVEGQQVKKGTILAKLDDRDARNTLLNRE
FT                   ADNELATADYKRKGELLRRQLISTADYDLAKAQLKSAAAALANARDQLSYTHLLAPYDG
FT                   TVAKISIDNYQMIQANQMVLLIQKDRNIDVVIQVPESMAIQAITFNPHAKFQPQVRFSA
FT                   HPEQAYPVKLKEHATQVTPGTQSYEVVFTLARPTQINILPGMSAELSLDLSMDSQLDKT
FT                   VIPASAVMKRDQDGENIIWLYHADTGKVTAQIVTLGRVTTDGIEILTGLNMGDLLVVAG
FT                   VQYLSAEQKVKPLHWQRGV"
FT   CDS_pept        435863..436810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0362"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00333"
FT                   /db_xref="GOA:D4ZEV3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV3"
FT                   /protein_id="BAJ00333.1"
FT                   /translation="MMKTEDISLFHRIVETGSLVEAADLLNLPKSTVSRRLQALEDELK
FT                   VKLFHRQSRAMTLTASGSHFYDKTLSILGDLEQTLMELTDTQAEIGGHLRILMFPVPEL
FT                   LDIANGIFEFMEHNSELTVELIVSTEPQDMIRNNIDLAFMVEDSFNENEMVAREVISEE
FT                   LHFVASPGYLAKAGTPVLPEDLEKHNSILFRYPNGRIFNEVPFGNDMKIAVKGNLCLNS
FT                   IELCLEASITGRGIAFLPTKVTREYVERGELTILFEDVEPYIGKCYLVYPSRRFISLAS
FT                   KRFIDHMMDALERCNLGQGCGREERLRGSIKSWV"
FT   CDS_pept        complement(436956..437621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0363"
FT                   /product="pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00334"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV4"
FT                   /protein_id="BAJ00334.1"
FT                   /translation="MQPDTYTDKTFIDASFSGEDLQDAIFERCEFYRCDFSRADMTDAS
FT                   FINCRFVEAGTAEGCNFSYATLISASFKHCNLSMAMFTGARCFGIELRECNLQGADFAR
FT                   ASFANYITHKSFFCSAYITESNLSYANLESAQLEKCELMDNRWRGANLLGASMKGSDLS
FT                   GGEFSQSQWGTFELEGCNLCRVELDGLDPRNVKLEGVMINQWQQEQLLAPLGIIVAPD"
FT   CDS_pept        complement(438289..439680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0364"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00335"
FT                   /db_xref="GOA:D4ZEV5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV5"
FT                   /protein_id="BAJ00335.1"
FT                   /translation="MNDRHGLLTQPIGRVLLNMSLPNLIGILTILGFSLVDTFFISQLG
FT                   TESLAAISFTFPVTLIISSIAIGIGAGVSTNLGRLIGGGQADKAKVFLHDSLLLTFMLI
FT                   ALISMLGSLCIGPLFSLLGANDSSLPLIADYMFLWYLGAPLLVLLMVGNQGLRATGDTR
FT                   SPAKIMMLAALINLILDPLLIFGIGPFPRLEIQGAAIATVISWVVALSLSSYLLIFKRH
FT                   LVEFADFNMVRLKRNWKQLAHIAQPAALMNLLNPLANAIIMAMLARIDHGAVAAFGAGI
FT                   RIESVLLIAVMALSSSLVPFIAQNLGAGQTERARDALLLSLKFILVFQTLLYLPLLLLS
FT                   EPIAQLFSGDPQVVEWLSFYILMIPAAYGPLGIVILMATSLNAYHRPMSSLILNVCRLF
FT                   LIMLPLAALGSYLGGIKGLLLALPISNTLMGITCYILATKISEPEQLKHTQNYAAGTNK
FT                   KVKSH"
FT   CDS_pept        439907..440197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="SVI_0365"
FT                   /product="chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00336"
FT                   /db_xref="GOA:D4ZEV6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV6"
FT                   /protein_id="BAJ00336.1"
FT                   /translation="MNIRPLHDRVIVKRSEVESKSAGGIVLTGSAAEQSTRGEVLAIGN
FT                   GRILENGSVQPLDVKVGDIVIFNEGYGVKKEKIDGEEVLILSESDLMAVVS"
FT   CDS_pept        440262..441902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="SVI_0366"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00337"
FT                   /db_xref="GOA:D4ZEV7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV7"
FT                   /protein_id="BAJ00337.1"
FT                   /translation="MAAKEVLFGNDARVKMLAGVNILANAVKVTLGPKGRNVILDKSFG
FT                   APLITKDGVTVAKDIELEDKIENMGAQMVKEVASKANDEAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVVAAVAELKNLSQECSDSQAITQVGTISANSDETIGQIIA
FT                   TAMDRVGKEGVITVEEGQALENELDVVEGMQFDRGYLSPYFINKPETGSVELESPYILL
FT                   VDKKVSNIRELLPILEGLAKTGKPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTGGTVIAEEIGLELEKATLEDLGTAKRVIITKDDTTIIDGNGEES
FT                   QIKARVSQIKIQAEESTSDYDKEKLQERMAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVASKIADIEVLNEDQKHGVVIAIRAMEAPLRQIAANA
FT                   GEEGSVVANNVKNGTGNYGYNAGNDTYGDMLEMGILDPTKVTRSALQFAASIAGLMITT
FT                   ECMIADVPQDASAPDMGGMGGMGGMGGMM"
FT   CDS_pept        complement(442821..443435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0367"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00338"
FT                   /db_xref="GOA:D4ZEV8"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV8"
FT                   /protein_id="BAJ00338.1"
FT                   /translation="MRCLNEDIARRANREDGCKGAFWEGRFKSQALLDEQALLACMMYV
FT                   DLNPIRAGIANTLQASDYTSIQERITELSTSDKNTKAHDDKSAATSSEPLKPLAQFDGA
FT                   THLATQSGIPFHFCDYLQLIDWTGRAIRPDKKGFIDSSLPKLLNELGIAPEAWITSAKE
FT                   FRRQYSGISGRWDAMCAFKQQHNCGLWCKGKASSNALHPSP"
FT   CDS_pept        complement(443448..443729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00339"
FT                   /db_xref="GOA:D4ZEV9"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEV9"
FT                   /protein_id="BAJ00339.1"
FT                   /translation="MESKVKALSAIFCIHVCAYAVMNNHYHLVLKIDLDRANSLSNREI
FT                   IELWCKVTKGHDVATKYMNGDALIEGERLLLDGLLAEWHERLSSISCT"
FT   CDS_pept        complement(444070..444276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00340"
FT                   /db_xref="GOA:D4ZEW0"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW0"
FT                   /protein_id="BAJ00340.1"
FT                   /translation="MRMNFFRLYKVQIIVYLLLLLVCGGFISIENGLLRGLGFSVVCLV
FT                   FLCVISYISYRNSISKYGKRDIK"
FT   CDS_pept        complement(444286..444396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00341"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW1"
FT                   /protein_id="BAJ00341.1"
FT                   /translation="MIGNTAGQTTSAATGLANKAADLGIAVADKTVKENI"
FT   CDS_pept        complement(444548..445630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00342"
FT                   /db_xref="GOA:D4ZEW2"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW2"
FT                   /protein_id="BAJ00342.1"
FT                   /translation="MILKTKRVQNTKSPQAIAGQQQETNVAFFLRRAYKDNLQVLVIND
FT                   FKFTFNDETAQIDHLIIYPYGFILIESKSIKGHVKVNKQEEWTRSYNKKWQGMASPIKQ
FT                   VELQQALLKEMLRAHKSQMLSKLLGFKQQGFNMRCWDHLCAISSDAVIDRKTIPATISD
FT                   KLVKSEFLVEKLNNIMKIKNKFMRLVNFADTRPDFSQTELESIASFLLEQNIEKSIEKN
FT                   IEKNIEKSVEKSIKSQRKVSSTTETISPSIRISDPQQIQVPAAVYQSTTQQAKLESSQH
FT                   AQSTQTINSELRCKHCGESTNYSPMHGKFGYYVKCNICTKNTPMKQACSKCQSKNTKVQ
FT                   KRRDTYTLNCQECGCGQQVI"
FT   CDS_pept        complement(445866..446177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00343"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW3"
FT                   /protein_id="BAJ00343.1"
FT                   /translation="MRIQYMSKLNAEERKARDNDRFSKRVDERRVKGEDVVAYALANKK
FT                   AFKFLTKSEKHSLKERQAVLLEEAKVKAQEAIKLRDEQELEKIEAAFPEEEDTKSSKS"
FT   CDS_pept        446495..448297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0373"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00344"
FT                   /db_xref="GOA:D4ZEW4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW4"
FT                   /protein_id="BAJ00344.1"
FT                   /translation="MSMKYRGDIQIVRGVAVLLVVLYHLGVQSIQSGFLGVDIFFVVSG
FT                   FLMAGLYDKDKKYEFIMKRARRLLPAYFTVIFATLILSLFIATPNETQQVVQQALYATV
FT                   FASNIGFWMQNTYFSNTEFSPLLHLWSLGVEIQFYVIVPIIAALFARARGLLFLTFLLS
FT                   LILCFIVVGISPKTSFFMMPLRLWEFLIGFACAYYFCKEGGARFSHKPWLGFAAFLVLI
FT                   FIPFMKVDGTSLSVFTGHPGVFSLLVSVATAILLIFGLPKAVEKSLFGSVFIKLGNYSY
FT                   SIYLVHFPILVLYLTEPFSGTITQASSWLDTAIMLVLIILSSLLMYHLVEKGVRTHSIA
FT                   RLIAAPVISIAGLALLLPYLQYSNLPLKEQQIFNAFSDRSTYRCGKLIRIIEPKAISCE
FT                   LTDNSSVSKKRLLLVGNSHADSIKTAFATSAIREQVSLFFVVSNNSLLKGGLSPQRIVN
FT                   EAAARSIDTIVLHFSDEAIDTKKVQEVVSLANDEEINVVFIAPVPAWSEHIPKAMYDHL
FT                   RNKADLPQKSRNMYLAQNKAVIDDINNINLDNFRSVSVVEYFCDPLCSYSSSDGTPYYF
FT                   DKHHLTLTGSNILSPLFSQIIREL"
FT   CDS_pept        complement(448376..448930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0374"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00345"
FT                   /db_xref="GOA:D4ZEW5"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW5"
FT                   /protein_id="BAJ00345.1"
FT                   /translation="MTDTKLNSIEYRTQQQVDGKLRAIKASIEGIAVVSASSAPRHASS
FT                   TNQIPKSQSRNSQHQSKSSSVMLIPLLIILGLGVFGFKRYEAITAESNTPAQVTIEFRQ
FT                   EPAAKHIPRAQPKESFYQEPATKQISWTPPKENFHCEAGKQHCSQMESCAEANFYINNC
FT                   LGTKMDGDNDGIPCEKQHCGY"
FT   CDS_pept        complement(449096..450463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ktrB"
FT                   /locus_tag="SVI_0375"
FT                   /product="potassium uptake protein KtrB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00346"
FT                   /db_xref="GOA:D4ZEW6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW6"
FT                   /protein_id="BAJ00346.1"
FT                   /translation="MRFIAHRNTFFPIKAEKSGVKWSEPKIILCSFFAILFPSALLLTL
FT                   PVFSVTGLSFTDALFTATSAISVTGLGVVDTGTHFRASGKILLLFLMQIGGLGQMTLSA
FT                   ILLYMFGQRLSLRQQALTKEALGQDKSINIKRLVEHIIVFAIIAELLGFIFLAIRWVPE
FT                   MGWKQGLFAALFHAVSAFNNAGFSLFSDSLSSYATDPMITFTIAGLIISGGLGFTVISD
FT                   IRRNFSNGFHHLQLHTKLMLLATPCLLIFGTLMFWLLEHNNPNTLGQLDLGQQWLVAFF
FT                   QSVTARTAGFNSVDISMFTQGAFFIMIILMLIGAGSTSTGGGIKVSTFVVVAVATWSFL
FT                   RQRPHVILFKRTVPSRTVTKCLAIIVISGIILALAMFALMLTENAPFEQIMFETISAFA
FT                   TVGLTAGLTANLSEAGKYIMIVVMVIGRIGPLTLAYLLAKPKPTLLKYPEDNVLAG"
FT   CDS_pept        complement(450460..451170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0376"
FT                   /product="potassium uptake protein KtrA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00347"
FT                   /db_xref="GOA:D4ZEW7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW7"
FT                   /protein_id="BAJ00347.1"
FT                   /translation="MHKYVSFYGKNNLRLNMASENKYIVIIGLGRFGMALCHELSQEGA
FT                   QVLAIDIDEKNVRKAAEFVTQAIVADCSDEDTISELKLDEYDLAMVAIGEDVNSSILTT
FT                   LILKEAGVKAVWVKAKNKFHAKILTKIGADKVVQPERDMGIRIAHHMLDHHIFEFINLG
FT                   SGIALAEIGIYEKYYGSKLIEHPCYQSSDINLLALKRGVVVDKNPLPDTLFEKDDILIL
FT                   TGQKEKLIEVLRRR"
FT   CDS_pept        451433..451540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00348"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW8"
FT                   /protein_id="BAJ00348.1"
FT                   /translation="MEYACRFTVQFTVPVYELFLFTLMPLKKEQGQPQV"
FT   CDS_pept        complement(451614..451865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00349"
FT                   /db_xref="InterPro:IPR021376"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEW9"
FT                   /protein_id="BAJ00349.1"
FT                   /translation="MNPILAILKEHKVSDTQIKDLFQTLTQNPMAAMAIIGQLGIPPEK
FT                   LQQLMALVMQNPALIKEAVVELGLDFSKVEAAKAQLDK"
FT   CDS_pept        complement(451987..453711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00350"
FT                   /db_xref="GOA:D4ZEX0"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX0"
FT                   /protein_id="BAJ00350.1"
FT                   /translation="MNNNKILCILCTLILGLISAPKVHATESKAVWMEGKVGVGFRINA
FT                   DRKDNIENYDVDTLVNQIKTIDGISYVIFNLSDAAHGDAYLAPHSILTTLNPDSTPNAD
FT                   RDLFGELAKAFHAAGIKVIAYAATQGPAMLKHGAAYAFDGVQDANGHWSSKSMTNWAKW
FT                   VTNKYGSASDDNYKKAYAEVIIAEYAQRYGSLIDGWWFDHSSCANIPLLHKITKAANPA
FT                   VILAFNKGQKVPLINNNPGYEDYTSGHPTPLRRSTVSNDINLPMVESIEASSNGYVDDG
FT                   AGHKSLGHMFMPLGNTWNSGLSVWPLSKAVDWITRVNNACGAWTWNVATQDTNSKLADH
FT                   AITFMNDVTAKIISNGGTRCTVTIDPSGQALSDGTAITITNKLAEKLTFYYDLDVEASE
FT                   LTIATSGGSGDGDLYVKLGTAPTTADYDCRPFKNNNQETCLYSSPQAGRYHVMVDGSTV
FT                   TSGVSLIAKVTIAPKELVKGAAITIAGKLGSEQYYYYDLTTSPAKLIFQLSGGSGDADL
FT                   YVKYQAVPTSTIHDCGSSSKNNDEVCTFNAPEKGIYEVMVKASSAYSDMSLRFIKKK"
FT   CDS_pept        454009..454515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB-1"
FT                   /locus_tag="SVI_0380"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00351"
FT                   /db_xref="GOA:D4ZEX1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX1"
FT                   /protein_id="BAJ00351.1"
FT                   /translation="MIIFTTNLGDIEIELDFERAPVSAKNFLKYCEDGFYEGTIFHRVI
FT                   KGFMVQGGGMTVDLEEKPTRAAIVNEANRGLKNVKGTLAMARTDAPHSATGQFFINLGN
FT                   NDFLDHTGTTNDGWGYAVFGAVTSGMDVVRKMEKARTTSKMGHDDVPREPIIVEKVTIN
FT                   YPDKR"
FT   CDS_pept        454761..455549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0381"
FT                   /product="DSBA-like thioredoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00352"
FT                   /db_xref="GOA:D4ZEX2"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX2"
FT                   /protein_id="BAJ00352.1"
FT                   /translation="MKKILIPILIALGVSGCDAGKLDITDLNQDQKDQLGQIASDYLIQ
FT                   HPEFLIKASEKLNQQKKAEMAQHSTETAKAMVKQLTQDEKTPFIGPKDAKVSVIEFFDY
FT                   QCVFCAKITPIVNQLIQDNSDVKFVFKETPIFAQRWESSLYAAKMGQWIFEQKGSEAYA
FT                   SYHDNLFATGKNEGKLTKEDIDKQAQSAGVQVADFKMSELKADGINENFQLFSELGFQG
FT                   TPALIVMPTSNPSIENIKIIGGFDPEGLKAAIAAIKKNIS"
FT   CDS_pept        complement(455624..456541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0382"
FT                   /product="integral membrane domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00353"
FT                   /db_xref="GOA:D4ZEX3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX3"
FT                   /protein_id="BAJ00353.1"
FT                   /translation="MNILLAMIPAFFWGTTYAVTQFSLPDWPPLLLGALRALPAGLILL
FT                   AMKPNIPKKRDWGILFKLGSINIAAFFSLIFVMALTLPSAISGVGMISVPVFAMLAHWM
FT                   VSKTQPKTIQAIFGFLLIVLAWLLFDPGSISLNPLGMLAMLGAIICIIVGSSITKALGS
FT                   RIHWWSVLTWQLILGGGILAIAAGIQALISPEIYIEAFHSFNLTHGLGLLWIVILNTVL
FT                   GYTMYVWLLQRMTVVDFTFGGIANPIAGITAGMLLLGEVFTPHQYALMACMLLCSLMPQ
FT                   IIGLIGNRSTLNKEQRASSISDKR"
FT   CDS_pept        456771..457256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0383"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00354"
FT                   /db_xref="GOA:D4ZEX4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX4"
FT                   /protein_id="BAJ00354.1"
FT                   /translation="MDGLDRVVAQWGEEKPQLDTLPMELIGRLMRLSKHIESRVAECHK
FT                   AYDLKPGEFDVIATLRRSGGKYCLTPSELIDSMMLTSGAMTNRLSRLEDKGLIERVHSK
FT                   EDRRSVSVALTQQGVVLIDEAIEEHCKMQQILVASLSMADRPELNTLLTSWLAQFET"
FT   CDS_pept        457550..457681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00355"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX5"
FT                   /protein_id="BAJ00355.1"
FT                   /translation="MDSINVIGDNWVLPSSPDTDANLIALGQSEYVIFSEQLSWFFR"
FT   CDS_pept        457774..458604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0385"
FT                   /product="rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00356"
FT                   /db_xref="GOA:D4ZEX6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX6"
FT                   /protein_id="BAJ00356.1"
FT                   /translation="MVIQIGEVASRFIGLICISLMSVIIFTPLAFSADDIQFPLREKYP
FT                   KIPTISHQELYRQLDSTVLVDVRSKYEFDILHIKNAINISISNAGFITRLMKIREKDLR
FT                   AIVFYCNGITCVKSYKASDKAIKFGIKDVSTFDLGILGWTKAHPDAAVLLGESPVPLDK
FT                   LIDNKLRQAHLLTPDDFVGAIGKNTMVIDIREHFQRDVIILTKITRVASSDKILGLVKK
FT                   AKKDGLTLLIYDAVGKQTRWLQYLLEKEGLLEYYFMEGGLQGYLKADLPPSEYD"
FT   CDS_pept        complement(458813..459469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00357"
FT                   /db_xref="GOA:D4ZEX7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX7"
FT                   /protein_id="BAJ00357.1"
FT                   /translation="MGQTALVLGATGVVGRELVEQLSQSAYIDKLVAITRRPIEYDSNK
FT                   ITNCVVEFDRLEEYSSVFNADIIFSCLGTTLKQAGSIERQRQVDVDYQYLAAKLSHINR
FT                   VGHYLLVSSSGANPNSHSAYLSMKGELETKVIELGFQRLSIIQPSLLLGERTDVRLGEK
FT                   LGSKLLPLICRLPGLKKYRPITGKQVAAKMCDIASQEDTSGASKLQYYRLDELFS"
FT   CDS_pept        459572..459682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00358"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX8"
FT                   /protein_id="BAJ00358.1"
FT                   /translation="MSNNRLGDSREIPMLIIFKVSVGQYLARAYLVQLCD"
FT   CDS_pept        459915..460196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0388"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00359"
FT                   /db_xref="GOA:D4ZEX9"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEX9"
FT                   /protein_id="BAJ00359.1"
FT                   /translation="MLAVNEYFEGQVKSIGFQGKDKPASVGVMEPGDYEFGTGAPEVMI
FT                   VVSGALTVLLPGSDCWQTYHAGTQFDVAGDAKFQVKVETQTAYLCLYG"
FT   CDS_pept        complement(460299..460400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00360"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY0"
FT                   /protein_id="BAJ00360.1"
FT                   /translation="MSSASEHRQGSHHGLLSYATEHRTYTLDRLEVK"
FT   CDS_pept        460734..461603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00361"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY1"
FT                   /protein_id="BAJ00361.1"
FT                   /translation="MSIRRITDNQSQPQVNSGSLLKHSFNALWLSDIHLGSKDCKAEYL
FT                   LQFLRQTHTDSLYLVGDIIDIWAMKRRVYWPESHNQVLQQLLIMAKNGTKIIYVPGNHD
FT                   EPFKAYVGFNLWDVSIAKEHIHTTLGGHKILMLHGDQFDSQVCVGKALTRLGDRLYDLL
FT                   LVLNRLLHRIRTHLGYPYWSLASYIKLRVNKAQQAIGLFRAAVVSYAQDQEVDGVICGH
FT                   IHQPELSQQGKLFYANDGDWVENCTFIAESDRGELQLHKWDEQTNTSFVTASISLNNKC
FT                   KSLKQQVA"
FT   CDS_pept        461616..463376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0391"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00362"
FT                   /db_xref="GOA:D4ZEY2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY2"
FT                   /protein_id="BAJ00362.1"
FT                   /translation="MIFTVDNMVEKNLPKLNQTPWLAAPTKAILRYLLKEKECNDIAAE
FT                   YAYLKGVDFVEQILANFNFTYSVPSSEIENIPSEGRVVIYANHPIGSLDALALIKLISK
FT                   VRPDIKVVANELLMALEPLHSILLPVRNMTGGTPKEHLENIHQHLRGEGAVLIFPSGEV
FT                   SRLRPYGVTDLHWHSGFLKIAKACNSPLLPIYVDAKNSAAFYGASMIYKPLASLLLVKE
FT                   MFKQAKRTMPIRIGQLIPKEAVNSNDFPLKTKVKLLKSHLYRIGKNLSPLFTTQNAIAH
FT                   PESRSELQQALKACELLGETSDNKQIFLYQHSGSNPIMREVARLREVAFRAVGEGSGKR
FT                   RDTDKYDAYYQHIILWDREALELVGSYRFASVKQVHQQIGTESLYSQSLFRYSDEFNSY
FT                   FEQGLEMGRSFVQPKYWGKRSLDYLWMGIGAYLTKHPEIRYLFGPVSISDQLPEQAKEM
FT                   LVYFYQTQFKGGADLVRSNSPYTFTKARESQLAQWFDGLDYTLGFKVLKQTLASMNTAV
FT                   PTLYKQYGDLCDPGGVQFLDFGIDAEFGDCIDGLVLVDLQKLKHKKRSRYLDCHRSELN
FT                   VNSEDVIIVR"
FT   CDS_pept        463532..464743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0392"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00363"
FT                   /db_xref="GOA:D4ZEY3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY3"
FT                   /protein_id="BAJ00363.1"
FT                   /translation="MGEHIVILVIALVVLLYGYISKALSQKNISGPMMFTSFGLLLSPF
FT                   GFNITQVEVNAEFVTIIVEIALVLVLFADAALLDLNLLRKSWKIPARLLFIGLPITILA
FT                   GTYVGSLIFPDEPLIYLILLALLLTPTDAALGKAVVSDPNVPKKIRSSINVESGLNDGI
FT                   VFPLVLTVVAMISSGLTQAADSSWVGYVFEQIIFGALVGGAVGYLGTTITVKAVKNNWM
FT                   ESSYQNLIPIALAILSFYLAESLSGNGFIAAFFAGLYAGNTCEISRQHIEDFAETEGEL
FT                   FVLVSFFLFGLAFVPITLAHISLDVVLYAFLSLTVLRMLPVIISLIGAKLDLSTMFFIA
FT                   WFGPRGIASILYVLIVAHEMGSIDGFETVYSVVTVTVLMSIFAHGLTAQPLANWYAKSH
FT                   REDN"
FT   CDS_pept        464974..465135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00364"
FT                   /db_xref="GOA:D4ZEY4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY4"
FT                   /protein_id="BAJ00364.1"
FT                   /translation="MARKKQAVLTDSEQEIMEILWCVKEVEVRDITDELSKSKVVAHNS
FT                   VQTMFEPR"
FT   CDS_pept        465208..465582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00365"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY5"
FT                   /protein_id="BAJ00365.1"
FT                   /translation="MCQCFPQFDSQDPAINVLRHKIRHGEEVDNPSLVLIWFSMELTLM
FT                   GACKHAAWSLHVAEYRLLLDTLADDMLEGHWRLWCLDNIYKPLCALSRLVDSDSQKQEL
FT                   EQLFYELRVTSQFFQSGLAH"
FT   CDS_pept        465620..466996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumC"
FT                   /locus_tag="SVI_0395"
FT                   /product="Fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00366"
FT                   /db_xref="GOA:D4ZEY6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY6"
FT                   /protein_id="BAJ00366.1"
FT                   /translation="MTTRIERDSMGELEVPASALYGAQTQRAVNNFPISGKRMPEAFIR
FT                   ALLLAKSAAAQANAKLKLLPQDMADGISDAVSQLLDDKAMMQHFPVDVFQTGSGTSSNM
FT                   NANEVLATMASKIANQTVGANDHVNYGQSSNDIIPSCIHISAAMELDNCLLPALDHLVK
FT                   VIKHKAAEVDHHIKTGRTHLMDAMPVRMSQSLLSWASQIEQNIDLIHGIKPRLQSLAQG
FT                   GTAVGTGINAHADFAAEFNHQLSQATGLTFTPASNFFSHIGTQDIAVSLSGQLKAVAVS
FT                   MMKIANDLRWMNSGPLAGLGEIELQALQPGSSIMPGKVNPVIPEAATMVAAQVIGNDSA
FT                   ITVGGQAGNFELNVMLPMIADNLLSSISLLANVSYLLADKAIATFKVNEAQLQKALARN
FT                   PILVTALNPIIGYEKAAEIAKKSYKEGRAVLDVAEEETNIPREELEKLLDPAKLTLGGL
FT                   "
FT   CDS_pept        complement(467048..467875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0396"
FT                   /product="PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00367"
FT                   /db_xref="GOA:D4ZEY7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY7"
FT                   /protein_id="BAJ00367.1"
FT                   /translation="MLPTHELNRVEASKQPHGSVINTSFLSVLLLLFIFHILTLNAQTN
FT                   LDTFNWFNELGASLPSWLLLSVTDLGDGITAGALILICLTYKPQWLYRVIVTTLLCAIC
FT                   VHIFKQYFDAPRPAALLEVINIIGKARYEHAFPSGHTTTAFALAGVIWLLADKLWCKLS
FT                   VLMLAVAVGLSRIAVGAHWPEDIAFGAILGWLLAYLACSAAPLSTLRLKYQYWIIFALS
FT                   MIVLVSELKNLGKDPFSVLLLNRYLIITALISLTVYMCSKFQFKDKQTQIRES"
FT   CDS_pept        468128..468289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00368"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY8"
FT                   /protein_id="BAJ00368.1"
FT                   /translation="MGGDKFCDLYKIPELINVNTQKGGGNIGCGVLLADATSVINFIFT
FT                   LVGSKNAG"
FT   CDS_pept        complement(468286..469371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00369"
FT                   /db_xref="GOA:D4ZEY9"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEY9"
FT                   /protein_id="BAJ00369.1"
FT                   /translation="MALNFAIIARQRLPSINISHLNELFTMSISTLLATAFEKRQDLLV
FT                   QAKKNNTDCYRVFHGTVEGINGLNIDRYGQAWLIQSFHQTLTADELKEISESLTKVEDL
FT                   AIIYNDRADKNSRVMNTLDVITHDFANQAQVMHENGIKFTSKLRHEGQDPLLFLDMRAG
FT                   REFVKANSLNKTVLNLFSYTCGIGTAAAVGGASRVVNIDFSSFALAAGKTNAELNDVSD
FT                   VCEFVQSDAFPALRQLAGLKVGGRRNQKLPKYPKMPRTQFDLVFLDPPRFAKSPFGIVD
FT                   LINDYQSLFKPALLTTKPGGSIVCCNNVAKVERNAWFDALVRCVEKQGRLVTSHTWLDC
FT                   HQDFPSFDGNHPLKMVSLVIS"
FT   CDS_pept        469413..470009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00370"
FT                   /db_xref="GOA:D4ZEZ0"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ0"
FT                   /protein_id="BAJ00370.1"
FT                   /translation="MTRIQRKPKLVLVHGIFNTGSVMTWMRKQFESQGFECFTPTLKPF
FT                   DGRYGVEYAAKSLKSQIEHEYGENQNIVIIGFSMGGIVARYYLQNLDGYARTSHLFTIS
FT                   SPHAGSYMAYLPYPSKAMKQLRPDSELLQSLDESADRLNGLKLYSYRTSIDCTIVPSTS
FT                   SHWELAENKKFFVALHLSMVFSSQLTNEILARLNE"
FT   CDS_pept        complement(470210..470935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00371"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ1"
FT                   /protein_id="BAJ00371.1"
FT                   /translation="MMTKAPQLFSTLPPQEVIVKRVPIETQAGAAGGSYIPPALDASRP
FT                   GVFFINLKDMTSISKYSLKTLTYHEAVPGHHFQIALNMLQTDIGLMRQNASFNAYIEGW
FT                   ALYSELLASEMGMYENDPWGNLGRLKAEAYRAARLVVDTGLHHKKWTRQHAIEYFAEAT
FT                   GSTQKEVTSAIDRYIAWPGQALGYKLGMLKLVELRAKAQQALGEQFDIRAFHDLILLPG
FT                   ARPMSVVQADVEQWIKAQT"
FT   CDS_pept        complement(470932..472095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00372"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ2"
FT                   /protein_id="BAJ00372.1"
FT                   /translation="MFTKSLIGLSVLVALFGCTNDQTEATPNTIKTSDKLVKTPEVDIN
FT                   KRANIDLKVAQFTQDFIQAEPALATSLNLSSDIGGDFQQRLPDYSPAGMQALQQKMQHW
FT                   ASELASIDTANLSDDDKRHVVVNQVIASYYAGDRTFNAGYIDTWAGHLPYIVNQISGPL
FT                   IDIPAILTDQQTISNLSDAQDYLSRLSALAEMTLQVKAKVEADATNGVILPKPLFTNTL
FT                   KYLANFVAKPASEHALVTSFEEKLTNTAKINDKHRQDLVAQATKLVGEKIYPAYRKVSL
FT                   LMTSLEQKAPTDVGIWAQPNGESFYQHDITYLADSDLSADEIHQLGIEEVNRITSEMDS
FT                   ILKANGYDKGSVGERMIQLSSEPRFLYQNSDAGRQQLLRILVKISLW"
FT   CDS_pept        472285..472968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00373"
FT                   /db_xref="GOA:D4ZEZ3"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ3"
FT                   /protein_id="BAJ00373.1"
FT                   /translation="MLNKIQVKMTKDGSHTLMSSLFDDSYHAHNGAMSESEHVYIQSGF
FT                   EQLKPEFKGVNILELGFGSGMNAILTLKSALAKTGKLVRPIRFTSIEAYPIPMEIVAQL
FT                   NYKASFSPQIAELFDKLHQAPWDRDVELIPGFVLHKVYGKLQEFRTGDDSINLVFYDAF
FT                   TPSKQPELWLQDNFDRLMPMMQVGGMLVTYCANGQFKRNLKAAGFKVKAYPGVLGRREM
FT                   TRAWK"
FT   CDS_pept        473015..473107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00374"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ4"
FT                   /protein_id="BAJ00374.1"
FT                   /translation="MLLANNGQFKRNLKAAGFKVKAYSGHVFSD"
FT   CDS_pept        complement(473162..473263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00375"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ5"
FT                   /protein_id="BAJ00375.1"
FT                   /translation="MLQTNKAGAYLDTIYRVNSPLFASSTSIFHFKL"
FT   CDS_pept        473371..474960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00376"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ6"
FT                   /protein_id="BAJ00376.1"
FT                   /translation="MEKIISRFFRLSVLAALSAVVVPVMAMASFGVNAASQNSAVTLES
FT                   HSVEVSFKLTHPILPANLLSASGKELITFGVDDFQQKWLSVFTFDKLKGKYSESLKVKL
FT                   PDELSSFDLTGRDKDNSSTDANTNANEIQQLMFLSSKHLIRFVPSDKSNPFQIVAEISS
FT                   MSLKHRPDYISDSDFIRDLNGDGLDDIIISDFERVEIFIAQTDGSYHRQQLPIKPQIRL
FT                   YNDGAHYTHSAIYSADINLDGKLDIVKIGEGELEVYRQDESGNFDPIAKYSSVRLAISG
FT                   LDWWNKRDAFGEQLDQSDLIYRKVEELKDINNDGLADMVVRYTKSSGVLDRVNDYEIYL
FT                   GENTEGQLTFPKKPNSVIRADGTLTDLEFIDIDGDNKDEVLVVGFDIGLSQIIGALISG
FT                   SIDQDVYLFKMDGNSQFSDDANISKEVELSFSLTSGQSGTPVVKLADINGDGLQDLLLS
FT                   DGDDSLQIFLGSDSDSLFVKRGEKISVQLPQDGGMVSSEDLNGDGKDDLLIKYGQQDAE
FT                   SLQTKFRVILSG"
FT   CDS_pept        complement(475006..476295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0406"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00377"
FT                   /db_xref="GOA:D4ZEZ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ7"
FT                   /protein_id="BAJ00377.1"
FT                   /translation="MKVPKLGNSTAQSLTKKLSLYFNGIALLIGILFFAFSQAGLYWLE
FT                   DEINKRVLQQTADYAISQFQQGARSPLIIGPNILAYDSAEAFPEKFLPLTLYPVGYNDE
FT                   VTDDIAHDLFFHYSSFDLDGETSPLFLTLAADKIELSSDDWRYINFASLAIMILLYLAF
FT                   DFAISKLSKRLVQPVNQLSQQLKSAQRKTSFSVPEGSALEFTELSNSLNKYRNQSELLI
FT                   QQEQSFAKYASHELRTPLTVILGATKLLDKSAEPDFQLRQRDRIAKAATNMQHTIEALL
FT                   SLVKQEQTRENSSSRKLTESEIKLILEEVSPLAKYKHLKVELKIFAEPEIQPSAPVLRM
FT                   LLINLLQNAINASDSGVITLEIWDTCIKVLDQGRGLNDAEQSKDGHGLGLLIVDALCKR
FT                   YGWQLSLTAGEFSGCIAQLDFACHEDESSS"
FT   CDS_pept        complement(476282..476989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0407"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00378"
FT                   /db_xref="GOA:D4ZEZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ8"
FT                   /protein_id="BAJ00378.1"
FT                   /translation="MRSKLLIVEDNQDVAGILADYFEVQGTEVDFATNGELGFKLALES
FT                   NFDAIILDLMLPKMDGLSVAKELRKQGCTTPILMLTALDDKQDLLNGFESGADDYLAKP
FT                   FDLDVLNARITALIKRQQGKVALGTLKYACLELNTAEHQVYRNGTKLILTPTCYQILQL
FT                   LMKRAPHVVKREELIEEVWGDMPPGSDILRSHMYQLRNQLDKPFPESILVTVPKIGFKL
FT                   QQQTLDSDSNESP"
FT   CDS_pept        477252..477914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0408"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00379"
FT                   /db_xref="GOA:D4ZEZ9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZEZ9"
FT                   /protein_id="BAJ00379.1"
FT                   /translation="MNKLVLSVAVLATSILVAGCQTTNPYTNEGQNAKATNGTIIGAIA
FT                   GAAIGVASSSKSDRGKGALIGAASGAALGGGIGYYMDVQEAELRKQLRSTGVSVTRSGD
FT                   NIVLNMPNEVTFGVDEVHLNPGAKNVLNSVALVAKEYDNTQINILGYTDSSGSESYNLR
FT                   LSKVRAVEVADYLISQKVEYARVRSEGIGEARPIASNSTAQGRTQNRRVEIILSPLR"
FT   CDS_pept        complement(478079..479440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="SVI_0409"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00380"
FT                   /db_xref="GOA:D4ZF00"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF00"
FT                   /protein_id="BAJ00380.1"
FT                   /translation="MPREVLDSETTDQRLNRLTQALGSGMFVHVRNMLHDMAASDVAFI
FT                   LESSPPRTRQVLWQLIDLDHTGEILDELGEELKDNLIKQMTPERVAKAAAGMDTDDLAY
FT                   ILRSLPDSVFNKVLQSMSSQDRTRVEQALSYPDDTAGSIMNTDTVTLRPDVNIDVILRY
FT                   LRIRGELPEATDTLYVVDKHDNLLGGVRISDLLTCNPDASVRDIMASDLEGIPVGMNDS
FT                   EVAQLFERHDWISAPVIGKDNQLLGRITIDDVVDIIREDAEHSMMGMAGMDDDSDTFGP
FT                   VLKSTLQRSLWLTINLFAALLAASVTNMFEGTLEQFATIAILMTIVPSMGGVAGNQTLA
FT                   LVIRGIALGQIGQSNSRWLIGKELAIGFLNGLLWSVLVFVAVWLWKGDVALGALIGGAM
FT                   LINMTVAGFAGACIPLLLKKMNIDPALAGGMVLTTVTDVIGLFAFLGLATFFLL"
FT   CDS_pept        complement(479551..479826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsO"
FT                   /locus_tag="SVI_0410"
FT                   /product="phosphocarrier protein NPr"
FT                   /note="Nitrogen related HPr"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00381"
FT                   /db_xref="GOA:Q9S0K8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S0K8"
FT                   /protein_id="BAJ00381.1"
FT                   /translation="MTKLERQVTICNKLGLHARAATKLAILASEFDAEITIVQGEKKAS
FT                   AASVLGLLMLETGMGKTITLLGKGQDADAALDAICALVDAKFDEAS"
FT   CDS_pept        complement(479819..480667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00382"
FT                   /db_xref="GOA:D4ZF02"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF02"
FT                   /protein_id="BAJ00382.1"
FT                   /translation="MKLVMVSGRSGSGKSVVLRVLEDLGYYCVDNLPLPLMDTLLEQLK
FT                   GSTDLVAISVDVRNMPEQDKEFLKQLANLPKGTELLSFFLDSSDEVLLKRYSETRRLHP
FT                   LSRTKTSLKEAIEHERELLEPVSKMVDHYIDTSNLNIYDLSDKIREILLGSVDKELVIN
FT                   FESFGFKYGMPVEADFMFDVRFLPNPHWEPELRPMTGLDEPVQLFLSQQPTVNKFIWQI
FT                   ENLLATWLPHLERNNRSYLTIAIGCTGGQHRSVYVTEQLAKLFANSKHKIQARHRELSD
FT                   D"
FT   CDS_pept        complement(480664..481107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsN"
FT                   /locus_tag="SVI_0412"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00383"
FT                   /db_xref="GOA:D4ZF03"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF03"
FT                   /protein_id="BAJ00383.1"
FT                   /translation="MELSSILQPECTTCATPGSKKKVLELISDLAAVQYPTLSSQEIFE
FT                   SLLAREKMGSTGIGNGIAIPHGRLSNISQPVAVLIKCEEPISFDAIDKQPVDILFALLV
FT                   PADQCEQHLSTLSSMAEKLNNKLIVKQLRKTQDESELYQVITQ"
FT   CDS_pept        complement(481111..481398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfiA-1"
FT                   /locus_tag="SVI_0413"
FT                   /product="ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00384"
FT                   /db_xref="GOA:D4ZF04"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF04"
FT                   /protein_id="BAJ00384.1"
FT                   /translation="MHINLTGHHIEITTSLRHYVEEKFTKLERHFDQINNVHVILNVQK
FT                   MQQKAEAKLHLAGGEVFAMSENADMYAAIDSLIDKLDRQVIKHKEKLTKH"
FT   CDS_pept        complement(481624..483102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="SVI_0414"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00385"
FT                   /db_xref="GOA:Q9S0L2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S0L2"
FT                   /protein_id="BAJ00385.1"
FT                   /translation="MKASLQLKMGQQLTMTPQLQQAIRLLQLSSLELQQEIQQALDSNP
FT                   LLELDEEQVDPPVNGEDKTVDTEDFSATAESDGPIDNSAVETSEAITRDSMPEELPMDT
FT                   TWDEVYTASPNSTSGAMRDDDMPFQGETSEGLYEHLEWQKNLTPFSDNDLAIATAIIEA
FT                   IDERGYLTQSIEDILEAMGDPEIEQDEIEAVLKRIQHFDPIGIAARDLSECLLIQLAQY
FT                   ADTTPHIDNARILIRDHLDLIAGRDFRLLMRKTKLKEDALRDAIELIQTLNPRPGLAVT
FT                   PGKDEYVIPDVTVTKKKGRWMVELNPDNMPKISVNQHYASMAKSTKSQADSQFIRGHLQ
FT                   EAKWFIKSLESRNETLLKVSKCIVKFQQGFFEFGEEAMKPMVLNDIAEAVEMHESTISR
FT                   VTTQKYMHTPRGIFELKYFFSSHVATDDGGECSSTAIRAFIKKLVAAENQQKPLSDSKM
FT                   ALLLADQGIKVARRTIAKYREAMLIPPSNQRKSL"
FT   CDS_pept        complement(483254..483976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0415"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00386"
FT                   /db_xref="GOA:D4ZF06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF06"
FT                   /protein_id="BAJ00386.1"
FT                   /translation="MTLKAVNLAKSYKSRAVVQDVSITVKTGQIVGLLGPNGAGKTTTF
FT                   YMIVGLVQSDKGRILIDDDDLTLDPMHLRARKGIGYLPQEASIFRKLSVRDNIMAVLQT
FT                   RSDIDNNAREEQLENLLEEFNITHIRDSQGMALSGGERRRVEIARALAANPKFILLDEP
FT                   FAGVDPISVIDIKKIIQQLKSRGLGVLITDHNVRETLDVCERAYIVSHGNLIAEGTPAE
FT                   IMDNQQVRAVYLGEQFKL"
FT   CDS_pept        complement(483982..484635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00387"
FT                   /db_xref="GOA:D4ZF07"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF07"
FT                   /protein_id="BAJ00387.1"
FT                   /translation="MKDDMNKHNLIIAALLCVTSFSGIAKQNDLMQEVKISASSQEADI
FT                   KNNQMIFHGPVEVTQGSIKILADELRATSKEDGGGKILVAIGNPATYSQIMEDGRPASA
FT                   SAKEIRYELSSRTLTLLGNATLEQDASRVTGNMIRYNIAKQQLIAESKGNDRVITIIQP
FT                   ESYQDTSQDKAKQPPAAKKLPTELPEIEQDKTNNQANKQDAMPALLPIIGQEKQ"
FT   CDS_pept        complement(484727..485284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0417"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00388"
FT                   /db_xref="GOA:D4ZF08"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF08"
FT                   /protein_id="BAJ00388.1"
FT                   /translation="MNRVTLGIIAFFGTALLLYWQVQSKKNDQGVAFDASLRPDYIADD
FT                   LRSVDYNELGLVSSRVTATHMEHFDEANMTYFTKPIYLVYPNGGQAKWRLQSTMGTLDK
FT                   KSGKVVLENDVIIDSVNAEEPIQTMKTSYLELDLNTMIMTSDREVYITGNDFMIQGMGL
FT                   FGDLKAQKVQLLSKVKGVYEVN"
FT   CDS_pept        complement(485281..485838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00389"
FT                   /db_xref="GOA:D4ZF09"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF09"
FT                   /protein_id="BAJ00389.1"
FT                   /translation="MNESHQSFYGPVTDKVWQKAKQIKLLICDVDGVFSDGLVYMSNGG
FT                   EELKTFHTRDGYGVRSLLTSDIPVAIITGRKSQIVEDRMTALGIEHIYQGVDNKLMPYQ
FT                   ALLSLYDVTPEQVAYIGDDMVDLPVMKQVGLSVCVADGHPYVKQAADFVTSIKGGHGAL
FT                   RELTDLLLLSQEKFDTAHGMSI"
FT   CDS_pept        complement(485840..486817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0419"
FT                   /product="carbohydrate isomerase, KpsF/GutQ family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00390"
FT                   /db_xref="GOA:D4ZF10"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF10"
FT                   /protein_id="BAJ00390.1"
FT                   /translation="MLDVNKLRQWGKKVIDVERKALDNLYQYVDSAEFAAACKLIFECT
FT                   GKVIVMGMGKSGHIGNKISATFASTGTPAFFVHPGEASHGDLGVLSEDDIILAISNSGE
FT                   ASEILTLMPVIKRMGLPIIALTGNPESTMAKHAVVHLCIEVPEEACPLGLAPTSSTTAT
FT                   LVMGDALAVALLQARGFTRDDFALSHPGGMLGRKLLLKVSDVMHKGSELPLVRHNICVT
FT                   DALYEISNKGLGMTAVTDDDNKLVGIFTDGDLRRVIDAQVNLRETSISDVMSKACTTIS
FT                   EGILAAEALKVMDEKDINGLIIVDDNNTPIGALNMLDMVKAGVI"
FT   CDS_pept        complement(486856..487815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0420"
FT                   /product="K+-dependent Na+/Ca+ exchanger related-protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00391"
FT                   /db_xref="GOA:D4ZF11"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF11"
FT                   /protein_id="BAJ00391.1"
FT                   /translation="MLFNIFMLIAGLSVLVWSADKFVYGASAFARNLGLPPMLIGLTIV
FT                   AMGSSAPEMFVAVTASMEGMTDTAIGNVLGSNIANITLILGITALLGAISVRSQTLLRE
FT                   IPLMLAATAIAGYFLHDGMLTRTEGVTLMGLFFILMGYLIWHGLTSKQVDTLEDEADKE
FT                   IPKGVPTHKAVFWLIAGIILLPLSADWMVQGAVGIAKAYHLSDLVIGLTIIAIGTSLPE
FT                   LAACVAGVLKKEHDLAIGNIVGSNLFNILAVLALPGIIAPGEVDAAASTRDFYMVMATS
FT                   SALVILILLSGRARALKPWHGGVLLLTFISYQLVLFLA"
FT   CDS_pept        487863..488000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00392"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF12"
FT                   /protein_id="BAJ00392.1"
FT                   /translation="MKMKVLRQDKCRFSCAYKRNYVQFAAQFLSDLSVFPWCLYLMDAV
FT                   "
FT   CDS_pept        487997..488815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0422"
FT                   /product="ABC transporter, ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00393"
FT                   /db_xref="GOA:D4ZF13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF13"
FT                   /protein_id="BAJ00393.1"
FT                   /translation="MNIEVSPKPKSLVEIRNLKFSRGDHVIFDDISLSIPKGKITAIMG
FT                   PSGIGKTTLLKLIGGQLTPDSGSVFFDGKNVHKCSRKELFTLRKRMSMLFQSGALFSDI
FT                   NVFDNVAFALREHSGLAEEIIARIVLMKLEAVGLRGTAKMMPSELSGGMQRRVALARAI
FT                   ALEPDMVMYDEPFAGQDPISMGVLVKLIKELSSALGLTSVVISHDVQEVLGIADYVYVM
FT                   ANKRVIAQGTPEELRVADNELLKQFIGGEPDGPVPFHFPASNYAEELVGQ"
FT   CDS_pept        488880..489656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00394"
FT                   /db_xref="GOA:D4ZF14"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF14"
FT                   /protein_id="BAJ00394.1"
FT                   /translation="MPDSLANLGRGGIDLVTGLGRAGLMLWGAVVRKPRLKGFSLFVKQ
FT                   LYVVGVQSMVLILISGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLRELGPVVTAL
FT                   LFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVVSLPLLTLMFTAV
FT                   GIYGGHLVGVEWKGIDSGSFWSILQASVEWRQDIVNCLIKSFLFGIVVTWIALYRGYQV
FT                   TPNPEGISKATTQTVVQSSLAVLALDFLLTALMFGR"
FT   CDS_pept        489712..490176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0424"
FT                   /product="mce-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00395"
FT                   /db_xref="GOA:D4ZF15"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF15"
FT                   /protein_id="BAJ00395.1"
FT                   /translation="MLTRKIEVLVGVFLLSGLAAFLILVFNVANVEVRSGANNYTLYAK
FT                   FSNIGGLKVRSPVKVGGVVVGRVSAITLDPTELVPVVKLSMDKHFDQFPETSSLSILTS
FT                   GLLGEQFLGLTPGFMDDDISMLVDGDRVHDTHSALVLEELIGQFLYSVKD"
FT   CDS_pept        490269..490925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0425"
FT                   /product="toluene tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00396"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF16"
FT                   /protein_id="BAJ00396.1"
FT                   /translation="MFNCICKYTASLLLLVLSATAHSEDSVVNTMNPYDMVEAVANNTF
FT                   ARFHQDIDIIKANPDHLKLIVSDELMPYIDYKYASYKVMGTHLKATTKEQRQRFVIAFQ
FT                   GYLVSTYAQAFTEYTDQKVRFSPGKDFTGEKMVDVNVELIEAGRPAIKLMFKVRRLKDG
FT                   SWKAFDLVAEGVSLLASKSSEISNLIRQKGIESVILELEQRNKGHVSQKSNGVKL"
FT   CDS_pept        490926..491228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0426"
FT                   /product="SpoIIAA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00397"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF17"
FT                   /protein_id="BAJ00397.1"
FT                   /translation="MLEFICQDSVCCISGRLSQGDVVKLWGKRKRLLSDNIKVIDLSAL
FT                   TYSDSAGIAFILELIALSKQQGREITLSSASSQLSKLIGLYDLEHFFDEEVKKGK"
FT   CDS_pept        491233..491520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0427"
FT                   /product="BolA/YrbA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00398"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF18"
FT                   /protein_id="BAJ00398.1"
FT                   /translation="MDTNETELANEAAKLKEIEQLLQDALSLDEVHVTQAGTHYKIVAI
FT                   GECFDGMGRVKQQQTIYGPLMERITSGELHALTINAFTPTQWKREKIFNM"
FT   CDS_pept        491534..492802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="SVI_0428"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00399"
FT                   /db_xref="GOA:D4ZF19"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF19"
FT                   /protein_id="BAJ00399.1"
FT                   /translation="MDKLKIQASKALAGEVVISGAKNAALPILMAGVLAETDFVISNVP
FT                   DLRDVNTSCELLRCLGAEVSRTDNSEVRISTTSLDNFCAPYDLVKTMRASILILGPLLA
FT                   RFGTADVSLPGGCAIGARPVNLHLHGLEQMGAKIEVKEGYIKARVDGRLKGAHIFMDMV
FT                   SVGATENLLMAASLADGETIIENAAREPEVVDLANCLIAMGAKIEGAGTDSIRIQGVES
FT                   LQGCHYRVMPDRIETGSFLIAAAVTRGKIRCVKADPKTLEAVLAKLEDAGAKITTGNDW
FT                   IELDMQGQRPKAVNIKTVPYPGFPTDMQAQFCLLNALAEGTSTITETIFENRFMHVPEL
FT                   IRMGANMELEGNTCIIQGIERLNGAQVMATDLRASASLVIAGLVADGTTIVDRIYHLDR
FT                   GYEHIEEKFRGLGGQVERTREPV"
FT   CDS_pept        complement(492951..494033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degS"
FT                   /locus_tag="SVI_0429"
FT                   /product="protease DegS"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00400"
FT                   /db_xref="GOA:D4ZF20"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF20"
FT                   /protein_id="BAJ00400.1"
FT                   /translation="MALKDTLLYLGKAVFFGLIMAAVFLVVTPFLANRDVTSLFFQKRG
FT                   DDGVELSFSMAVRRAAPAVVNIYSLSVNRDKPLNSSTLQGLGSGVIMSGEGYILTNYHV
FT                   IKKADEIVVALQDGRKFTSEVVGSDPITDLTVLKIEGDSLPIVPINLGVPAQVGDVVLA
FT                   IGNPYNLGQTITQGIISATGRNGLSSGYLDFLQTDAAINAGNSGGALIDTSGHLIGINT
FT                   AAFQVGEEGGGHGINFAIPIKLAHSIMGKLIKNGRVIRGALGISGEPISPVMAQILNLP
FT                   DLTGVVITAVDPNGPAAQAQLQPRDVIIKYQGEDIPGVEMLMDRIAETPPGKHISMTII
FT                   RKGKPYDVPVLIGENTNIPE"
FT   CDS_pept        complement(494207..495559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0430"
FT                   /product="serine protease, HtrA/DegQ/DegS family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00401"
FT                   /db_xref="GOA:D4ZF21"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF21"
FT                   /protein_id="BAJ00401.1"
FT                   /translation="MKSKLSLLSAALLTASLSLAPSLSQAAIPMAAEGQSIPSLAPMLV
FT                   RTTPAVVAVAVTGTHISKQKLPDAFRYFFGPNAPREQVQERPFRGLGSGVIIDAAKGYI
FT                   VTNNHVIDGADEILIGLHDGREVEAKLIGTDSEADIALLQIKADNLVAIKRADSDKLRV
FT                   GDFAVAIGNPFGLGQTVTSGIVSAMGRSGLGIEMLENFIQTDAAINSGNSGGALVNLNG
FT                   DLIGINTAIVAPGGGNVGIGFAIPSNMVSNLVDQLIEHGEVRRGVLGVTGRDLTNELAK
FT                   GFGLNTQHGGFVDQVMDDSAADKAGIKAGDIIVSVNGRNIKSFQELRAKVGTMGAGAEV
FT                   KFGLIRDGNKRTVTATLGETSQTTETAAGAIHPMLTGAALENSQQGVEITDVAQNSPAA
FT                   ASGLQKGDLIVGVNRSQIKNLKSLKAKLADQQGTVALKIKRDKSNLYLVLR"
FT   CDS_pept        complement(495705..496136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00402"
FT                   /db_xref="GOA:D4ZF22"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZF22"
FT                   /protein_id="BAJ00402.1"
FT                   /translation="MPAIIVYSNFSVPAVKEFYMEWPLIIASLVLGILLGYVGHTILAR
FT                   NSESDGKGKAHEQTKLELSQHKQEVTDHFELHHKQLAELTEQLNKVNKQWNEAANSLAP
FT                   KSKAKPLASLVGNETNHDTISVQDDELDSENVIIVNQNN"
FT   CDS_pept        496182..497288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0432"
FT                   /product="AFG1-like ATPase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00403"
FT                   /db_xref="GOA:D4ZFF4"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF4"
FT                   /protein_id="BAJ00403.1"
FT                   /translation="MSQLTPWQHYQQDLTRDEFSYDPAQEQAVKSLQRVFDEIQLISSK
FT                   PTLVKKVFSLLGAKQQTVQGLYLWGGVGRGKTYLMDTFYDALPGERKLRAHFHRFMHQV
FT                   HLDLDNLKGQRDPLLTIAKQMAEKYQVICFDEFFVSDITDAMLLGTLFQALFKEGVALV
FT                   ATSNIIPDELYRNGLQRARFLPAIALINQHCQILNVDSGIDYRLRTLEQAEIYHFPLDV
FT                   KADTNLLSYFDRLAPESEVSLDGIEVDGRNISIRKQAQGVLLLDFLALCDGPRSQRDYM
FT                   ELACLYHTVLLSGVKQMGDKLTGDDIARRFLAMVDEFYERNVKLIISAEVSLEDIYTEG
FT                   LLSFEFRRCRSRLTEMQSHDYLALEHLP"
FT   CDS_pept        497539..497970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SVI_0433"
FT                   /product="ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00404"
FT                   /db_xref="GOA:D4ZFF5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF5"
FT                   /protein_id="BAJ00404.1"
FT                   /translation="MKTTFTATPETVTREWFVVDAEGKTLGRIATEIASRLRGKHKPEY
FT                   TPHVDTGDYIIVINAEKVTVTGNKAKGKVYYSHSGFIGGIKQITFEKLQAHKPEMIIEK
FT                   AVKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQPQVLDI"
FT   CDS_pept        497985..498377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SVI_0434"
FT                   /product="ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00405"
FT                   /db_xref="GOA:D4ZFF6"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF6"
FT                   /protein_id="BAJ00405.1"
FT                   /translation="MAATQYYGTGRRKTSTARVFAKAGTGNIVVNQLPLDQYFGRETAR
FT                   MVVRQPLELVEMTDKLDIYVTVKGGGITGQAGAIRHGITRALLELDEALRPSLRAAGFV
FT                   TRDARKVERKKVGLRKSRKKPQFSKR"
FT   CDS_pept        498517..498705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00406"
FT                   /db_xref="GOA:D4ZFF7"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF7"
FT                   /protein_id="BAJ00406.1"
FT                   /translation="MSLQLIMLALGIVLVIEGIGPLLFPNRWRAYLKEISNQNQQLLQR
FT                   LGGGLVTAGIVLLIIFS"
FT   CDS_pept        498772..500067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="SVI_0436"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00407"
FT                   /db_xref="GOA:D4ZFF8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF8"
FT                   /protein_id="BAJ00407.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTEQAKYVVRYQGGHNAGHTLV
FT                   IDGEKTILHLIPSGILRDNVKCIIGNGVVLAPDALMTEINMLKERGVPVEERLLISEAC
FT                   PLILPFHCALDVAREKARGNNAIGTTGRGIGPAYEDKVSRRGLRVGDLFDAELFAEKLK
FT                   EVMSYHNFMLTEYYKCEAVDYEKTLKDALAIADYLKSMCTDVSQLLDTARKAGEPILFE
FT                   GAQGTLLDIDHGTYPFVTSSNTTAGGVATGSGFGPRHLDYVLGIMKAYTTRVGAGPFPT
FT                   ELECEIGDYLGTKGHEFGATTGRKRRPGWLDIVAMKRAVQINSVSGFCLTKLDVLDGLK
FT                   EVKICVGYQYPDGSVATVTPLAAEGYEKVTPVLETLPGWSETTFGATSLEQLPQAALNY
FT                   IKRLEDLLETPIDIISTGPDRNETMILVNPFS"
FT   CDS_pept        500332..500943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motX"
FT                   /locus_tag="SVI_0437"
FT                   /product="sodium-type flagellar protein MotX"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00408"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFF9"
FT                   /protein_id="BAJ00408.1"
FT                   /translation="MLSIVTLTPALCWAETETQAVDIYSQEQLIELIRTKQYLTRVTGD
FT                   DCQLVQDIEARAEVLKQPLYQYLWAEMLNHGICVKANPPRGISLLRDSAEQGSAEAMLR
FT                   IAEYYHDGHFVIQDRERAIHYVMPAAANGDLPSRMMLVRLFGEGYGSPRDFELGYHWLY
FT                   NDVFSDEATKEQALKLLKVLEQKMPPSAVARAKQEHLRSR"
FT   CDS_pept        501012..503501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="SVI_0438"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00409"
FT                   /db_xref="GOA:D4ZFG0"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG0"
FT                   /protein_id="BAJ00409.1"
FT                   /translation="MIKDPHLKREQDNYENPIPSREFILEYLRSETSPLNRERIAQALK
FT                   LEGEEQLEALRRRLRAMERDGQLVFTRGQAYGLPERMDLLTGTIIGHRDGFGFLKLEGG
FT                   GDDLFINNRDMMMYFHGDKVLAQKAGVDRKGRREARIVRLVEQRAAALVGRFHLDSGMA
FT                   FVIADDRRIGQEILIADEDRNGARQGDVVVLELTRRPGRYVKAAGKVTEVLGKQLAPGM
FT                   EIEIALRNYDLPHTWSSLIEKKLRAIPDEVTEDDKEGRVDLRHLPLVTIDGEDARDFDD
FT                   AVYAEAKKSGGWRLWVAIADVSHYVRTESALDKEARARGNSVYFPSQVIPMLPEKISNG
FT                   LCSLMPEVDRLCMVAEMTISAAGKLSGYKFYPAVMHSHARLTYTQVADMLEGGEVSDKL
FT                   KPIFPHLQTLQSLYLTLDVTRAQRGAIAFETTETQFVFNAERKIDSIVPRNRNQAHKII
FT                   EECMILANVASAKFVKKHKGEVLYRVHESPSEQKLTNFKDFLKERGLTMGGGLQPTPTD
FT                   YQALMESITERPDAELIQIMLLRSMKQAVYTPDNEGHFGLALEAYSHFTSPIRRYPDLI
FT                   LHRVIRFLLAKEQAETTEKWTPGGGYNYQLEELDLLGVECSTTERRADEATRDVSDWLK
FT                   CEFMQDHVGDTFDAVVASVTHFGMFVRLNKLFIDGLVHISSLGSDYYQYDNMRQRLVGE
FT                   SSGQVYQIGDKVRVKVASVNLDDRQIDLMMEGDSGGKPGSRRGKKPMTARDRVNAEGAK
FT                   LGKADKSGKPKRRGSRSKSAAGKAAADSDKTNTSGGAKKSGAKTKTTAKKSKAKKSSAK
FT                   KASVKKSPAKRKVKASK"
FT   CDS_pept        503517..504272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmB"
FT                   /locus_tag="SVI_0439"
FT                   /product="23S rRNA (guanosine-2'-O-)-methyltransferase
FT                   rlmB"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00410"
FT                   /db_xref="GOA:D4ZFG1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG1"
FT                   /protein_id="BAJ00410.1"
FT                   /translation="MKKQDITFGIHAVEAVLKHSPERVIELWVLLGRDDKRLMPILESA
FT                   AEYGVSVQYAARKVLDDKSGGGQHQGVLARVKAVKQLNDKDLTALLDKIEVENTETPFL
FT                   LILDGVTDPHNLGACLRNADAAGVHGVIVPRDNSVGLTPTVSKVACGAAEVVPLFQVTN
FT                   LARTMKSLQDKGVWIVGAAGEAEHNLYKADLKGSLAIAMGAEDKGLRRLTREGCDSLVS
FT                   IPMTGSVSSLNVSVASGVCLFEAVRQRLS"
FT   CDS_pept        505094..505465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00411"
FT                   /db_xref="GOA:D4ZFG2"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG2"
FT                   /protein_id="BAJ00411.1"
FT                   /translation="MWEHCQDALIIFKNAAQITMLSLHLFNKLLAVQRGFMLFIKESET
FT                   TLTIWWKFIGSIVLFVVAVVAALTGTLYIPSKYGFLTEESSPLTFIGLVTFVFLLSVLS
FT                   FWQGGYGIYKKYIAEPNCS"
FT   CDS_pept        complement(506202..506963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00412"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG3"
FT                   /protein_id="BAJ00412.1"
FT                   /translation="MFRVLTALLLSVPMSAWALVPPDYQEPPSDFIAEIEAGLQINRGN
FT                   TESSSFNGRTKLVYDTKQFKQEGTFKLYYSADADKTTAEKYDLQLQSSYKLDNDFSWLD
FT                   DGYIFGRGDFTLDRFGSYTQVSTISVGYGFDAISNSDTKLSLEIGPGYRYNMPIETEAE
FT                   PNPDADKDIIVRTAAKFKHKLQEYTSLNADLTAEMGENNSTLTLDMNYKNTLFQDWAFK
FT                   IGVNVKYTDVVPEGSKQTDTITTFNLMYTFQ"
FT   CDS_pept        complement(506980..507117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00413"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG4"
FT                   /protein_id="BAJ00413.1"
FT                   /translation="MIIGNTSPRNYDDKNFDLHCHIHFTDAAQNRYYVDLMSLFLTTLK
FT                   "
FT   CDS_pept        507344..507766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="SVI_0443"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00414"
FT                   /db_xref="GOA:D4ZFG5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG5"
FT                   /protein_id="BAJ00414.1"
FT                   /translation="MRHYEIVFLVHPDQSEQVPSMIERYTGILTQAGGQIHRLEDWGRR
FT                   QLAYPIIELHKAHYVLMNVEASAESVEELETAFRFNDAVLRSMVLRTKAAITEASPMAK
FT                   LKEERDSRRSTEGERRSAPAEKAVEEVKETAEKAAE"
FT   CDS_pept        507775..508080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priB"
FT                   /locus_tag="SVI_0444"
FT                   /product="primosomal replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00415"
FT                   /db_xref="GOA:D4ZFG6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG6"
FT                   /protein_id="BAJ00415.1"
FT                   /translation="MATNHLVLSGTITRSRSFKSPAGIAHSVIMLEHKSQCFEAEMLRN
FT                   VYCQIQVILSGERFQSVTDKLKIGVDIEVQGFIALQQSRNGQNRLVIHAENVELKT"
FT   CDS_pept        508092..508319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="SVI_0445"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00416"
FT                   /db_xref="GOA:D4ZFG7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG7"
FT                   /protein_id="BAJ00416.1"
FT                   /translation="MARYFRRRKFCRFTAEGVTEIDYKDIVTLKNYITESGKIVPSRIT
FT                   GTNAKYQRQLARAIKRARYLSLLPYTDLHQ"
FT   CDS_pept        508347..508799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="SVI_0446"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00417"
FT                   /db_xref="GOA:D4ZFG8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG8"
FT                   /protein_id="BAJ00417.1"
FT                   /translation="MNVILLDKIANLGNLGDQVAVKAGYARNYLLPLGKAVVANAANTE
FT                   VFEARRAELEAKLAATLTAANERAAKINALESVVIASKAGDEGKLFGSIGNRDIADAVT
FT                   AAGVDLAKSEVRLPLGALRTTGEFEVEVQVHTEVKAIVKISVVTEG"
FT   CDS_pept        complement(509047..511959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0447"
FT                   /product="Oar-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00418"
FT                   /db_xref="GOA:D4ZFG9"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFG9"
FT                   /protein_id="BAJ00418.1"
FT                   /translation="MKINFKHSLLAASISTLLAISSPIMAANNTAGSMKGTITDASSKS
FT                   ALAGATVTIINKANGASTTVTVNEKGTFKVPSLSIGNYKITITKPGYETQVIESAKVTI
FT                   GSEVSIEVPMSTGDVERISVTGSRIALVDTSSPEISLTISADEIARLPIAQDIVSVALL
FT                   SPGATKGDSAFGNLASFGGSSVAENSFIINGVNVTSFRRGTSIADIPFSAYEQFQIKTG
FT                   GYSAQFGRSTGGVVNAVTKRGNNGWDFGIAARWEPDALREQRPSVLYPVGNASGSIQPF
FT                   DTFWDNSKDEKDDLEAEFTVSGDIIEDTLFVYGLIQPQKYKSINASANGETYTTTEYDD
FT                   PLWLARVDWQITDDHSLMIWGFSDSEQVVDTTKAYDPNSEIMDQVSIESRGGTTWSAQY
FT                   VGRLNDWISVDALYAEVEFDSTVQAPEDETCPAIYDDRGSGLVPMGCWQNFSSSAESDL
FT                   RKQTNINFNFDYFEDHAIKAGYDFEDNTSLESSFYSGHVYYRYYKGAAGESVNGVELAQ
FT                   NIEYARTRVYDNGGEFTSKSTAWYIEDTWSILPNLTARVGLRSESFENLNAEDKAFIEI
FT                   KNQLAPRLGLSWDPMDDGESKVFVNWGRYHIPVASNTNVRMAGAETFTAEWNELISVDA
FT                   EGLPSLGASIGDQQVYSDGSVADPAEILDTSIDPMYQDEFILGYQRNLDEDWSAGIKFT
FT                   HRDLKSIIDDITIDKGIRANGWVESEAHVYVLTNPNTDVHVSYDTNGNGTLEQVVIAAE
FT                   DLGYPDPERIYNSVELTLNRTWNDDWAFNASYTWAQSYGNAEGYVKSDNGQDDSGLTTD
FT                   WDFPYLMDGANGSLPNDRRHTIKAYGAYQIIENLSIGANLIAQSGRPKNAFADTLPEGY
FT                   PDPYEYGATYYPFDQKCSRGCMGNEDWRFKVDLNFVYNIDFIDNIQADVRLDIFNIFNS
FT                   SNVLKTSETLTIGGQYDPSYGLPKEFEAPRYVRISANIKF"
FT   CDS_pept        complement(512648..514867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00419"
FT                   /db_xref="GOA:D4ZFH0"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH0"
FT                   /protein_id="BAJ00419.1"
FT                   /translation="MRNALISALVLSSGVAFISLETHADEGQWQPYQMPSIADKLSERG
FT                   IDIPAKQLADLTQYPMNAVVGLGYCTASFVSPQGLVVTNHHCAYSAIQYNSKTEHNYIA
FT                   DGFLATSKIDEPSAGPNERLYITEAVTDVSDRVTQGLSQEPLARYQEIQSNRKSLIKSC
FT                   ESDDNYRCSVRSFHSGLEYYLIKQLIIRDVRLVYAPPKSVGAFGGDIDNYEYPRHAGDF
FT                   TFLRAYVGKDGQPAAYSKDNVPFEPKSYLKINADGVKAGDGVFVAGYPGSTSRYRLTSE
FT                   LKFASDWLYPTLASRYQLRIDTIETMGNSNHEIELKYAGTLASMANRMKKYNGLLDGFK
FT                   ATDIAGIKQSREDGFKQWLATDKTYQTYQAKFDQLELLLTKKRVDNQTRYYFENAQSSA
FT                   LLAAANKLYRLSKEKVKPDAEREEGYQERDMKMFKARLKRIDSSFDASVDKALWQQDLQ
FT                   AYIAQEHRVAALDNMLNYVDESVTLSDKLAGLYSLTSLTDKDKRLAWMDAKAGDFETSA
FT                   DPFIRLAVALFDTNMAQEKDKKTLAGQLSQARPDYMKAIIAYYKANDWPVYPDANGTLR
FT                   ITYGMVDGYQSKDALYKQPFTRLEGITAKHTGLAPFNAPQKVLDAIKEQRFGSHKVASV
FT                   IKDPSTWLCRLFSCYKPEEFNSVPVNFLSSVDTTGGNSGSPVFNGKGDLVGLNFDSTYE
FT                   AITKDWFFNPTITRAVHVDFRYILWMMDEVDHADNLIAELDLVRN"
FT   CDS_pept        514978..516390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="SVI_0449"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00420"
FT                   /db_xref="GOA:D4ZFH1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH1"
FT                   /protein_id="BAJ00420.1"
FT                   /translation="MSQQGQGSFKAKQKPRDIQMDALKMPPHSLEAEQSVLGGLMLDSD
FT                   AWDRVSEAVVAEDFYSRSHKMIFNAMATLTAASHPIDLITVSEQLEIEDQLEDAGGFAY
FT                   LGEIAKNTPSAGNIVSYAGIVRERAVVRDMIKVANEIADAGFNPEGRNSSELLDLAETK
FT                   VFKIAESRTNENDGPKGIKAILEKTVDKIEELYNNPTGGVTGISSGFHDLDKMTAGFQG
FT                   GDLIIVAARPSMGKTTFAMNLCEQAALNEEKPVLIFSLEMPSEQIMMRMLASLGRVDQT
FT                   KIRTGQLDDDDWARVSSTMGIMLEQGKMYIDDGSGLTPTDVRSRARRIAREHGGLSMIM
FT                   IDYLQLMQVPALKDNRTLEISEISRSLKALAKELMIPVIALSQLNRSLEQRADKRPVNS
FT                   DLRESGAIEQDADLIMFIYRDEVYNHDTEHKGVAEIIIGKQRNGPIGRVPLTFQGQFSR
FT                   FDNYAGPKFDED"
FT   CDS_pept        516573..517649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="SVI_0450"
FT                   /product="alanine racemase, biosynthetic"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00421"
FT                   /db_xref="GOA:D4ZFH2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH2"
FT                   /protein_id="BAJ00421.1"
FT                   /translation="MKPFPRAEISCKALKNNLARLRQIAPASKIMAVVKANGYGHGLLN
FT                   VAKCIEDADGFGLARLEEAIALRDGGVTSKLILLEGFFRPVDLTTLVMKDIETVVHNEK
FT                   QLEMLEQASLSKPANVWLKLDTGMHRLGFTPEQFEHVYARLLDCPQVAKPIKIMSHFAC
FT                   ADEPDNPYTREQLNIFNRLAKNLPGETTLANSAGTLYWPDSHKDWVRPGISLYGVSPVV
FT                   GDLGKNHGLQPAMELISQLIAIREHKAGDPAGYGCYWRAKEETKLGVVAIGYGDGYPRN
FT                   APEGTPVWVNGRLVPIVGRVSMDMLTVDLGLDSTDSIGDEAIMWGSALPVEVVAEHIGT
FT                   IAYELVTKLTPRVAVCME"
FT   CDS_pept        517814..519079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00422"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH3"
FT                   /protein_id="BAJ00422.1"
FT                   /translation="MNITDTEVHEDGNVVEPLVSTEPEQIENKFEPEFVAVPFIFSTET
FT                   LSTTFGGAGVLKHAGQAQASILGIGLYSSNSSWVSYLGLTNYQLPKLDQWLFSGEFYRA
FT                   NFKEGIYFVPQGAGEGSLEPVATDSSQRNRILAEGDESFYKLHIKYVLPFGRGADGAAL
FT                   SLIPSRNNDNFSWDPTKSGVSSIELTPFVKTQELVGYNDLPTKAQGLELKLDWDNRDNG
FT                   KNSTRGGETSLIFTRDFGSSSSTDSGGRESWTTWEFEQSAFFSLGGSSWFPQQTLALNF
FT                   YLADTPTWSKDEDNSTGSHRPPSFSGVSLGGFEHLRGYSSRQFVGRSAVLYSAEYRVQP
FT                   AWQPLQSLPLFNLYDVPWWQWVVFTEAGQVADSFSASELHDDMKWTLGAGARFEVESVV
FT                   VRAEFAHGQDSNQFWVMVNQPF"
FT   CDS_pept        complement(519489..519953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0452"
FT                   /product="CheC-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00423"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH4"
FT                   /protein_id="BAJ00423.1"
FT                   /translation="MNVNFINPFLESLLNVISTMANMKLNPGKPKIKTDNLAKGDVSGL
FT                   IGMVGPQTKGSLSITFEQGLILEIMQNMLGENPGEINDEITDLVGEITNMVTGGAKNIL
FT                   GEKGYDFEMATPVVVAGLGHRISHQADGMKIIMPFTSPHGSAYIEICFEK"
FT   CDS_pept        520209..520793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0453"
FT                   /product="pilin, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00424"
FT                   /db_xref="GOA:D4ZFH5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH5"
FT                   /protein_id="BAJ00424.1"
FT                   /translation="MVIPVYYTSEVNSITIMKHYRTSDKYQRLNGFTLIELILVIIVLG
FT                   ILAVVAAPRFMDLNRDAKTSSVSGFQGSIEDALKMVHMKAQIDNGLGDNVNLDTQFGSY
FT                   QFYRGYPETKSEATNPNLYFLETFLQLGAADSESKNNLTRTANYANIGVYEDNGFSRIG
FT                   YGSGNLLAGLCYAEYFHTSLAQGVSIETRGC"
FT   CDS_pept        521014..522003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="SVI_0454"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00425"
FT                   /db_xref="GOA:D4ZFH6"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH6"
FT                   /protein_id="BAJ00425.1"
FT                   /translation="MDMQFMPVRKINRTFSIAPMLDWTDRHYRYLARIMSTELLLYTEM
FT                   VTTGAIIHGKGDYLAYNSEENPLALQLGGSNHHDLATCAKLAAERGYDEINLNVGCPSD
FT                   RVQSGRFGACLMAEPKLVAECVTAMKQVVDIPVTVKTRIGIDDQDSYEFLSEFVDTVSD
FT                   VGCDTFIVHARKAWLQGLSPKQNREIPPLDYQRVYRLKKDYPDLHISINGGVKTLDECH
FT                   EHLQHIDGVMVGREAYQNPYILAEVDQRLCGSNKPVLSRDAVLDKFIPYIEKHLMDGGR
FT                   LNHITRHMTGMYQGEPGSRAWRRYISENAHKPGAGIEVIEQARKNIDC"
FT   CDS_pept        522288..522587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00426"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH7"
FT                   /protein_id="BAJ00426.1"
FT                   /translation="MLNLMISKIVKLSLVATVLMGVSVGAHADSLILTDLTSNIEQNIS
FT                   AQMQDLMQVTQRELSLSLQTQLAEAMFELKGSEETNQLVQKTPENVITSAMVKD"
FT   CDS_pept        522734..522952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0456"
FT                   /product="PspC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00427"
FT                   /db_xref="GOA:D4ZFH8"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH8"
FT                   /protein_id="BAJ00427.1"
FT                   /translation="MSYLSSTDKYMGHMKRPTSLICGVAAMMANKFNWSCLWTRVVWAG
FT                   VILLNPGMGLLLYFVLALVLPKWDANS"
FT   CDS_pept        523063..523368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00428"
FT                   /db_xref="GOA:D4ZFH9"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFH9"
FT                   /protein_id="BAJ00428.1"
FT                   /translation="MIAALVMALDSWGISEFFSGSFLNIDPLFWIDVSLCSVVIISVML
FT                   VVILFWLTVAFSILALVSGLCIVAALVMGFSGFSLLWPLMLLLLAAWGLGKSSQCD"
FT   CDS_pept        complement(523474..524211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0458"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00429"
FT                   /db_xref="GOA:D4ZFI0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI0"
FT                   /protein_id="BAJ00429.1"
FT                   /translation="MSTIQVKDEQGVRIITINRPEKRNALSLEMYTNLTEYLIQGESDN
FT                   AIHSFLIKGQQDCFTSGNDVADFLKNSNLDSEHPAFKFLFHLLDLKKPLVAAVTGAAVG
FT                   IGTTLLLHCDLVYADNTAKFQLPFVNLALVPEAGASLLLPQLVGPQKAAELLLLGESFD
FT                   AETAKTLNIINDVIPSESIFDFALAQAVKLAKQPPQALQATRALLGTNKDLVRQQMKDE
FT                   LAQFAVRLKSDEARTRFEAFLKK"
FT   CDS_pept        524259..524720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00430"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI1"
FT                   /protein_id="BAJ00430.1"
FT                   /translation="MKQKFKHVFSFVVLWVASFSAMANVVLVDGQVRAMPPSVPNSAAY
FT                   LTLENHGPSIKLVAVEAGFVKEAQLHTVIEEDGMVKMRQVESFTIPQHGRLTLSESGQH
FT                   IMLLGLKQPLVSGESVNLTLKFDNGSELPVSLMVSKQAMTKSEGHHHHN"
FT   CDS_pept        524727..525722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00431"
FT                   /db_xref="GOA:D4ZFI2"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI2"
FT                   /protein_id="BAJ00431.1"
FT                   /translation="MEFTGVYQMQMTWKKWTGIAVLIIFIGYLISVWWSVAPDAIKAQQ
FT                   LKVAEGPQVVGYATTTSLIITMETLLNKRGGWLSNDVTPPSIFMDNMPAFEFGALEQVR
FT                   DLALIMRKEFSRSQSQSLSDKDLLAAHSKLNIEHTSWLAPSAEGEYKDAIKLLKLYRAK
FT                   ISDTHNQDAQFYARADNLNEWLKEVQKRLGSMSQRLSASVGQDRINTDLAGDSEASQST
FT                   PKQASQQIKTNWWKIDDVFYEARGETWALLNFMKAIEIDFADVLRKKNAEVSLQQIIRE
FT                   LEETQQAVWSPVILNGSGFGVVANHSLVMANYISRANAAVIDLTNLLIKG"
FT   CDS_pept        525730..526479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00432"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI3"
FT                   /protein_id="BAJ00432.1"
FT                   /translation="MKKTLLACALLASLVGTSAQASTLIGFKVGGDYWKADTSGTFAEN
FT                   GQTQQDFNYSSSSQGSIWVAFEHPIPLVPNVKIRENRLDTSGNGVADGFAFAGQDYNGE
FT                   ISTSTDLSNTDFILYYELLDNDLVSLDLGAAYKMMHGSFRVNDRVTSGRVNSEIELDSG
FT                   IVMAYAEAQVGIPGLGLYGFADVMMGIDESSVYDYSVGLGWQFDGMVLDTKLRVGYRDF
FT                   NFDVNDFDGVTTNTQFNGFFAGVELVF"
FT   CDS_pept        complement(526702..528045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="SVI_0462"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00433"
FT                   /db_xref="GOA:D4ZFI4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI4"
FT                   /protein_id="BAJ00433.1"
FT                   /translation="MKFKIRTICAALTLAFSTSAVQADDLLQIYQQALTSDPIALQAQA
FT                   KRDALYEKIEENRAPLLPTISARVGYNKNWINNESPEPNTDSSGVNAGVTLNQVIYDHS
FT                   AWVGLNLAELAASQADATYASSLQTLIIRVTSAYFSVLSAKDTYEFQGSEKRAIERQLE
FT                   QTKQRFAVGLTAITDVHEAQAQYDLARAQEILAENELTNSYEALREITGIEHNSINILD
FT                   TERFSAVTPSPTRANDWLKMAEANSVDLLTTRIGKDMAQEAISLYKAGHMPSLSLNAGY
FT                   TTNIQQENNNNDARDFDNGTVGLTLSIPIFEGFKVTSQVNQAQYQYVEASEKMEQTYRK
FT                   VVKDVRNNFNDVGASISSIRAYEQSVISSESALKATQAGFEVGTRTIVDVLNRTRDLYD
FT                   SKRKLSDARYGYINSILALKQAAGTLNEDDVIAINNGLTAQTTQTTTQ"
FT   CDS_pept        528381..528989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="SVI_0463"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00434"
FT                   /db_xref="GOA:D4ZFI5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI5"
FT                   /protein_id="BAJ00434.1"
FT                   /translation="MKQKFDQEDVVLLGKETVFKGFFSLDVYRFKHKLFKGGWSDEVHR
FT                   EVFERGDAVVVLPYDPVTDEVVLIEQIRIPVLAKAKSPWMLELVAGMIEKGETAEGVAH
FT                   RELAEEAGVTAKHMSKISSYFASPGGTSEKFEFFWAEIDASQAHGVHGLDHENEDIQVH
FT                   VFSREQAFKFVNDGTINNASTVIGLQWLELNYLNLRKAK"
FT   CDS_pept        529172..529618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00435"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI6"
FT                   /protein_id="BAJ00435.1"
FT                   /translation="MSSASSLNPKRYQPNINRFLALCGRNYFHILRWLPDGAEQGASWQ
FT                   VKGEFGFLDVRLLENTRYTQLIEISRNVDTSGFVDPPKISVRVYHDAKLAEVLTSRQIY
FT                   QLSPVYDYPNLRMHHRDEKYRVNAFLEELLRIDNHTSVVCLAES"
FT   CDS_pept        529631..530470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icc"
FT                   /locus_tag="SVI_0465"
FT                   /product="lacZ expression regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00436"
FT                   /db_xref="GOA:D4ZFI7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI7"
FT                   /protein_id="BAJ00436.1"
FT                   /translation="MLKEAISYSLEEKASVRIVQVTDPHLFADPSSQLLGVNTAKSLES
FT                   VLNAIKTGDFPADLMLATGDISQDYSGESYHSFVRSIAPLDLPCHYLPGNHDDPRVMSL
FT                   HMQGAKIFGQRRILAGNWQIIMLDSTVRGKPGGHMSDSEIEIIKSAVADQPERHVLLVM
FT                   HHNPILVKCRWLDQHCMDNGSDFIEQVAQIPQVKGLLWGHVHQELDEEHQGMHGIIHLM
FT                   STPSTCIQFKPLSSYFALDALQPGYRQLELKSDGSMITNVHRVLGDKFFPDRNARGY"
FT   CDS_pept        530676..531248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00437"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI8"
FT                   /protein_id="BAJ00437.1"
FT                   /translation="MLLYIHGFNSSPLSDKGRVTAQFVAEHYPDLNFHQPQLPSTPKEA
FT                   MELLSALVETALDNGEALTYIGSSLGGYFASYLAEKYGGRAVLVNPAVTPFELFDEFMG
FT                   QQYNPHIDEYYQVLPEHKDQVAAFNTQVILNPDRFLVLLQSGDEVLDYRQAVQKYHCCQ
FT                   LLIQSGGNHSFVGYDKQMHSICQFLFS"
FT   CDS_pept        531304..533190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="SVI_0467"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00438"
FT                   /db_xref="GOA:D4ZFI9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFI9"
FT                   /protein_id="BAJ00438.1"
FT                   /translation="MTNQYTSDSIEVLNGLDPVKRRPGMYTDTTRPNHLGQEVIDNSVD
FT                   EALAGHATKIEITLHKDNSLEVIDDGRGMPVDIHPEEGISGVELILTKLHAGGKFSNDN
FT                   YQFSGGLHGVGISVVNALSSRVEITVRRSGIVYDIAFENGDMVEELRETGTCGRRNTGT
FT                   RVHFWPIPSYFDSANFSVPKLTYLLKAKAVLCPGLKIKFTNKQTDEVQEWFYESGLTDY
FT                   LQSSTKDAIMLPEEPFIGSLKGNNEAVDWAITWLPEGGEYLNESYVNLIPTPLGGTHVN
FT                   GFRQGLLESMREFCEFRNLMPRGIKLTPEDIWDRSSFILSIKLLDPQFSGQTKEKLSSR
FT                   QSSAFVSGIVRDSFSLWLNTNTEQALALAEMCINNAHKRLKSAKKVARKKVTSGPALPG
FT                   KLTDCSGQDPMRGELFLVEGDSAGGSAKQARDREFQAIMPLRGKILNTWEVDSSQVLAS
FT                   QEVHDISVAIGCDPDSSDISELRYGKICILADADSDGLHIATLLCALFMKHYKILVEKG
FT                   HIYVAMPPLFRIDIGKEIFYALDEAEKQGILDRIAAEKKKGKVQVTRFKGLGEMNPLQL
FT                   RETTMDPNTRRLVQLTIDDVEETISMMDMLLAKKRSGDRKIWLESKGNLADF"
FT   CDS_pept        533278..534399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0468"
FT                   /product="L-sorbosone dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00439"
FT                   /db_xref="GOA:D4ZFJ0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ0"
FT                   /protein_id="BAJ00439.1"
FT                   /translation="MFACAAVLFSQKLLAAQPMMITVTKGFGLTLYASELGDAKQMALG
FT                   DKGTLFVGSHKKGAIVALVDSNADGRVDKRYTIAKGLDNPEAIAFHHGDLYVAVDEKIV
FT                   KFVNIENRLRRPGRGKVIYDRLPGKSNKSRRAMHFGPDGRLYVAIGAPCNVCETVAPFG
FT                   SIIAIDLKTGGSEQVAMGIRNVTGFDWSPIDGALWFADEGRDWMGDRLPPDEINRLEKN
FT                   GEHFGFPYIHGASVIEPAYDKPKNLKITLPNYELPAHVSPMGLHFYRGQQFPAKYHNQM
FT                   FVAENGSWNRSSKIGYQVVMLAIEGQKVIKRSTVVSFLDGGFPVARPYGLLTAPDGAMY
FT                   ISDNLKGNIYRLYYKDTVKKKIEQAAQAEDTEK"
FT   CDS_pept        534396..536669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="SVI_0469"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00440"
FT                   /db_xref="GOA:D4ZFJ1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ1"
FT                   /protein_id="BAJ00440.1"
FT                   /translation="MNDAIDLSLDGVEQMSMRRFTEDAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIIYAMSELGLSSQSKHKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRY
FT                   PLVDGQGNWGAPDDPKSFAAMRYTEARLSKFAEVLLSELGQGTVDWGVNFDGTMKEPLV
FT                   LPSRLPHILLNGITGIAVGMATDVPPHNTRELVAACVELLDNPKADLERLMEFVPGPDY
FT                   PTEAEIITSRADITKIYATGKGSIKARAVYAIENGEIVITALPHQASGGKILEQIAAQM
FT                   QAKKLPMVVDLRDESDHENPVRIVVIPRSNRVDCDQLMAHLFATTDLQKNFRVNLNILG
FT                   LNGRPQVKGLKQILTEWLEFRLTTVTRRITHRLDKVLARLHILEALMVAFLNIDEVIEI
FT                   IRYEENPKAELMSRFKVSDIQADAILDLKLRHLAKLEEMKITSEQGELATERDKLQLLL
FT                   SSDRRLKTLIKKELIQDGETYGDDRRSPLVERSESKALTEHELSPVEAVTVVLSEKGWV
FT                   RCAKGHDIDGNGLSYKSGDGFLCSAAGRSNQPSVFIGSTGRAFATETHTLPSARSQGEP
FT                   ITTRFNLSPGEVMEHVLLGDEDKFYLLASDAGYGFVGSYKDMVSRNKAGKALLSLPANA
FT                   KVIKPKLVDKSKVESILAITNEGRMLLFSMEALPQLSKGKGNKIIGIPTERAKNREELL
FT                   THLYVVPEGTSVTLWAGKRKLTLKPSDLEHYRGERGRRGAKLPRGLQRVDSVELGDGSS
FT                   ESID"
FT   CDS_pept        complement(536761..536952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="SVI_0470"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00441"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ2"
FT                   /protein_id="BAJ00441.1"
FT                   /translation="MYVCLCFAVTDTQIKEAVSQGDVSLADVKQRLGVGSQCGKCTKMA
FT                   GQIIQRQLDIEPKYYEVA"
FT   CDS_pept        537150..537275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00442"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ3"
FT                   /protein_id="BAJ00442.1"
FT                   /translation="MVQDWVPFLDGADLGEQMLGINNKPKGDSHSHRILVELFSE"
FT   CDS_pept        complement(537367..538293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0472"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00443"
FT                   /db_xref="GOA:D4ZFJ4"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ4"
FT                   /protein_id="BAJ00443.1"
FT                   /translation="MRYKLLLLTSDNEGYRSLLKSCHLPEIEILGDETHQITQANIWLA
FT                   DPALAAPLLPHSKHILWMQSTLSGVGALVKPRQRKDYQLTNVRGIFGPLMSEYLFDSLL
FT                   IHQHKRIIYRSQQAQKTWRPTSFKTLQGQHLLLLGTGNIAKHIAQTAKRFGMHVTGINR
FT                   GAKPTIGFDNIDTLSNLPHYLPQADAIVSILPSTSDTRKALNAQTLSMMKPNGILFNLG
FT                   RADVLDLNALYLQLKQNRDQNAILDVFNQEPLPQHHPIRTLENVIITPHISAPRFPELV
FT                   VEIFANNYHKLLRGERLSHGVNFERGY"
FT   CDS_pept        538354..538686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00444"
FT                   /db_xref="GOA:D4ZFJ5"
FT                   /db_xref="InterPro:IPR021813"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ5"
FT                   /protein_id="BAJ00444.1"
FT                   /translation="MEHIISVFHQVGSLLYPWLNEISTAIIACFLIVFAADFNRLISRK
FT                   LTGRSFILRTLVFVFINAFGYGLLIVTASPFLAKQMAQVSAHWLLLLVISIFIFIGVWA
FT                   QRNKQI"
FT   CDS_pept        complement(539096..539212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00445"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ6"
FT                   /protein_id="BAJ00445.1"
FT                   /translation="MPRGQHAALSKASELGTLTLLDSKSNDTGLIEEQLAVI"
FT   CDS_pept        complement(539242..542448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0475"
FT                   /product="transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00446"
FT                   /db_xref="GOA:D4ZFJ7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ7"
FT                   /protein_id="BAJ00446.1"
FT                   /translation="MRTIFLLLIALTGFSAVAGSPLELNKRLGLTLPVSTDLTTEQKLA
FT                   HIQHSIEEQALIENNYLKLINNYQGHKLSLDRQLKEAKTPLPRSKNNGPTQQASLAYLR
FT                   LSELKEIEAQLNTKATDLIKQHNRLPSDIASARQSLTQHQKNKIDDSDTNQDMLLKAQR
FT                   QLYIQTLEALEAEQASSQKRINLNQQQMLLVRYQLSQQESLIEEINKATAKQRQKKTDA
FT                   TIAKSLFETSAEQSPLTQQLSRLNLGYANKLKGLTKDTNLIVLTQETAENLYQVQAKQL
FT                   TNIQQQVGLIKLNSAFGERFLQMLQSLPAPPNQDKLEAQIAQARLTRYQLEQELTINNQ
FT                   QLVTNEPLTKIQSRLLTSQNDLITQLLQSQDLYLSKLSDLRVIYEQLTQQNITLTSILN
FT                   EHLFWVPNAKSIDKLWFTDLFQSVKWLMGQSVWSDISVSLDEQSEYWSWWIILFVLCLV
FT                   TQDLLTPKFKSVMAHDITFVGNVTQDQFSYTFSALSNSLLYSVIKPLPVIAAGAILLFS
FT                   SLNLTAAIGMGVLVIGLLYLFYRFTYLLALEQGLLIGHFKSEASIIRQGQLRFKTFIIM
FT                   AIPFFGVMGFTEFIDNSVLRNSIGRGAFIIFSIFLFGFYRDILSLSKKHKHQHQDDKNK
FT                   KLLQRLLWGVLLLIPPVCAILAFRGYYYTAFQVLLQLQLSLLLSLGFMLLYQLIKRWMF
FT                   IERRRIAFDRAKARRAEILLQRERERDEEPQNNTEPLDTYEEPGVDLETMASQSLGLVR
FT                   SLLLLAFLASLIGLWSQTHTALFSLLDDVTLWTSNTLVNGIEQQLPITLKSLFLGLIIV
FT                   GFSLMIATNLPGLLELTILQRLDLSQGTGFAITTVSRYLVVFFGILSGFSTLGMEWSKL
FT                   QWLVAALSLGLGFGLQEIFANFISGLIILFEKPVRIGDTVTIRELTGNVSKIQIRATTI
FT                   VDWDRKEIIIPNKAFITEQLINWSLSDPITRVIVYVSVARDSDPARVEAALYQAVEGCE
FT                   DALESPEPEVWFAGFGQHTQDYEVRAYAKDMNTRWPLRHTLHKAINKKLQENQLELAYP
FT                   QLEVHIKNTQSKETQGLIRS"
FT   CDS_pept        complement(542630..543505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0476"
FT                   /product="integral membrane domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00447"
FT                   /db_xref="GOA:D4ZFJ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ8"
FT                   /protein_id="BAJ00447.1"
FT                   /translation="MNQTASNKQAGLLELHLAVLLFGGTALFSKLIPLSALNITLLRCV
FT                   VAAVVLACIVKASKKTLSLDATKDYFIALGLGIIVSLHWVTYFASMQLSSVAIGMIAFF
FT                   TYPVMTVFIEPIITGNPIQRSDIISGITVLLGVILLIPEASLGNDVTMGIALGILSAAF
FT                   FTARNLLHKRYFSAYSGSQAMFYQTGVAVLFLAPWNTVEFSQIEQSTWGLVLLLGVIFT
FT                   AAPHALFTTALRHLSAKTVSLVSCLQPFYGAVLALLFLGEQLDIKPAIGGLLVVATAIF
FT                   ETRRNRKTAK"
FT   CDS_pept        complement(543544..544407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="SVI_0477"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00448"
FT                   /db_xref="GOA:D4ZFJ9"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFJ9"
FT                   /protein_id="BAJ00448.1"
FT                   /translation="MDKVKIALQYMMPKHLVSRLVGKLAAAELGSVTTAAIKWFIKQYK
FT                   IDMSEAAQSEPEAYKTFNDFFTRSLKSGVRPLSKDQDYIVHPVDGAISQCGPINDGQIF
FT                   QAKGHEYSSLALLGDQADDAKRFQDGDFATIYLAPKDYHRIHMPLKGTLSKMTYVPGEL
FT                   FSVNPLTAENVPGLFARNERVVAIFETEIGPIAMVLVGATIVASIETVWAGTITPPGGK
FT                   KVFTWDYPTEGPEALTLEKGAEMGRFKLGSTVVMLFAKDALDEFADGVVPKAVTRMGQA
FT                   FAKIED"
FT   CDS_pept        complement(544443..545498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engC"
FT                   /locus_tag="SVI_0478"
FT                   /product="probable GTPase engC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00449"
FT                   /db_xref="GOA:D4ZFK0"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK0"
FT                   /protein_id="BAJ00449.1"
FT                   /translation="MSKKKPLSQGQRRRMRANQDKRLQRKDSGSNAPELQDSSLEPEQL
FT                   GTVISRFGQHADVETESGQVVRCNIRRNIQSLVTGDKVIVRLAVEMSSTIAGVVEAVHP
FT                   RFSLLSRPDLYDGIKIIAANIDQILIVSSIVPSFTTQIIDRYLVAAEDTGISPIIVLNK
FT                   IDLLSDEDRPEVEAALQRYRDIGYQVYQISSHTGQGVDDIKALLNKKVSIFVGQSGVGK
FT                   SSIINAMMPDAELAIGDVSQNSGLGQHTTTTAKLMHFASGGDLIDSPGVREFALWHLPP
FT                   ERVGECFIEFREYLGTCKFRDCKHKNDPGCAITDAFNDGKIAEDRYKNYHKIIASLNEM
FT                   RHARQFRASDE"
FT   CDS_pept        545611..546156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="SVI_0479"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00450"
FT                   /db_xref="GOA:D4ZFK1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK1"
FT                   /protein_id="BAJ00450.1"
FT                   /translation="MVVDANNLIWVDLEMTGLDPETDRVIEIATIVTDKELNILAEGPV
FT                   IAIHQTDEQLATMDDWNQKHHGESGLVERVRSSQYNEDDAIAMTIKFISQYVPQGVSPM
FT                   CGNSIGQDRRFMNKYMGKLEDYFHYRNIDVSTIKELTRRWKPELMDGFTKQGTHKALVD
FT                   IQESIAELQYYRAKVFKI"
FT   tRNA            546346..546421
FT                   /locus_tag="SVI_t001"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GCC; tRNA-Gly-1"
FT   tRNA            546549..546624
FT                   /locus_tag="SVI_t002"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GCC; tRNA-Gly-2"
FT   tRNA            546869..546944
FT                   /locus_tag="SVI_t003"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GCC; tRNA-Gly-3"
FT   tRNA            547189..547264
FT                   /locus_tag="SVI_t004"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GCC; tRNA-Gly-4"
FT   CDS_pept        547801..548253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00451"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK2"
FT                   /protein_id="BAJ00451.1"
FT                   /translation="MRFQQLGEVLTYVAICRVEMATLYSRLKTNADSTRVKMMLEYFQQ
FT                   HQRGVATKLEIYIESAPKKVLNAWYKDICFEDFIKKCHDTVLTANMSEGDVLELHLYLD
FT                   NLLMDLLQETAGHSSVGIAGMLNQLVRVERIRQQRLVHSCIRMDDI"
FT   CDS_pept        548772..549230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00452"
FT                   /db_xref="GOA:D4ZFK3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK3"
FT                   /protein_id="BAJ00452.1"
FT                   /translation="MASVKVFLDNEQDTVDLGKRLAQIITPPLTLNLSGELGAGKTTLS
FT                   RGLIQALGHEGAVKSPTYALVEPYELDGIDLYHFDLYRLSDPEELEYMGIRDYFTDKSV
FT                   CLVEWPDRGHGLMPVADISVDIKYVGTSREVEMTSGTNKGQVLLSKLK"
FT   CDS_pept        549233..550558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiB"
FT                   /locus_tag="SVI_0482"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00453"
FT                   /db_xref="GOA:D4ZFK4"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK4"
FT                   /protein_id="BAJ00453.1"
FT                   /translation="MIKINNFIKTILVVLSLCTSFIAHSANKLDGVRVWAAPESTRIVF
FT                   DLSNAPKFTHFNLASPHRLVVDLKGTTTSLNLGKLTNNSKLVKKVRISKSPSKGTLRIV
FT                   IDLAKPVKSNLFSLPPTAPYGDRLVVDLDDNSSTTAVVSKASKVTQKLRDVVVAIDAGH
FT                   GGDDPGSIGPSGIYEKKVVLEIAKRVAAKINATPGMKAVMTRTGDYFVNLNQRSVIARN
FT                   SKADLLVSIHADAFTSSQPRGASVWVLSMRRANSEIGRWLEHKEKHSELLGGAGEIMKN
FT                   AANEQYLAMTLLDMSMDRSMAVSHHIADDVLSNLGKVTKLHKSKPESASFAVLKSPDIP
FT                   SILVETGFISNHTEERLLSQRQHQNNLANAVYKGVVKYFTSNPPVNSLMASKGSRRHSV
FT                   RKGESLSVIAHRYKVSITNIKKANNLKSNNIHIGQRLVIPRA"
FT   CDS_pept        550588..552447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="SVI_0483"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00454"
FT                   /db_xref="GOA:D4ZFK5"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK5"
FT                   /protein_id="BAJ00454.1"
FT                   /translation="MTIQILPPQLANQIAAGEVVERPASVIKELVENSLDAGATRVDIE
FT                   IEKGGSKLIKIHDNGSGIPKEELSLALSRHATSKLSSLDDLDAILSFGFRGEALASISS
FT                   VSRLTLTSRTAEQSEAWQAYAEGSDMAVKVIPAAHPVGSTVEAVDLFFNTPARRRFLKS
FT                   DKTEFTHIDEWLKRIALVSRDIHFTLKNNGKVVRNFRPAKTSDQYLQRLAQVSGKKFAL
FT                   QALAVECEHEGLKLSGYIQSPYFEGSASDTQYFYVNGRLVRDRLVNHAVRQAFAEHVTG
FT                   AQASYVLMLELDPHQVDVNVHPAKHEVRFHQSRYVHDYIFQALQSALSQVGKPVFLAED
FT                   QSNKEASSNSYQASVLESPRVNESDASTGYLPFNKEPDTSQARAKHEHSIASSAYYPGS
FT                   KSGLSPSSAARPQVELPSVAAIASYGALLTTPVVPPQVGNGQVRDPQDMPPVLDGKYWV
FT                   LTQADSLTLLTIENVASKLLQVSILAKLECGLVSQPLLMPVSIPMDDDWQVTIEHRELM
FT                   LRKMGIELTIRLGQLIIKKVPPYLRQSQLVSVIPELLQWMRFEEPGLEALASWVAKHGD
FT                   MNLESPTPIWQDFMQAEQSLREELMADVISLPWQVWLKKALID"
FT   CDS_pept        552487..553413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="SVI_0484"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00455"
FT                   /db_xref="GOA:D4ZFK6"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK6"
FT                   /protein_id="BAJ00455.1"
FT                   /translation="MTEASLPKIITLMGPTASGKTALAIELVKEHNCEIISVDSALIYR
FT                   GMDIGSAKPTAEELAIAPHRLIDIRDPLQSYSAADFRTDALREIADIVKSGKTPLLVGG
FT                   TMLYFKALLEGLSPLPAADEVIRAEIAAEALTHGWQHLHDALKRVDPVSAARIHPNDPQ
FT                   RLSRALEVFRISGKSMTELTKIKSPPLPYEVIQFAISPKDRKVLHLSIEERFKLMLNQG
FT                   FVEEVQSLRQRNDLHLDLPSMRCVGYRQCWEHLDGDYDYNTMVDKGIIATRQLAKRQLT
FT                   WLRGWSELNWLETGLDSNLTSVLRHCR"
FT   CDS_pept        553509..553787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="SVI_0485"
FT                   /product="host factor-I protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00456"
FT                   /db_xref="GOA:D4ZFK7"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK7"
FT                   /protein_id="BAJ00456.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQVESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPARPFSVNSHHATPTQAAGLNGQQDEVSE"
FT   CDS_pept        553807..555105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="SVI_0486"
FT                   /product="GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00457"
FT                   /db_xref="GOA:D4ZFK8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK8"
FT                   /protein_id="BAJ00457.1"
FT                   /translation="MFDRYEAGESAVLVHIDFADEDRREDLVELKLLVESAGAQQVGVI
FT                   TTSRRSPDRKFFLGSGKADELAALVAATEANVVIFNHALSPAQERNLEMVCQCRVLDRT
FT                   ALILDIFAQRARTYEGKLQVELAQLRHMSTRLIRGWTHLERQKGGIGMRGPGETQLETD
FT                   RRLLRGRMGTINKRLAKVDKQREQSRRARSRSEQPTVSLVGYTNAGKSTLFNSLTVSDV
FT                   YAADQLFATLDPTLRKLDLPDGAIILADTVGFIRHLPHDLVAAFKSTLQETREADLLLH
FT                   IVDCHDDNMEDNFEQVQLVLKEIGADEIPQLVVCNKIDLLEDVSPRIDYNDEGVPTRVW
FT                   VSAQQQKGLDQLKEAINQIVGRATLELTLRIPATAGHYLGQFYRLDAIQQKEFDDLGDC
FT                   ILSVRLLEADWLRLVKQSQGELEHFIVEDAAVE"
FT   CDS_pept        555147..556289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="SVI_0487"
FT                   /product="hflK protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00458"
FT                   /db_xref="GOA:D4ZFK9"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFK9"
FT                   /protein_id="BAJ00458.1"
FT                   /translation="MAWNEPGNKGNKDPWGNKSGNDKGPPDLDEVFRNLSKRFGGGKGN
FT                   GSGPKVSSFGLIIVLGIAVVVWGLSGFYTVKEAEKGVALRFGEYIGEVDPGLQWKATFI
FT                   DQVFPVNVNTVRSIPASGSMLTTDENVVLVELDVQYRVTNAYNFLFSAVDANESLREAT
FT                   DSALRYVIGHNSMDDILTTGRDKIRRDTWSEVERIIEPYKLGITIVDVNFLPARPPEEV
FT                   KDAFDDAISAQEDEQRFIREAEAYSRAIEPKARGQVQRMEQQAKAYKEREVLEATGKVA
FT                   RFNLLLPEYKSAPKVTRDRLYLDAMQIVLSGTSKVLVDSKSSNNMMYLPLDKLMQKSQS
FT                   NAKPRSVNSNSTTSSSYGSSTHSSVPLDTRPTRGERQGRN"
FT   CDS_pept        556292..557170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="SVI_0488"
FT                   /product="hflC protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00459"
FT                   /db_xref="GOA:D4ZFL0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL0"
FT                   /protein_id="BAJ00459.1"
FT                   /translation="MGRLIAVISAVLVAVFLSSILVVNEGERAIVSRFGKILKDDGITR
FT                   IYAPGLHIKIPMVDKIKFLDSRIQTMDGAADRFVTSEKKDLMVDSYVKWRIRDFEKYYL
FT                   STNGGIKANAESLLQRKINNDLRTEFGRRTIKAIVSGSRDELQQDALRNASESAADLGI
FT                   EVVDVRVKQINLPANVSSSIYQRMRAERTAVAKEHRAQGMEQSEIIRAKTDASVTILLA
FT                   QAQRKALEVRGEGDATAAKIYADAYGQDPEFYSFLRSLEAYKGSFQGDSNVMVLEPDSD
FT                   FFKYMKSPLGK"
FT   CDS_pept        557495..558085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="SVI_0489"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00460"
FT                   /db_xref="GOA:D4ZFL1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL1"
FT                   /protein_id="BAJ00460.1"
FT                   /translation="MSNAPVDTGRRRFLTAATAVVGGVGAVAVAVPFIKSWNPSAKAKA
FT                   AGAPVEVNISKIEPGQLIRVAWRGKPVWVVRRTKEILTNLATLDSQLRDPASAEEQQPS
FT                   YAQNAVRSINPEYFIAVGLCTHLGCSPTYLPDTFSEQVEGVPSGFYCPCHGSKFDLAGR
FT                   VFQGVPAPLNLVVPPHQYIDEGLVIIGVDQGAA"
FT   CDS_pept        558085..559299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="SVI_0490"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00461"
FT                   /db_xref="GOA:D4ZFL2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL2"
FT                   /protein_id="BAJ00461.1"
FT                   /translation="MIKNLVDWIDARIPMTATYNRHVGQYATPTNFNFWYFFGSLAMLV
FT                   LVNQLLTGIWLTMNYVPTAEGAFASIEYIMRDVEYGWLLRYMHSTGASAFFVVIYLHMF
FT                   RGLIYGSYQKPRELLWLFGMLIFLVLMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPFI
FT                   GDDLTLWIRGDFVVSGATLNRFFALHVIALPLVLVVLVFLHLIALHEVGSNNPDGIEIK
FT                   KNKDENGWPVDGIPFHPYYTVKDIFGTAGFLIIFCYVLFFMPEGGGYFLEGPNFEAANP
FT                   MKTPEHIAPVWYFTPFYAILRAIPDKLIGVMGMGLAIAVLFVLPWLDRCKVKSIRYRSL
FT                   THKLNIAQFAISFIILGYLGAVPATPELTIAARVFTLTYFGFFFFLWLYSKNEKTKPVP
FT                   ERLTH"
FT   CDS_pept        559299..559997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="SVI_0491"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome c1"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00462"
FT                   /db_xref="GOA:D4ZFL3"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL3"
FT                   /protein_id="BAJ00462.1"
FT                   /translation="MKKLLIALVALVPTLAFASGSSVHLESANIDLNDTESLQRGLDLF
FT                   QHNCSGCHSTQYQRYIRVANDLDISLDDMRAKFMFDDDAKPGDLMENAIPEEAAAKWFG
FT                   STPPDLTLVARVRGEDWIYTYLKGFYKDENRPFGVNNIVFPSVGMPHVLEHLQGIPVKQ
FT                   EDGTLVSTGGSLNAEEYDQVVRDITGFLVYSGDPVKLERESLGWWVMGFLSIFFVLAYL
FT                   LKKEYWRDVH"
FT   CDS_pept        560104..560733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="SVI_0492"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00463"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL4"
FT                   /protein_id="BAJ00463.1"
FT                   /translation="MAVAANKRSIMTLYSGADDLYSHQVRIVLAEKGVTVDVLQVEPSE
FT                   MPEELIELNPYNTVPTLVDRELILYNSRIIMEYLDERFPHPPLMPVYPVSRGQTRLMMH
FT                   RIENDWYSLVERIRSGDRADAARKELQESLTAIAPIFTEMPYFMAEEFGLADCYLGPLL
FT                   WRLPVLGIELDNRTAKEVKAYMTRLFDRESFKASLTETEREMRMGI"
FT   CDS_pept        560733..561251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="SVI_0493"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00464"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL5"
FT                   /protein_id="BAJ00464.1"
FT                   /translation="MKPMTPNRPYLLQAYYDWLMDNDLTPHVVVDAYVPGTQVPQQYVK
FT                   DGQIVLNITSTAVSNLQIGHDFIEFNARFGGVPQQVVLPMAAIVAIYARENGAGTVFDM
FT                   EDAYKLDGESAEAGLSVVKPEEASVAGLKSPLSSVESSPSETPKFESSADKKSSDPEPK
FT                   RRGHLTLVK"
FT   CDS_pept        561358..561948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="SVI_0494"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00465"
FT                   /db_xref="GOA:D4ZFL6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL6"
FT                   /protein_id="BAJ00465.1"
FT                   /translation="MLLMIDNYDSFTFNLVQYFQQLGQEILVKRNDEITLEEIEALNPA
FT                   YLVISPGPCTPKEAGISLAAIEHFSGQLPILGVCLGHQAIAQVFGAKVIRAQRVMHGKT
FT                   SLINHTDTRLFSSLNSPLTVTRYHSLIVEALPEDFILDAWFDDPVHGREIMAISHKSLP
FT                   ILGVQFHPESVLTEQGLELLQNFLDLGTRTKSN"
FT   CDS_pept        562264..564753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0495"
FT                   /product="dipeptidyl peptidase IV, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00466"
FT                   /db_xref="GOA:D4ZFL7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL7"
FT                   /protein_id="BAJ00466.1"
FT                   /translation="MTGLLRNSGLSMLTIAILSGCSVSDSNSNLQSVTQVNQAVVTPTL
FT                   ATPPQVNEPLTMKQIMADPDWMGILAKGAYWSDDSQSVYFARQAHASPIRDYYNQGLEQ
FT                   DIASQLRLDQLHLADQQHGVTDSAKTRKAYIYQGNLFIKHLASGKISQLTRQNTGVDGV
FT                   RFLDSGDLAFWQGDQIFRIHQNSGMLDQIANIKMAPEPKGVQEPDTYIAKQQQRLIKYV
FT                   ALQQDKAKKKQAYKQERNKVDPSIASKTWYLGDKEVVSDLSLSPDARYVLLSLIDKEYS
FT                   WRSEHDIMPNYLGKAGYVDAVPARARVAEDNPPGERLVLLDLDTGTKKDITIEGLTGFD
FT                   EDVLAKVKSENAKAQGELYKSEETPRKIQLMQDWGWSQSAIQWQGSGHSAAIMLESLDN
FT                   KDRWIASLNIEKGSLKTEHRLHDNAWVNYTFNQFGWVTGTDSLYYLSEETGYSHLYLKH
FT                   KGEQAEPLTQGKFVVSSVTLGPKAQFIYYKANKAHPGIDNVYRVNIVTGKDEQLTQWDG
FT                   QLSYKLSPDGNSLLLNASRRTEPAELFVKTIGGERKQLTHYTSDTFKNYPWQAPEVVAV
FT                   VSSHGAGDVYARVYLPQGYDKNRAEKYPAVVFNHGAGYLQNAHYGFSGYFREFMFHNLL
FT                   TQNGYVVMDMDYRGSKGYGRDWRTSIYRNMGHPEVEDLKDGVSWMAANTNVDTAKVGTY
FT                   GGSYGGFLTFMALFTEPELFQAGAALRPVTDWAHYNAPYTSNILNTPDVDAIAYERSSP
FT                   IEYAQGLEKPLLIMTGVLDDNVFFQDSVRLVQRLIELEKPMFETAIYPVEPHGFKQPSS
FT                   WLDEYRRIYKLFEQELK"
FT   CDS_pept        565001..566143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00467"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL8"
FT                   /protein_id="BAJ00467.1"
FT                   /translation="MVISVAGGVRPGKIIEIEHRLYQQLIVGKQKSNSMFDEFDVELES
FT                   DANKLAIEREAVLERLAKQIQARQVFEEVSEQLINTVNNAVDHRLSSPEQVLKHSGINQ
FT                   HQLLMLELLQDENVDLTRLKSLIEEQAWLVRDLTNMVNSASFRHRRPQSSDVKVTDIKL
FT                   VLNFIGIENIKLLIPYFCIRNWLPTGHANLLWTTRKLWRYSVVSAIAAQALAKLHEKDA
FT                   SFVYTCTLLSQLGPSVVLKNSAKLFEQIWGTWLREASASRDKEVYDAVVATEFPAEKVY
FT                   HLVLEHGNKLNWQLLHHLDFKGSAMTEVLAELDNNLSYKELSEDAAMVARANCYAKVVL
FT                   LEELRQIDPQEKRMMFDYYELSEQEVIRLKGQNYKKLTII"
FT   CDS_pept        566596..567813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="SVI_0497"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00468"
FT                   /db_xref="GOA:D4ZFL9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFL9"
FT                   /protein_id="BAJ00468.1"
FT                   /translation="MSVNNTLTRAQFDEVMVPNYAPSAVIPVRGKGSRVWDQEGKEFID
FT                   FAGGIAVNCLGHCHPALVSALKEQGEKIWHLSNVMTNEPALELATKLVNATFADRVYFA
FT                   NSGAEANEAALKLVRRYAMDKFGAEKDQIIAFDKAFHGRTFFTVSVGGQAAYSDGFGPK
FT                   PQGITHVPFNDIAALEAVISDKTCAIMMEPLQGEGGIVDADPEFLKAVRALCDKHNALL
FT                   VFDEVQTGVGRLGELYAYMRGDVVPDILTTAKALGGGFPIAAMLTTKEIAAHLKIGTHG
FT                   STYGGNPLACAVANAVLDVVNTPEVLQGVKVREQLLRDGLKKINDKYDVFTEVRGQGLL
FT                   LGAVLNDKYQGRAKDFLVAGTAEGLMSLIAGANVIRFTPSLVIPEADIAEGLARFERAV
FT                   AKVVAG"
FT   CDS_pept        567962..568981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="SVI_0498"
FT                   /product="arginine N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00469"
FT                   /db_xref="GOA:D4ZFM0"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM0"
FT                   /protein_id="BAJ00469.1"
FT                   /translation="MLIIRPIRSSDYEALYQIAKESGHGFTSLPVNEELLKSKIARVEA
FT                   SFQKQVDKPFDEGYLMVLEDTESGEVVGTCGLEAAVGMEDAFYHYRLGTEVYHSGQIDV
FT                   RNEVETLTLCHDYTGAAELCTLFLRDTYRKNNNGRMLSRSRFLFLAQHSERFGDTVIAE
FT                   MRGESDEAGNSPFYDWLQKHFLGIDFVEADYLSGLGQKAFMAEMMPKNAVYVCLLPEEA
FT                   QKVIGEVHTSTRPALNLLQAEGFRCRGYVDIFDGGPTVECNLSDIRSVRESRLLTISIG
FT                   TTPESDSSFIISNTQLANYRATSAKLLLTEDSDVVTVSPELAAGLLLSEGDQIRVLAM"
FT   CDS_pept        568991..570451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="SVI_0499"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00470"
FT                   /db_xref="GOA:D4ZFM1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM1"
FT                   /protein_id="BAJ00470.1"
FT                   /translation="MTQFIKGQWVPGLGHDVTSKNPATNEVIWSSKTATPEQVNTAVDA
FT                   ARDAQFDWFMLGFDARLAIVEAYRTQLEENKAEIAEVIAQETGKPQWETATEAGAMIGK
FT                   IGLSVAAYNKRTGYSENDIPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGN
FT                   TVIFKPSELTPKVAELMLKLWEKAGLPVGVINLVQGELETGKALAAHPQIDGLFFTGSS
FT                   RTGHILHQQYAGEPGKILALEMGGNNPLIIKGVENTKAAVHDIIQSAYISSGQRCTCAR
FT                   RLYVEKGAQGDALLELLASAVKQIKVGAWNAQPQPFMGSMISEVAAKGMVEAQRNLLNL
FT                   GGESLVELTHLEAGTGLVSPGLIDVTNVIELPDEEYFGPLLQVIRYSDFDEAIKLANST
FT                   RYGLSAGILADSREDYDYFLARIRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYA
FT                   ADYCSYPVSSVEADVVSLPANLSPGLSL"
FT   CDS_pept        570622..571422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00471"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM2"
FT                   /protein_id="BAJ00471.1"
FT                   /translation="MMHTDINKLFENLWNDYIKMTPSAEPVRQLLSRGETIINDHIALR
FT                   TFNIEKVNLKVLAAHFESLGYVDSGDYHFEAKKLKAKHFEHPDATQPKVFISELLVEEF
FT                   SPELQNTIKALVEQIDVAATKADDFLYSGRHWELDSKTYEALLAESEYAAWVAAFGYRA
FT                   NHFTISINHLPGYTNILDVNETLKQGDFVLNSAGGEVKGSAEVLLEQSSTMADRISVSF
FT                   TDAEKEIPSCFYEFALRYPKADGSLYTGFVAASADKIFESTNAS"
FT   CDS_pept        complement(571515..572843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0501"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00472"
FT                   /db_xref="GOA:D4ZFM3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM3"
FT                   /protein_id="BAJ00472.1"
FT                   /translation="MMSIRTKLSLWLTGLVIISTVIGIVSFETMLRQAFHDSIIARLQE
FT                   DLEQVLLATQLNNSKLSIDQSQLSGFYKPVFSGRYYQLNLPEQEIRSRSLWDQKLNIKP
FT                   LEKGESRVWQSKGPQNHDIQLLSLGLGSDYLNVDATLTVAQDLSIGRKIFTQIYGTKLG
FT                   VNLAMLLAMIAGIFLVLRQSFKPINQIQQVLSKLREGEITSLEVNNIPPELQPLASTYN
FT                   ELLEYSSKQIERSRNNIGNLSHGLKTPLAVMQQQVEVLGLKDPDTAIALQNQLDLIHKM
FT                   VERKLAAARITGDMLPAAQMQLPKDLQDLCNTLSKVHYNKRLLCNIDIPENITRLPLHR
FT                   EDGMELIGNLLDNAHKWANSHVEIRAKLAEEAIMLIIEDDGPGVASDELKQLTDRGRRL
FT                   DEATMGHGLGLSIVKDIAEQYKIQLTFAHSDLGGLKICLRFKQ"
FT   CDS_pept        complement(572840..573514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0502"
FT                   /product="DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00473"
FT                   /db_xref="GOA:D4ZFM4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM4"
FT                   /protein_id="BAJ00473.1"
FT                   /translation="MKLLLVEDNALLVEELEKQLKQAGYVTDVTDKAAEADYLLKETDY
FT                   DCVILDIGLPDGNGLELLERWRNRGVMTPVIMLTARSQWHEKVEGFNAGADDYLGKPFH
FT                   TQELLARIHALIQRAHGKASLPTKELSFSGVVLDENQQSVTVEDKNFELTAMEFKLLKI
FT                   FLMSPKKLLSKSQLTEKLYQFDDEKESNVVEVYVTHLRKKLGKTAIETRRGQGYIFHGI
FT                   KE"
FT   CDS_pept        complement(573546..573884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00474"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM5"
FT                   /protein_id="BAJ00474.1"
FT                   /translation="MTRALFITLLALATYTPVCASSSPLVELGHYQANDLVSAGKILSL
FT                   DITLSKIKYFCYGKLIDAHLYQEQGKWRYDLQIKAQGGQIIELSLDASTGQPHPNKSLP
FT                   SGCIAFKD"
FT   CDS_pept        complement(573965..574600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="SVI_0504"
FT                   /product="catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00475"
FT                   /db_xref="GOA:D4ZFM6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM6"
FT                   /protein_id="BAJ00475.1"
FT                   /translation="MALIGKPKPDPTLEWFLSHCHIHKYPAKSTLIHAGEESDTLYYIV
FT                   KGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEQSLRTAWVRAKQPCEIAEISYKKF
FT                   KQLIQVNPEILMKLSSQMAYRLHSTSQKVGDLAFLDVAGRIAQTLLHLAKQPDAMTHPD
FT                   GMQIKITRQEIGQIVGCSRETVGRILKMLEEQSLIQAHGKTIVVYGTR"
FT   CDS_pept        575045..575824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00476"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM7"
FT                   /protein_id="BAJ00476.1"
FT                   /translation="MKYHPLILSAGLMFTLVVSTAANAFSIPQTKVALAASKVAHIQLK
FT                   ASQGEQEAQFLLGLMYLSGRFVSQDQQQGIKWISAAAEQGHPKAQQTLADLSFEGNIIQ
FT                   RDLGTAEHWYLMLSEQGNKWAQFRLGFIYAAGGEGVERNCGKAVERFNSVGDEVSLGNV
FT                   AWILATCPEAEYRNGDKALELARSLVASDQQDPTNLDNLAAAYAETGDYNSAVETQQKA
FT                   IHALKNSKMVNRSDEFEQRLQSYQQNKPFREVIPLMD"
FT   CDS_pept        576145..576255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00477"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM8"
FT                   /protein_id="BAJ00477.1"
FT                   /translation="MPRFFLERNSQHTQGNKLIKMGEFTPKSMLTHQSFA"
FT   CDS_pept        complement(576325..577212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkB"
FT                   /locus_tag="SVI_0507"
FT                   /product="phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00478"
FT                   /db_xref="GOA:D4ZFM9"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFM9"
FT                   /protein_id="BAJ00478.1"
FT                   /translation="MSAKHPIIAVTGSSGAGTTTTTTAFKHIFRQLGINAASVEGDSFH
FT                   HYTRPEMELMIRKAKTDNKNISYFGPEANDFERLEQCFSDYSSTGQGETRAYLHTFDEA
FT                   VPFNQMPGTFTQWHPLPENTDMLYYEGLHGGVKTDTCNVAEHVDLLIGMVPIVNLEWIQ
FT                   KIIRDTSERGHSREKVMGSIVRSMDDYINHMTPQFSRTHINFQRVPTVDTSNPFSAKNI
FT                   PSLDESFVVIRFRGIKNVDFPYYLKMIDGSFMSRINTLVVPGGKMSLAMELILTPLIQD
FT                   LLEKRQQLLSLDSE"
FT   CDS_pept        complement(577387..577623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00479"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN0"
FT                   /protein_id="BAJ00479.1"
FT                   /translation="MLVPYDALLQLPSATMNNLIKEYLLTQIEDGGFSDTDEQVLTSAS
FT                   ERCKQLLKQGVLVVEFSEDDESIAIKHREHLNR"
FT   CDS_pept        complement(577626..578597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0509"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00480"
FT                   /db_xref="GOA:D4ZFN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN1"
FT                   /protein_id="BAJ00480.1"
FT                   /translation="MMRYFSPPWWARNPHIQTILPVLTKVDRPDLTRQRLELSDGDFID
FT                   LDWLGQPKAHQAIVIIIHGLEGSSESHYVRRLLNDCQRQSVCAVVHHHRSCSGETNRKA
FT                   RSYHSGDTQDLQENLSQLRLKYPDSPLLAVGYSLGGNVLAKYLGEYANASLIERAVVVS
FT                   APLLLSACAKRLESGFSKVYQSYLIKQLQQKTIEKVKNPKLTQDMPISLSQISKLQSFY
FT                   EFDHQVTAPLHGFDSVDDYYRRASGMDFLQNIHKPTLVIHAADDPFMTADVIPTAEQCA
FT                   SQVTYELHSQGGHVGFIDGGTPFKPRYYLEKRILHFLIPTET"
FT   CDS_pept        578778..579287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00481"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN2"
FT                   /protein_id="BAJ00481.1"
FT                   /translation="MERRTFLTTALVGTAALALGVNLYIPEHIKVNKALDSEHRLLFSI
FT                   LLPVFLDDALPEVGSLRIAAQNRTLDTIIQTISLLPADGQAELEQLLDMLENRLGLLVL
FT                   TGSMTPLMMRKPDELIVMLEYWRNSFLDMMVIAYQGLRELVLASYYSCPEHWSRLNYAK
FT                   PTFLEE"
FT   CDS_pept        579372..580967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0511"
FT                   /product="oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00482"
FT                   /db_xref="GOA:D4ZFN3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN3"
FT                   /protein_id="BAJ00482.1"
FT                   /translation="MAIPDPIVEGLASGWKHIDASQLSQDQTLEADVVIVGSGAGGGVA
FT                   AEILTDAGLTVIIVEGGPLKSSESFNMEERRAYPNLYHQAAAMKTQDKAIGIFQGRAVG
FT                   GSTTVNWTTSIRTPRPTLDFWAKDKSVKGLSRQDLDPWFDKMEKRLNISKWEYEPNRNN
FT                   QALKLGCEKLGWDYTVIKRNVKGCWNTGYCGMGCPINAKQSMLVTTIPAALDKGATLVS
FT                   RAKVIKLEHHNDKISAIEAQALNEQMQPTEFKLIFKAKHYIIAAGAIHTPTILLRSNLA
FT                   DPHQLLGKRTFLHPTLLSGAIFSDSINGHSGAPQSIYSDEFVWKHGTASGDLGYKLEVP
FT                   PIHPVLIASKTIGYGKTHASLMDQFNQLQVTIALIRDGFHEQSQGGQVQLTDTGFAIDY
FT                   PLNEAFWRSVRRSFGSMAELQFAAGAKQVLPITEGAPYFNSWKEAKSAMETLDLGPLKT
FT                   VVVSAHVMGGCPMGENTKLSMVDSQGNSHYYENLSVMDGSVFPTSLGANPQLTIYAMTA
FT                   RNATLLAERLKSSS"
FT   CDS_pept        581221..581328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00483"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN4"
FT                   /protein_id="BAJ00483.1"
FT                   /translation="MTVRNAALEQKGLNHLHKSLTECVLNMRLKRILWV"
FT   CDS_pept        complement(581355..581798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0513"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00484"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN5"
FT                   /protein_id="BAJ00484.1"
FT                   /translation="MTFVNHFDISLWKICDGYYHQHQALCLELQDNHQLNVNLLLLSLW
FT                   LDTQDYLLSSQDWTKLQSEIHQWEARILLPYRKLRKLSKNSLASDEYQQMLDVELMLER
FT                   KSQGLILHKLKQLSHFGKTSNLGTYLSLFNLNKADYPMLTEQV"
FT   CDS_pept        complement(581888..583798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0514"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00485"
FT                   /db_xref="GOA:D4ZFN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN6"
FT                   /protein_id="BAJ00485.1"
FT                   /translation="MISISQAQLIRGTKTLLDETSLTIYPGHKVGLVGANGTGKSSLLA
FT                   LILGKISLDKGDISFPSGWQIATVAQETPALDVSALDYVIDGDFEYRELEAKLVQAQHD
FT                   DNGNEIAHLHGKIDAIGGYAIRSRAASLLAGLGFNEAEQSNSVKQFSGGWRMRLNLAQA
FT                   LLCRSDLLLLDEPTNHLDLDTMYWLEGWIKAYQGTLILISHDRDFIDGIVDEIIHVEHH
FT                   KLNYYKGNYTAFERIRAERMAQQQVAFERQQKERAHMQSFVDRFRYKASKAKQAQSRLK
FT                   ALERMAELLPSQADSPFHMSFREPEALPNPLVTMEHVSVGYGDKEILKSVQLNLVPGAR
FT                   IGLLGRNGAGKSTLIKLLSEELAPMKGKYETNPGLNIGYFAQHQLESLRLDDSPLQHLS
FT                   RLAPTHKEQELRNFLGCYGFNGDMVLSPVRPFSGGEKARLVLALLVWQRPNLLLLDEPT
FT                   NHLDLEMRHALTMALQTFEGAMIIVSHDRHLLRLSCSDYYLVDQGKVTSFDGDLDDYHQ
FT                   WLLDAAKAANKTEASTEAKPAQDKKLQKRLEAELRQKLSPMRKVQLKLEKAQLQANDRL
FT                   SEIETMLADMSLYDAENKAKLTQVLAERTTLAQSLEESEMEWLDVQENIEEIELQVRSQ
FT                   L"
FT   CDS_pept        583994..584179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00486"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN7"
FT                   /protein_id="BAJ00486.1"
FT                   /translation="MKKRFVAGAKCPKCKAMDSIVLFKEQGVETIECVECDYREQQTDE
FT                   KVAKKASGDIIGVFKP"
FT   CDS_pept        complement(584276..584995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00487"
FT                   /db_xref="GOA:D4ZFN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN8"
FT                   /protein_id="BAJ00487.1"
FT                   /translation="MTLGQQLKQFRVDRGFSQPELAELAGIEQSYLSKLENDKSIPSND
FT                   IFRALLKALTITVEEFIHRFDVMKDRFQLIQIPDIELKLAQQEQELIHNLRRYLYIASL
FT                   LIILGITLFYTGYSKQLFDETRYQYESPGIILPGEANDIYSSWRNIISTDTREGRAEVD
FT                   ARRIEMAKRRNEIILLTDENHGQYFVEESTMGKRQYLLDKKEKLPRTINAWLQIIGVLL
FT                   LCSGIMGFVLERRFNKT"
FT   CDS_pept        585051..585167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00488"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFN9"
FT                   /protein_id="BAJ00488.1"
FT                   /translation="MDLLAGNRLYSWVFMDKYEVEYLLLFRNVEVIKAIRHK"
FT   rRNA            585953..587497
FT                   /gene="rrsD"
FT                   /locus_tag="SVI_r010"
FT                   /product="16S ribosomal RNA"
FT   rRNA            587804..590708
FT                   /gene="rrlD"
FT                   /locus_tag="SVI_r011"
FT                   /product="23S ribosomal RNA"
FT   rRNA            590865..590984
FT                   /gene="rrfD"
FT                   /locus_tag="SVI_r012"
FT                   /product="5S ribosomal RNA"
FT   rRNA            592584..594128
FT                   /gene="rrsE"
FT                   /locus_tag="SVI_r013"
FT                   /product="16S ribosomal RNA"
FT   rRNA            594624..597528
FT                   /gene="rrlE"
FT                   /locus_tag="SVI_r014"
FT                   /product="23S ribosomal RNA"
FT   rRNA            597685..597804
FT                   /gene="rrfE"
FT                   /locus_tag="SVI_r015"
FT                   /product="5S ribosomal RNA"
FT   rRNA            599573..601117
FT                   /gene="rrsF"
FT                   /locus_tag="SVI_r016"
FT                   /product="16S ribosomal RNA"
FT   rRNA            601437..604341
FT                   /gene="rrlF"
FT                   /locus_tag="SVI_r017"
FT                   /product="23S ribosomal RNA"
FT   rRNA            604498..604617
FT                   /gene="rrfF"
FT                   /locus_tag="SVI_r018"
FT                   /product="5S ribosomal RNA"
FT   rRNA            606543..608087
FT                   /gene="rrsG"
FT                   /locus_tag="SVI_r019"
FT                   /product="16S ribosomal RNA"
FT   rRNA            608407..611311
FT                   /gene="rrlG"
FT                   /locus_tag="SVI_r020"
FT                   /product="23S ribosomal RNA"
FT   rRNA            611462..611581
FT                   /gene="rrfG"
FT                   /locus_tag="SVI_r021"
FT                   /product="5S ribosomal RNA"
FT   CDS_pept        complement(611856..611981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00489"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP0"
FT                   /protein_id="BAJ00489.1"
FT                   /translation="MLKWVSHLPTLPLDMGTGKYKLNSQNFVKSQTQKSHLNKVA"
FT   CDS_pept        complement(612584..612802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00490"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP1"
FT                   /protein_id="BAJ00490.1"
FT                   /translation="MAQLRINPPRSMGDRQQPDDPQGCGKHDYMDIGGRAKQDARAEEQ
FT                   VSTYHMKEACFACAIYIPHLRVVIFPG"
FT   CDS_pept        613094..613285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00491"
FT                   /db_xref="GOA:D4ZFP2"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP2"
FT                   /protein_id="BAJ00491.1"
FT                   /translation="MGLEFFVLSWVNDHSNIGRAWFKVKQDFLNFLAQILLILGVFLSV
FT                   TRSSHMGILESAFHWNLL"
FT   CDS_pept        complement(613496..613645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00492"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP3"
FT                   /protein_id="BAJ00492.1"
FT                   /translation="MNMVMNEYEIAKQQKFRLENFKLAIEFISSNESRFNQTRHLFLQD
FT                   GFSD"
FT   CDS_pept        614490..615899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="SVI_0522"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00493"
FT                   /db_xref="GOA:D4ZFP4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP4"
FT                   /protein_id="BAJ00493.1"
FT                   /translation="MSQDTPKADTNMSFSTLTLKPELIENLKTMGYDSMTAIQAQSLPA
FT                   ILNGEDVIGQGKTGSGKTAAFGLGLLHKLDVKRFRIQSLVLCPTRELADQVAKEIRTLA
FT                   RGIHNIKVLTLCGGVPMGPQIGSLEHGAHIIVGTPGRIIDHLSRDLLNLENVNTLVLDE
FT                   ADRMLEMGFLPDLDYIMAEMPRERQTLLFSATFPKQIQKVAEQIMFKPVMVKVASTHDS
FT                   NTIDQHFYQIDSNKDRQKALRLLLLQHRPDSAVVFCNTKRETKDVAATLANDGFSVVAL
FT                   HGDLEQRDRDITLMQFANKSASIMVATDVAARGLDIEALDMVINYEFAFDTEVHIHRIG
FT                   RTGRAGSKGTAFTFYTLDDDYKIKLLEEYLERDIVSEGLPPENLLDTFPTQPRMVTLQI
FT                   EGGKKNKVRPGDILGALTGEDGIKGSEVGKIKITEFRSYVAVDRKAAKRALHKIVNGKL
FT                   KGRTYRAWEMR"
FT   CDS_pept        complement(616314..617750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0523"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00494"
FT                   /db_xref="GOA:D4ZFP5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP5"
FT                   /protein_id="BAJ00494.1"
FT                   /translation="MSFTSLGLSAPILKAVASKGYETPSPIQAQAIPAVLEGKDVMAAA
FT                   QTGTGKTAGFTLPLLELLSRGNRAQAKKVRALVLTPTRELAAQVAESVETYGKYLPLKS
FT                   AVIFGGVGIGPQISKLGKGVDILVATPGRLLDLYNQGAVNFNQLEVLILDEADRMLDMG
FT                   FIHDIKKILRVLPAKRQNLMFSATFSDDIRKLAKGLVNNPVEISVTPRNATAKSVEQYI
FT                   YMVDQKQKTAALIHLIKQNDWKQVLVFSRTKHGANRIAKNLEANDLTAAAIHGNKSQGA
FT                   RTKALANFKNGAVRVLVATDIAARGIDIDQLPNVVNFDLPNVPEDYVHRIGRTGRAGAS
FT                   GQAVSLVSGDESKLLRDIERLIKQNIPRKEVEGFVPTQIVAETDLNDSKHGQNRGPRNA
FT                   NGRGNGRNGNSGSRSGSRDSRSSQGKVEHKDGQRSGEAARGHKPNDSNASHRRSSSQAR
FT                   TTNSASSAASKPSNTSIWGK"
FT   CDS_pept        618302..618511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0524"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00495"
FT                   /db_xref="InterPro:IPR021948"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP6"
FT                   /protein_id="BAJ00495.1"
FT                   /translation="MKKSIVGYLKDDENHWVAKLSCGHYQHVRHMPPWVVRPWVITDEG
FT                   RESMLGHRLDCKKCDLGLPKDVNE"
FT   CDS_pept        618592..618945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0525"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00496"
FT                   /db_xref="InterPro:IPR022069"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP7"
FT                   /protein_id="BAJ00496.1"
FT                   /translation="MTQTKKFDFRIVQDKQVWAAEITRRMTARKTIVSKRKTGFATEAE
FT                   ATVWGEKELKSFLDKLMLRNERKAKQREVRTEAAASKEQAADAWRDARDVADGESSGSF
FT                   DEDNDDYASDESK"
FT   CDS_pept        619445..621280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="SVI_0526"
FT                   /product="ABC transporter, ATP-binding protein CydD"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00497"
FT                   /db_xref="GOA:D4ZFP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP8"
FT                   /protein_id="BAJ00497.1"
FT                   /translation="MDKSLEKQLTSWLRLQKKACGFYLNLTVLFGLLTGLSLIIQAYLL
FT                   STILHGVIILELDKSHYTHEFILLLVLIPIRALLAFARERACFESGKRLRLQIRSAVLD
FT                   KLTELGPAFIKGKPVGSWASIVLEQVEDLHDFYARYLPQIILAGFIPLTILIVVFPLNW
FT                   AAGLILLATAPLIPMFMILVGMGAADANRKNFSALAKLSGHFMDRLKGLPTLKLFNRGD
FT                   AEVKEIETASEEFRERTMSVLRMAFLSSAVLEFFSAVSIAVLAVYFGFSYLGHLNFGDY
FT                   NGGVSLFIGLFVLMLAPEFYQPLRDMGTHYHAKAQAIGAAEELMALLEYRVESNSVESK
FT                   SGGKEIKHMAVNDKAIDWQAGVEIEARDLKVLSHDGATLVGPVSFHLSPGQHVAIVGPS
FT                   GSGKTSLLNAMLGFLPYEGSLKVNGLELSELDMTLWRRHLAWLGQDPQLFHGTVRDNVA
FT                   MADVAMGDEAIKLLLEKANILEFVEQQSLGLSHPIGEQMAGLSVGQAQRIALARALGQD
FT                   AHLYLLDEPTASLDSHSEQAVLSTLWQAMDKTSCLMVTHRLDQLHQMDTILVLDAGAIV
FT                   QRGSFEDLNRAEGLFKLMQEDETDVEAQANKESNS"
FT   CDS_pept        621277..623070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="SVI_0527"
FT                   /product="ABC transporter, ATP-binding protein CydC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00498"
FT                   /db_xref="GOA:D4ZFP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFP9"
FT                   /protein_id="BAJ00498.1"
FT                   /translation="MRALLPFIKLFKHQWLMMCIGLILSITTLVAGIGLLSLSGWFLSA
FT                   AAVAGLTAATAMMFNFFTPSGGVRFFSIIRTASRYGERLATHEATFKLLTQLRTWAWRK
FT                   LMPLSASNMQGIRQGDLLNRLVADIDTLDHLYLRLLTPMAASFLMLGALYFFVAWFDAD
FT                   LALILCGSLLLVWLVLPWVFYHLGRKPGVDLLESKRIYRVQVLEFVQGLAEISLFGANE
FT                   RFRTQLAESEAKLLASQSAMANVTALSQGALILCHGLVVMGILYMASSGVGEHQPPGPM
FT                   LAMIVFMTLACIEMLMPIAGAFQHLSSCVTAAERVNELVEQEPGIVFNNVSDIRVQHGE
FT                   LALKGIFFSYEQGSQLDTQQVVLQDINLNIKPGEKVALLGQTGCGKSSLLSMITREWQP
FT                   QSGNILLDGVEIDQYSQESLTDGITLVSQRIYLFSGTLRDNLTLVQKSVADLPTRAERR
FT                   AAQTANDEILVGVLDKVGLSNLIQGDKPLDAWIGEGGRQLSGGEQRRIGVARALLRDAP
FT                   VLLLDEPTEGLDKRTEREILALLFEFAKDKTLLMISHRLTAMTQMDKIHLMEDGQLRVS
FT                   GSHDDLLVKDEYYASLYHKLN"
FT   CDS_pept        complement(623246..623422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00499"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ0"
FT                   /protein_id="BAJ00499.1"
FT                   /translation="MSDKVLDLDEVSKLLGKSEATIKRYARENLLTNIGENDEYKFNED
FT                   EVNRYLEFSKRLG"
FT   CDS_pept        complement(623608..626802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0529"
FT                   /product="proline
FT                   dehydrogenase/delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00500"
FT                   /db_xref="GOA:D4ZFQ1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ1"
FT                   /protein_id="BAJ00500.1"
FT                   /translation="MEVITMFKASEVLTGHYDSANLDELFKAITNNYIVDEEQYLSELI
FT                   KLVPSSDEEINRVTKRAHEMVNNVRQYDKKGLMVGIDAFLQQYSLETQEGIILMCLAEA
FT                   LLRIPDAATADALIEDKLSGAKWDIHLSKSDSILVNASTWGLMLTGKIVKLDRNIDGKP
FT                   SSLLNRLVNRMGEPVIRQAMLAAMKIMGKQFVLGRTVKEALKNSLDKRKLGYTHSYDML
FT                   GEAALTKTDAQKYFEDYSSAIASLGEQSYDESQAPRPTISIKLSALHPRYEVANEDRTL
FT                   TELYDTLIKLIQQARGVNIGISIDAEEMDRLELSLKLFQKLFNSDAAKGWGVLGIVVQA
FT                   YSKRALPVLCWLTRLSKDQGDEIPVRLVKGAYWDSELKWGQEKGEAGYPLFTRKAGTDV
FT                   SYLACARYLLSDATRGAIYPQFASHNAQTVASITDMAGDRNYEFQRLHGMGEELYDTLL
FT                   AESGVKTVRIYAPVGAHKDLLPYLVRRLLENGANTSFVHKLIDPKTPIESLVVHPLVTL
FT                   QKYKSFANSKIVLPSDIFGEERKNSKGLNMNIISESEPFFAALDKFKDTTWNAGPLVNG
FT                   ELLSGETNEVVSPYDTTQVVGKLAFANNQAIEQALTGADAAFSGWCNTPVEVRANALQK
FT                   LADLLEENREELIALCTREAGKSIQDGIDEVREAVDFCRYYAVQAKKMMAQPELLPGPT
FT                   GELNELFLQGRGIFVCISPWNFPLAIFLGQVAAALAAGNTVVAKPAEQTSIVGFRAVQL
FT                   AHQAGIPKDVLQFLPGTGATVGAAITSDERIAGVCFTGSTGTAKLINRTLANREGAIIP
FT                   LIAETGGQNAMVVDSTSQPEQVVNDVVASSFTSAGQRCSALRVLFLQEDIADRVLEVLK
FT                   GAMDELSIGNPSSIKTDVGPVIDAMAKANLNAHIDHIKQVGTLLKQLELPAGTDKGHFV
FT                   APTAVEIDSIKVLEKEHFGPILHVIRYKASELAKVIDEINSTGFGLTLGIHSRNEGHAL
FT                   KIASKVNVGNVYINRNQIGAVVGVQPFGGQGLSGTGPKAGGPHYLTRFITEKTRTNNIT
FT                   AIGGNATLLSLGDSDE"
FT   CDS_pept        complement(627108..627650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00501"
FT                   /db_xref="GOA:D4ZFQ2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ2"
FT                   /protein_id="BAJ00501.1"
FT                   /translation="MLSPSLLAAGQAGYISDKVYLYLHGGPGTQYRILGSIEAGQAISL
FT                   LGETQGNYSKIIDHKGREGWVETKMVTRKKSFRQQLPEVQAELDKTKSELEQNLSSSDN
FT                   NTQLLSKLKSDLSRAQRDLATASSERDRATSQLASIEKNERFQMWQEGGIIALIGLFIG
FT                   VVLVYLPRPRRKKKNHW"
FT   CDS_pept        complement(627940..629208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0531"
FT                   /product="phosphate transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00502"
FT                   /db_xref="GOA:D4ZFQ3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ3"
FT                   /protein_id="BAJ00502.1"
FT                   /translation="MVDVLVTNGPLLIAIAATFGFLMAWGIGANDVANAMGTSVGSNAI
FT                   TIKQAIIIAMIFEFAGAYLAGGEVTSTIRKGIIDSSYFVDSPELLVYGMISALLAAGIW
FT                   LISASALGWPVSTTHSIIGAIVGFAAVGVGTEAVEWGKVAGIVGSWVVTPAISGFIAFM
FT                   IFQSVQKLIFNTDNPLKNAKRYVPFYMALAGFMMSLVTIQKGLKHIGINFSTPEAYGLA
FT                   IGVAVIVGIGGMLAIKRLKMDDKADRQTQFGNVEKVFAVLMVVTACCMAFAHGSNDVAN
FT                   AIGPLAAVVSVVNSGGEIGSQAAIVWWILPLGAVGIVMGLAIFGKRVMKTIGKNITHLT
FT                   PSRGFAAELAAASTVVIASGTGLPISTTQTLVGAVLGVGMARGIAAINMGVVRNIVVSW
FT                   VITLPAGAALSILFFFTIKGIFG"
FT   CDS_pept        complement(629233..629913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00503"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ4"
FT                   /protein_id="BAJ00503.1"
FT                   /translation="MPVNSILGVFAKSPIKPLQEHIDKVHECASILVPFFDATVAGNWD
FT                   QAIELRKQISATEREADSLKREIRLTLPGGLFMPVERTDLLELLTQQDKIANKAKDISG
FT                   RIIGRQLLIPQEIQVPFAAYLSRCLDAVVLAKQAINELDDLLETGFRGREVDLVAKMIA
FT                   KLDKIEEDTDVLQIKIRRQLFAIENDMNPIDVMFLYKIIEWVGDLADLAERVGSRLELM
FT                   LARV"
FT   CDS_pept        630199..631701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0533"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00504"
FT                   /db_xref="GOA:D4ZFQ5"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ5"
FT                   /protein_id="BAJ00504.1"
FT                   /translation="MNAEIELKLLFQLEQQQTLISLLDSLPNSEQQACRKLSNAYFDTP
FT                   DLQLRLWDMGLRVRGCDGKREQTIKTAGTVIGGIHSRPEYNLDIDQAEPDLNLFPSNIW
FT                   PDAANITAVQSQLTCLFDTDFERRTWHIYVDESLVEVALDIGEVSVTRDGETKSEPICE
FT                   LEFELMAGKTGALIELGIKVAETIPMRLGKASKAFRGYRLAAQSSPLSLEVLEFIALEA
FT                   GQDLKQTLTSLLSTGLDRWQQLEAMILETDVHSLEQVPTLCYRLRACIRLLRCTLEQFN
FT                   LLSDSLNANFDSIEGHLSFVETGLSLSEVLSHNCQLIAKQPTKAKLAEQALRALQQLSI
FT                   SSLMQKMLADTCYGSLQLSLVDLLFAIRAGETRVDIKTDLKTFADQMQEASWQKILGLM
FT                   PSEADLTSCEYQSFARALDDSIFVGVAYGELYTRQSRDAFRAPWQDLVLGIRTLAAYRQ
FT                   LAHISKSLDIDISDWLQNKEESLVFAMEHSRRSALSNLPYWR"
FT   CDS_pept        complement(631747..632553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0534"
FT                   /product="voltage-gated potassium channel family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00505"
FT                   /db_xref="GOA:D4ZFQ6"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ6"
FT                   /protein_id="BAJ00505.1"
FT                   /translation="MANLSRWLPETETHPTPFQLAMMVLSFLSVIVVLVLTFAKVDEET
FT                   RRLLLIIDFSICMIFLSYFFFNLFRAENKLQYFKHNWIDLVASIPAIEPLRLARLFQIL
FT                   RVIRLIRMTHSLIIPMVKQRRQATLASLLVAMVTILTFSSVLMLIVEAGVPNANIHTAE
FT                   NAIWWALVTISTVGYGDFYPVSTAGHVIGAIVIICGVSFFGVISGYMASIFIAPDETEK
FT                   LELQSEEIKCELKMAIDRMEQNQNVLLAEINSLREEIREGKEDPSS"
FT   CDS_pept        complement(632627..632956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0535"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00506"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ7"
FT                   /protein_id="BAJ00506.1"
FT                   /translation="MTKKKNSLPEQWLQNQKAAKATQVAFDLDEKFQYSIRKAALDSGF
FT                   SPSDQIRTILGLSVTKRPKRPRLTVSLSPEDYVQLAKMYDLSPESQLEIKKRVLDDLIH
FT                   FSDKN"
FT   CDS_pept        complement(633045..633728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0536"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00507"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ8"
FT                   /protein_id="BAJ00507.1"
FT                   /translation="MKYINQSGVMMSFLKGLFGKKEAPQRQLDHPSKLLKGDMISLDDS
FT                   FALPPQLRGQQLRVESISTYEYQRSQQTEWILKGHGNDTVFLSLDEDDETYLAFSIKIN
FT                   RSMVEHIFDLDQFGAIFEEDEQAQLTTLKLPSELVSEFSQWLGKEYHQVNFAQFGYFHR
FT                   EDFRGKKPPQDADGATGDEFESYHLLDEDEKYAVDVEVYADGDTDVMLTLYRPLADIRD
FT                   YWPGK"
FT   CDS_pept        633771..633863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00508"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFQ9"
FT                   /protein_id="BAJ00508.1"
FT                   /translation="MVSLLQAICGLRQKSAFLYEKKSAAVLVKA"
FT   CDS_pept        complement(633902..634588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0538"
FT                   /product="PspA/IM30 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00509"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR0"
FT                   /protein_id="BAJ00509.1"
FT                   /translation="MGILNKILTAFRGGATEVGQTIVDANSTRIFEQEIRDAEKHLTKA
FT                   KRELTDVMAKEMQASREIDRLKRSVTEHEGFATQALEQDNETLALEVAEKIAQLDQELL
FT                   EQQSANDSFSAHAARLKDLVRKTERQLTDYQRQLTMVKTTESVQKATASITNSFAGSNS
FT                   KLLNAKDSLERIKARQQQFDDRLKASEALEDENSDKSLHAKLAEAGIGEQKSNANAVLE
FT                   RLKARK"
FT   CDS_pept        complement(634672..635103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00510"
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR1"
FT                   /protein_id="BAJ00510.1"
FT                   /translation="MSKRTNMNIHNIANHLNDLCDKSHTGLQFDCYPIDGEVEVLQVNI
FT                   VGREEIPVFVSVTENQVLCISYLWGEDEVKQETRMAMFETMLELNIPMPLSSFAKVDDK
FT                   YVVYGALSVHSDMQEIEQELSVLSDNCLEVIDEMSDFLK"
FT   CDS_pept        complement(635144..636886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="SVI_0540"
FT                   /product="probable spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00511"
FT                   /db_xref="GOA:D4ZFR2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR2"
FT                   /protein_id="BAJ00511.1"
FT                   /translation="MTESALNTGSTNQERKLSWFDDTLLLGIMAVLAGCGLIYEYLLSH
FT                   YAGRILGALEAAIYTMIGLMIVSMGVGAFAARKIRCAYTGFAVLELSVALCGSLAILIT
FT                   AAVIGFGQQLPLIIASTLGLPPDQLPEGGFIGLLQHLSEYLPYFWGILLGLMIGMEIPL
FT                   IARVRQSLCDEHLMHNAGTIYGADYIGAGIGAAIWVTFMLAIDIQLAAALTASFNLLAG
FT                   FIFIWRFWDRIKFVKVLLVGHFIASGILLLLAWHGPGWEQNFNNLLYKDQVIYAKSTRF
FT                   QQLTFTERLRGSGIDPVYSLYINGRLQFSSIDEHIYHAFLVHPTMEAAARHDKVLIIGG
FT                   GDGLGLKQVLKWQPKHVTLMDLDKDLLALFTSHDADMPKRLSQTLLKLNGDSLNDPRVE
FT                   VLVDDAFNGVDKLLKKGEKYDVIIVDLPDPSHPDLNKLYSDLFYKKLKELLSADGALTV
FT                   QSTSPYHAPKAFISVGKTLALAGFDVSQYHHNVPSFGEWGWSIATASGKNAKARLSNIK
FT                   QLSITDDWLTPGLIKGAFEFPGNFYKDIDKIQANRIGSMQLYQYHQQAWDENQGVMIFF
FT                   KNST"
FT   CDS_pept        complement(636960..637859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0541"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00512"
FT                   /db_xref="GOA:D4ZFR3"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR3"
FT                   /protein_id="BAJ00512.1"
FT                   /translation="MTIFQHFGITTDLAIILVIDLTIAIILLTLMRYLQGWTAKVDSRV
FT                   ELAERDNFAFGISTAGAIAGLGIVLTGAISGEAASSYAAEAIGMSAYGLFGLILIKLGR
FT                   YLHDKIALNEFNKGEQILKGNISVAIVDACAAIATAIIIRSVLIWAEDLTVDTFIAIFS
FT                   AFAISQLMLVLLTRFREHRYAKRNQDASMQDALVQGHTAVAIRHSGYMLAMALSFNAAS
FT                   HFIIYNPQAYIANLIGWLIFSVIMLVALTVLIKIVKKLVLSNINLAQEVEQQHNIGIAT
FT                   VELAISVAVALILTSLMY"
FT   CDS_pept        complement(637873..638832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00513"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR4"
FT                   /protein_id="BAJ00513.1"
FT                   /translation="MAAMLMRILTVTLLFTLVGCGDDRPDKIAQFQQLAGQRIDTLGQM
FT                   LNDGQIRNAMLLKQYTSIMQQQKPEMAPLFGELAKDATTKGPMYTSLMSRYRDLGNASK
FT                   YVDLDQQLSEAENVYYAADPSLYNDMISDPLNVVADMSDGALARVNSISREASALANGA
FT                   DNFGAGSQLVGNPGYGSWQTGSSGTSFWAWYGMYSMFSNVMRGPIGYDRWSGRRNYSYY
FT                   NDVGRSRYTSPKQASAQNKTFERTKKQFSSQGKKFDSPYAKSRSGSTSLSRQSTSTPKA
FT                   STTGTRSKSSSKFRSNYSKNSNFRNSNSRTTRGVRRGK"
FT   CDS_pept        639080..641965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="SVI_0543"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00514"
FT                   /db_xref="GOA:D4ZFR5"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR5"
FT                   /protein_id="BAJ00514.1"
FT                   /translation="MLRIMITMENISNKPLSAIIVKVADRYWQRLNEAWPELPSTLSQQ
FT                   QSDELYRIMGLSDFVAEQLCRHPDWISPLFNGLLDNLERQSLDKEVHELLEACTSEDEV
FT                   KLHLRRYRNQQMVRLAWRDFFGYVSLEDSLLDLSALSEALVIAGRDWLYTDMCKQLGTP
FT                   CDSDGNPQPLLVLGMGKLGGRELNFSSDIDLIFTFPEHGETQGGRRSIANQQFFIRMGQ
FT                   RLVNLLHQVTVDGFVYRVDMRLRPYGESGPLVVSFSGLEDYYQEQGRDWERYAMVKARA
FT                   LGPWTAYSDELHSMLRPFVYRRYIDFSAIESLRKMKQLITQEVRRRQLTDNIKLGAGGI
FT                   REVEFVIQSFQLIRGGREPSLRQQSLFAAIDTLYSLGQLEYLVVDELKQSYLLLRRVEN
FT                   LLQAIGDKQTQTLPDNGLDWYRLCHAMGMASEAELRTHIESAMSKIHRHFKDTVGGHDQ
FT                   DEITDLWTQDLWNVQEDDHAQSLIGEQAIEDPDLWPLLKQWRDTIAKRSIGPRGRDTLD
FT                   KLMPWLLRELINFDSPSKAFAAVSKVLDQILTRTTYLELLYENPGARQQLVSLCQASPW
FT                   IAEQLAKFPMLLDELIDPTQLYDTTSLDDYGSELRQYLLRVPEEDMEQQMEVLRQFKLS
FT                   QQLKIAAADVTGVLPVSEVSEHLTLLAEAVIDQVVTQAWLQIISRHGVPGHLEDGDMGF
FT                   AVIGYGKAGGLELGYGSDLDLVFLHNYSREIYPEHRETDGDRPIEIGHFYLKLAQRILH
FT                   LFSTRTTSGELYEVDMRLRPSGSSGLLVSEIENFGQYQKEEAWTWEHQALVRARFMFGA
FT                   NELSSRFSQIRSQVIELERDKHTLAKEVRGMRLKMRDHLLKSAPDMFDLKQSEGGIADI
FT                   EFIAQFLVLAYAHDHDELSTWSDNLRIFEALGELELLPLIDVQSLIQAYFFLRDESHRL
FT                   ALQHLPAQILKNKVEEHAHRVMDIYRRVLQS"
FT   CDS_pept        642144..650564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00515"
FT                   /db_xref="GOA:D4ZFR6"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR6"
FT                   /protein_id="BAJ00515.1"
FT                   /translation="MKLDLIYTCFLLLTRWVSRFISSLLSGGHHLSKLISKLVSREGDN
FT                   VTHLSGLLLLITCFLAVQQAKAVEHELESLSADITETELIIIDPAVHDPYMLYQALNAK
FT                   FRQHLGQNSKTQIVFLRPELEPLQQILIAIKDKPNLSQLSIISHASNGAIFLAGKWIDK
FT                   DYINQHKAMMSEIGSSLKKGADLKLYGCNLAAGLSGKRFVNRVAELTQLDVAASTDTTG
FT                   GAKQGHNWELEYKVGSINSRSLFSEALPTSYSSTLNHFRYGTMAVEPITGESGKVRLKV
FT                   QIGYTLNHYIMTQLVNSPVGTVNCQMPYLQSFSWGDGQGQGGICVQLLSKDTATNDALV
FT                   EVVSIGANGYEPGLVHQYQADGNYTLSWSSYARSPAMSQDNAYWRAEASTSVVNGEITN
FT                   ASPVTAVSALVYVRDDHPFTMQISGVDQNGDQIRYRWGKQKEFYSGNSNNEVKKPTGMQ
FT                   LSAEGLITWDLAADLANGDLITYTDNANPSTVTSNRWQAAIVLEDLDINGVVKSKAPLD
FT                   FVFIISDPDNASPGFNPAPEITATQYIQLHQTTTFTITATDVDENGDPDVPSISVLNPP
FT                   STDTAIWSTSTISQDPTTGTSVIEVTFSPSDDMLGKAYAVIFSAKDSNGITSEAAVNLV
FT                   IVNEAPIAQDDSAFTQQGQMVIVDVLANDSDPDGDPLTITQFNAPNGTVVLNPDNTISY
FT                   TPDANFSGLEIISYVISDGIGSVASANILVTVNGKPIAQDDLFTINEDTSSVLDVLAND
FT                   SEPDADTLNITLTSASFGQLSLVNNLVTYTPNGQFYGTDTFSYTISDGLGGSDTASVTV
FT                   TVVSINDLPVANNDLAEIDEDQSIAISVLANDSDPENDPLSVTAHQSLHGTTSVNLDQS
FT                   LTYVPALNYFGPDQITYTISDGNGGESTATVAVTVTPINDAPVAIDDVATLAEDTSVLL
FT                   TPLSNDVDVEGDLLSYVSVVASSGLVTVNADMSVLYTPAENFQGNVQINYLISDPSGLQ
FT                   SAAVISVSVTQVNDAPKANADTASVDEDGTLTYAVLDNDTDVENHALTVSVAQSSHGQA
FT                   NVEANGSITYVPDPDFNGSDSVIYTIDDGHGGQDSALFSVTVNGVNDEPIAVDDSVTLD
FT                   EDASVTVPVLANDSDVDGDSLTVTVQSSVNGTASVTALGLVLYTPNANFNGADSLTYTI
FT                   EDGNGGSASAVLSIFVSSVNDQPLAMNDTASLDEDTSIRVHVLANDSDLDNDLLVVTAQ
FT                   SASHGDVTVGLDGSISYMPEQDFNGVDSVTYSIDDGHGGTAQALLTITVNAVNDLPVAV
FT                   DDYAYVTEDGSVTFSVLSNDTDVDNDVLTLTLNAASNGSTINHNDGSVSYTPDANFNGS
FT                   DSVQYSVSDGQGGEAQAVIYLNVTAVNDAPVAEVDLISMEEDTSLNFDLLLNDTDVEFS
FT                   LNPASAELLDLPQHMSVRVVNGVVTLTPDADFNGSDSLTYRVSDGEGKASNIAVVTIEV
FT                   AAVNDAPRPEPDFVSVDEDITSDIEVLANDIDIDDSGESSLDIHSVVVVQAPLHGQLTN
FT                   VDGVLSYHPDSNYVGSDSFSYTVADMIGAVSQASLVTLNVQGINDAPVAVSDSFTSDED
FT                   LGISFNVTTNDTDIDSQLAPESVSIFSAPTHGVVSISATGELTYTPNADYFGDDSFSYT
FT                   VKDAEGAVSLPGTVSVSLASINDAPRLDDDMAQLMEDGVNDINVLGNDLDIDGELVLAS
FT                   LMVTVMPEHGTVSILASGLLRYTPDDNYYGADSFSYSINDNDGVTSEANVQITIDSIND
FT                   RPMAQDDGAVLDEDSLITLDILANDTDLDGALDVSSVIIINAPTSGIVEVNSDGSLLYI
FT                   PDANFNGSDSFSYQVSDDGGGSSEIAFVSLDVISVNDAPQISGNAPETLIEGESYQFTP
FT                   SSLDIDNDTLIFSITGLPIWASFDGLTGTLSGIAAYENVASYGPMVISVSDGVIEVELE
FT                   AFYIQVEVLDSDGDSIPDTIEIELGLDPFDAYDAGQDADGDGLSNLDEWLGGSNLYLDD
FT                   VAPELIIPDDIWIDATGLFTGVSIGQAQAYDYVDGVRQICCEDLSNTMVSDQPELPPGT
FT                   HQVTWTAVDAAGNVSELIQNIFVRPLISLPQDQIVSRGNRVLVSVYLNGPSPEYPLSVA
FT                   YSVAGSAVEGLHHDLTSAVVTFEPGQVVARIEFTALDIEVDALQDELVSIHLDDQLNLG
FT                   SKKDHYVTITLDNLAPEVQVSSYQSEELRTWVAQVNGVVEVQASYSDPNIQNSLTLDWS
FT                   LTDSELQEVQLPEGQEVMQKVSSLGVNNIKLQTWLFDPSGLAEGVYTIRAKVTDDGEPN
FT                   LSHFSELRVRVSEHLPLLTMADTDGDGIADIEEGLVDSDGDGIPDYLDPIVAANVLPER
FT                   IVNTESYLVECESGVKCRLGQYAMSGVYMGAQVAGSDIHANLQGIMPGDFVDVGGVFNI
FT                   EALDLSEQNQAVNIVIPQRNPIPENAGYRHFIHDKGWFIFSVNADNQLMSAPGAAGYCP
FT                   PPGSDEYTDGLNQGDWCLQLVIKDGGINDADEMVNGAVNITGCLIQEELVQPGSETVEV
FT                   EILTEGGGASSGASMQIFILYLLAIIAFFRNGFLRNGLFRNGLFRNGLLNNRRLKSLRH
FT                   RCQVHRLSLLVTIIFVSLTTQVKADSAPQVIPEDVSQTGFFISGLFARSQGSDNTGDIN
FT                   QFLVDAGLNAQVFEIDDSTSGWKLGAGYAFTPSWSVALEYIDLGEVSVRIKGVTDDPEA
FT                   FYATASQFHPDSAKGLGLNLGYRYQFITDVSALLHLGLFHWQADFTSYDIDTQQVATSE
FT                   DDGNSLYGGIGVEYALTQNIRFSVQWSHFSLDEQSRDLIGVGVQYQF"
FT   CDS_pept        650767..651522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00516"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR7"
FT                   /protein_id="BAJ00516.1"
FT                   /translation="MKPLFCHLGRGWVPSGIQTVSDLFGQLVTQVSRRVSYSRFLTIKD
FT                   IKFFNCAGIVLASLLVSPLAHAELTMQVQVSRELIIMDLSVHDPKMLVEALNTKFKQHA
FT                   GHANNTKIFFLKPNKEPLLQIKNAIEATANISHVSIVSHASNGALFLSERWVDKEYISA
FT                   RKTLMLEIGDLLQSGTDLNLYGCNQASGRLERSFVDILAKLTSLDVAASIDITGELSEG
FT                   RNWELGYRVRDMEVASQFNIGMTKSVHQP"
FT   CDS_pept        complement(651500..651625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00517"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR8"
FT                   /protein_id="BAJ00517.1"
FT                   /translation="MTNQNEQREIKYDSRPGINSIFILKMLHQELLYLTMADGQI"
FT   CDS_pept        651754..652584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00518"
FT                   /db_xref="GOA:D4ZFR9"
FT                   /db_xref="InterPro:IPR000498"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFR9"
FT                   /protein_id="BAJ00518.1"
FT                   /translation="MRCIMKLAVSRMNSNNKLARGLPVLSLISTGERLHSRALPPKKDI
FT                   RNKRKKSRSTFPYAWIGILCCLFIVQASVAGEADNMDLESDFFDVYDYQYMAEISQSDI
FT                   PLSPNQQRSLRFNLKLNSSGNLLELEYHFSPAWQVSFESLQLGAGVFPGANVYHSNQGY
FT                   LNFDRYNDSTGLYASSLYGLRLYEAWGASVSRIFELTDKLSTQVYLGAYHWQQEELVFS
FT                   AIDKHASSKGVSPYGGLGVRYRLSDEVNLRLDWDHFSLQGDTYDQVGIKFQYQF"
FT   CDS_pept        complement(652787..653674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00519"
FT                   /db_xref="GOA:D4ZFS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS0"
FT                   /protein_id="BAJ00519.1"
FT                   /translation="MQNINDMLVFAEVIKAGSFTKAAEVLDLPKSNISRKLTRLETHLG
FT                   VRLIERTTRSIHLTEVGQIYLQHCQRIQEEVESAELCVDHLVESPRGQLKICVSVTMGQ
FT                   QIISRNLCRFIALYPDIDVTLELTNRRIDLIEEGFDLAIRIGKLEDSSLIAKYLGQIER
FT                   KLCASPALFNLYALPSIPAELSLLPSLFMTSGMPKNQWLLSREDLVESVHLAPKIQVND
FT                   FLSLSQLCISGCGITMLPAYLCDEAIIEGSLLHILPEWQCEQSNVYALYPSHKSVTPKV
FT                   RAMLNFLEEVFEND"
FT   CDS_pept        653829..654503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0549"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00520"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS1"
FT                   /protein_id="BAJ00520.1"
FT                   /translation="MEILTKSDLREGGFAGLKEHQFVMDKKAFGPNRNPQAWDGLGNFV
FT                   YLADARFMPKGETRMHGHKEVDVISVMVRGRINHEGSLEHGQMMNAKQAQVQRAGGEGF
FT                   SHNEVNPDSEENQMIQLWVLPDRQGEKAGYKLYSPKIGELTRIYGGEIEQDQTFDSHTL
FT                   ISVANLETGHSVEQATASLVYVSDGEVEIDGARIEAGTLVRSHGFTLVALTCAQVIVIH
FT                   ES"
FT   CDS_pept        654589..655206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0550"
FT                   /product="hydrolase, isochorismatase family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00521"
FT                   /db_xref="GOA:D4ZFS2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS2"
FT                   /protein_id="BAJ00521.1"
FT                   /translation="MSKFSEVLTPDNAVLAMIDHQTGLLVSCADEHPLVVKNNIQGLCN
FT                   MAKTLGLPSVVTASLADGPNGPIMPEITKILGDKVINREGEINAWHSSEFKSAIEATGR
FT                   KKIIMAGIVTDVCLMFPALSAVEEGYDVYAVIDASATWNKTVQQASIHRLTQAGVKVTT
FT                   WASVLAEIMSDWRSDKGMELGQVLADHTTSYNYVMNSYFARS"
FT   CDS_pept        complement(655274..656065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0551"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00522"
FT                   /db_xref="GOA:D4ZFS3"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS3"
FT                   /protein_id="BAJ00522.1"
FT                   /translation="MQSTIDVSWPELALFMLVLVIPFSIDRYLKLDLGKEIITAVFRMT
FT                   AQLILVGLYLQFLFELNSLLLNLLWLTMMLLIGASAIIGSAKLPKRRLYLPIITGLVVG
FT                   ITPLIAILLLALLKPAPLYSAQYMIPMAGMLLGNCLSGNIVALQRLFSAFDEQKDQYEG
FT                   ALALGASPYQASFPFMQSALKQSFAPILASMTTTGLVTLPGMMTGQILGGIDPMVAIKY
FT                   QLIILVAIFVMLTVSVTLSLILTIKSCIEPSGLIRVVIRKK"
FT   CDS_pept        656087..656317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00523"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS4"
FT                   /protein_id="BAJ00523.1"
FT                   /translation="MVKKINIFQVDIQGKEFLASDKFIRKHNPHIPAKYIESYRLSVIR
FT                   YQWLTRPTLFRYSYYLGPNPGNPDYSHRPVD"
FT   CDS_pept        complement(656414..658657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00524"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS5"
FT                   /protein_id="BAJ00524.1"
FT                   /translation="MGRKLLVSLLLLCTFLIACEEDPLVKRQVKSIAPMDQDNLLLQID
FT                   RHISLTPRPKDTYPFPIELGGVGPADSLYSGKRQYPFYCMTIDAGLGQPLVDNQEGYGV
FT                   TVYDKNDKVIGYSKDCMTTSRIDYFYTLTGTDKIRAYDLSSPPAKAEIATTEIQGKSVP
FT                   EIYRLERGSINRYIYYIAMLVPEEGLGQRQDKRYWNNKLIYQFKGGASIGFRQGQMGAS
FT                   RLINRRHTLLRQGYAVIASSGNNTSYSYNMLLAEDTARRVKAQFTSLYGDPLYTLGIGG
FT                   SGGGLAQYLIAQNSTGVLDGIMPIYSYPDMVSQSIFLLDCDLLQHYFNVTDNGNSKWKD
FT                   WEQRENIEGMNGINGFDHPYTFLIPLNQLFAGAWPSMPNGSSECVYSWFIAATFFYNPK
FT                   QGFVKPYFSDEVKEQVNWTYWQDLAQIYGTDSNGFALTTWGNEGVQYGLRAMQRGDISI
FT                   DEFIHLNQYIGSWVPQNKMRKESALTPFGMKFPIWLSLWSRNNITEPEPDIAKRKPSDP
FT                   QAIVNGYKYGQIFIGKAELPILEIRHYLEDDLNMHHTLASFETRLRIQEYQGHHDNQVV
FT                   WISHKDHIPIDKGMEYLDQWLMAIRASEDKDPVTSKPTDLVDTCIDHLGQVQFAGEHVW
FT                   DGEWNKRPVGKCSKIYPIYSNIRVQAGGPWAGSIFKCGRIPVGDAIKAGLYGKTPIHAY
FT                   QQRLENIFPDGVCDYTQGDISKPDLGLTPSLQARKNKQVSPVSAVGVIQSLEK"
FT   CDS_pept        complement(659212..659313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00525"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS6"
FT                   /protein_id="BAJ00525.1"
FT                   /translation="MSLALGAVSAQEESKSSASLVDEVNEKINHFRY"
FT   CDS_pept        complement(660110..662197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0555"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00526"
FT                   /db_xref="GOA:D4ZFS7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS7"
FT                   /protein_id="BAJ00526.1"
FT                   /translation="MIQFSSIRHQILLFGTASLLAVTLAIIGYGYFSNQALRHEVHTSV
FT                   LVQAQEQVIENINLAAQHEALKIKTAFDHAMDIATSVAGSLFPEAPGLTRIQINSMLKN
FT                   LVENNHDILGIYTGWEADKFDGSDAENTDNKYSQSDGKFAPYWTRSASGKIDIQALSDF
FT                   YTEKLTPTGVRNSEWYLCPMESRSPCVVDPASYKVQGVDTLLSSFVAPIIRKNSYVGMV
FT                   GVDYSLNFLQQLAIKAAGNLYGGAARVIILSPRGLVSADSTNKANISKVATSTDITSLI
FT                   SARQKQQTVINDTSIITSKTFAVTGTDASWEILIKVPKNMALAKASAIVEQLESGFASN
FT                   LNGQLIVSFIAAFFGMLLIWFMSGSIYRPIRELVDVVANLTQSGGDLTQEIKIKRSDET
FT                   GQLATHLNTFIANVRSIVSDVANSMGELTLSAERNAALSESGRDKISQQQMEIEQVVTA
FT                   TNEMSSTAHSVSDNAQVTADSVSTTQESVSRGQEVVQANAEGLQSLSEQMEHASNEIIE
FT                   LEKQTESIGSILDVIRNISEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLATRTAD
FT                   STDEIQQMIDALRNKSKQAVNTMSQSKDLSQTCLTHAKQAVIELDEVNKQSSKIQDMAH
FT                   QIASAAEEQAAVTEEVNRNIVAINDAAESLAQGAVSAQEESKSSASLVDEVNEKINHFR
FT                   Y"
FT   CDS_pept        complement(662338..663480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0556"
FT                   /product="AFG1-like ATPase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00527"
FT                   /db_xref="GOA:D4ZFS8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS8"
FT                   /protein_id="BAJ00527.1"
FT                   /translation="MSLSPLVKYRQKLTQPDFSLDPKQEQAMVLLDTLFEEITASPRGI
FT                   NPSGSVKGLYLWGDVGRGKTMLMDLFCDALDDKLTLRLHFHRFMARIHKEMLAESGKRD
FT                   PLVRIAKRIADECQVICFDEFFVADIGDAMILGTLFEALFKQGVLLVATSNIPIPRLYE
FT                   SGLQRDRFLSTITLLQNHCTEFHLDGKEDHRLRSLEFQQIYFLDQQADFNEFFGLKADE
FT                   KTSSNGSIKILGRDIPVIKVSDDQAWFSFDALCDGPRSQLDYIELAARFDTLFVSDIPV
FT                   LGGRPKSWIRARGTEDGAIATETGERQLSYAVGDDPARRFIALIDELYDQRVNLYLSAE
FT                   VPLEELYSEGALSFEFRRTFSRLQEMQSKQYAGSSKRRAA"
FT   CDS_pept        complement(663573..664406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0557"
FT                   /product="OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00528"
FT                   /db_xref="GOA:D4ZFS9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFS9"
FT                   /protein_id="BAJ00528.1"
FT                   /translation="MIARLPGAYIQNYQQFDFGQTTVFTSVKNGQHKVEQLEGKITDIN
FT                   YKLPRTYSEFEVNANYKAALLKLGFVQGFNCQGLECGKSRHIQKRIKTLAYIGFDEQQF
FT                   YSLYTLKRPEGNVHAMTYITGFVGGLWAELKLVEETSLVDDRVSIDLHGLTDKIAQTGH
FT                   VALEGLLFKFDSDEMLLEATPVVEVVATYLKSHPKQSFYVIGHTDDLGKQSYNQVLSNK
FT                   RAKAVVKQLLSVYKVPKSQLEAKGIGEYSPVANNSNDAGQKLNRRVELVLRSDNI"
FT   CDS_pept        complement(665073..666953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00529"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT0"
FT                   /protein_id="BAJ00529.1"
FT                   /translation="MFVKKLGLLLLSSSLLTACGGSDSDDTRLADVPPLVTDTPEPTEY
FT                   NHQVQGLVAYQGAVTGADVCIDLNMNKLCDANEPASTTDGDGLYQIDWAGTTELPTYYL
FT                   IANWTDTSNSNSNSNSNSNSDKVQPTLLSSKFKARKLKQVSVIESSSENTLSHSTYADV
FT                   INNGDAQLISMSGHQGAINALTHIEFQRYEQMINQELSAEAIQALLQQLSIILDALYAP
FT                   LTGQAYQVTADISASDAFLNTYFSHQYITALIGDRLMATLAIDEVMAASKASMEYLALQ
FT                   TGMTIGDYLASDPIDVRFIVNDTLIAQGYIVTPFDNKIMTDADWLILQSNLLSDDITSH
FT                   GFTLAPTHLNNFYSLEYGNTAQSLSGFISNNTLSGSVIDTGDTQALAMTCWNEQLGKWI
FT                   NPDRNDQGYQPIAAEYANNTINTHYQGTSVAINIKIEKYNTNSETWRAILNSQPEQLKL
FT                   TELEWPEYVYRYHIEQIYDVICHTESNVSIWDMPLHNSAEMLTTADIARLFWAEFYPND
FT                   VVIDEDNQQLSVEYTTGVTSTFEWQLNISPIGLPLIRTIEVNLPVASSGSSIFGEYLVD
FT                   DTKIIEVEVHQAISFEDMNDFLLLSYDGETNNFSQRFLEHLSRLLPTSQP"
FT   CDS_pept        complement(667161..668708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00530"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT1"
FT                   /protein_id="BAJ00530.1"
FT                   /translation="MANSKYSCTRIYPALIGLLLAGSVTASEVSDSSDTRLQDTQEAIE
FT                   TFQNSTKALLDNAHQLNDQHAVQMQQLTDVLQQTESAKAVLQSNLIGDIEHNSTKMLVL
FT                   ANQYVSHYRTFINSIRHESTCYQPKQVGEFEQTIAELEEYVGSIQQLAATQDSTEAFAA
FT                   LMEININQARVSMVVNLFEMFKLCYLTEAIGPLGQEFEALSKVLEQEAAKLGYVQDTDA
FT                   REQADTSELTDANSHPKITAKYRDNIVQIYQFKADAVPHFNELTYLYIDNIAQLKGLTF
FT                   SNGLSVNDDLSLKLPASAQANINQNYQAKINGTIETDAEIVTLDITVERAATSLIGDIQ
FT                   FIDKQVKNCVNQAAQLNKMTYSHQLTQLNCTFIQAGIIRFDDLTQFKQLNMLSVKGGAL
FT                   DSLAPLASLSSLNTLYLSQLAVNQFDGVSQFTGSLNFSNVSSSDWAKLALSNADSININ
FT                   QLDNCQSLQPLTNASNVAVMYKGLDANELMAAMGQIDNGTKSVMVMTNCTKIQVNSL"
FT   CDS_pept        complement(668889..669356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00531"
FT                   /db_xref="GOA:D4ZFT2"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT2"
FT                   /protein_id="BAJ00531.1"
FT                   /translation="MVLINIGLLPVYLIVRYILIRLRYSIKGTLRCYVSQQRLSIPANA
FT                   IIKKPAEQLELYRDQIERITVQYKSKMHRLHVRNHIISCNLELKTGEVISLNAMYFPLK
FT                   RIVYLLRFFDYPLFTQHGQWSWSNIPSIIAVTFPVLVNITVNGLLFKQYFL"
FT   CDS_pept        complement(669612..670118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00532"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT3"
FT                   /protein_id="BAJ00532.1"
FT                   /translation="MVKYLVLIPLLFITSSAWAAAGEADYARWSKAAKKIELSQPYLLC
FT                   EQAEKVVTNQDVTLFREIFIETPATDDQVKAYLAEVHHKYFKKKYLGINNYRIEKGREL
FT                   AFENARNSLNYTVSSSSEKFGHNLELWVKYKFDTFDARNNNAHIAGGLCKLAYLQDKWQ
FT                   VISLL"
FT   CDS_pept        complement(670231..670452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00533"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT4"
FT                   /protein_id="BAJ00533.1"
FT                   /translation="MLISPCNSVHTIGMRYPIDIVYLNNKNKVLKIQRNLQPWRSSACR
FT                   GATQVLELAAGNTDNKNINQGDTLSWQD"
FT   CDS_pept        complement(670746..671048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00534"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT5"
FT                   /protein_id="BAJ00534.1"
FT                   /translation="MLLNKYTQWDECSRIAPSADRMALGVQLNKELPGFMREIIRDIYP
FT                   VDNDSFRDVINQKVMDLAFEMADLVDGDETSDESPVTQAFWDWCIAQDPQDFADF"
FT   CDS_pept        complement(671272..671373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00535"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT6"
FT                   /protein_id="BAJ00535.1"
FT                   /translation="MTEYMIIVALMAITANEGGLDKYNATAGSSIKQ"
FT   CDS_pept        complement(671399..672028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0565"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00536"
FT                   /db_xref="GOA:D4ZFT7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT7"
FT                   /protein_id="BAJ00536.1"
FT                   /translation="MYDGELFTHNQSSKNLIIVRSAAGLLNLSVNNDKNLTQAWFNTTS
FT                   NTKILIHFIDCISSHLQQVEYSLFKSGTHIAICSKLTVEDELLLIEYGFNAALPSNESS
FT                   YNLLKKLTNVIEGNLCFSNEAFSRFILSTNRAPLKKERLSLISSTTRKEQEVINLVCNG
FT                   MSNEQVANKLHVSINTIKMHLQNIYKKAHINNRGQLLLTYGQGYLN"
FT   CDS_pept        complement(672374..673951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0566"
FT                   /product="peptidase M16 inactive domain family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00537"
FT                   /db_xref="GOA:D4ZFT8"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT8"
FT                   /protein_id="BAJ00537.1"
FT                   /translation="MFTDEQAPITPSFNQLEGAPQLHKSQPIKRQPQLPQSQSLESHPA
FT                   QAQLNQGIGTWAPQIHSLNTDFTLHLFPASPSELNYIELVLINSDRPFNNIDILNTALN
FT                   ERALWLASQHSLSCIDSLRISARMHSISIKMACPSQEVPQSLSILNDSWKRSAFEHIDI
FT                   DNIRRKLKLNKHINAYSGAEIDKVWAKIILGDKHPYNQALNNQTLQDELTLDTLAELQQ
FT                   KMRAGAKWHLFMSLPSNHPVSEPVQATILTQEDLIEEAERLAKRLTRSASVTAKEEREA
FT                   REDARALVKEARETDIAAEAFINKAKVLYLIDAPSAVQTQVRVGYRLPLLASSSASNSD
FT                   TWKNEFSSSHPLSCQLLADWLGRSFSGRLYYDLREKRGLTYGIYGRCFDNPQSRTLKYY
FT                   GSTQVQHTGAFVAGILAHQGLTTEQGIGSAELSALKTYERSKYTLTIQSQHAMKLEYIK
FT                   QLTLKRSSEDLAHNQMMIKQLTDKELMQISQSIFASPPYILLRGDANKIRQDLTDKLPD
FT                   WRIQMIKP"
FT   CDS_pept        complement(674044..675483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0567"
FT                   /product="peptidase, M16 family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00538"
FT                   /db_xref="GOA:D4ZFT9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFT9"
FT                   /protein_id="BAJ00538.1"
FT                   /translation="MKTEFSLKYCLLTCCWCLCAFISPNTLADELNLNQLAAPLYHLEQ
FT                   KINYQTLDNGLQIRLLALENTLSVSIASQFSVGSRDEVSGQTGYAHLFEHMLFKGSKNA
FT                   PGDSYAQTMSSLSGQFNASTFFDFTNYYLTIPSEALELALWLEADRFIRPALTQETVTN
FT                   QQATVLEEMASTIDNQPYVRQAMEFLLKQVQGTPYQHAVIGSKQDIAQSTPASLNRFHQ
FT                   NHYRPDAMQLSIVGGLPAQTTDWVQSQFGDWVKPVSPIKAHQEYIFDNKSARAEIVDSR
FT                   GPWPALLLAWHTVGQVHPDAAAVSLLEGYLFQNRNSIIKQSGLQDPEQLLTYSIPLSME
FT                   LMGVTNLVMVPRAKISLDRLAKNIEQMINQLSSQAISEAELTQLKAQWLNLKLRQVDSP
FT                   SALARLLSATLTQDSQTPLSGPWERINAVTAADIQRVASRYFNHGYVRLDLLPPWYIRW
FT                   GKTLLEWLPHGLTDSLEDGVL"
FT   CDS_pept        complement(675660..676586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="SVI_0568"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00539"
FT                   /db_xref="GOA:D4ZFU0"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU0"
FT                   /protein_id="BAJ00539.1"
FT                   /translation="MVEKAQFSTHLFHPKYWLLWFGVGLMRLTQLLPLSIQMKLGSLIG
FT                   RLAKAVMGSRVNTAKRNLELCFPEMSASERQDLLNRNFEETGKAIFDTINAWWWSDAKV
FT                   QSHMSIKGQQHVENTLSDGHGVILFAVHCLPLEMGARVFGQFQPGVGVYRPHNNAVMEY
FT                   LQVKGRLRSNKALVSKRDLRQMIRCLRSPDVIWYTADQDFGRSSATFIPFFAMQEAATI
FT                   TGATTLARLGKAKVLPFSVVRNADDKGYTIEIMPALDNFPGENEVIDAKRGNKIIEGII
FT                   NRSPSQYMWLHRRFKTRPNQDDPSLYK"
FT   CDS_pept        676830..677654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00540"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU1"
FT                   /protein_id="BAJ00540.1"
FT                   /translation="MILLALVFSSSFYWSDVGSKQALVCQVTELESCLTHLPAKVRQQL
FT                   PPTIDSLNHAMARRGAMVLPLVDTDISGLILISPSQIPDSILVELSGKLHSFPLVEQPK
FT                   LTLWHELGHLQGGDLVDKGLMGELSDYQHEWVADCYLVWRSAREKQGLDLAWQQYHRRN
FT                   IDVMKDVSFMSHWTVPVLSQLLSRYSLEELNQFETFAALMSDFLPQVKQANQDTLDEFS
FT                   SLIHRSFSTQASLHLPSYIYWRKPALRRYFEPSLVSLLGRDGANLWLKDKSL"
FT   CDS_pept        678034..678573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0570"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00541"
FT                   /db_xref="GOA:D4ZFU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU2"
FT                   /protein_id="BAJ00541.1"
FT                   /translation="MIASIWAIRYQTKIRGAVMAKRSKAQTELTIKQILDEALQQVLSI
FT                   GYESMSYTTLSEATGISRTGISHHFPRKLEFLIRLDADIVGLFIHELDFSTPAALEGSW
FT                   MKALKNHRFCAILRLFFSLCGYSGKDTSLFKAIDIARDKAISSLGLKGEGVFNDLLGRS
FT                   AVVLLSRDYGIEVEAA"
FT   CDS_pept        complement(678644..678907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00542"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU3"
FT                   /protein_id="BAJ00542.1"
FT                   /translation="MQTSAISSFTDFDDRRIAQAHIDQHWHKLSTAQRFAFYTLAKLGY
FT                   QLLFVRQSKNENTAVARQDGLLVTIDSEGHINFNPSLVLRNH"
FT   CDS_pept        679241..679828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00543"
FT                   /db_xref="GOA:D4ZFU4"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU4"
FT                   /protein_id="BAJ00543.1"
FT                   /translation="MEIKPKPQPANEPLKRFPQLDNRELVKTSFWISQVFMIIATIVGV
FT                   YLAAQEGLSQALAFDNLTNKQNNYYLRHALYDEVSDNVNIINDYADLISETSPHDIKAV
FT                   HPSMATFIWDNMRFSAYTLETPTKILSETRRFYMGADEIITKVETRFYGAKFGAEQLKK
FT                   LTIKVSEQTLPSLKENYLALALELKQAKIIVE"
FT   CDS_pept        680069..680923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0573"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00544"
FT                   /db_xref="GOA:D4ZFU5"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU5"
FT                   /protein_id="BAJ00544.1"
FT                   /translation="MARYYLMDGYQIEVDVCHSCSGVWIDEAERTKVVQSPRVKALLSE
FT                   LDAKISTKTWLFQFLSQMPVEFNIKPKRRPVITYLLLALNIMIFAAYGFNYEMTDRVFD
FT                   NFAMRASDIVDGNHVWTLLSHMFLHGDLMHLAGNMYFLYVVGDNLEDSLGRMRFLGLYL
FT                   LCGFAAAAAQIMADPTSGIYMVGASGAIAGLFGMYLLWFRHASLTFMFVIYQKKLSPMA
FT                   FFTIWLAFNILGMLMAGEGVAYWAHIGGFAAGLVIGLLMKHKVMETNPILAMLNEPEVK
FT                   VTR"
FT   CDS_pept        681147..682712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0574"
FT                   /product="amine oxidase, flavin-containing superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00545"
FT                   /db_xref="GOA:D4ZFU6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU6"
FT                   /protein_id="BAJ00545.1"
FT                   /translation="MDMKECLWSQKSAEEPITVIVGGGVSGLYAAWKLGAAGKRVVLVE
FT                   ASPDRIGGRIETIELEGFTAEFGPMRFEPTLQPTFDNLIKSLDIEYIDFVGPTAEKMEF
FT                   PKYDVLPEESDMDALTLLKRGIMLIMGQEPNDQDWIDKQTEDDYRRWRKHQKLKGRNLW
FT                   QMGFWNALSADGVLSHQALMKVRDTGTFYHMIPENLNAIEWIIWWMRALKTVGQDLVSI
FT                   KGGTAKITDTLLSKLQAMPNVDIFQGYELLSFNECHEQQQYIELFFNHRREKVKAYADR
FT                   LILALPQLPLKKLGRSLPPHVEDLLDTVNGFAMLKIFFVTDTPWWNYDQKPQQYSNRMP
FT                   TRELHYYRRDNAEESDGYGMVMLYTDRPATEFWRHYVVDQNNHDRAEMDKNNELVNEFA
FT                   KFIARDVKHELTSDDSGKPLNLTPYAIELFSNATLDEAAEMIRRSIITYGIHDWACEPF
FT                   GAANHGWKPNVQSWKVQQTLKSFSLGSGRNNVHICGEAYSDYHGFVEGALNSVHLVIDD
FT                   LLEA"
FT   CDS_pept        complement(682853..684016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0575"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00546"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU7"
FT                   /protein_id="BAJ00546.1"
FT                   /translation="MLPLIKYRNDYVFINGMEAGVHLWNNDEHQVNLYTRFRFVDIPQE
FT                   LQNKSQSQAFDFGIQYRFLHDAWEFDTAFMSDSNKRSYGYTRTQYHWETRDWYLNPYVE
FT                   LHWKSADFSQHYYGLDQYEVGAGIEFNMGVKARYHLYSNLYLLGQFNLGRIDNETANLP
FT                   TLDTQYQFESFLGLGFFPDFSNKSIKNKTTKSESRASDASDGEFIQLAHGWATPSNLSA
FT                   IFSWQTQTDPYNNQLTSVFYGTRLTDSLFNFPIELYFTPGLVWHHDSQVQNNLAEGVVA
FT                   IKAFYTFELGPRWRLGVAEGLSYTSSVTYIEGSELEEKGYRPSKLLNYLNFSLDVNMGD
FT                   LFNRRAMDKMWMGYSIHHRSGIYEKSSAFGRIGGGSNYQALYLQWHF"
FT   CDS_pept        684506..686308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="SVI_0576"
FT                   /product="sulfite reductase (NADPH) flavoprotein
FT                   alpha-component"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00547"
FT                   /db_xref="GOA:D4ZFU8"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU8"
FT                   /protein_id="BAJ00547.1"
FT                   /translation="MLLKELSSFASPLSSGQVDKLKQLTAELSAVQLAWVSGYLSATAE
FT                   QGTNLLGSETAAQSDPAQTITILYGSQTGNGRGVASELAAKAQAQGYAVNLASMGDYKV
FT                   RQLKQETILLAVVSTHGEGEAPDDAIELHKFLASKRAPKLENLNYSVLALGDSSYEFFC
FT                   QTGKDFDDRLSALGAKPLQTLVECDVDYESAVELWQESVLEAVKPLIETSGASVVSLSG
FT                   SGIPGAAASEFTKQKPYTAELLVSQKLTGRESDRDVRHVEIDLGESGLSYQAGDALGVW
FT                   FTNTETLVEELLTKLSLDGDEAVTVGKDTLSLKQALIEKKELTQLYPGLVKDWAALSGN
FT                   AELLSISDDKALTRQFVLNHQLADLVTNYSAEVTSTQLLAMLRPITPRLYSIASSQSEV
FT                   ESEVHLTVALVEDEREGGARFGGASQFLSQAQEGAEVKVYVEPNKHFRLPENPETAVIM
FT                   VGPGTGIAPFRAFMQERAAQGIEGNSWLIFGNPHFEQDFLYQTEWQQYLKDGSLSRIDL
FT                   AFSRDQAHKIYVQHRIAEQGEELWKWLESGAHFYICGDAERMAKDVHQALLDIAVKFGG
FT                   KTEEEAEAYFEQLRSDKRYQKDVY"
FT   CDS_pept        686424..688157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="SVI_0577"
FT                   /product="sulfite reductase (NADPH) hemoprotein
FT                   beta-component"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00548"
FT                   /db_xref="GOA:D4ZFU9"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFU9"
FT                   /protein_id="BAJ00548.1"
FT                   /translation="MSENKNAEQAEPLSINEHLKTDSNFLRGTIQEGLDTAVTGSFSEG
FT                   DQQLIKFHGFYQQDDRDLRNERKEQKLEPLYSFMLRARVAGGVCTPDQWLGVDEIASTL
FT                   TSSNSIRLTTRQTFQYHGISKRNLRALIQSLDSKALDSIAACGDVNRNVMCNPNPVESR
FT                   LHEQAFYWAKKLSDNYLPRTKAYAEIWLGDDKLATSEGDDVEPVYGKTYLPRKFKMAVA
FT                   VPPDNDVDVYTNDLGFIAVAEEGELIGFNLVAGGGMGSTHGEVQTFPRLADDFGYIKAE
FT                   DTLKFAEAILKVQRDWGNRSNRKLSRLKYTIVKYGYEVFKAEVEKRAGVKFEPKRDVVI
FT                   GDRGDRYGWIKGVDNQWHLTLFIEGGRIKDLPGQPLQTGLREIAKIHKGDFRMTSNQNL
FT                   IIARVAAEDKAEIEALARSHGLMGKLITETRGRSIACVALPTCALAMAEAERYFPDFLT
FT                   KVESLQEKHGFLNQGIVIRMTGCPNGCARPFAAEIGLVGKAPGRYNLYLGASFEGTRLN
FT                   KLYRENIQEAEILSELDTLFARYVGEREEGETFGNFTVRIGVVAAVIDAAKDFHGQSSN
FT                   A"
FT   CDS_pept        688180..688920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="SVI_0578"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00549"
FT                   /db_xref="GOA:D4ZFV0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV0"
FT                   /protein_id="BAJ00549.1"
FT                   /translation="MVSAQELLALLSAPAVEQKSELERINGFLEELTPRQRVAWGLKYL
FT                   PGNHALSSSFGIQGAVMLNLVSTEKPDIPVILTDTGYLFPETYRFIDELSERLSLNLKI
FT                   FASPMTPAWQEARFGQLWDKGLEGLDQYNRMNKVEPMQRALDELDVGTWFAGLRRSQSS
FT                   TREALPILAIHGSRYKILPILDWSNKHVHEYLTEHDLPYHPLWEKGYVSVGDTHSSKPL
FT                   ELGMSEEETRFNGLKRECGLHFEI"
FT   CDS_pept        690003..690980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0579"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00550"
FT                   /db_xref="GOA:D4ZFV1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV1"
FT                   /protein_id="BAJ00550.1"
FT                   /translation="MAVDNKRIRIGVIGFGTIGKYVVDGALAHNEFEVVAIFDPSLLSV
FT                   SAEFMSAEKYRHISLMASANELVAYQQVDLVYIATPPATHIEYCRLALAQRKAIWCEKP
FT                   LSVDLMAAKKLVEELEASGLVSAVNLSLASSPILDKLVSLTMEEEHGAAQQVEMRFHYS
FT                   EWPRHWQVGAASWLSSREQGGFLREVFSHFVFLQHRLFGEMKLTNCQISFAAGGCETYV
FT                   MAQYLCGSLPVRVCGGIGGVAPDTNEWTLFTDRRAIRYSDWNKLSMGTQESWWDVDIGQ
FT                   VGSSVLLQLDEVAKMMRGKPHKLASFREALAVQVVVEQTLNSSC"
FT   CDS_pept        691227..692972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00551"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV2"
FT                   /protein_id="BAJ00551.1"
FT                   /translation="MKKILIAAAVVAVGAGGYWFNQQSEEGVSQSNEVLASVPADTPIF
FT                   SGQLKPFPIKSYINSMSQSYKTYPKEMFAELEQSDDAKAKFFVSLSKAYMDSLDSGQKF
FT                   VTTFGLADDIKSYFYTLGLLPVLKLDVQKPEAIWALLDKAEKDSGFSHQMKTLKGLSYR
FT                   SYTLTDAGDAEPIELLVSQQNGLLTITLNASMLAEETLETALGINPVTPSLADSKVLQD
FT                   IIKAHGFSNEAVGFVNHQELVKAITTQDGNLLARQVTAIFAQVGEDPLLELRTPECHSE
FT                   FTAIAANWPRTVFGLNSVSIEDNESSLDFSTVIESKNQTFLNALKSMRGFIPEYVKNSR
FT                   DTVFSMGLGIELNQLVPALTAVWDEMLQPQYQCQVLQEFQQEMSGQSPAMLGMFTGMAN
FT                   GVHGISAALIDYKFTEQAPGAQGEPSLESVDAIVSLSADNPSILFNMVKPFAPELANIK
FT                   LPQDGSPIDLSHLLPLPPEYGISPKLALKGKHLVLYTGDKAEIVANKLADEKVDNNGLY
FT                   SVYLDYSKVFAPIFSLAEMTGEPLPEEFSMMKDYNMQVQMGLDINDQGIVFDSYMNNKA
FT                   APGGE"
FT   CDS_pept        693089..693502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00552"
FT                   /db_xref="InterPro:IPR021378"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV3"
FT                   /protein_id="BAJ00552.1"
FT                   /translation="MVIAGLFLKANEVRMVSLSGTRESHELVAPKINKLTLNKNPTQEE
FT                   VSQFAAEVKAYCDEHQLDKIVMNRRASKGQGAGGAGTFLMEGVILATASVSIDLVHPAT
FT                   VRATDKRTNTLKDLKPKTVDLGKAYDLAFELLN"
FT   CDS_pept        693641..694495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0582"
FT                   /product="RIO1/ZK632.3/MJ0444 family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00553"
FT                   /db_xref="GOA:D4ZFV4"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV4"
FT                   /protein_id="BAJ00553.1"
FT                   /translation="MKIPKRIQPLVDEGLVDEVLRPLMSGKEADVYVVRCGDDVRCAKI
FT                   YKEAEKRSFKQAVQYREGRKSRNSRRARAMEKGSKFGRNEQENSWQNAEVDALFRLAYA
FT                   GVRVPQPYGCFDGVLLMELITDDQGYVAPRLNDIILTREQALEQHQSVMKDVQRMLCVG
FT                   IIHGDLSEFNVLLDSKGPVIIDLPQAVDAAANNNAKRMLERDVNNMTRYYGQFAPELLT
FT                   SKYAKEMWALFESGKLNPESELTGEFKESTKAADVESVLAEIEAAFDEEQERKERIREA
FT                   EEG"
FT   CDS_pept        complement(694543..695013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp-1"
FT                   /locus_tag="SVI_0583"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00554"
FT                   /db_xref="GOA:D4ZFV5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV5"
FT                   /protein_id="BAJ00554.1"
FT                   /translation="MATDLKVGDTAPNFRLQSTDGNFYQLSDYLGKQTLVLAWYPMANT
FT                   RGCTLECRSLVQKGHLIREYNAVYMMASVDDLEDNQDFAKKQKADFPMLSDPTKEIAKA
FT                   YDVLNFVRVASRVTFYIGKDGKIIKIDEDINAPTAAEDIAANLEQLGIEKSD"
FT   CDS_pept        complement(695303..695677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00555"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV6"
FT                   /protein_id="BAJ00555.1"
FT                   /translation="MNSQKERDMPNQQELVLTADTFSRGALRMTVTLLRGINPRLALTV
FT                   QNQMCSPINPQRDNNPSPKDNFKIALAPLEVRWVVESLQIKGQHPQVDPGTQMLVKALI
FT                   IDWINYANLLIDSENSKNAY"
FT   CDS_pept        complement(695798..697243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00556"
FT                   /db_xref="GOA:D4ZFV7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV7"
FT                   /protein_id="BAJ00556.1"
FT                   /translation="MHQDLDALINEIKLHSAFAALDQQRLAEIEADIGPLIYRATNTLE
FT                   SQYFYAEVVKLLTTLGDPGVIVTSPNEPLPVLPVILKPLADSWLALDEDANPIDPDHPF
FT                   ITHIDGLPLSRWEQASKKFISPHLQESVSERIHWLSQLDILRHSMGLPLNPQVTLSLSD
FT                   DEDSNIQLTLPVAKHQFQPPRDLIAGKVDSSSDSGITSQPEYISIDSLSHYDSDSELVA
FT                   RLEKGTRQALTIIDLRKAVGDSDKLLHFIARHYANPKTGYNQLLTPQHLIALGQYRRSL
FT                   DFKSNFLRPLGFIPFDEFNVFEQLEFSHANQTIDLTNPERFGLWYGRKSPLATELPIDK
FT                   ADRSSSNRLGLIIGPECRRECEWIAYFAKSLSRVTLIGEKTSGDLGRQYGFTLPNSGIK
FT                   IKLTASLTYDMQGKLLSSVGTRADIPLPITEVINWQGLLSLIESEQQDRETVYTLKSPD
FT                   IEAKRTFGVDETPTSESQVALQQ"
FT   CDS_pept        complement(697709..697906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00557"
FT                   /db_xref="GOA:D4ZFV8"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV8"
FT                   /protein_id="BAJ00557.1"
FT                   /translation="MEAKFQISLKFSLMYKVFDDNPDILDYMANFELTDVYGVDEHRFT
FT                   LMLRNNLSSDKYGAAEATWS"
FT   CDS_pept        complement(697996..698112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00558"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFV9"
FT                   /protein_id="BAJ00558.1"
FT                   /translation="MSESIEDINRAEPESLVDEIIQNELATSEQPFVIPPIM"
FT   CDS_pept        698410..699258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA-1"
FT                   /locus_tag="SVI_0588"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00559"
FT                   /db_xref="GOA:D4ZFW0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW0"
FT                   /protein_id="BAJ00559.1"
FT                   /translation="MWDIEMEIVALPGQRAGGKVWLVGAGPGDVELLTLKAYRILQTAD
FT                   VVLYDALVSEEIMALVPQDAEKIAVGKRAGKHSAGQDEINQLLVTKAFTRQNVVRLKGG
FT                   DPFIFGRGGEELQTLVEAGLEFEVVPGITAASGTSAYAGIPLTHRDYAQGVTFITGHCQ
FT                   LESRPMDWKAYANPNNTLVIYMGILNAGLIKSGLLGAGRNIDTPVAIVSKATTQDQKCF
FT                   IGTLGELERLAANPGLKMPALMIIGEVVELADSLNWFKPDSNQKDRVRNEWIQTDLAQN
FT                   K"
FT   CDS_pept        complement(699364..700197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00560"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW1"
FT                   /protein_id="BAJ00560.1"
FT                   /translation="MADIAKISEIKSAQSDVSARKKALQLGLRIGLSSEEGYSATTASV
FT                   AERAEHRQRKLMSQYQANLETIYKIALSITPSDVTGTDLDPDWSHQFFKIAEQIHNRKM
FT                   QELWGRILANEITSPGNFSLRTLTTLKQLTHKEAQILEKALGMAVKINNETRLKLIIGY
FT                   RYAGGIGQIFRKSSPINIGLSNFGLPYSSILTLIDAGILHRSEFESGLLNSKTPIHFTM
FT                   LDTKMKLTPKSGHLLFNYYRLTPIGDEITQLVHPKADNEYTKAMRSLFAKDFKIE"
FT   CDS_pept        complement(700366..701562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0590"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00561"
FT                   /db_xref="GOA:D4ZFW2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW2"
FT                   /protein_id="BAJ00561.1"
FT                   /translation="MKHRNPQKLLLWMTFIMSLVFAVWQVLLNNFVIEKAQFTGVEIGI
FT                   LQSLREVPGFLAFTAIFVLLLLREQTFALVSLAVLSIGVAVTGFFPQVLGLYITTVLMS
FT                   VGFHYFETINQSLTLQWVDKKDTAGFLGKALAWRSAAALSGYASIWLVMSWLQLDYVYM
FT                   YGLIGCLGLIMVLVVTLYFPKFEVGEAQHKKIILRKRYWLYYLLTFFSGARRQIFMVFA
FT                   GFMMVEKFGYSVSEITSLFLINYVVNLLFAPAIGRFIGRIGERRALTIEYLGLIIIFVS
FT                   YAWVQQPEVAAALYVIDHLLFAMAIAIKTYFQKIADGKDIASTMSVSFTINHIAAVVIP
FT                   VLLGLLWLYSPQAVFYIGAGFAVCSLILARNIPSDPSPGNEVKWSWSRKNVQLTEPRQ"
FT   CDS_pept        702000..703385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0591"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00562"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW3"
FT                   /protein_id="BAJ00562.1"
FT                   /translation="MKTKLSLLALCIAGFSCTSALAASNPAQLEQAIAKQEAELNKLKH
FT                   DLAELAAQQKMQQAEQEKQAEVVATTNKVLTESKWSKFSFKSYGSMVYTSDEYYQNVQD
FT                   TSPERRGRFDLERIVTEFGYQFNDEWDMEVEIEYEHGGTGTALEYDGFDEFGEFETEVE
FT                   AGGEVMIEKAELRYRPNDAFGVKFGNIHLPIGLTSILHKPNQYLTVQRHRSEAAMLPAV
FT                   WNEMGVGIFGEMANFHYQAQVVSGLNSEYFRTYDWIASGHQKRFEHVNADELAYAVRLD
FT                   YGNFKQGSAVGVAYYYGNTSDNRHKSNKVSGDGTVSILAISGAFVQGPWILRGQYLNGT
FT                   LSDADAITQANKTTPGLKPGNFAQLGSESEAFFVEAGVDLSHFTPVPITVFANIDYSNP
FT                   LADVDTGTGSKRYENTWTSIGINYFPIPEIVIKAEAGRQQVAMSSIPDTNFFALGVGYQ
FT                   FSL"
FT   CDS_pept        703654..704673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00563"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR034982"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW4"
FT                   /protein_id="BAJ00563.1"
FT                   /translation="MITNLTDDVIISGYSTLAIKGEEMFLASQTLVANKTQANLLAAQE
FT                   AWKAARQPWEQGESHIFGPVDSLGIDPHLDSWPLNTTDLKTVLTDNSGFSADTIKGWND
FT                   DVQGFHTMEYLLFGDGVADNQKDVADLTMSEAEYLMGLSEVFRDYTKTLDDSWLISHDG
FT                   QTGKAYGELVKNPGTADNTFYASQVGVIQELVNGMIGIVDEVGNGKIADPFGTSAATAD
FT                   TSKVESQYSWNSLTDFSDNIIGVRNVYQGELTGASDKQGIIDFVKAGDEALALRVSSEI
FT                   DDAIIKIQAIKGSNNMPFRQAIADAEGRVRIQTAVDALSKLQASLESDVVPLLNKWKV"
FT   CDS_pept        704819..706441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0593"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00564"
FT                   /db_xref="GOA:D4ZFW5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW5"
FT                   /protein_id="BAJ00564.1"
FT                   /translation="MNFNRYQYTSLALAICFGLTGCGGSGEDAPEPKPEEKVYPSFTDI
FT                   KASGGETTTFDASESGHGFSTPAPNLSEASLGHHLEGDLGFETAFTTAPNVEHPDLDGL
FT                   GPVFNNTDCNSCHQRDGRNSTPLVPAGQERIKLGSEAGLFLRISMAPAEPCTQGTLAND
FT                   YCAPIPVPNFGGQLFHRGVLKARPDWRDNMFGGQADVYLSYETKAVTYPDGSSITLKKP
FT                   VFAVENPYDAPGETLASANVTSDLLQDDVLMGWRNGMPVFGLGLLEAIPEADILALVDE
FT                   NDADGDKISGRANLVFDAVKAQTGDTNPVSLGRFGWKANTPSVRVQSLGALRGDIGVTN
FT                   PLFPDESVFNTALHDSYMTRTGFVDTGEGVNGEPEASAEFSDSVVFYAETLAVPARRNV
FT                   DDPNVREGARLFEQVNCTGCHKASFVTKSTGDIGGAPMIDALKGQTIYPFTDMLLHDMG
FT                   VELADGRPDFLADGNEWRTRSLWGIGLTQTVNPQAGFLHDGRAATLEEAILWHGGEGEQ
FT                   SRNDFMALTKAERDQVVAFLMSL"
FT   CDS_pept        707246..708880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0594"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00565"
FT                   /db_xref="GOA:D4ZFW6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW6"
FT                   /protein_id="BAJ00565.1"
FT                   /translation="MRAFSIFSNYLVLFSILVGIILSGGLGYSFYQNETQAIESDFRRD
FT                   VDDKAAALERELLINLEVLYAVKGLFNSSDDVNEAEFKQLASSFLVRHQNIQALEWIPR
FT                   VSLEQRDKYEQQRRKFYPDFEFTEREFQGSMIRATDRKEYFPVYYVEPMEGNEVAFGFD
FT                   LASNPKRDKILKKSRDLDLALATASITLVQEVSNQKGFLMFMPIYLGDPNTLIKRREQL
FT                   TGFVLGVYRIGDMFETAIRYTGAQGINLKLIDNTSISAEQLYSSYATEQHQDKTQLKLI
FT                   YNKPLSRFGGRQWTLVATPSLGYIAERRSLLPFISCAFGVLFVLLAGAYISAIIRRSSL
FT                   IKVEVEARTQDLNEAKLELEQLSHTDSLTKIANRRKFDDKFEKEWQRAVRSKTSLSLIM
FT                   IDIDNFKQFNDHYGHLAGDQCLRDVAKSLQSTMSRNTDLVARYGGEEFVILLPNTNEPA
FT                   LLADKCLINVEKLRIPHEPSSVSEYVTISIGVISTSPTYNSDPLALSAKVDKLLYLAKD
FT                   LGKNRVCVDEPIIIPNGDVIDFKSPNK"
FT   CDS_pept        709109..710809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0595"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00566"
FT                   /db_xref="GOA:D4ZFW7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW7"
FT                   /protein_id="BAJ00566.1"
FT                   /translation="MLIPTMNIFSKYITFITILIGLALSGYIGKSFYDEETKAIKLGFQ
FT                   NDVDDKAAALEREILLNIEVLHAIKGLYDSSDEVTAVEFHRIAQSFLVRHQDIQALEWV
FT                   PKVEARDRLGYESAMGTQHPDFEVTEFSDKGMLTAGQRDIYFPVTFIEPIAGNEMVLGY
FT                   DFGSSHQRLAIMDRARDLDKPVATSSISLQHYSSDQQGFLIFVPTYMGEPTTLVKRRER
FT                   LRGYILGVYRIDDMFDSAIKRTSAEGIYYSLEDNSYEPAYDQAIKASLAEGVEGASVLY
FT                   SNFPLNLSITQTQQAFSYIKTLRPFSGRKWSIVATPSLGYVAERRGQLPYTIAVFGGLF
FT                   VLLSALYVYAILRRAELIEKEVKQRTADLNEAKRQLEEISQTDSLTKIPNRRCFDESLQ
FT                   EEWQKAIRNKSRLGLIMIDIDHFKLYNDTYGHPAGDQCIKDVAQTLNQTLNRGKDLVAR
FT                   YGGEEFVVILPHTRDCVSPAKRCQYNIERLELPHETSMTSSFVTVSVGVYSIFPDKDSD
FT                   LLEFIARADTALYQAKNEGRNRVCVYEEKDKEGIIETLDLAFSSSALAS"
FT   CDS_pept        complement(710826..712097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0596"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00567"
FT                   /db_xref="GOA:D4ZFW8"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW8"
FT                   /protein_id="BAJ00567.1"
FT                   /translation="MKTTAIERVKSAFIAGIWASLASISIGFGFKIWLAQWVAKEELAL
FT                   YHTSIDIISLSLILMTGFRSSMVVSYSQTQNDKDITNIFRYSLITMVLITWGLVLPYIK
FT                   HQLHIQVEYFHLVGIILGMGFKVYFTNQIAMYRMYQISNKVTWMEPLVQVLIFFICFYL
FT                   LGQAAIASLFFSMMFSSLAMAGFMFISRRKQIATPPLDSVNMNSSLVNFVKKSFTASLE
FT                   AGASILMIYITVLLTVAHFSIQELGDFQVVVRPVITYLTLLFVFPIYRFVLPELAVCVR
FT                   NSDFKQIKQIKRWIYKLAIIIGSVFFITMLLFNHDIVAWVFPPEYAHAAPVLMHFSMFF
FT                   VFMILNAYQLAFIKAHGLFTHSLMIRISGIIGLIVSYYLYSEATDNVVAVILALGTGYL
FT                   LMFIISSLVERQINSRERSSISRA"
FT   CDS_pept        712348..713445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0597"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00568"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFW9"
FT                   /protein_id="BAJ00568.1"
FT                   /translation="MLSTHSDSHYQLKIASFNLFNFIAPPDAFYEFDNIYTQEQWQKKL
FT                   DWITKYLNEHQPDVIGFQEVFSPDELQSLTKSCGLDYFCVLDSPQVMDDFIYSKPVVAL
FT                   ASRYPIKQAVSVNADPGWAAKMGLESEFEFSRKPLRATVELPKLGLCDCYVVHFKSKRT
FT                   LFDVQQSKAGSYTGSVKETSSAAELNIGQLLAVEALGQWGSSIQRGSEAALLRYAMVER
FT                   RSQTQNPMILMGDFNDILSDGVLAALTSVDTRIKPQTVIGQGAMGDVAHQLGFYRLQDA
FT                   YDLYQASQYSLSEQARPATHYFFAKGSVLDYILLSSEFDAKNDLSLAEVGRYETYDRHL
FT                   INPSFEHDSQSTDHAPVMISLAIRG"
FT   CDS_pept        714172..716442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00569"
FT                   /db_xref="GOA:D4ZFX0"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX0"
FT                   /protein_id="BAJ00569.1"
FT                   /translation="MQGKDSSQIEQSKWSWLNLSAWLWPFCLSEKFKFASRVSLSMVLA
FT                   FLIPMAMGWPQASTAATTVMLIASTGSRRESLALGTYRVIGTLIGAVVGLLLVGLLAQE
FT                   RFLYMLVVSVVVAVIFYFRNAYKKDPSVFMLTGVMVLMMSNGGDANGAFIYGVDRAFMT
FT                   TFGVVVFTLVSVFLFPVKTEQNLRVLARELNRIQGQLFHLLTSPKETQVRGYALEPIDL
FT                   DGVHESVEPTDVSSLVKQLFGALAALEQRYISISAECSDVSAYKKEWDLALLYYKQITE
FT                   LLIFVAESGSHDTKESERLSLERFITDYEQAVQKLAALFTESDQAWDDKEHRFEVIEQR
FT                   VTLDEEALKTCTHLSRGKVLTIAYLLNQLHEKLSRLTATISCIDSVTGKVDFSERFPKS
FT                   LSQFIWWDAENAKTAVKVFVTYWIAGLIWIYFNPPGGYSFVIFSVIFMSLFSFLPVHPV
FT                   MLLVLFTFGFLFAVPSYLFVLPGLALSAELGIFIFIYTFIAFYIFKEQVTIFFLLGLFL
FT                   LGIDNTMQYNFAVLLSVMMMFYLVVLMIILSYYFPFSSRPEHLFLVMRERFFRHAAGVL
FT                   SSNQIAQPNGRQKLRADWHLMTMNVTVKKLTLWSAKINNKLFQQTTPEALAAFSAACEL
FT                   LNNHINIFVSAQDKFASNQLVSQGRQSFNSEALFPMTKSLAGGYKKETLDQVFHGYELD
FT                   YEDTEQQLEDFLNGQDLSVYSSADISGFYIFLNLKKNVFDAIGQCKQAYEDISWNNLRQ
FT                   KRF"
FT   CDS_pept        716453..718225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0599"
FT                   /product="outer membrane efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00570"
FT                   /db_xref="GOA:D4ZFX1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX1"
FT                   /protein_id="BAJ00570.1"
FT                   /translation="MLNKYVKTCLVMMPLLGLSACTNLGPDFQTLAPKSLPKAWSDSAL
FT                   VDHEAEIEQTAQDSAMWWKQFNDPTLNILVERANKQNLDIEAAGLRILQARMILGISDS
FT                   LNYPQVQVASGSLAKVYRNDNSFNNLALSFDAGWEMDIWGKYARGVEASEAALYASIAS
FT                   YNDIAVTITSEVARNYINFRTFQERVLLSRRNIHIQERVVHITQVQYDSGNVTELDVQQ
FT                   AKSQLYSTQAALPSLKIGMMQARNALAVLLGVMPNEIVPMLESEQLKAKVDAYSIEYGK
FT                   SETKRSMTDESSVSIVPTPPMLDARIDASLVMRRPDLQVAELLAHGQSAKIGLAEAALY
FT                   PSFTLFGSIGVNSMRPSGHSFSLSDSLTLTAGPSFSWNIFQYGRIKNNVRLEDARLQEA
FT                   LIGYNKKVLLAVQEVSGALESYSLYREQKALRMSSVNASVRAFNISMTQYENGQIGFER
FT                   LLNSVEKMTRSEDSYAQIKGYVANQVVALYKSLGGGWQINNGKALISDETREVMRQRTD
FT                   WGDVLDEPQFLPASGNNSTASKAEAISSQVANQDSPAASKVEAVSSQVANQDSSTVTKV
FT                   EAVSSQVANQGEQE"
FT   CDS_pept        718225..718434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00571"
FT                   /db_xref="GOA:D4ZFX2"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX2"
FT                   /protein_id="BAJ00571.1"
FT                   /translation="MDLPHELAAGDIYFSPLLLVLVMATMASWITVALLNKTRLSRFIA
FT                   FPSITFMAITLFYVIAIDSLFLRF"
FT   CDS_pept        718460..719332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0601"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00572"
FT                   /db_xref="GOA:D4ZFX3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX3"
FT                   /protein_id="BAJ00572.1"
FT                   /translation="MKKLLIIALNIIIIGGALFLGYQKYQEYFSNPWTRDGQIRANVIK
FT                   VAPRVSGPLVQVYIKDNQFVHKGDPLFQIDPSTYEVSLAQAEVGLQRAKLSAQGRKIEF
FT                   VRLKDIRAKDRGAVSHKDLIRREIAYEEAKLKIKAAEQQLKAAKMNLAFTKVYASVDGY
FT                   VSNIDIQLGTQAVMNQPLIALVDSNSFWAFAYFRESELEQIHIGSTAMVTLMAHPDKPI
FT                   EAKVESIGWGIAPKNGTVGYNLLPSVNPVFQWIRLAQRIPVRIALDELPEGVELRFGLS
FT                   ASIMVLDDD"
FT   CDS_pept        719325..719987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0602"
FT                   /product="ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00573"
FT                   /db_xref="GOA:D4ZFX4"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX4"
FT                   /protein_id="BAJ00573.1"
FT                   /translation="MTKKINQENNFYYMTCALIGLLVSSSLVEVMPSGILEYALEGVIG
FT                   VTFLICILSLRFDHRWKRFMQVLALCWVIASVLRLVLGIQEIDLLVLLIMFAFFWGTFK
FT                   SISRQILFTGSVDGNKVVGSVALFLLIGLMWTIAYLLIMEFAPNSFTGMGPLPWGENFS
FT                   QMAYFSFVTLTTLGYGDISPISSFSQVVVYMEAIAGVFYMAIVVASLVSSNQGKKHG"
FT   CDS_pept        720007..721137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00574"
FT                   /db_xref="GOA:D4ZFX5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX5"
FT                   /protein_id="BAJ00574.1"
FT                   /translation="MGNQQSKIFVNNMMESAIRIGLLFMLVLWTFDIIRPFVIPVLWGA
FT                   IIAVALMPLTQKLEKAFKGRRGLAATAMAIIGIALLVIPFVLVSGSIFDGVSHAIEVLQ
FT                   SGEVNIPGPTQKVADIPVIGDKLYEIWALFSTNLEKAVQHFLPEIKTAVGTIASVIGSS
FT                   LATLMMFIISLAIAAGFMSNAEKISGAISTVAVRVVGKNGEQWTTLTAATIRSVLLGVV
FT                   GVAFIQSMLIGSAMFVFNVPAAGLITLGVLILGIAQLPALIVVLPAIFYVFSTQDTTSA
FT                   IIFTVWVLLAGVSDSFLKPMLMGRGVDVPMPVILIGAIGGMLAAGIIGLFLGAVILAIW
FT                   YELFMAWLKADKAPEAEQSLAIEGEPKLEAVVNQAK"
FT   CDS_pept        721404..722225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0604"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00575"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX6"
FT                   /protein_id="BAJ00575.1"
FT                   /translation="MYRQSLICPACSGKAYFRKASKDGKAACFGSRYHLPDCSELTPSK
FT                   AKVREDLAVIEVNQLLVDSEALVINFSKGAAGKHASSKADASDTRGKAKPIIINDIPKG
FT                   AGKVNAGLTGTGSDKAQLQDEHSAMSRVSSEGLETLLHSLLRGSDLAESELWVYTDEKY
FT                   RWRAKNLFVNFADAEPTDNGAPRMYWGTLSHSDKHMHWLNPADCRDVGIPIEDFQQALC
FT                   NRFDIHERRDLEGAGIIIFGKCFFNKDKTRKIIQLWGKDISRIAISKLDDD"
FT   CDS_pept        722550..722771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00576"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX7"
FT                   /protein_id="BAJ00576.1"
FT                   /translation="MSIMSVTIQEKFAEPELHFKVNHHLYETSNSYRCRVDYVIKLLAA
FT                   EELEQANGAHCAKEDVINLEKDFIRGYN"
FT   CDS_pept        723191..723679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00577"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX8"
FT                   /protein_id="BAJ00577.1"
FT                   /translation="MSSENTKVFLFSLFLLLAAIGVGFGLYVNTDKHDPSKSLVPLVIG
FT                   SWVKIPGICDGKTHYDELVEILSKQSMKVKGKVINIVDFSISKTAPIKISCDAVGDGDM
FT                   FVQTSFMADKFFRYYLGKIGDYTIMKSVAPRSELWFKLDTHFQQKLQAMSDINNGSRL"
FT   CDS_pept        723706..724182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0607"
FT                   /product="cold shock domain family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00578"
FT                   /db_xref="GOA:D4ZFX9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFX9"
FT                   /protein_id="BAJ00578.1"
FT                   /translation="MAKHHFRILVDIAMKTQMLKGILIRWNDDKGCGFIRPDASHVDMA
FT                   TLHGPASEQEIFIHISALKHMCRRPELGDTIFFLIETKLDSKLNAIQAYIEGVEANTAN
FT                   GENTKPYLGNGNSKIPISATGVITRLFIIAVVLIGASLTYQTFTDTTRLISQTQ"
FT   CDS_pept        complement(724194..725138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00579"
FT                   /db_xref="GOA:D4ZFY0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY0"
FT                   /protein_id="BAJ00579.1"
FT                   /translation="MTMQVPATLPRQVPAAFLSVVLIWSTTPLGIVWSSESVHPTMAVL
FT                   LRMTIALLLGSLLLLITRIRLPWTKTAIKLYSVSSIGIVGGMLLSYFSAQYLASGTMSL
FT                   IFGLSPLISGLLAQRLLGEAKFGPMKLLALAMAFIGLGIVCSSKLSLGSDSWIGLMLIL
FT                   TAVFLFSLSGVLIKTIKINIHPIASTVGALAFSTPMFALAWLIFDGTLPIDTWQERSLW
FT                   SILYLGVFGSLIGFVAYFYILQNLQASTVALVTLITPVFAMMLGAQLNGETITGALILG
FT                   AMFVISGLGLYQFGETAMNVIKAKGLGLKKKSP"
FT   CDS_pept        complement(725608..725817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0609"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00580"
FT                   /db_xref="GOA:D4ZFY1"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY1"
FT                   /protein_id="BAJ00580.1"
FT                   /translation="MTKHRNTCAVMEHDSGRGIIKDNALKALVTSELFRMRTEKPKKGK
FT                   GSYNRKQQKGHVLKGNAPFDFLAS"
FT   CDS_pept        complement(726066..726278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00581"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY2"
FT                   /protein_id="BAJ00581.1"
FT                   /translation="MRKSNSTDEFSYLIAPRWNMYELIDIEYFNTVGSAPATSSPIKAQ
FT                   GASVKAKVSIARKILEPNKLPMQLH"
FT   CDS_pept        complement(726329..727642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00582"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY3"
FT                   /protein_id="BAJ00582.1"
FT                   /translation="MKRSILSLLVTSAFLSGCGSDDDTPIEIETQNKAPAVSANFSPIV
FT                   EKSSSTLAVIATDSDGSIAKYAWVQTAGPALAITGGDTAEISFTTPSIAVDSPISFTVN
FT                   VTDNEGAVTEFIAETNIDRIETHYLLAGQVVGVQYASALISATVGSESASIAADENGNF
FT                   SLNLAIDDDVDLSSSVKLIASNESSLQLASLLPSLEQLSGFITQAQSSSKILKASTQAV
FT                   GDTPKISVSAVSTALYTLLVAENGGTEPTNIDAIKLIESQIDPNALIEIAAVVQILINS
FT                   EVSLLPQGTTDLLSVLADPEQYNALLESIEQATPGVIEETIIAIVEDPALTPPLEAADV
FT                   PSLYYQTTPVAASFIARFGSRYEFAENGTGQRASNFDILEFEWSINSGDILLTYSQDQG
FT                   YTSYPMVSGVEGLSQVQKDALFAANIDQVDVVIENGHY"
FT   CDS_pept        728217..729698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00583"
FT                   /db_xref="GOA:D4ZFY4"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY4"
FT                   /protein_id="BAJ00583.1"
FT                   /translation="MSSVKIDLGLSFDNSYAKKLEGFYADCQGAKAPQPELVKLNTSLA
FT                   HSIGLSNTNPGQLAEVLSGSQSPIGASPLAQVYAGHQFGGFSPQLGDGRALLLGEVLDK
FT                   DGNRVDVQLKGSGRTPFSRGGDGKAALGAVLREYVVSEAMFALKIPTTRALAVVTTGEQ
FT                   IMRTQELPGAVLTRVAASHIRVGTFQYFSSRGEQDKVKQLADYAIERHYPQLKISQQPY
FT                   LDFLCAVCDKQAELVARWLLVGFVHGVMNTDNMTICGETIDYGPCAFMDDYDPQAVFSS
FT                   IDRDGRYAYNNQPVLAQWNLARLAETLLPLISDDEAVAVAKATQAVTEFMDVYQGYWLT
FT                   GMRAKLGISNEEEGDLALCEQLLESMVGQEVDFTQMFRQLARDLEGQSHGSDQLFNDAD
FT                   RFIQWRESWMARLSRASLPMSECVAMMDGVNPMYIPRNHQLEYAIEAAEQRADYQPFEQ
FT                   LIGILANPYTPQDGAEEYAKPAPASFGRFTSYCGT"
FT   CDS_pept        730566..731345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsM"
FT                   /locus_tag="SVI_0613"
FT                   /product="polysialic acid transport protein KpsM"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00584"
FT                   /db_xref="GOA:D4ZFY5"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY5"
FT                   /protein_id="BAJ00584.1"
FT                   /translation="MRKRSSIQIMVDTVHALMMREIKTRFGSNRLGYFWALAEPIGQVA
FT                   ILGLIFSLMGRSSVANIPIALFLFTGKLPFSLFTKLLTQITAAVESNKGLLSYRQVSAI
FT                   DPVITRVLIEVATYLVVYLIIFAFMAWLGFEVLPDDLLGVLAASGLLIIFSVGIGLIFC
FT                   TAASYWKDTSKLVGMITMPMFFVSGIFFCATSIPPQYLYLFDWNPVFHAIELGRDASFS
FT                   AYTTPIGSWLYLSLLALVSFSLGLAMFHLSRMRFLIT"
FT   CDS_pept        731342..732007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsT"
FT                   /locus_tag="SVI_0614"
FT                   /product="polysialic acid transport ATP-binding protein
FT                   KpsT"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00585"
FT                   /db_xref="GOA:D4ZFY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY6"
FT                   /protein_id="BAJ00585.1"
FT                   /translation="MIHFEGVNKYYPTKQGRHYVFKDLNISLPTDRNVAILGPNGVGKS
FT                   TLIRMMGGADMPNSGRIHSEKNISWPLGLQGGLQGSMTARENVRFVARIHGYKNTKPIE
FT                   QQVQDFAEIGKFFDEPVKTYSSGMRSRITFGLTMGFDFDFDVLLIDELGAVGDANFRKK
FT                   SEQMLLDKYDKTKLIMVNHSIVGLKKFCDSGVVIKNQGLYFFENVDDAIQEYQEVYVK"
FT   CDS_pept        732219..733265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00586"
FT                   /db_xref="GOA:D4ZFY7"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY7"
FT                   /protein_id="BAJ00586.1"
FT                   /translation="MVLASLLVIIYYSVIASPRYVSQVQFVVKQVSSSDIPVIGLAAIG
FT                   TSSPSTRDALILQEYILSSEMALALDDLLNLKAHFQQNQWDILSRLKADSTQEEYIEFY
FT                   QKHIKAVYNEMSEILLIEVQSFDADFSLKLAKAVLSTSETFINQLGEGMAVQQRQYAQS
FT                   EVHRAYDELKRQQVSLLKFQDENNLYNPEIKSAALVEAVNGLESAIIKQKTELKSLQAY
FT                   MRSDTAEIKSKEFQVAALEQQLNEEKLKLTNQDQLALNKVNVDFKELELNALLATDLYK
FT                   SALASLQAIRAESFKNLKYLLVVERPKLAEQEKYPQRLYSIFTWFVAIILIYLVGRLIA
FT                   SVIKEHKE"
FT   CDS_pept        733262..734923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsD"
FT                   /locus_tag="SVI_0616"
FT                   /product="polysialic acid transport protein KpsD"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00587"
FT                   /db_xref="GOA:D4ZFY8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY8"
FT                   /protein_id="BAJ00587.1"
FT                   /translation="MNNKLKTIIGLLCSFSLSLSVFSHTATASTAMQADVADQQQQSIT
FT                   QSTENQRYGNWLFKGGFKGEAFSAINPEYRISQGDNLLVQLWGGIDHQAEIPVDAQGNI
FT                   FIPKVGPIKVLGVKNADLNHVILKSVKRVYKSNVEVYVSLVSSQKVKIFLSGMVVKPGL
FT                   YEGQSADSVLRFIDQAGGIRQDMGSYRQIQVKRNNKQKYQLDLYAFLQKGEMPAMQLQD
FT                   ADVIFVGPKQAEVTLEGEVGFSGKYELTEHESLQSVLDAVVMDEDATHITIIAPERSSN
FT                   SSNGIRKVEARQYPINQIANIRLQAGALIKVTSQLRATSISIELIGEHNSAKEIVLPWG
FT                   ANLADLQGKIEYSRLSNKQAIQLYRKSVAQRQKDMLQASLTALEQSVLTARSETKEAAL
FT                   LRKAEAEVILQWVAKARKAEPKGQVLLSEGYDASKIILNQGDTIVIPAKRNLVMIHGEV
FT                   LFPTAIAYNDSMSIMDFIDKSGGATKDIDDMNVLVMKPNGSFVDMNDLLDEESEIEPGD
FT                   EIFVLAKPDFKGFQLTKDITQLIYQLAMSTAVVLAL"
FT   CDS_pept        734924..735874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00588"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFY9"
FT                   /protein_id="BAJ00588.1"
FT                   /translation="MRIGLIADQFTHVALALEPNIDIVALSPQLWRIQLIFKPVDILLI
FT                   ESCWQGNDGQWRNMIASYSNHSKCKTIKQLTSYCRQKKIPTVFWNKEDPIHYDRFKHNI
FT                   EYFDVCLTTEKELVKHYKQTFPHLKMVANQAFFFQPRIHNPEIGKRLEVLSRKIIFCGG
FT                   LYKNEFPLRAQQLEMAATTLGSKLVVFDRFEHSDNSWELSKNIARKTGFKYIDSKSYYQ
FT                   SGLAHLNVNTCDGSETMISRRLIELLACGTNVIELTNFKGKHFLSQYVHQVSSADELES
FT                   AYLKLSDDQTTIIEYQELVEHYSVSCFIRFLNKLT"
FT   CDS_pept        735891..737048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="SVI_0618"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00589"
FT                   /db_xref="GOA:D4ZFZ0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ0"
FT                   /protein_id="BAJ00589.1"
FT                   /translation="MKVMLVFGTRPEAIKMCPVIEAMIANPKITPIVCVTGQHREMLDQ
FT                   VLELFEIKPDYDLNIMKPGQDLTDITTAILQKLKPILAAEKPDRVLVHGDTATSFAATL
FT                   ASYYQQIPVGHVEAGLRTGDLYSPWPEEGMRRLTGSLADQHYTPTTGSLKNLILENVDP
FT                   ESIFVTGNSVIDALLMVSEKLDSCMEMNKELIEKFSFIDPNKKLILVTGHRRENHGDGF
FT                   ENICKALGELATRDDVQIVYPVHLNPNVQEPVNRNLKGVDNIFLIEPQDYLPFVYLMKK
FT                   CYLILTDSGGIQEEAPTLGKPVLCMRNTTERPAAVKAGTVKLVGTCHKTIIAVTTRLLD
FT                   DELAYQVMSHANNPYGDGKTSQHIVDAILGTDGALVTHIDSKIVA"
FT   CDS_pept        737130..738368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecC"
FT                   /locus_tag="SVI_0619"
FT                   /product="UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00590"
FT                   /db_xref="GOA:D4ZFZ1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ1"
FT                   /protein_id="BAJ00590.1"
FT                   /translation="MKFNTISIVGLGYIGLPTAAVIAGNGIRVKGVDVSEYVVNCINQG
FT                   KIHIVEPGLELLVKTSVEAGFLTAHTESQPADAFLIAVPTPFKGDDYEPDLKYIEAAAK
FT                   ALATKLVKGNLVVLESTSPIGATEKMAAWLHEVRPDLSFPQTVGEGEIADILVAHCPER
FT                   VLPGQVIRELVENDRVIGGMDQASTDAATAVYKMFVHKGNCIATNARTAEMAKLTENAS
FT                   RDVQIAFANELSMICDKQGIDVWELIELANLHPRVNILQPGAGVGGHCIAVDPWFIVNQ
FT                   NPDEAKLIHQARKTNDFKPEWVINKIEDAVKSIDNPKIACLGLAFKPDIDDLRESPALE
FT                   ITKALAIKGYNILAVEPNIDELPAKFSSLENIKLTPFKDAVEQADLVAVLVKHKEFVGM
FT                   VTSLNKLDFVNAK"
FT   CDS_pept        complement(738457..738579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00591"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ2"
FT                   /protein_id="BAJ00591.1"
FT                   /translation="MRGLVFFMDLLYYIWQGNNVYDNFKKLIDSPPLPTSVTLG"
FT   CDS_pept        738824..742477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00592"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR024542"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ3"
FT                   /protein_id="BAJ00592.1"
FT                   /translation="MNPKTEELKLQPEEVQQQLKYLQQQLDIAKSKQMADQISMTELKR
FT                   NNLKNRISLGEKQLEQTKLDQQLLDGKYQIVKVKNHLSYKLGHSLINSTKSWRNLFSLP
FT                   RDLLRIRAEAKRKRGILEEKTLQNKILLVSPPEQEKDLLNLKRELQYLPVLSDASKLKG
FT                   LKIACVMDTFTYECYAPEAVLLQLTPDNWQAELEAFTPDMLFIESAWRGKDELWGNKVG
FT                   HTSQELVNIVQWCKENRVTTMFWNKEDPIHFENFLNTAKLFDHIFTTDIDCISRYKKAL
FT                   GHNQVYFLPFAAQPKLHNPVEKYQRQDKFCFAGAYYVKYPERTKDLNNFVFTLPEYRDI
FT                   EIYDRNFGKNDPNYMFPEEYQPFIVGTLSYDQIDKAYKGYNYAINLNSIKQSQSMFARR
FT                   VFELLASNTVTVSNFSHGMRLMFGELVFTSDSGEEIVRRLTKLTGDELKLKQFRLLALR
FT                   KVMSEHTYQDRLNYIHSKLANTKMLAVHPKVQVLSYAKTPEALEYIYQSFQCQNYDHKF
FT                   LTVVISGFESVPDWLQDQNDVHLLTPIEADSIALDKWAEDSWVSVMVPEDFYGEEYLTD
FT                   LVLAIRYTDHKVIGKKAYYRWQENLVKSYPKAEYEQVSGLTLRQSLMAASMLPVMSLRQ
FT                   WLPSLYTWKADGPHFSIDSFSYCMNGMGHCEALPEFQSPAGINTGMNLAELQVKAELMA
FT                   PAALDISKLKTIKPAELSACFKPGRDSQCVSALANGKLQIASQLPDGKHEYWYSSKDFS
FT                   AAELNAKGGKLVLHLETSPGLNLQMVMLFLDINKQRLSHTIFSANKNSEIIIPQDAVFL
FT                   RPALRVYAGGNSEISNFYLEEKPDTLIDQLGTNEFLILTNHYPSYDNLYRNGFVHSRVR
FT                   AYKELDVQCDIYKLNLGTATKYDEFEGIRVTEGGQEQLLDLLAKGSYKKVLVHFLDSHM
FT                   WDILKNFNNIEVLVWVHGAEVQPFHRREYNYINASTDVIRKAKKDSEERLEFWRELLKI
FT                   VPSNLHLIFVSKYFAEEVMEDLELRLPDGKYSIIHNPIDTDIFNYVEKDPQQRLKILSI
FT                   RPYASAKYANDLSVKAILELSKESFFDELEFRIIGDGPLFDEILKPLREFKNVIIERKF
FT                   LKQSEIAELHKDYGIFLTPTRMDAQGVSRDEAMASGLVPITNAVAAIPEFVDEECGILA
FT                   EDNDYIKMAEGLTSLYKDKNLFSRMSQNCTKRVGYQLSHKKIIDHELSLLR"
FT   CDS_pept        742551..744533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00593"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ4"
FT                   /protein_id="BAJ00593.1"
FT                   /translation="MKIFIYGECVSRDIFDFIDAENYDLVGYYARSSYASSFSQTPVKD
FT                   IWSDNIKSNFQRRMVRTDLDKCLIDFIDAEEFDILLLDFYMERHSLFIFDDGSRCTISS
FT                   ELISSGFDTRKLSGRVIKPFSDEMYDLWEAGWEKFLKVVDSLDVRNKVVINKLFWAHVI
FT                   ENGNDFGDLFHSNSIDIVNKYLQRIYNRVSVDFKAKQFIGFDESLNIASSSHKWGLSPM
FT                   HYIDEAYVEMGRKLNDIYSRLCDDSENVNVHKSTSSEPVSIKSIDDILNGRAVEGMNKV
FT                   VFNDGNEVAIFLKNSHLIGASQDTNEKGRLAISFSGAVSNTSGKKGPFFSGLSISSELG
FT                   IPLVAISDPTLNLCDDLPLAWYAGNEKFPNCLRSISVLVDSIAEAYNVDLVIFGGSGGG
FT                   FASLAVAKNIRSKASIFVWNPQTTITKYVYTFVEQYMRVGFPSFFGEGDSGLDKINEIL
FT                   DTLKIDYKLKGLDYKENISIIYFQNQSDWHTNVHAVPFLRELTPLRSSDCTFVSREARN
FT                   VAYFGDWGDGLAAPDTQVIKQVLLDLFSGSPPIDIERKLRLGDYFHNTPPFFEALVLDD
FT                   SEWSVVSSVDKGCVECSIRFNESVNGKYQFAFYFIVDGVKNDIRGYDNLNMAVFKLPES
FT                   YESIEVVGFAMDVHGNRWVNKSRLI"
FT   CDS_pept        744993..746351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM-1"
FT                   /locus_tag="SVI_0623"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00594"
FT                   /db_xref="GOA:D4ZFZ5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ5"
FT                   /protein_id="BAJ00594.1"
FT                   /translation="MNQKYFGTDGIRGKVGNFPITPDFALKLGWAVGKVLAGNGTQEVL
FT                   IGKDTRSSGYMLESAIEAGLSAAGVNVALVGPMPTPAIAYLTSTFRANAGVVISASHNP
FT                   FYDNGIKFFSKNGTKLTCAQEQEIEDLLDKALNHNAMQCVESSKLGKVRRIDDAAGRYI
FT                   EFCKGSFPTKLSLKGLKLVIDCANGAAYQVAPAVYRELGAEVIAIHVEPNGININHECG
FT                   ATHMHSLQQAVLEHKADIGIALDGDADRVMLVDHCGAVVDGDEILYILARAQQANGTLK
FT                   TGVVGTLMSNLGLELALQAINIPFVRANVGDKFVVEQLLKHGWQLGGENSGHILALNHT
FT                   TTGDGIIASLKVLKAMLESGSRLAQLKLGMTKLPQVLINVRVSDKQADDVLLSDIVKNA
FT                   VNETERSLGTNGRVLLRKSGTEPLIRVMVEAKDPLLTRAKAEYIAEAVQLAGS"
FT   CDS_pept        746498..747589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0624"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00595"
FT                   /db_xref="GOA:D4ZFZ6"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ6"
FT                   /protein_id="BAJ00595.1"
FT                   /translation="MVSFIVPFTERSYLPFDARLSLLLTELCSLANCEVILHVTGVISD
FT                   KYSQVIRQLESSLVVVQQVKSDNDTYSAGQARNHAVTVAKSDYIFFIDADLAVAPELFS
FT                   QLKARVHKLATIGPFAFEMYPCLYLSQQATVNFKSDFNAYLDSFMQGHNDMAEGIALAS
FT                   SCLLLNRNWFLQLGGFDIEFIGHGGEDFGLIHKLCLHYPISSFPADYADNIKGQHPGGY
FT                   LGCRRYFSLYALQHLFEGRFLVHLWHSRPLTHHYHKRRVVNDKLLSDKLRQVRLIQQTV
FT                   TLESTNSLQASCKVTGKVVADLNANFTSWMESNQIQNGYPIENYPGLFKWADNVVIKRT
FT                   FRRKLRKLYLKPILFFKDMVFKT"
FT   CDS_pept        747698..748510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB-1"
FT                   /locus_tag="SVI_0625"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00596"
FT                   /db_xref="GOA:D4ZFZ7"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ7"
FT                   /protein_id="BAJ00596.1"
FT                   /translation="MVKESPLKAPNYKIIIPARMKSTRLPGKPLALICDQPMIWHVYQR
FT                   ALETNIGQDNIVIATDSEQICEVARGFGAQVLMTSDSHSSGTERCAEVVSLLDWHDDEI
FT                   VVNLQGDEPLVTADLIKLTASTLASSSAAGMATLACAIKSQSELVDPNYVKLVTDINRK
FT                   AMLFSRQPMPASITANADEEACIGGDFGPWLRHIGMYSYRVETLKILSALPETELEKYE
FT                   RLEQLRAMWHGIHIQVACVDDAPGHGVDTPADLQRVRAIVKANASVCA"
FT   CDS_pept        748503..748784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00597"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ8"
FT                   /protein_id="BAJ00597.1"
FT                   /translation="MLKCFENTRKREYEKARKREYEKARIRESEKARIRESENTRKREY
FT                   EKARIRDNEKEQKLFLERTLFRSRFLAATKLPLEAALQRSRSTCLDFV"
FT   CDS_pept        748803..751064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsC"
FT                   /locus_tag="SVI_0627"
FT                   /product="capsule polysacchride export protein KpsC"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00598"
FT                   /db_xref="GOA:D4ZFZ9"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZFZ9"
FT                   /protein_id="BAJ00598.1"
FT                   /translation="MIQVTHQLWTASRGIARDPHLAKFFDPELNSGSEKCDSGAASSYK
FT                   IKKLSPTSLPEQDDIVLGWGNKANTLKAKQFSGKYGLSYLRLEDGFIGYLGHPLDKSPR
FT                   LSLIKDSSGIYYDARSQSDLEALCLTADDWFTDEHMRRANKLQLLWTQHGISKYNHRRC
FT                   ELPAWLDEQAPHSVILVVDQTFGDCSVNQGVGSKPEGSPLNTPEQDEREGRERFAAMLT
FT                   DALVAHPNQLIVLKTHPDVIKGSKQGFLDITACSNPRVRLLGDDCSIDKLMAKSECVYT
FT                   VTSQLGFEGLLYGLPVHCYGMPFYAGWGLTIDKQVCHRRRANSVNKPLSLAKLIAAALI
FT                   EYPHYLNPETQAPCEVEDLLDWLIVQLNDGQYGVDTCYAFGFSLWKRAFIKPFIGRMAG
FT                   RVVFIGNKNKLDSLIKADARANCTSSVLLWGKRQRSWLEELKQGCPVWFMEDGFIRSVG
FT                   LGADLRRPSCLVIDRQGMYYAPDGPSDIVDLLNNISLNESHTRRAEHLAQSLVERAMSK
FT                   YNVGQTSAASTLLDEIAELANLGSDSKSTAGKREIILVPGQFEQDQSIAASRGQIKTNL
FT                   QLLHQVRSDYPQAYILYKEHPDLYSGVRPGALGEQAALQYADRYLSDVDIVSVLALCDR
FT                   VCTITSLTGFEALLRHKNVTTYGSPFYAGWGLTEDALTFSDRTNLLSLSQLVYATLVSY
FT                   PRYVDWSTGLLTTPERVIEQLSEERARYEQLGERGQQLGSSWWSRLGRKVKYFYQAYGM
FT                   "
FT   CDS_pept        751125..752327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsS"
FT                   /locus_tag="SVI_0628"
FT                   /product="capsule polysacchride export protein KpsS"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00599"
FT                   /db_xref="GOA:D4ZG00"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG00"
FT                   /protein_id="BAJ00599.1"
FT                   /translation="MNILFLQGPLGPFFNLLAAHFSSMGHDCHKINFNGGDKLYSGADH
FT                   IVDYSGTCADWPEFLRDYIERYKIDSIAVYGDCRLYHKAAHQVSLELGLNFWAFEEGYL
FT                   RSGFVTLELGGCNANSLLFNNIEALPQIDCQDTKNIQGVKSVGSTFGLRAWFAGRYYFA
FT                   MSLSANQFASYAHHRPWTTIEEAVFWIKSLAQKWWSKLMDPPRYRRFIRRYDGQFFLLP
FT                   LQVEVDFQLRDHSRFESVEQVIIEVLGSFSAHASSDQALLIKHHPQNRGFVHYGDLIDK
FT                   LVSELGLEGRVLYGHDFNLPDVYRHVKGVVTVNSTVGLSALLHHLPTVVLGKSIYDIHG
FT                   LTYEHGLDRFWRDNYSVDQDLFARFRTYLCLQTQVPGDFYKNSAPLVASAYQKITAQGK
FT                   Q"
FT   CDS_pept        752350..752445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00600"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG01"
FT                   /protein_id="BAJ00600.1"
FT                   /translation="MLTYLAEIWHKSMPNSQFILIDFVRFPSIFK"
FT   CDS_pept        752497..753054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00601"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG02"
FT                   /protein_id="BAJ00601.1"
FT                   /translation="MFGLIKMGEKMNSTCHLSAILFFTIVTPQCVANSMPFRCLASTPM
FT                   IKQNVDINLVECSYLMLLDSGDINDSWYWYPVGTLGLLVTNSDDGFYLGGGLGLGWHIN
FT                   DNILIFSEGGVDWFSDYQYGERGKAYKNYGGPWQYFLKLGSSYKFSTRWRLGYAYMHIS
FT                   NGLRYEVNPAFDGHSVFLSFKF"
FT   CDS_pept        753519..753941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0631"
FT                   /product="ribose ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00602"
FT                   /db_xref="GOA:D4ZG03"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG03"
FT                   /protein_id="BAJ00602.1"
FT                   /translation="MRKGALLNSDLARVIALSGHTDEITIADAGLPVPECCERIDLALT
FT                   HGVPAFIDTLRIVATELQIESVVIAEEMLVHNPGMHTQLLQLLDEIGQTQSQPISLSTV
FT                   SHQAFKSQTANSRAVVRTGECTPYANIILQAGVVFK"
FT   CDS_pept        753938..755422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="SVI_0632"
FT                   /product="ribose ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00603"
FT                   /db_xref="GOA:D4ZG04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG04"
FT                   /protein_id="BAJ00603.1"
FT                   /translation="MTALLSLSGIDKSFPGVKALDGAQVNVYPGQVMALMGENGAGKST
FT                   MMKVMTGIYQADAGEIILNGEPVRFYGPRQSQAAGISIIHQELNLIDHLSIAENIFLGR
FT                   EPKNIIGLIDWRKMFSEADALLARLNVQRSSREKMGTLPLGEQQMIEIAKALSFKSNII
FT                   VMDEPTDSLTERETASLFKVIRELREQGVGIVYISHRLQEIFTICDRVTVMRDGQFIAE
FT                   SDVSDLTEESLIELMVGRKLQDLYPRIEHNTGKVSMKVRNLSGEGISDISFDLHEGEIL
FT                   GFNGLMGAGRTELMRILFGDAKRTSGEVELYGKPVHPTHPSEGIKAGIAYISEDRKGDG
FT                   LVLGMSVKQNMSLSSMTALSYMGAIKADAEHELASHFKQAFNIKTPSLDQPIGKLSGGN
FT                   QQKAAIAKGLMANPKVLILDEPTRGVDVGAKKEIYQLINQYKKKGMSIILVSSDMPEVM
FT                   GMSDRIMVMSGGRISGEFDATQVTQEQLLAAAIGNH"
FT   CDS_pept        755439..756410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="SVI_0633"
FT                   /product="ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00604"
FT                   /db_xref="GOA:D4ZG05"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG05"
FT                   /protein_id="BAJ00604.1"
FT                   /translation="MNQTATYNATGTKTFAWLKQQKALIALFVLIAVVSILNDQFFTMG
FT                   NLMNILRQTSVNAIIAVGMTLVILTAGIDLSVGAILALTGALGASMVGAELPLTLALPL
FT                   TLLLGGALGAMNGLLISKGKVQAFIATLVTMTAIRGLTMVYTEGRPISTGFTDTADNFA
FT                   FIGTGWLAGVPVPVWMMLITFVLVWVMLTHTRLGRYIYAIGGNESAARLSGINVDRVKV
FT                   AVYGLSGMMAALAGLIVTSRLSSAQPTAGTSYELDAIAAVVVGGASLAGGRGFIWGTLV
FT                   GALIIGFLNNALNLLDVSSYYQMIAKAGVILLAVLADRKSNT"
FT   CDS_pept        756442..757320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="SVI_0634"
FT                   /product="ribose ABC transporter, periplasmic
FT                   D-ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00605"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG06"
FT                   /protein_id="BAJ00605.1"
FT                   /translation="MNKLLKSAAALALALGLTAPAMAQDTIALVVSTLNNPFFVSMKEG
FT                   AQQKAEELGYKLIVLDSQNDPSKELSNIEDLTIRQVKAILLNPTDSDAASNAARMVNRA
FT                   GIPLLTLDRGVTRGKVVSHIASDNVAGGKLAGDFIAGKLGKGVKVIQLEGVAGTSASRD
FT                   RGEGFALAVAAHGFEMQASQPADFDRTKGLNVTENLLASKPDVQAIFAQNDEMALGALR
FT                   AVRGAGKEVLIVGFDGTDEGIEAVKRGLLSATVAQQPKLIGELGVETAVKVLKGETVPE
FT                   FQPVPLQIITQ"
FT   CDS_pept        757513..758427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="SVI_0635"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00606"
FT                   /db_xref="GOA:D4ZG07"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG07"
FT                   /protein_id="BAJ00606.1"
FT                   /translation="MAKLSVLGSINVDHLMQVGAAPRGGQTIQAKQYQIVAGGKGANQA
FT                   VAAAKLGADVAMIACIGTDAIGEQMKQGLADIGIDTKGITTITGENTGVAMIYVEDSGE
FT                   NRIGIWPGANASLTETVMSEHKASIQDSDLLLLQLETPVETLVAAAKIAKAAGTRVVLN
FT                   PAPAKALPEALLSNVDIITPNETEAEQLTGVAISELSDADMAANKLHTKFGIETVLITL
FT                   GERGVWLSHKGEGKHIAGFVMQAIDTTAAGDTFNGGFVTGLLEGQSMLDSVRFGQAAAA
FT                   LSVTRMGAQSSIPTRVETLALLA"
FT   CDS_pept        758609..759616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="SVI_0636"
FT                   /product="ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00607"
FT                   /db_xref="GOA:D4ZG08"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG08"
FT                   /protein_id="BAJ00607.1"
FT                   /translation="MTTIRDVAKLAGVSTTTVSHVLNKTRFVSVEGKAKVEAAVIELNY
FT                   VPNTIARSLKGGSSRVLGMLITDANNPFYADLIQWVDQVAYRYGYNLILCNTQGNIQRA
FT                   KDYLVMLSQRQVDGMLMMSSDARQLPVSSYGSMPMVMMDSGPEQAGYDRILDDSEQGGY
FT                   MATKHLLESGHKSIGLLAGPLDKSNSQNRIAGYRRAMAEAKLEVDECWIQSGEFTYEGG
FT                   AEAMSRLLNQSSPVTAIFASNDLMAMGAIRVAGKQGLTIPEDLSIIGYDDIPGAKYFNP
FT                   PLTTMSQPLEQLAEQAIAMLLARIETPKREGQRTLLPPSLIIRDSVAVRKSAEN"
FT   CDS_pept        complement(759703..760566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00608"
FT                   /db_xref="InterPro:IPR018883"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG09"
FT                   /protein_id="BAJ00608.1"
FT                   /translation="MINKTRVLCATAVLFPLLVNAATAADTGHSVSDKVIEKQRAALAT
FT                   NTQGKGYGPQSPRDIDTIQGSNQRIFGEAPDYTEMNLCNIHFHINAEHKGGEFTKYAGN
FT                   GDGHGYNSGYQYTGKLSKKELTPLKNKIGVSKHGSLHPGDTIEVHYVHSTAQVGPGATL
FT                   GSCLSEANSNPQLRVETQVFVLVNDTKAMSFMELTKLGMKNGLNQALNIPSNTGKPVQY
FT                   EGSTTGPGYNEIASPLQVSWSVRPQVMKVDIHTVGKWLEGNAFDEDHAHGVRNLVVNPA
FT                   LLSDSE"
FT   CDS_pept        complement(760827..761762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0638"
FT                   /product="histone deacetylase/AcuC/AphA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00609"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG10"
FT                   /protein_id="BAJ00609.1"
FT                   /translation="MLPLIYHPIYSQLPLPEGHRYPIMKYQFLYDAIMEKTQNDTNWQQ
FT                   EITFFSPQALTLQDIKQVHDADYVDMLACGQLPANKMRRIGFPWSEALMQRTLTSAAGT
FT                   VLTAHKAIESGVAIHLSGGYHHAHNDFGSGFCLFNDLVLAAHFSLQKDDIHKVLIIDSD
FT                   VHHGDGTATLCQGRDDIITLSFHCDKNFPARKPDSDLDVPLTRGTGDETFLACFQQVVQ
FT                   MAINLHRPDLVIYDAGVDLHRDDELGYLDISTQAIYLRDLFLLQTMQDNHIPVAAVVGG
FT                   GYRAKHKDLVPVHFQLFQAALDLSLNSDSE"
FT   CDS_pept        complement(761834..762328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00610"
FT                   /db_xref="GOA:D4ZG11"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG11"
FT                   /protein_id="BAJ00610.1"
FT                   /translation="MTINQLLFALFLTAAIISILVYLRFPPRFYNKMRHHPHFKPTSHI
FT                   YEVLPDVHQDSHTNRQTIHPYHNVTIELTPHSCNAVKKLQGIHFLSKDAPSIPIAHCDA
FT                   MKCQCHYKHYQDRRSENLERRVGFGITRELFGAFGEKNLRVKKPDRRDVTAKRSEGNLI
FT                   K"
FT   CDS_pept        complement(762639..764549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0640"
FT                   /product="thermolysin metallopeptidase family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00611"
FT                   /db_xref="GOA:D4ZG12"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG12"
FT                   /protein_id="BAJ00611.1"
FT                   /translation="MSIRLNSSALLLLFAAVLTSPAIAQDKASNQGEANRPTFVTGDLG
FT                   SINASSQASLHASAKSALQLVLNEQYEADGREEMIVTKVIEDKIGGHHIRFEQKLNGLP
FT                   VAGTGMVIHADIHGSVFAVNGDFVPSGDLPLKPDLSAIEAFGLNDIKGTKNGKPELSYV
FT                   LGSDGIGHLAWKATFEYINEEGPQRDIVFVDASTGKIAARHPQILYARKLNTQDCQQRT
FT                   RRCKTVSRSSNVINTSDLAINSAHNYAIATYNYYLNNHGRDSIDDKGMTLKSRVHFGLN
FT                   YNNAFWDGSQMTYGDGDGVNFIPLSQDADVVAHELTHGVTERSSGLIYQNESGALSEAW
FT                   SDIFGAMVDRQEGATGADIWFIGEDIYTPMIPGDALRNMADPAAFGDYDYYPTRYMGGA
FT                   DNGGVHWNSGIANLAFKLLVTGGTHPRGETSVNVTPIGFDAAADIFYAANIGCLTPSSN
FT                   FATARYCTAIFAGSNEAAVNLAWDAVGVPNHPPIQLQNDVATAPKDGEIGDIQYYLLSG
FT                   VNSGETVTCTTSCDNGDADLYLRFNGLAETNPNSGLNECGSYSTNSNESCTTGAASSDG
FT                   STLNAAVHGFSAYTNLSLTCTISSNNGGSCPLLDLGSSCTSNSQCCSDKCKGKPGSKTC
FT                   K"
FT   CDS_pept        764936..765151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00612"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG13"
FT                   /protein_id="BAJ00612.1"
FT                   /translation="MILMTELKIRNVGKGLGLELPQDLVERLHLGAGDSICLEKMAHGN
FT                   YRLVSKNDELEEQMALIEGYMHEEDA"
FT   CDS_pept        765663..765995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0642"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00613"
FT                   /db_xref="InterPro:IPR021768"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG14"
FT                   /protein_id="BAJ00613.1"
FT                   /translation="MMKVKVLSAVMLSVLLSGCAGQMAVSNATMKFNMDVVDNRYARGG
FT                   LTILMAPVYAVTTIADYGLFNPIEFWTGENVLTDKKSIYDMKGKNYIEINDSLDEALKT
FT                   APIKLD"
FT   CDS_pept        767562..768743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0643"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00614"
FT                   /db_xref="GOA:D4ZG15"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG15"
FT                   /protein_id="BAJ00614.1"
FT                   /translation="MNITIIGAGNAGSACAFMAAEAGHKVSLLKTSNRITHDDHFEAMV
FT                   RNKGIYCIDNTQKGHFTDSADDAEKTFQPLELITRDPEAAIEGADVIMIFIQTTYHPAL
FT                   AERIAKYFKSNQLVILIPGYAGSIFYDKYCDNNPIFAEGESTPNDARVVEPGTVKVLFK
FT                   NARNSLSFFPAIRTAEGMAIASRLFPAYDIEMSQVRKNIFDSALHNPNIIVHTVGLYVM
FT                   YPMLEYCAKHHPDEVPYMYRDALSTEMAWLMIEKLDAEKMAVLSALGCEPIPYLEACLF
FT                   RNEEDLNQDPREVFESYKISSPPGPYSFDNRYVTEDVPMGLVLLSSLGEKLGIDMPECH
FT                   RLIEMCGGILSRDFYAEGRTLATLGLGDLTREELLNFVESRDCPDEVRASAQA"
FT   CDS_pept        769024..769161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00615"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG16"
FT                   /protein_id="BAJ00615.1"
FT                   /translation="MLCCELSASGSEYSERRSQDHRKIEYPVVLASNSGGTLAATLVFL
FT                   "
FT   CDS_pept        769373..771979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD-1"
FT                   /locus_tag="SVI_0645"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00616"
FT                   /db_xref="GOA:D4ZG17"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG17"
FT                   /protein_id="BAJ00616.1"
FT                   /translation="MSGSDISPQFSSKMSITDYKKVIQDADNYLNENFTHVAIDEIVKL
FT                   RADFFDALLIHLWQCAELSSDNLSLNAVGGYGRQTLHLHSDIDICVLFPEELSSHQTTQ
FT                   IGLFFTQLWDLGLELGHSVRALNEIDNACKEDITIATSLFEIRHLAGPKSHANQVLDRL
FT                   YGDDLWSSEAFFKAKVSEQDERHLKAQGSAFSLEPNLKNSPGGMRDIQTLIWVTRKYFA
FT                   AEDMAALRRFGFFTADEYTELLESQHFIWRARWALHAAAERSQNRLLISLQSDVARLMG
FT                   FGDNSHLAIEKMMRQLYRAMRRISELNQMLLQYFKDEILVQADKKSTPLNQHFEINGRL
FT                   INARHDDVFVDRKQLIALFNHIAENSNDIDGITPLTIRLIRQVRRRLLGDLQDFHSCRK
FT                   EFIALFRHPQGMGLALSLMHKHGILASYLPQWREIAGQMQFDLYHVYPVDEHTHKLLKN
FT                   LYSLNGKPESPSLAQPSTVYKAIENKEALLLAALFHDLGKGRGGDHSELGAVDALQFAK
FT                   FHELKPSQAKVIVWLVKNHLLLSLSCQRLDIYDPSEVKNLAKSIGTKARLDALYCLTVA
FT                   DIKATNDELWTNWKASLLRDLYLSISYALRNGLENVLEQRTIVREHKNEALELMGVSET
FT                   PDVIKQLWKRLPLSFFSNAQPRDIVRYSRAMTQHPVEHALILLDESSTKGSSDLFVYMK
FT                   DKPGLFVTLFNTLASLQISVQQANISKTKDGYVVESLKILDYDHHPIRTAGRRDRIKKR
FT                   LKQVLFENRKVPKQRLNSNIGSFVSEPKVEFLHSRKKDRTLISVTALDNPQFMSHFCNG
FT                   FRQFELNIHSAKITTVGEQVDNVFLVSDKNGQSLDDESKQALKSFFVDIIKEQVPI"
FT   CDS_pept        complement(772094..773629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0646"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00617"
FT                   /db_xref="GOA:D4ZG18"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG18"
FT                   /protein_id="BAJ00617.1"
FT                   /translation="MMGKIEAGVTSIYNDRVVPLKDLKIIGDDYAVSVIDAVNKANAGM
FT                   FSAAEASRAMTESSRNISEKWNAYMATTLTDEESRLTKEANRLFMPANQQISQLVNKLN
FT                   SMQGSPSGQLNDDIAPLYDVIDPISGKISELISLQLRVAGEEKNKVDEIYSSSMTIFIL
FT                   LTLIAIVTSVIIGLWVTRAVMRPIDNIVSTLNTVRVDSDLTVTFKTFNDDELGQISTNL
FT                   TLVIEHLRGILNSIALAANTVGDSTVKLSEFTQQTNDRMHQQQAETEQTATAMNQMTAT
FT                   VAEVAQSATNAADSAKDAEANATKGNDIVQQSVASMTLLSKQIDQTSQVITHLASESNN
FT                   IGSVLDVIKGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAQRTQESTQEIES
FT                   MIDGLQKGVQEAVGAMKIGTEQVYDANEKAHMAGGALNEIVLSVDNISNMNTQIATAAE
FT                   EQSSVAEDINRSIIAISDIAQASTMAAQELTTSVTELSSLSESMREQVGQFKL"
FT   CDS_pept        complement(774486..776486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0647"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00618"
FT                   /db_xref="GOA:D4ZG19"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG19"
FT                   /protein_id="BAJ00618.1"
FT                   /translation="MRFKGTFMKLKNKLLITFLLIALVPILALGFIASYTASSSIEAEV
FT                   SSKLVAVRDTKKTQIKNYFSERQGDITILASTINKTLDFSSADSLTRTAHDNQAYFEEF
FT                   LKVYGYYDFFLIQDKGEIFYTVAKEADYQTNLVTGSYSNSGLGTLFKQVKNRDTFGMSD
FT                   FIRYAPSNNEPAAFIALPLNNREGSPVIIALQLSIDKVNELMQQREGMGDTGESYLVGG
FT                   DYLMRSDSFLSPQDHSVLASFAGNVKDNGVDTEAAKLAINGKDGYKVIIDYNGNSVLSA
FT                   FTPIDIHGIRWAVISEIDAAEAFAPIHTLYWNLAIVIFLAILGIITVAFVISSSILKPL
FT                   GGEPSEMQFISETIAAGDLTFAFERGREAASVYGAMQKMAQQLRTVMGEIIQDSISLAS
FT                   VAEETSASSLQSVTSLQEQQASIEQISTAVEEMSTSISDVAKNATDVASSSLSAQSSSA
FT                   EANKKLNQTIDDLGLLDQEISQASDVIQELERDSYEIGSVLEVIRGIADQTNLLALNAA
FT                   IEAARAGEQGRGFAVVADEVRTLASKTQDSTKNIEGMIVKLQNASDKAVKGMAASRNVC
FT                   EQTISNAHNMAQMIETMHSDIDSITQMTEVIATAVEQQSCASIEISQSLTVISDVAHQN
FT                   STSAEQVSTASSDISHIASTLNELTSKFKVS"
FT   CDS_pept        complement(777058..779160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0648"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00619"
FT                   /db_xref="GOA:D4ZG20"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG20"
FT                   /protein_id="BAJ00619.1"
FT                   /translation="MTKKVKYCLFSLLVIQYCNPALADTLSPLYDQGNIERISVTATRQ
FT                   ESLDTDLAMSLQGISKEELAIDNGQHAAESLNSISGVLIDQLSGGQGHKAAIRMPMNTS
FT                   GYYLYLQDNIPLQSPAFFNHNALWWSSFNSNIARMEVLKGAGTALYGSGAVAATVNILS
FT                   KEVAESPETDINLMLGEDEYSKVQFSHSNILSDTQGFRVSASYLNNEGWRDHTGSKRAE
FT                   LTLRHELDLGDNERLVTSLVISDLEQEMAGNLTEDLYNNDKTNSGLSDDVLASDPLRKT
FT                   QYMRLSSQWDKTAGDNYYSLIPYYRYRTNDYTATWNQNMPKIESKVQTLGLLALANFEH
FT                   SNDSDTSIGLDIELTQGDLFSYQILDYSTTGWKADTFIKGEKFFDDTTQYISLSPYIQH
FT                   KRNIAKNLDLTLGARYDYAHYDFKNHLSLYGDIGHGKQSLEDRTDNFNHFSPKASLNYH
FT                   LTPDSSVYLRYANSFRLPTAGSLYHLTIKDDGDAKAVDPEISDTYELGYKSNWKSISFD
FT                   TAVYYMDVDDGIVYAYNDSGQRYLTNATRVIHKGIEISVAWKINEQVNISTAYSKSKHE
FT                   FDQHDDYSGNEMAASPDYIANVRLRYTPEFIEDLTVMLEVQSIGKYWLDDANSQDDDGI
FT                   DRIQDGYTIANVKALYQVSEQLSFNARVLNITDNEYVQQASYRYGKTLYSPGTPITAYV
FT                   GLNYKW"
FT   CDS_pept        complement(779813..780076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0649"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00620"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG21"
FT                   /protein_id="BAJ00620.1"
FT                   /translation="MLNENHALIFDFPEYKQDIVYLNYKDETFTTLSKQYHLLDYDIRQ
FT                   LEIDGSPTDDEHMHQLKLQRANLKDLLFQQLKAHHDSPITTS"
FT   CDS_pept        complement(780713..784483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH"
FT                   /locus_tag="SVI_0650"
FT                   /product="5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00621"
FT                   /db_xref="GOA:D4ZG22"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG22"
FT                   /protein_id="BAJ00621.1"
FT                   /translation="MANDTLSTPIITKEKGQELTLKLTRQLEQEILILDGAMGTMIQDL
FT                   KLEEEDFRGEQFKDWHKDVKGNNDMLVLTQPAAIKGIHKQYLLAGADIIETNTFNSTRI
FT                   AMADYDMQEFSAQINLEGARLARAAADEVEQETGRSCYVAGVLGPTNRTCSISPDVNDP
FT                   GYRNVSFDELVEAYVESINALIEGGADIIMVETIFDTLNAKAALFAVETVYDDLGARLP
FT                   IMISGTITDASGRTLTGQTTEAFYNSLRHVKPLSIGLNCALGPKELRPYVEELSKISEC
FT                   FVSAHPNAGLPNEFGGYDETPKQMADIIGEWAEEGFLNIIGGCCGTTPDHIRVIREAVI
FT                   KHPARQLPDIPVACRLSGLEPLTIDENSLFLNVGERTNVTGSAKFLRLIKTGEFEEALS
FT                   VARDQVENGAQIIDINMDEGMLDGVEIMHKFLNLIASEPDISRVPIMIDSSKWEVIEAG
FT                   LKCIQGKGIVNSISLKEGEEKFIQQATLVKRYGAAAIIMAFDEQGQADTKARKIEICTR
FT                   AYRVLVDKVGFPPEDIIFDPNIFAIATGIEEHDNYAVDFIEATAEIKRTLPHAMISGGV
FT                   SNVSFSFRGNNPVREAIHAVFLYHAIQAGMDMGIVNAGQLSIYDDIDPELKERVEAIVG
FT                   NLPCTAVDKNGDATNNTELLLEVAEKFRGDGSQTAKKEDLEWRSWEVNKRLSHALVKGI
FT                   TDYIVQDTEEARAASSRPLDVIEGALMDGMNVVGDLFGSGKMFLPQVVKSARVMKKAVA
FT                   YLNPYIEEEKTPGQSNGKILMVTVKGDVHDIGKNIVGVVLACNGYDVIDLGVMVPVEKI
FT                   IDVAITENVDIIGMSGLITPSLDEMVHNVKSFHKAGLTIPTIIGGATCSKIHTAVKIAP
FT                   HSPTGAIYIADASRAVPMVSKLINNETRQATIDAAYEEYDVMREKRLSQTKRKIITTIE
FT                   AARDNRCKYDWDNYTPFIPNQLGRQVFDDYPLEDLVDRIDWTPFFRSWELHGHFPKILT
FT                   DKVVGEEATKLFADGKAMLKRIIDEKWLTAKGVIGLFPANTVNHDDIELYSCDGTDESR
FT                   DKPIITLHHLRMQIERVGNDNFCLADFVAPKDSGVADYMGGFAVTAGHGIDEHIARFEA
FT                   DHDDYSAIMLKCLADRLAEAFAERMHERVRKEFWGYASDEVLDNEALIREKYKGIRPAP
FT                   GYPACPDHTEKGLLWDLLKPDETIGLNITESYAMYPTAAVSGWYFAHPKSRYFGVTNIG
FT                   KDQVEDYAQRKGMSIEETERWLSPVLDYDPE"
FT   CDS_pept        784550..784891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00622"
FT                   /db_xref="GOA:D4ZG23"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG23"
FT                   /protein_id="BAJ00622.1"
FT                   /translation="MFIRIDVYTKPDTFLCRVAILCVLSPCILTYFLMISPLFLRSELC
FT                   FKQALYRRNVVWRKNNNQAAFRLLALVTWFFIVSWPVASNIAFSLSSMLLSITLIWLSL
FT                   ILFLYALTK"
FT   CDS_pept        785521..788343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0652"
FT                   /product="sodium-solute symporter/sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00623"
FT                   /db_xref="GOA:D4ZG24"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG24"
FT                   /protein_id="BAJ00623.1"
FT                   /translation="MISATSLLLIIFAYVGLLYVIAAWAESGSKAAERITTSAVVYALS
FT                   LAIYCTSWTFFGSVGIATRSSILMLSIYLGPTLLMIVIWPLMQRILLIKQIYRVTSIAD
FT                   FLSARFNRSVSLAGLAALVAMIGIVPYLALQLKAINTSIDLLLGVQTEVKLTIAWLVWL
FT                   GVALFTIVFGIRHLDPTERHPGMMLALAVEGLVKLAAMLSVGVFVCFVMFDSPLDIFAQ
FT                   LEQKMPEAAAKMSSKPAFVTWFSYLVLAGSAFMLLPRQFHVMVVENPDPNHVKKVQWWL
FT                   PVYLILMTLFVTPIAAAGLLLLGPDTADSYMLSIPMLAGQELLTIFVFIGGFSASMAML
FT                   MVSGMTLSTMFSNHLVLPLIQWFRPESRLKKYLLQSRWLAVFVVLGAGQVFYLYLGESY
FT                   MLVNMGMISFGAVLQFLPLVIAGLYWPQVTSKGAFSGLCAGFGIWAYCLLLPAIMKSGW
FT                   INADILLTGPFGVGWLHPEHLFGTEMHKISHGTFWSMAANISALVLGSLYSKMSGEEKR
FT                   YNAEFMDVMAERVAEDEAIMDTLPRDIELKPKLELLKAIFSQYLSPEFADIKLSACLGE
FT                   AGLSQAELINVQELANLERATERLLSGITGAAVAHMVVTQSNIYSKQETQTLERYYGQL
FT                   LAQLKISPAQLRQQLNYSKEKELLAKRYSEQMQGIVDDRTRELQSTLDKLKSAQAHLVE
FT                   TEKQASLGKMVAGIAHEINTPIGVCVTAASHLHDEVVALKKMFAAGDLSEEEFQGFMQT
FT                   CTEAMDIILKNNARASSLIQSFKRVAVDQSSEQIREFSLKEYLEEILMSLRPTLKKVPH
FT                   EVKIICSDKLICNTYPGILSQVVTNLIMNSMLHAFKPEQVGVVTIEISVKEGTILMDYR
FT                   DDGVGLDEDGEKNLFDPFYTTKRNQGGSGLGTHLVYNLVTQKLKGEVDVETSPGKGLCY
FT                   HIRFPQNVED"
FT   CDS_pept        788480..789103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0653"
FT                   /product="alpha-ribazole-5'-phosphate phosphatase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00624"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG25"
FT                   /protein_id="BAJ00624.1"
FT                   /translation="MAECTTVFYLLRHGECEGGNILRGHTDVAVSQTGRASMTAAIDRL
FT                   VERHEVEFDQIFSSPLRRCSEFALNLYLKNGVPLKLEEDLKEVNFGDWDGETLESLYQH
FT                   SSEMIESYWKNPWAVTPPNGESMLGFESRVDAVWQSILQQYSGQTLLLITHAGVMRHLM
FT                   ANALGVSGVAGFYTQLSLAYAAVVKISVFTSPQGHFTKLHWGND"
FT   CDS_pept        789587..790513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0654"
FT                   /product="iron-compound ABC transporter, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00625"
FT                   /db_xref="GOA:D4ZG26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG26"
FT                   /protein_id="BAJ00625.1"
FT                   /translation="MSLVSGLTSQSTSELALDVQDLCWQVDSRSILSQISFSIKRGQML
FT                   GIIGPNGAGKSTLLRCIYRYIKPDSGKIQLFGQEITHLSSKAFAREVAVVLQDTPHHFE
FT                   LTTAQLVAIGLTPHKGPFELTNAADRILISDALEKVGLTHKAKQSYEHLSGGEKQRALI
FT                   ARAIVQQPKLLILDEPTNHLDIHYQIQIMELLHSIGITVITSIHDLNLASAMCDSLLLL
FT                   EEGKCISYGSPSEVLTEQAIGEVFGVCSHVTPHPQHGNPQICYYYGYEKGYDKGYEPGH
FT                   ENSHEKDRQQSQLNKNGSASLEDSGHG"
FT   CDS_pept        790674..791663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0655"
FT                   /product="iron-compound ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00626"
FT                   /db_xref="GOA:D4ZG27"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG27"
FT                   /protein_id="BAJ00626.1"
FT                   /translation="MFAASFGAANISSMDTLDVVLHQAFGIGDVPSITQRIVMELRFPR
FT                   VILAFIAGAGLSIAGSVLQTVTRNPLADPYLFGISSGASFGAVIVLTLFTGSGLFASSG
FT                   LLAGSGLFERFSWMTLPLGAFMGAGLSVAMVLALCGRHMSSQIERMLLSGVAISFMFGA
FT                   LTSLLLYFSDPQAAASVLFWSLGSFSKASWSGLIAPLVIVTGCTGIILLFKRQIMAMRA
FT                   GDETAHTLGINVSRLRLQMLLLCSIITAILVANCGGIGFIGLMVPHTVRMLFPGQFPLI
FT                   TTALVGGVFMVWIDVIARTILSHQELPVGIITAVIGSIFFLFILGSRK"
FT   CDS_pept        791719..792747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="SVI_0656"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00627"
FT                   /db_xref="GOA:D4ZG28"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG28"
FT                   /protein_id="BAJ00627.1"
FT                   /translation="MFDISPVSHEFDEEIQNKIDHKTKPLGALGELENIAIQLARILDK
FT                   DKPEIIKPKLLVFAADHGIAAFGVSIAPSEVTTQMVINFIQGGAAINVFCRQVGFELEV
FT                   IDCGILQPVQGVEGIIDQRLGAGTKPIHKQPAMTLAAVKQGFEMAANRIEYHHQQGTNL
FT                   IAFGEMGIGNTSSAAAIMACIMNMEGAECVGRGTGIDASTLERKQQLIEQALHLHEAEL
FT                   TTPMNILACLGGFEIVQMTGAMLAAAERNMILVIDGFIATAAAMVAVQINPNVRDYMIF
FT                   GHQSDERGHCLMIEHLQARPLLKLGMRLGEGTGAALALPMIQAAAGFYNEMASLNDVGI
FT                   DI"
FT   CDS_pept        792911..793711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="SVI_0657"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00628"
FT                   /db_xref="GOA:D4ZG29"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG29"
FT                   /protein_id="BAJ00628.1"
FT                   /translation="MDVLRRELTLFFIAMGFFTRIPMPTWVKVDADNLNKASRYFGLVG
FT                   VLVGAISALVYEVSMYALPTSISIILALIAGVAVTGSFHEDGLADTADGFGGGWTVADK
FT                   LKIMKDSRIGTYGTVTLLLSMILKYMLLLELALYDPENVIAALILGHCLSRVLAASIIF
FT                   TETYVSDAYASEGVSEEKSSKSKPLAESQTANELAILLVTGALALWLSGLGAAILIAAG
FT                   LFVLRWILVALFRRQIGGYTGDTLGAAQQVSELVFYMLLLASLA"
FT   CDS_pept        793797..794351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobU"
FT                   /locus_tag="SVI_0658"
FT                   /product="cobinamide kinase/cobinamide phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00629"
FT                   /db_xref="GOA:D4ZG30"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG30"
FT                   /protein_id="BAJ00629.1"
FT                   /translation="MIHLVLGGARSGKTGFATTAAKTYSEKGYQCVYIATAQALDDEMN
FT                   DRISRHRSDREADSLDWITVETPLNLVETLREYAREDRLLLVDCLTLWLTNHLMLEDSP
FT                   TVFTDCDCKWNDEKQALLSVLTELPGEIYLVSNEVGCGIVPLGEINRRFVDEAGWLHQD
FT                   IAAIADTVTQVTAGLPMRLKG"
FT   CDS_pept        794481..796076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="SVI_0659"
FT                   /product="cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00630"
FT                   /db_xref="GOA:D4ZG31"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG31"
FT                   /protein_id="BAJ00630.1"
FT                   /translation="MGAARVLMVQGTTSDAGKSTLVAGLCRLFARQGRRVAPFKPQNMA
FT                   LNSAVTADGGEIGRAQALQAVACGLPLHTDFNPILLKPSSDTGAQVIVQGQALDQMEAK
FT                   TFFGLSKYQADVSGDECQPGYRVKAMSAVLDSFSRLTHGYEMVMVEGAGSPAEINLREG
FT                   DIANMGFAEAVDCPVIIIADIDKGGVFAHLVGTLALLSDSEQARVKGFVINRFRGDIAL
FT                   LQSGLDWLEEYTNKPVLGVLPYLHDLHLDAEDALTPAPDKSTQTRLKVLVLVFPRISNH
FT                   TDFDPLRLNPHIEFNYVSMQTQAESQSELGVLPPADLIILPGSKNVRGDLEFLRQQAWD
FT                   IGIKKHLRYGGKVLGICGGYQMLGQLIDDPSGVEGRPGVSAGLGLLPLFTELQSKKVLR
FT                   QVTGELSLLGEQAEVKGYEIHCGESRQQTQVKGLIQPLSLTPQNSVLDGASTTEGAFHD
FT                   GMLAEDGQVLGTYLHGLFDSADACALLLKWAGMADAKPIDIDAIRDQQLNRFADQLEKD
FT                   LDMDKLEQILGART"
FT   CDS_pept        796228..796881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="SVI_0660"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00631"
FT                   /db_xref="GOA:D4ZG32"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR025826"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG32"
FT                   /protein_id="BAJ00631.1"
FT                   /translation="MTENNENSNSIDAEKQKSQEERKAQRHKERQQKVKEAVDAKIAAA
FT                   QEEKGILLVLTGNGKGKSTSGFGTIARSVGHGKKSAVVQFIKGNWECGERTLLEGAGVE
FT                   FHVMGTGFTWETQDKEKDTQAAESAWAAAETLLKDESIDCLMLDELTYMVSYHYLEVDR
FT                   VIEALKNRPPMQHVIITGRACHRAIIELADTVSEVQSVKHAFDHGIKAQPGFDY"
FT   tRNA            complement(797187..797273)
FT                   /locus_tag="SVI_t005"
FT                   /product="tRNA-Leu"
FT                   /note="codon recognized: CAG; tRNA-Leu-1"
FT   CDS_pept        797516..798340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0661"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00632"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG33"
FT                   /protein_id="BAJ00632.1"
FT                   /translation="MKTINRIVLLLAVCLPIFSAMASPAKRIIALSPHSVEMLYAIGAG
FT                   DSIVATTDHADFPKSALDIPRIGGYHGIQIERVLELQPDLVVVWGSGNKAEDLQRLKEL
FT                   GFNVYNSDPKTLEAVADELKELGELTGHQVEANKLADDYLAGLEALRKENQPKSEVKVF
FT                   YQLWSTPLMTVAKNSWIQQIISVCHGNNVYLDAASDYPQVSLESVLLNMPEVILQSQDE
FT                   GNVLGIDWSEWQEIPAVKNKHIYQLNADLLHRATPRALQGVQALCDALDKAR"
FT   CDS_pept        798540..798923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0662"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00633"
FT                   /db_xref="GOA:D4ZG34"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG34"
FT                   /protein_id="BAJ00633.1"
FT                   /translation="MTSLLICLCIAMLLPYLTKGPVAWAMAKAGGYDNSHPRAQQARLT
FT                   GFGARAVAGHQNAFESLLIFGLAVVTVIATEKVNDTVVTLAIVHVIARITYQLLYLIDK
FT                   GTLRSLAWFVAVFCSFGILFQAF"
FT   CDS_pept        799458..799892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0663"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00634"
FT                   /db_xref="GOA:D4ZG35"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG35"
FT                   /protein_id="BAJ00634.1"
FT                   /translation="MDTSLVAALLGGMLIGLSAIALMIFNGRIAGISGILSRALFRTDA
FT                   ESGSGKAAAWQWYFLFGIIFSGVIYAQFSISMGAPQFEFNQVSTPLLCFAGLLVGLGNQ
FT                   LGSGCTSGHGICGIGRFSLRSIIATCVFMLTGVISAVLLH"
FT   CDS_pept        799961..800428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0664"
FT                   /product="YeeE/YedE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00635"
FT                   /db_xref="GOA:D4ZG36"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG36"
FT                   /protein_id="BAJ00635.1"
FT                   /translation="MNKNVAALISGILFGAGLLISGMADPNKVIGFLDITRLLDGSWDP
FT                   SLMLVMLGALLVYIPVFHFYVKPRAESTIKLKPKPMFDNEYHLPAAKKPDGKLVLGSAI
FT                   FGLGWGIAGICPGPALVNIGSLDISLGLFVISMVTGSYLGKMSLAAILSRG"
FT   CDS_pept        800759..802021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00636"
FT                   /db_xref="GOA:D4ZG37"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032681"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG37"
FT                   /protein_id="BAJ00636.1"
FT                   /translation="MMIQDTSGQDTALEPNLGKKLKWPLVAGAAVLLVSGLVWASVGGQ
FT                   VSESIKGSELRLATLERGTLTRDITTTGKIVAANAPILYSTDQGTVTLLAKPGDRVELG
FT                   DVVATIESHKLTNSLKQQEALLEGMLSALERARLDARREQLKAQQTLDMAKVDLEAADR
FT                   ESRRGDELIQNKLISKIDYEKGKDDLHKAKLLSAHAKQDTELMRDTLAFEIKNKASQVN
FT                   RQKLVVSELERQVGALNIKAPVGGIIGNWLTEQKARIGQSQPVLTVVDLSAFEAELAVP
FT                   ESYADELGLGMAVELSFGELTLIGELSSISPEVRNREVTARVRFEQDERLHLRQNQRLS
FT                   ARVLLENRPNVLMVKRGAFVSTGGGREVYAMNGDIAEQTEIKLGARSMSHIEVLQGGKA
FT                   GDVWVISSIQAFNKAEQVLVR"
FT   CDS_pept        802032..802529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00637"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG38"
FT                   /protein_id="BAJ00637.1"
FT                   /translation="MNKSNQKSGFRAFSIQRAFSGNRALSIQKAIRPQKALDLLAGLNM
FT                   QRVITVSALLLLLVAVQVSTQSIGDWYVFGLNVLEMTTPLMPTTPAFTEVSNVATGLDT
FT                   DLGSGLSTGLSTGLSTGLGTGLTINSEIVNIFSDIGVFTQKFVIAIIECALDSLPKSGF
FT                   SR"
FT   CDS_pept        802607..803389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0667"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00638"
FT                   /db_xref="GOA:D4ZG39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG39"
FT                   /protein_id="BAJ00638.1"
FT                   /translation="MLSMKSISKVFKTDLVETHALRDFNLEVKEGEFVAVTGPSGSGKT
FT                   TFLNIAGLLEGFTHGDYFLDGVNISNLSDNKSAGIRNEKIGFIFQGFNLIPDLNLAENI
FT                   EVPLRYRGFNAKERKRRVQHALEQVGLAARMKHLPSQLSGGQQQRVAIARALAGEPRFL
FT                   LADEPTGNLDSMMARQVMELLEDINKAGTTIIMVTHDPELARRAQRNIQIVDGQVCDFT
FT                   MYQGGGYQGGVGQGEGAEKPHLVTGAASAAKQTQRVAS"
FT   CDS_pept        803395..804702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0668"
FT                   /product="ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00639"
FT                   /db_xref="GOA:D4ZG40"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG40"
FT                   /protein_id="BAJ00639.1"
FT                   /translation="MTMFFYYLDLAWRSIKKTPLLSLLMVFAISVGISTTITTLNVYQL
FT                   MSVNPAGERSDKLLAVQLWSQGKDAWKEFNAQVTYQDAFNLRKSELPVRQTPMFVTGLA
FT                   VQTEDADFSPLLETVRVTDSDFFGMFSVPFLYGGAWDKSVDTQAAYQVVINEDLNKQLF
FT                   AGENSVGKTLFLDSKPYQVVGVIKTWSPSPQYYDLTTGAFKDSAQLFIPFSLTPMEEFQ
FT                   SWGNNQSWKRESMDTYNGRLNSEMHWIQFWVEVTDDKQRDEYAQWLTAYVEQQQLLGRF
FT                   ESPEAGAQLSNVAQWLDLNEVVPEDNKILVGLSGLFLLVCLVNMLGLLLAKFLKRAPEV
FT                   GVRRAIGASRNQIFAQHMVEVGLIGFCGGVLGLIWAWGSLSMLSARFNLEESLTHLDPS
FT                   MWIIAPAIAICAALVAGIYPAWRICSTNPSVHLKSQ"
FT   CDS_pept        804735..805946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0669"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00640"
FT                   /db_xref="GOA:D4ZG41"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG41"
FT                   /protein_id="BAJ00640.1"
FT                   /translation="MLHIKPIINTLMRSKSGPILLLIQIILSVAIVANASFIIGERLAL
FT                   MDRESGTEEEQVFNFLLYAFDSGIDIESQIPRDIRAIRELPGVIDATTTSMVPLSGGGW
FT                   SSGYTIGDSEETAKDTENTAIYYGDDHMVNTLGVDLIEGRNFYETEVLTGSPDLATHGI
FT                   VSKAFAKKTWGDESAIGQIMYAGGWGDKPIQIIGVVDKLQGAWVNSSYLDNSVILNVRL
FT                   VNMFSKVLVRVEVGTLAQLKQVIPAMLHKDEPNRVIEDFTLISEHRKRVYRNHELMATV
FT                   LSMMVILLLLITSLGLAGMVMFNIERRTKQIGTRRALGAKRRDIISLFLVENYIICIVG
FT                   GIIGGLVAVQLGQQLMTFYSLPKLELIYPIVTVAGMMVLTTIAVILPARKAASISPATA
FT                   TRSV"
FT   CDS_pept        806222..807778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0670"
FT                   /product="sigma-54 dependent nitrogen response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00641"
FT                   /db_xref="GOA:D4ZG42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG42"
FT                   /protein_id="BAJ00641.1"
FT                   /translation="MDTILIVDDNQAVCDALALMLELHGYKTHSCLSPEVALELVKIHD
FT                   IALVIQDMNFTQDTTSGEEGKSLFYELRSLQPLLPIVLITAWTQLDIAVELVKEGAVDY
FT                   MGKPWDDAKLLNSVSNLISLHTLSRENTQYQRAESQRMVAIKDADLCGIVFASGSMQRS
FT                   VDLALQIARSDVSVLITGPNGAGKDKLADIIHANSPLKNKPFIKVNIGALPMDLLEAEL
FT                   FGAEAGAFTGANKTRIGRFEAADGGTLFLDEIGNLSLSGQIKLLRVLQTGEFERLGSHQ
FT                   TRKVKVRVLSATNAELALDIREGRFREDLFYRLNVIELELSPLNQRQDDILPLVSHFIG
FT                   PNFSLNKQTQRALEAHAWPGNVRELENACKRAVILAPSKLLTPLDFGLSAEPVQDNPVS
FT                   GPELKQELTLELKPVLKSELKQELASDSKPELKPVLKRELKPESAIDQKADTPRVPDSA
FT                   SDNAHSSASSSTRSSISVIDKTSIQAELHRHHGVIARVAKSLGLSRQALYRRMEKFGIN
FT                   K"
FT   CDS_pept        807850..809241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0671"
FT                   /product="nitrogen regulation protein NtrY, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00642"
FT                   /db_xref="GOA:D4ZG43"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG43"
FT                   /protein_id="BAJ00642.1"
FT                   /translation="MMDDCAMTLRSKLILASVLACFLGLVSAGLLFNWLGQDYLVLIAL
FT                   LSLGLVWAVSHYMTRNLADCLAALEVGLLNFKDNDFSISIPVKGDEQLRTLARLFNESA
FT                   HTLRRERQFIYQRELLLDKVIQSSPNVMILLDDEQRVIYANDAARHLFNQGVPIEGLHL
FT                   HELIEACSPELITALNNPKDGLFTLGAKESLGTDIQGETSDETMNEDETWHLSRGRFKL
FT                   NGQLHHLLLLKQMTHELNRQEVAVWKKVIRIISHELNNSVAPIASMVNSGRMITKDLND
FT                   PKLKMIFDTIDDRTQHLSQFIFNYARFAKLPLPNKSMVNWLKMTEHLSHHYKFTLDGSL
FT                   PEGDGYFDLIQMEQVLLNLLKNAHESGSKVDEITMSITQANPSHGVDSASGNKGILISI
FT                   CDAGSGMSSEVLKQALLPFYSTKQSGTGLGLPLCREILEAHDGRISLHNREETGLCVKL
FT                   WLPQS"
FT   CDS_pept        809852..810046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00643"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG44"
FT                   /protein_id="BAJ00643.1"
FT                   /translation="MLNWLLGKDTVVNMSLAALRFQTMSMFNGQFGIPASRSESITSRY
FT                   LTLKSKLLAAYTLVDLQDN"
FT   CDS_pept        810421..811227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0673"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00644"
FT                   /db_xref="GOA:D4ZG45"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG45"
FT                   /protein_id="BAJ00644.1"
FT                   /translation="MEKSKIWINKTFKGVELLSASYTKFKFTKHWHDELAIGVIEDGAE
FT                   GLFYRGDNLIIPKRHIVAINPSEVHTGFSGAPNGWRYRMFYFNLKELDSEFSNRDMPID
FT                   PIINSPIIYDEYLFNILFQLHVSLEKPSFELTKESLFSLAIEKLFRQYGSAKRERFNSI
FT                   CTTSSYLARDFIQDNFEFNPSLSELEKISNCSKFQLIRSFKIIFGITPHQYLLLIKVKN
FT                   AKKLLSKGLSCVDTSLACGFCDQSHFIRNFKKAFGISPSNYLNDKG"
FT   CDS_pept        811272..811931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0674"
FT                   /product="transporter, LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00645"
FT                   /db_xref="GOA:D4ZG46"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG46"
FT                   /protein_id="BAJ00645.1"
FT                   /translation="MPLLVKEVSMSLFIIWLGVMFPLVFSPGPANIVFAASGARVGIKR
FT                   SIPLVAGIDSIFIIKSIIIGYGLGEVVKSHPEIMNSLQLVGAIYLVYVAVKFMRPNSSK
FT                   SENISTELGFFDGLLIQLLNSKGWLMVFLMFSLFTEPSQDIFGDKGVAVLIIWLAFLNI
FT                   SMHFVWVSIGEFLSRVSSSPLYEKWLSFFYACCLIAVSIWLIIENPMVITYLGIST"
FT   CDS_pept        complement(812094..812294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00646"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG47"
FT                   /protein_id="BAJ00646.1"
FT                   /translation="MNAPVYIAKVKLTTVKHKPVNTTLKVIWRSGALVSKLRAVNKLSN
FT                   CQENKARPSAQPIAPIYDVSL"
FT   CDS_pept        812508..812867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0676"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00647"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG48"
FT                   /protein_id="BAJ00647.1"
FT                   /translation="MDSPSTLLVVRDLSISREFYVNILGLNILEEYEDSLKFQIGSHSV
FT                   FMFQGTMEATDYEHGFNANSALVFTVSDLDEKIKELKENGVVFVHESPNENRWGRYAAF
FT                   KDPSGIIHELMEFCT"
FT   CDS_pept        complement(813520..814134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0677"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00648"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG49"
FT                   /protein_id="BAJ00648.1"
FT                   /translation="MLKHRRILLNTSEQALSQREPQTRHMTPETIINFWFDEIEPKAWW
FT                   VKDTEFDALIKHRFGLLVEQAKVGELYHWRATPQGRLAEIILLDQFCRNIHRDTPQAFT
FT                   SDPLALALAQEAVARGADTELKAKQVPFLFMPYMHSESRKVHEIAMVLFNREAAAGNLE
FT                   FERRHKAIIDQFGRYPHRNKILGRESTPEEVEFLSQPGSSF"
FT   CDS_pept        complement(814165..815730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0678"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00649"
FT                   /db_xref="GOA:D4ZG50"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG50"
FT                   /protein_id="BAJ00649.1"
FT                   /translation="MHKRFSLWSGLSPWSIISYTLNTIRLVISNGYAMVPVVYTGWQQG
FT                   FNSPWVIVAAVGVALAVLVYAIVQWAMFRYRLYEDKLGVRQGLIFKKTHEIPLSKIQNV
FT                   RLEQPFYFRPMGLYSLVVETAGSKEDEAVLAAVNYRQAIQLKHKLVNPLLPTPREGVEA
FT                   NREDGTQAGVTSEGAGKHATQGNNSPNTKSESLVRKGFKPLLLFGLYQNNLFWFVIISG
FT                   PILGQLDWSQLADTHLAQSAWLWYEQAVGTNLLYQVLFASLLFISFCLLLSLVSMAASV
FT                   LKYYPYHLSRNSSTLHRSGGIIAKQSDALALQRIQVIRFSQPIIARLLKLWTVYFKQVK
FT                   GTEVEQKSQSHMLVPSMTRRTVSALLKNMQGIEARTTELPKHYHPIHFGWYWRRALAPI
FT                   MVPAASTIAMGFTPLTELLWLIGVGLSLGLYLRYRQWGYFLDGSDCWIHTGTLGHSWHL
FT                   IALNKIQHVAIIQTKGQRKKGLASLELGLASGTLTIPYLPLSDAREIAERALAMTGRSH
FT                   QNWI"
FT   CDS_pept        complement(815732..816526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00650"
FT                   /db_xref="GOA:D4ZG51"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG51"
FT                   /protein_id="BAJ00650.1"
FT                   /translation="MPRQNQAQSDWLGFDQVPLTPVDPRHYTQVLCESIIGALVLFSLV
FT                   SVFIILVAQLPIKIALAALSVLGLILGIITWLSYAHAKSIAFAVCDHELLMQKGIIWFK
FT                   RISLPYSRLQHISLSQGPLERKFGLHTLKCFSAGSGSAEIELPGLESRTAEKLRQHLLA
FT                   KAGIANQGAKPSIEPEPSINPDLSINPNSSINPNSSINPNSSINPNSSINPNSSINPEP
FT                   SINLDSSINLEPSINRSTDTSQDTSLEGLESKTASLTTESER"
FT   CDS_pept        816993..817283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00651"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG52"
FT                   /protein_id="BAJ00651.1"
FT                   /translation="MDIEVSKQKKAFLRKLYLAHTIDSDQHNLLSLNKLTGMPRRTLQD
FT                   SIAALSDIGVECQFIQDGERNNSGHYKISSWGPISSAWVDTHLDEITKLLA"
FT   CDS_pept        complement(817469..818716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="SVI_0681"
FT                   /product="flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00652"
FT                   /db_xref="GOA:D4ZG53"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG53"
FT                   /protein_id="BAJ00652.1"
FT                   /translation="MLSAKHIELVKSTIPLLESAGTGITEYFYQRMFKHNPELKHIFNM
FT                   TNQRTGGQPAALFGAIAAYAKNIDNLGALSGAVERIAHKHTSLNIQPEHYPIVGHHLLA
FT                   TLRELAPEAFTAEVEEAWAAAYGLLAGIFINREDELYQKNANQVGGWLGARQFKLVEKQ
FT                   QESALVTSFVLAPVDGEPVVDYQAGQYLGIKVEPANHEYREMRQYSLSDKPNGKTYRIS
FT                   VKREDAKNPKDEPGTVSNYLHDQLNIGDVMDIFPPAGDFHYVERNEPVVLISAGVGVTP
FT                   MQSMLEMLASKAFDKPVFYLHACENLAQHSFNERVQALTNTLTLTQHTWYRELDGNEQE
FT                   SLNCQSLNQSNSGSVNSHMGFMNLVPIKAELPLARGDFYLCGPVAFMSFVKQQLIEIGV
FT                   EDSRIHYEVFGPHADL"
FT   CDS_pept        complement(818891..819190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00653"
FT                   /db_xref="GOA:D4ZG54"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG54"
FT                   /protein_id="BAJ00653.1"
FT                   /translation="MHATQANDFSFTHDTEFSKDSLKPSPRGFKLALHTGNAVMLIAVL
FT                   GILLSIFVAYAHAEQFSLWAQVASHITLILCATAIKIGYVIRCIGLHGLGAIQL"
FT   CDS_pept        819473..821110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norR-1"
FT                   /locus_tag="SVI_0683"
FT                   /product="anaerobic nitric oxide reductase transcription
FT                   regulator norR"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00654"
FT                   /db_xref="GOA:D4ZG55"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG55"
FT                   /protein_id="BAJ00654.1"
FT                   /translation="MTMIDISSTALIELALDLANSLTTKDRFDRLLSTVRRTVNCDAVV
FT                   LLHVQGERLKPLAQQGLSKDSLGRRFDIQAHPRFEIICGSQTPVRFAADCMLPDPYDGM
FT                   LLGHEGDLPVHACMGLPLLADGLLIGVLTLDSMTPQVFDELPKRTLDVISSMSAATLKT
FT                   AILLQELESHSLHSQELVAELTNEALVKDGGELIGDSPVMLKLKREIDMVAVSGFSILI
FT                   EGETGVGKELVARTLHRQSARSDGPLVYVNCAALPENLIESELFGHVKGAFTGADRNRT
FT                   GKFSLADGGTIFLDEIGELPLGVQSKLLRVLQSQEIQPVGKDATEQVNVRILAATNRKL
FT                   KLEVSEARFRADLYHRLSVYPISVPPLREREGDVTLLAGYFIEQIRRKLGIRQLAIDAS
FT                   AISILNRYDWPGNVRELEHVIGRAALRAKGRGDQAIVRIDTRHIEQLVDSVERSEGLLL
FT                   SSSSNGLNTDVLTTVLTAGLVVDKGTSVSLKLETEAFQCKLITRVLSQESGNWSAAAKR
FT                   LQTDRANLSRLAKRLGISVTKAVTLSTD"
FT   CDS_pept        821145..821435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0684"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00655"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG56"
FT                   /protein_id="BAJ00655.1"
FT                   /translation="MLNNYLRRESMNKSNFFDKIPEDLTDEAFEQIGGNDKILIERIVS
FT                   KAHVTPEGQWYDQDRSEWVMVYTNLIKYLLSSEPLRLFNSRRIDVEMVIPF"
FT   CDS_pept        821678..821779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00656"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG57"
FT                   /protein_id="BAJ00656.1"
FT                   /translation="MGDYVDIAAHCKHRVTWTSTETETLWLAVHYLL"
FT   CDS_pept        821961..822335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0686"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00657"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG58"
FT                   /protein_id="BAJ00657.1"
FT                   /translation="MGLLDSLLGNASEVNLEELADELGPILADNEELHLAYKLIRDMFV
FT                   FTNKRLILIDKQGLTGKKVSYHSIPYKAITHFEVETAGRFDMDSELKLWISGQDKPLVK
FT                   ELKKGTDVVGIQKTIANFML"
FT   CDS_pept        complement(822494..823285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00658"
FT                   /db_xref="GOA:D4ZG59"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG59"
FT                   /protein_id="BAJ00658.1"
FT                   /translation="MKIYQVSDCHLYLDEAQPRDNLIRALALIELQGDGDILLLTGDLV
FT                   CDPNIEIYTQFKAIVQAHSSIDRIFAIAGNHDDLTMMKSVFKGSRVQVKSHVHLGDDLS
FT                   LCFVDSSPKPLAHMSLGAGRVARKALSSLKQFTRKYRSIVVIHHPVVNLGAKWFTQIGI
FT                   ENNLDVVAAIHPQTLAILSGHAHAFFKDNLTSPQGKIIPLIVSPATSYGFEHSNPDYEK
FT                   NTNIGIMAYDIRLDIGSQSPTKSCKSKPNYLIHESVINLSH"
FT   CDS_pept        823700..824680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0688"
FT                   /product="immunogenic protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00659"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG60"
FT                   /protein_id="BAJ00659.1"
FT                   /translation="MLTKVNACLYSKYIKGQSMSYRAITLALLLILPAAVHAENYSIGT
FT                   GGQSGIYYPFGGALAKIWSDKIPGVNVKAEVTAASVENTIKVVRGDMIAGIAMGNVVLD
FT                   AYKGEGKFRSKMPVKTLFALYPNLVHTLALEKSGIKSLGDLKGKRISLGAPASGTAVTA
FT                   AALLASVGIDVKKDIDAVYLNYSETTNALANGQIDAGFIVGGQGVGAVTQISLTHKVNI
FT                   IPISDAQSTAFIEKNPAYSKYTIPADVYNKVGEVSTLSVWNVVVVSAKMSDEMAYNLTK
FT                   SAFENMGEVRKVVKVAEATTPENAHRLAGVPLHIGAQKYLDSLAQ"
FT   CDS_pept        824844..826820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0689"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00660"
FT                   /db_xref="GOA:D4ZG61"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG61"
FT                   /protein_id="BAJ00660.1"
FT                   /translation="MTQTNNITLGHDEPVLEDIPSIDVCSSASLIKADPLPNEGVFKLL
FT                   GYLILTLAVSLSAFQIWQGITSTISATYFRPVHLSWVLVLIFLNYPLISDRYNKGYLPG
FT                   RVLDLALCGLALFAAYRMSIFDYNDIDHLLYGLKMPDLLAGSALLLLLMEGCRRTVGWV
FT                   MVLISALFLSYSAFGDILPSAIATKGYSLQELIQFQIYSANGVFGSALGIAATTVFIFV
FT                   LFGAFLEVTGAGKFFIDLSFSIAGKYRGGPAKAAVLASAGLGSISGSAIANTVTTGSVT
FT                   IPMMKQLGYKPEQAAGIEAAASTGGQIMPPIMGAGAFVMAQFTGVPYSEIMLASIAPAI
FT                   LYFFCTLLYVHLMACKLNLKAVSRTEAVISVMKHGAHYLIPLGLITALLMMAYSPLLVG
FT                   VAGCGAILVTAALRKHSRIGLSQFIQGMKNGALMALPISVACGAAGIIVGVVGQTGIGL
FT                   QFTQFVMEFSGGYMLVALGLISIVALILGMGLPVTAAYIVLAVMAVPMLGDFGLPLLTA
FT                   HLIIFWLSQTSNVTPPIALAAFAAAGVAKANPMKSSVEAFKLAGGLFIIPIMMAYTDLI
FT                   NPEASVLEFGFAIAQTAAIILALAISIEGYLLRPLSKMERIIAFMMAPLILFNFFGVGF
FT                   VGILVICGLILMQWKSRELAEGT"
FT   CDS_pept        826955..827485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00661"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG62"
FT                   /protein_id="BAJ00661.1"
FT                   /translation="MGDNMARRVLIFGNSGSGKSTLAKRLASSDGLAHLDLDSLAWQPY
FT                   EPPKPPERMPLNESAYKLKTFTQGNQNWVVEGCYTDLLQLLVGNVTELIFMNLPVDLCI
FT                   ENAKQRPWEPHKYPSKQAQDANLSMLIEWIAQYDLRDDTFSRRAHEDFYSAFQGKKTRY
FT                   LSNLSSTRNSRDI"
FT   CDS_pept        complement(827556..827774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00662"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG63"
FT                   /protein_id="BAJ00662.1"
FT                   /translation="MQTLLRLAASTIPVGSAVTSLSRKVTAAFTPAMQSRKSYLRFSFL
FT                   DVKNKLWDIDELVVNRIKWSEGSERIK"
FT   CDS_pept        complement(827924..829078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0692"
FT                   /product="aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00663"
FT                   /db_xref="GOA:D4ZG64"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG64"
FT                   /protein_id="BAJ00663.1"
FT                   /translation="MSTLDHSSKLPNLGTSIFTYMTGLANQYQAINLSQGFPEFDAPKL
FT                   LKQGLAKYCDLGFNQYAPSPGLAPLQAQIACLIGRQYGIDVNPNDTVTVTSGATEALFV
FT                   TIQAITHPGDEIIIFDPAYDSYKPAIELAGGRAVHIPMLAPDYAIDWQLVAAAITDKTR
FT                   GIIINTPHNPSAKTLKQADFDELKALVIEHDLLIISDEVYEHIIFGNTPHISILTDAEL
FT                   FSRAFVISSFGKTFHCTGWKMGYCVAPKMLTQEFRKIHQYVTFSSFTPAQLALTDMLAQ
FT                   EPEHITALAAFYQHKRDVLVNALQNSRFTILPSEGTYFLLLDYSEISGLDDMSFCEYLV
FT                   KEIGVAAIPLSVFYQTAPGDKVIRLCFAKEDKTLLQAAEKLSAL"
FT   CDS_pept        829343..829483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00664"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG65"
FT                   /protein_id="BAJ00664.1"
FT                   /translation="MHLFEAIAGVNAAVTFDIRDDVAEAIGIYSRRVAEVFALKPTAGD
FT                   R"
FT   CDS_pept        complement(829615..829863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0694"
FT                   /product="Fe-S metabolism associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00665"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG66"
FT                   /protein_id="BAJ00665.1"
FT                   /translation="MILRLDKVMPVPSFSYYLADSDARIVKGLVALLLTACNGKSADEI
FT                   VAFDIDAYFDRLGLTGQLSPSRTNGLFSLAKAIKTSV"
FT   CDS_pept        complement(830349..830786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0695"
FT                   /product="Fe-S metabolism associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00666"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG67"
FT                   /protein_id="BAJ00666.1"
FT                   /translation="MSSAAKPATEVFLALKLDASEILPKFENANNWQERYRQIMLLGKT
FT                   LSKLEDEFRVEQAQVRGCESNAWLYHSEIDGKHYYLADSDARIVKGLVALLLTACNGKS
FT                   ADEIVAFDIDAYFDRLGLTGQLSPSRTNGLFALAKAIKTSV"
FT   CDS_pept        complement(830910..832124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0696"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00667"
FT                   /db_xref="GOA:D4ZG68"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG68"
FT                   /protein_id="BAJ00667.1"
FT                   /translation="MDFPQLRAQFPTLEQTLEGYPLCYLDTAATSQKPKCVIDAMTQYY
FT                   HKDNANVHRAAHQLSSRATSQYEAVRDQLTGFIKASRREEIIFTHGTTESINMVAHGLM
FT                   NQTQAGDIILIDTAAHHANIVPWQELAKRSGAIIKPIPLTEDCRLDELAYEALLKEKPA
FT                   IVALCHVSNALGTLNPVNQLVAKAKAAGAITLVDGAQAIAHLEIDVQAIDCDFYVFSGH
FT                   KMYGPTGIGVLYGRFDILDKLEPMMTGGEMIKTVSFDATEFNILPNRLEAGTPPIAEVI
FT                   GLGAAIKFIQNLPKAETAQREQELLAYLQTQLANLGDIKLYGASENNIGAVAFNLADEH
FT                   HQDVGILLDQQGIAVRCGHHCAMPLMQSLAIKGCCRASIGVYTSKEDINRFIEALKSVK
FT                   EILLD"
FT   CDS_pept        complement(832177..832290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00668"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG69"
FT                   /protein_id="BAJ00668.1"
FT                   /translation="MANSSKRWPEKIAKKCHQDAQVSHADNPPKKPLALAA"
FT   CDS_pept        832317..832934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00669"
FT                   /db_xref="GOA:D4ZG70"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG70"
FT                   /protein_id="BAJ00669.1"
FT                   /translation="MQSKAHWEKVYSSKDEAEVSWFQEHAKLSLKLIQNSAVNKNASII
FT                   DVGGGASTLVDDLLGNGYRNLTVLDLSAAALAKAQNRLGEQASNVTWLEANVIEAQYPH
FT                   HGYDVWHDRAVFHFLNTLEERQAYVKAVLHAVKPGGLVIVATFAENGPTMCSGLPVKRY
FT                   SADELHEEFGEPFSLLGHEKESHQTPNGSEQHFVYCFCRKLV"
FT   CDS_pept        complement(832956..833999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0699"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00670"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG71"
FT                   /protein_id="BAJ00670.1"
FT                   /translation="MEYRRIPHSNLEVSELCLGTMTWGEQNTQAEAFSQLDYAIGEGIN
FT                   FIDTAEMYPVPPKAETQGESERIIGHYLKKTGNRDKLVIATKVSAPGPKSDYIRPNMAL
FT                   DWRNIHQAVDASLERLQIDTIDLYQIHWPDRNTNFFGELSYQQQDDNEQQTPIIETLEA
FT                   LASLVTAGKIRYIGVSNETPWGLMKYLEIAEKHDLPKVISVQNPYSLLNRSFEVGMAEI
FT                   SHREDVPLLAYSPLAFGALTGKYLDNKWPENARLTLFKRFSRYTGTQIALDATKAYVEL
FT                   AHEFKLSPAQMSLAFVTSRKFVASNIIGATSLKQLKENIDSINTCISPELMVRLDELAQ
FT                   TYRLPCP"
FT   CDS_pept        complement(834155..835135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0700"
FT                   /product="transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00671"
FT                   /db_xref="GOA:D4ZG72"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG72"
FT                   /protein_id="BAJ00671.1"
FT                   /translation="MTKDNKLGNQTGSELRTISRHIVRQLGMLNSACGDLPLSPVQAHA
FT                   LIEVSRGAISIKKLAQILNIDKSNASRALSHLVEKGFAHTKSNPRDSRSLLAHLTPQGR
FT                   KLLQKLDHQQNIIFDEILCQLSPFETQQIETAMTLYHKAIHHSRLQQEYELREMTSEDN
FT                   APMAEVIRTVSAEYGLTSDKNDSVGNPNLDTLSEQYQGSDACYWVIEKEGEIFGGAGIA
FT                   PLVITGETNPESQERVCELQQMYFSQALRGKGFTKRLAYLALDFAREQGFNSCYLETTA
FT                   KLSEAVKLYESMGFKHLDVHLGTHLDTHQGDSGHHGSEMPMLLKL"
FT   CDS_pept        complement(835402..835989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00672"
FT                   /db_xref="GOA:D4ZG73"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG73"
FT                   /protein_id="BAJ00672.1"
FT                   /translation="MQQITKLKKIRVLVGSKNPVKVNAARVAICQLFPDIDIECNGMHA
FT                   PSGVPDQPMTDVETREGAINRVKYCREFSAKAAQQADGEPIAELFIAMEGGVDNFEYGP
FT                   ATFAYTVIATQSQLSVGRSAQLPISQSIYKSLLAGEELGDVMDRLFNTNNIKQQGGAIG
FT                   LLTQGHATRESTYTQALILAMAPMLNPELYLD"
FT   CDS_pept        836600..837907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0702"
FT                   /product="serine transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00673"
FT                   /db_xref="GOA:D4ZG74"
FT                   /db_xref="InterPro:IPR004694"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG74"
FT                   /protein_id="BAJ00673.1"
FT                   /translation="MQKETTVSQANDTQLNGAETQVNPAVSLGWTRKDTTWMLSLFGTA
FT                   VGAGILFLPINAGMGGFWPLVMMAVIIGPMTYLAHRGLSRFICSSQKPGSDITDVVEEY
FT                   FGVSAGKAITLLYFCAIFPIVLIYGVGITNTVDSFIVNQLGMASPPRWLLSGLLITAMM
FT                   SVMVSGEKLMLKVTQFLVYPLVGILVFMSLYLIPSWKMDALMQVPSTGDFLGTVWLTIP
FT                   VLVFAFNHSPAISQFSVALKREHGKDASKKADVILRNTSMMLVSFVMLFVFSCVLSLSP
FT                   EQLAESKAQNLPILSYLANVHSSDFVSYFGPIIAVIAIVSSFFGHYMGATEGIKGIINK
FT                   QLRSSNKQVSEKKIDRFILVFMFITIWGVSIINPSILGMIEALGGPVIAAILYLMPMYA
FT                   IYKVPALKAYRGRISNIFVVVAGLLAMTAILFGMLS"
FT   CDS_pept        838013..839380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA-1"
FT                   /locus_tag="SVI_0703"
FT                   /product="L-serine dehydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00674"
FT                   /db_xref="GOA:D4ZG75"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG75"
FT                   /protein_id="BAJ00674.1"
FT                   /translation="MFSAFEIFKIGVGPSSSHTVGPMKAAKEFVDELRQRDELESVTRI
FT                   SVDIYGSLSLTGKGHHTDIAILMGLGGNSPANVDIDSIPATISEIEQSSSLLLGKEAHR
FT                   VDFPQDAVTFHKHALELHENGMSIHAWLGDECLFSKTYYSTGGGFIVDEEHFGLTADND
FT                   VSVPYPYAYASELLEQCTQAGMSISDLMMENEKVFNSEKAIYEGFGAIWDVMQSGIKRG
FT                   CQTEGVLEGPLRVPRRAPDLHRQLLANDRLAVDPMVVIDWVNVFALAVSEENAAGGRVV
FT                   TSPTNGAAGIIPAVMAYYDKFIQPMGEQEYTRFYLAAAAIGSLYKRNASISGAEVGCQG
FT                   EVGVACSMAAAGLAEIMGASPSQVCIAAEIGMEHNLGLTCDPVGGQVQVPCIERNAIAA
FT                   VKAINSSRMAMRRTSEPRVSLDKVIATMYETGKDMNVKYRETSQGGLAIKVMSICA"
FT   CDS_pept        839411..839593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00675"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG76"
FT                   /protein_id="BAJ00675.1"
FT                   /translation="MVFFLPRILMMHQLLNFMMSAREGEGDSKRLCYETGKGMKVKYRE
FT                   TSQGGLAIKVMSICA"
FT   CDS_pept        complement(839771..840262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0705"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00676"
FT                   /db_xref="GOA:D4ZG77"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG77"
FT                   /protein_id="BAJ00676.1"
FT                   /translation="MHSSVKSNEKSNIQSSVQLRKGQQSDLAALVRFNQAMALETENLS
FT                   LDEILLTKGVNALLSEPEKGFYLVAEVEGEIVGSLMVTFEWSDWRALNYYWIQSVYIRP
FT                   ENRRQGIYGKLYQQVKTIAAQNGGAASFRLYVEQENTKAQQTYQALGMEQSYYLMYEEK
FT                   "
FT   CDS_pept        840573..841019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00677"
FT                   /db_xref="GOA:D4ZG78"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG78"
FT                   /protein_id="BAJ00677.1"
FT                   /translation="MASVRHKYRVHRLGSKSSAYCYVSYRRKGEDLQALFRRTAANQDR
FT                   LIVQERIGIHSKHVKCAKLESSNLEASNLEKKKLIHFVLTLITFGAWGLVWWWLILKSE
FT                   GKADQLFRGFDDAYWSYLIEREQPPASLHKIKIDQEAKTGYFDA"
FT   CDS_pept        complement(841176..841589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0707"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00678"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG79"
FT                   /protein_id="BAJ00678.1"
FT                   /translation="MSLKSFLITATFFALSACQSTAEPEPMEKELAGTWHIEAVAGQPV
FT                   MDYSPAQLIFSHDGKLSGNNSCNSFFGEYSLQGSSITLSPTGSTMKACVDALMDQEQRV
FT                   MKSMLEVTSGQIAKSKLVLKDANGKTQFVLSKI"
FT   CDS_pept        841622..841780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00679"
FT                   /db_xref="GOA:D4ZG80"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG80"
FT                   /protein_id="BAJ00679.1"
FT                   /translation="MASLEQDKKRKLDIRAQSVMKAIKRLHWLGLLMFLSGTAAYLFTD
FT                   STQVISV"
FT   CDS_pept        complement(841897..842841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0709"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00680"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG81"
FT                   /protein_id="BAJ00680.1"
FT                   /translation="MLAQSNHHRLWLREQDHPAISLPRWQQQMDLLTSFYRSQTSLILQ
FT                   LAENSFQVVCTQQSQDYDLSAGTTFFDAPLLKLIQSQSGYGQFHVEGNEFTSSLSQFQH
FT                   LICQLIYWPDGELFGCILICDPHQNKFQERLAPLVETTKSLIQAELKHLFLMMKVQILS
FT                   VQDEQTSMLNQYGFSLMAPRQLSLSRRFGSHAGIILVETLCDEAGEVETESNEQMLRIV
FT                   ARIINNCLRDADVSARISHNQFIILCFIDNESNLDSLVLRLKKQFAKEGEKLNLVTGQS
FT                   YFTPDTQIDLRPMQEQANKSLNLNRLGLDKKTR"
FT   CDS_pept        complement(843126..844097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0710"
FT                   /product="GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00681"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG82"
FT                   /protein_id="BAJ00681.1"
FT                   /translation="MLPETIDTSISLLESDNTQLNLVRWMHQCELMKRYYEANVVFIIQ
FT                   ETGTSFEVIVSSISQSRQFTTGTSFDRGHKIFQRLIRSLPDGLNIDLTNHDHVDLHEEF
FT                   NQAENLLTRPILWPDGTHFGCICVLNAEKSTAASNSFMLEPFQVLLQQELTLYCQTQRI
FT                   ESLSMRDRETGMLNQYGFIMMAPRQLSLGRRFGAHAGIIFFELYSAHTIEHIEEKHHRL
FT                   LGSIIQDTIRTADIAAHYDDNLFVVLVFVDSERDLLHISKRVDKLIFQQNDQLKVDSSC
FT                   NYFTPDSTLKLAPMLEASKQGLKSEKIKLAAQAAKLEAPAET"
FT   CDS_pept        844273..844839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0711"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00682"
FT                   /db_xref="GOA:D4ZG83"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG83"
FT                   /protein_id="BAJ00682.1"
FT                   /translation="MKIRLAHMGDLKQLVKLERLHLNDELSDGSQAHALDGQAFGEAEL
FT                   RQLIDSHWICVAEREADALDGHQGEIVGYVIAGAWSFFESWPVYRHILKRLKEFSLGGI
FT                   KLTKSNSCQYGPIWIKQECRGQGIFEALVTEIRTHVQAKFPFMLTFIAEDNMASFSAHT
FT                   NKASMQVLDFFTFDDRDYYLLALST"
FT   CDS_pept        844844..845395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00683"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG84"
FT                   /protein_id="BAJ00683.1"
FT                   /translation="MSKTQAAELTSIGLAIMNSTTDKQVLQRVQKLVAPYGGESLSAFD
FT                   NMKLVVAVIAADGKSGSDDSVNHQASIAYEVTPHREDDSETDGDQSKQAFYCVQWQGLW
FT                   IHCGLTNDYSASIQLLSHDGKLRPIKQSGLSDNNEHAIGEGTLGIIDIEASCLREVNLA
FT                   VISLQQIEFMCMEYAHFDHC"
FT   CDS_pept        complement(845514..846665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="SVI_0713"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00684"
FT                   /db_xref="GOA:D4ZG85"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG85"
FT                   /protein_id="BAJ00684.1"
FT                   /translation="MAQHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVMVGGEVTTSAWVDIEEITRKTVREIGYINSDMGFDADSCAVLNVIGKQSPDIN
FT                   QGVDRADPKEQGAGDQGLMFGYASNETDVLMPAPITYAHALVKRQSEMRKSKTLPWLRP
FT                   DAKSQVTFAYENNKIVGIDAVVLSTQHCDSVNQADLIEGVMETIIKPVLPAKWLSKDTK
FT                   YFINPTGRFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCELQVSYAIGVAEPTSISIETFGTSKVSEELLIALVREHFDLRPYG
FT                   LTEMLDLARPIYQSTAAYGHFGRNEFPWERTDKAEALKSAAKI"
FT   CDS_pept        847106..849100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="SVI_0714"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00685"
FT                   /db_xref="GOA:D4ZG86"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG86"
FT                   /protein_id="BAJ00685.1"
FT                   /translation="MSSRKELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFL
FT                   KHNPNNPEWVDRDRFILSNGHGSMLIYSLLHLSGYALPIEELKQFRQLHSKTPGHPEYG
FT                   YTPGVETTTGPLGAGISNAVGMAIAEKTLAAQFNQPGHDIVDHFTYCFLGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIMFWDDNGISIDGHVEGWFTDDTPKRFEAYGWHVVAGVDGHDSD
FT                   AIRAAIAEAKSVTDKPTMICCKTVIGFGSPNKSGTHNCHGAPLGDAEIAATREFLGWKH
FT                   GAFEIPENVYAGWDAKEAGATNEASWNDKFSAYEAAFPELAAEYKRRVITGDLPADFEE
FT                   KAQAFVQECQDKAESIASRKASQNAIGTFAAMLPEMLGGSADLAGSNLTLWSGSKGIQD
FT                   DPAGNYIYYGVREFGMSGIMNGASLHGGFINYGATFMMFMEYARNAVRMSALMGIQNVW
FT                   VYTHDSIGQGEDGPTHQPVEQLANLRMTPNMTVWRPCDAAETAVSWKSAIERRDAPTSL
FT                   IFSRQGLKAQARTAEQLANVAKGGYTLIDCAGTPELILIATGSEVQLAVDSAAALTEQG
FT                   KKVRVVSMPSTNEFDKQDVAYKESVLPKSVTKRVAIEAAHVDFWHKYVGFGGAVVGMST
FT                   FGESAPGADLLKHFGFTVENVVATANELG"
FT   CDS_pept        849389..850453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="SVI_0715"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00686"
FT                   /db_xref="GOA:D4ZG87"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG87"
FT                   /protein_id="BAJ00686.1"
FT                   /translation="MSIPIFPIGYKRLMIRVAINGYGRIGRSILRAVYESGKRDQIQIV
FT                   AINELAKPEAILHLTKYDTTHGRFQSQVELSADENYLHLGDDVIKLLHQKDANKLPWAE
FT                   LDIDIVYEATGVLSDRTSCEAHIHAGAKQVLISHPSSSDVDATIVYGVNHELLRAEHTV
FT                   VSNASCTTNCIVPVIEVLDKHFSVKSGAITTIHSAMNDQQVIDAYHDDLRRTRAAGQSI
FT                   IPVDTKLARGIERILPQMKDKFEAISVRVPTINVTAIDVSVTLASKVDIERVNQVLSDS
FT                   AKGLYKGILGYTDEPLVSCDFNHDPRSSIVDGTQTRVSAGHLVKLLLWCDNEWGFANRM
FT                   LDTSLEMIKARRSA"
FT   CDS_pept        850608..851783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="SVI_0716"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00687"
FT                   /db_xref="GOA:D4ZG88"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG88"
FT                   /protein_id="BAJ00687.1"
FT                   /translation="MAIINMSALDLQGKRVLIREDLNVPVSEGVVTSDARLRAALPTIK
FT                   LALEKGAAVMVMSHLGRPTEGEFNSEFSLKPVVDYLTKALDCPVRLANDYLDGVEANVG
FT                   EVVVFENVRFNVGEKKNDQALAKKLAALCDIYVMDAFGTAHRAQASTHGVGMHAPIACA
FT                   GPLLANELAALGKALDNPARPFVAIVGGSKVSTKLTVLESLSGIVDQLVVGGGIANTFI
FT                   AAAGHEVGKSLYEADLIDEAKRLVANAQSRGGDIPVPTDVVVASKFSPTASATLKDVSE
FT                   VTKDDMIFDIGPDSARALAKIIQGAGTIVWNGPVGVFEFDQFGEGTKHIALAIAESKAF
FT                   SIAGGGDTLAAVDKYNIADKISYISTGGGAFLEFLEGKELPAVAMLESRGK"
FT   CDS_pept        852014..853078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="SVI_0717"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00688"
FT                   /db_xref="GOA:D4ZG89"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG89"
FT                   /protein_id="BAJ00688.1"
FT                   /translation="MALISLRQMLDHAAEHDYGVPAFNVNNLEQMRAIMQAAEATDSPV
FT                   IVQASAGARKYARPQFLKYLMAAALEQYPDIPVCIHQDHGTDPDICQRSIQLGMSSVMM
FT                   DGSLMADGKTPASYDYNVGVTRRTVAFAHACGVSVEGEIGCLGSLETGEAGEEDGIGAA
FT                   GILTMDQMLTTPEEAARFVSDTHVDALAIAIGTSHGAYKFSRKPTGEVLRIDRIKEIHA
FT                   RIPNTHLVMHGSSSVPQEWLKVINEYGGEIPETYGVPLEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRKFLAENPSEFDPRKFLKASMEAMADICTTRYEAFGAAGMGSKIKPKSLQAM
FT                   YKAYQSGELDPQIK"
FT   CDS_pept        853186..854028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0718"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00689"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG90"
FT                   /protein_id="BAJ00689.1"
FT                   /translation="MFKFINMYHYFQFCLSDVNIARILRHMIFRSRIKMKKLLIASAIL
FT                   MAAPFAAQAGADFVEGDKTLAGEAEMGATLTTGNTETTSLKGRLDLKHELGNWENQYLL
FT                   EALYTEDTGEVTGKRYYGLIQGNYQLDGTSYIFVNANHEIDPFTGFDSTSTVSSGYGHK
FT                   FIDDGKTLFNVEAGPGYKYKRLDTESAALAGYETSDSWVAHGVMNYETEITESSKFKQM
FT                   FVADYGETFEGRSETSITANIIGALAMKFAIVVRYNDSPLDDKESTDTETNMTLLYAF"
FT   CDS_pept        854271..855014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00690"
FT                   /db_xref="GOA:D4ZG91"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG91"
FT                   /protein_id="BAJ00690.1"
FT                   /translation="MQIGCCWFDIKQTRLSNQANDTSWKMPLVEFSVLELLVRFRDQVL
FT                   SNEQLLQQLPEEQRTQVKLQQAVERVRFFMGEPSDRLLEAIDGEGFILHTRMKASLKKS
FT                   LTGPSLSMSAKHYGILMAQLLLLLPLIYWMIDPSVTIKPSHKLEIMTTDGLIIYHPIYG
FT                   SPEQKQEIEGQVQSFSELLSQCKKRPWDEMFYSVSKDKKIVNIILKNNKSSELESKNVK
FT                   AFSEDSNFSFMDKAWLNRAGICELF"
FT   CDS_pept        855001..855528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00691"
FT                   /db_xref="GOA:D4ZG92"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG92"
FT                   /protein_id="BAJ00691.1"
FT                   /translation="MNYFSKHYPVARFRIWHISLVLFGILLVILFLHAYALNSAGINLT
FT                   CRGNAFAANPADDLSLELKVKSKDKKVTLNYSFISKGLNLGGMEFRGRLDKLEVASMTY
FT                   KLNIDEGDFRLNFGHKVLPSYMESFIDSASNALANSHSVKLDIHVLDMDTSNNYTAIQF
FT                   IPGNSIWICELE"
FT   CDS_pept        855782..857167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0721"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00692"
FT                   /db_xref="GOA:D4ZG93"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG93"
FT                   /protein_id="BAJ00692.1"
FT                   /translation="MSKIKVKQEESLSIKFIHQMKVGDNRRLDLYFFLPKEMGIGPQSM
FT                   NEEQYYHSAITGRRSYYSSGLHLPLVQSRFASQKKRTVEEFRLYLNLFAYQFSVAIETD
FT                   SKELEQIEEPENFFNSLQGLCDLVSQLLKKFRRNEPSDPKLKSYFENADNYLSWFCEQR
FT                   LLKLLSRAPRGSEYSEVLDASIALCRAESEHRKTKRYNSQQTKDDPNRISNKMLLLRRL
FT                   IQQGVVLKEEMKTLGIGLKKMTTGFATAMVMLVVSALIIKAQGVFSGLTIALVLTLAVI
FT                   YGFREIFKEDIRNALWRLIQKGRPKWSRILRDTNSQAPIAKQLVWLDFMKTTELPDKVA
FT                   EILKRRHRQNKLDAEVLHYGIHTRVTQKEFLAGYTSIQEQVNFSLAPFARHLERGKAKI
FT                   YKEQDGKISNDSVERRYQINLILAVKDGKDEVQYARYKITMNRSMIIDISQSELPEGIE
FT                   AIV"
FT   CDS_pept        complement(857210..859420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0722"
FT                   /product="sensory box protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00693"
FT                   /db_xref="GOA:D4ZG94"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG94"
FT                   /protein_id="BAJ00693.1"
FT                   /translation="MLTPKLSPLIPAQGIHWSNQRLLSVATQIFILIISMIFISNVIIT
FT                   LGERRLQEDWATQRYSELQAVGTLIADKVSFQQFRTQMFAKSELLKNYLDVPSTKRQDK
FT                   LERNWAVITRNIPELLDIALFDPQGNFKFATSDDFGHEPLPPSLLGASRNMGGNEIYIS
FT                   PLEFSPVNGKLEPYHYQLAWLENPDQSIRGYLVTYNSMSKMLKTIKPAYSSSQSPLLML
FT                   DTQGLLYAGADSRPSLKRVPDTMGGSLKQSYPALWRKMAMSNFGQFHGDNATFVYLKVE
FT                   LTTQYETRREYFLVSYVRNADIAANFSQWRTILIGCALMLTLLASILIFLSHFYRLEQR
FT                   SRQFSIELSSRLFDREVGCIIVNHNNRVISANELAATQLSLPQDQLLDRNLQRILQLDN
FT                   DDYDYAGIITQIQQEQEWKGELDMGTETQTKLIAHIKTQASKDKQKGYLVITFEDVSQL
FT                   KQARQDAYLGTALNDNGVPTALIQTDGTIIRANPAFEQEMRLGTDCANIIDILPNELGN
FT                   NWPQISQLILLQGSWKGQVLCGASSTNTCLQATLKSHIDASGELDYVVCTFEKAISKNN
FT                   HDESGVLVPHRSTILVNYRDLESYFNSLEQSSKDRSSLLLLDITSESMLSHMSDVGLLE
FT                   SRQKEVEIFLLRELPSNYQMSHWQLGKIIFILPDTDADQAHHYAIKSLASLNDMGLGKG
FT                   ICMGIASFHPELNLEQYLSNAEVALQRAKQIGEHNICQAFTR"
FT   CDS_pept        859494..859664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00694"
FT                   /db_xref="GOA:D4ZG95"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG95"
FT                   /protein_id="BAJ00694.1"
FT                   /translation="MDRATVLFTLIPIGARAQVQLQPLVRQASYYLCVLNKNVTGVMII
FT                   PVTFYLWTVKS"
FT   CDS_pept        complement(859692..862856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SVI_0724"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SVI_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ00695"
FT                   /db_xref="GOA:D4ZG96"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D4ZG96"
FT                   /protein_id="BAJ00695.1"
FT                   /translation="MESQKGLIAWFARNSVAANLLMFVLIVGGLFSAVLINKEIFPSFE
FT                   LNYIQISVAYPGAAPQEIEEGINIKIEESLQDINGIKKVTSVASEGMGMVTIEVEDSHD
FT                   PQDILDEAKLRLDAISTFPENIEKPNIFRIKPENNVIWVSVYGDMNLHEMKELAKSIRE
FT                   DITSLPSVTRAKVTGVRDYEISIEVSENKLREYNLSFSQVAQAVQKSSIDLPGGSIRAQ
FT                   DGDILLRTKGQAYTGEDFAKIVISTRPDGSRIMLPQVATIKDDFEERLEYTRFNGKPAA
FT                   IIEVTSVDDQNALEISEQVKNYIEDRRLTLPAGAQLDTWGDLTYYLKGRLNMMLSNMIY
FT                   GALLVFIILAIFLDLKLAFWVMMGLPVCFLGAMLVMPIEPFSLSINMLTLFAFILVLGI
FT                   VVDDAIVIGESAYTEIEKHGHSLENVVRGANKVAMPATFGVLTTIAAFMPMLMVSGPQG
FT                   IIWKSIGMVVVLCLIFSLIESKLILPAHLAHMKPRKPKSQLGPLGRLKLKLNEKVQYFI
FT                   HHKYRHFLESCIKQRYNVVAIFIGVLILSIALVVSGKVRWVFFPDIPSDFIQVQLDMDQ
FT                   GSSETNTLKVVKQIEDALYAMNDQMETDYGYPVVKHSFIDMSSRTSAFVFAELTKGEDR
FT                   EADGVAIAAAWRAQLPELIAVKKISINASTNESGGDIAFRLTSSNLEQLSKASTELKQK
FT                   LKSYEGVYDIADTFSSGSHEIRLKIKPEAEAQGLTLSDLASQVRYAFYGYEAQRILRNK
FT                   EEVKVMVRYPLDERRTVGDLENMMIRTPKGISVPFSTVADIEMGDSYSSITRVDGRRAI
FT                   SITANADKNLVEPSKVVAEFQEDFLPYLEAKYPSISTALDGESADEQSTIVSLLQGFFF
FT                   ALFTIYALMAIPLKSYSQPLIIMSVIPFGMIGALFGHYMLGLSMSILSLCGIVALAGVV
FT                   VNDSLILVDFVNKARAQGQSITQAAIDSGCYRFRAIILTSMTTFVGLVPIIMEKSLQAK
FT                   IVIPMATSLAFGILFSTLVTLILVPLLYIILDDVRRTSRRFYNWWWQPKALSPIDHEVE
FT                   DMNRKL"
FT   CDS_